BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24916_g3_i1 len=4606 path=[1895:0-93 @1989@!:94-2639 4534:2640-3976
5869:3977-4029 18870:4030-4605]

Length=4606
                                                                      Score     E

ref|XP_006340095.1|  PREDICTED: putative disease resistance prote...    998   0.0      
ref|XP_011078960.1|  PREDICTED: putative disease resistance prote...    933   0.0      
gb|EYU20794.1|  hypothetical protein MIMGU_mgv1a022167mg                795   0.0      
ref|XP_009775465.1|  PREDICTED: putative disease resistance prote...    602   0.0      
ref|XP_006350193.1|  PREDICTED: putative disease resistance prote...    596   0.0      
ref|XP_009587018.1|  PREDICTED: putative disease resistance prote...    593   0.0      
ref|XP_002277498.1|  PREDICTED: putative disease resistance prote...    583   0.0      Vitis vinifera
ref|XP_006489981.1|  PREDICTED: putative disease resistance prote...    575   0.0      
ref|XP_006421373.1|  hypothetical protein CICLE_v10004284mg             573   6e-180   
gb|KDO42049.1|  hypothetical protein CISIN_1g041348mg                   570   4e-179   
ref|XP_006421375.1|  hypothetical protein CICLE_v10004287mg             567   5e-178   
ref|XP_007029648.1|  Leucine-rich repeat containing protein, puta...    566   1e-177   
ref|XP_002278041.1|  PREDICTED: putative disease resistance prote...    563   2e-176   Vitis vinifera
ref|XP_006421380.1|  hypothetical protein CICLE_v10006925mg             563   2e-176   
ref|XP_002529624.1|  leucine-rich repeat containing protein, puta...    558   2e-174   Ricinus communis
ref|XP_002277987.2|  PREDICTED: putative disease resistance prote...    558   4e-174   Vitis vinifera
gb|KDO39460.1|  hypothetical protein CISIN_1g038265mg                   557   5e-174   
ref|XP_007029651.1|  Leucine-rich repeat containing protein, puta...    554   7e-173   
ref|XP_002277526.2|  PREDICTED: putative disease resistance prote...    559   1e-171   Vitis vinifera
ref|XP_006490005.1|  PREDICTED: putative disease resistance prote...    546   3e-170   
ref|XP_007029652.1|  LRR and NB-ARC domains-containing disease re...    541   3e-168   
ref|XP_003634282.2|  PREDICTED: putative disease resistance prote...    528   2e-165   
ref|XP_009374159.1|  PREDICTED: disease resistance protein RGA2-like    530   2e-164   
ref|XP_006489979.1|  PREDICTED: putative disease resistance prote...    524   3e-163   
ref|XP_006372558.1|  hypothetical protein POPTR_0017s02790g             526   1e-162   
ref|XP_008392220.1|  PREDICTED: disease resistance protein RGA2-like    522   1e-161   
ref|XP_009374154.1|  PREDICTED: putative disease resistance prote...    521   3e-161   
ref|NP_001175444.1|  Os08g0224000                                       522   3e-161   
ref|XP_008366914.1|  PREDICTED: putative disease resistance prote...    520   4e-161   
ref|XP_007028725.1|  Leucine-rich repeat containing protein, puta...    522   6e-161   
ref|XP_007203026.1|  hypothetical protein PRUPE_ppa018734mg             520   1e-160   
ref|XP_007045385.1|  LRR and NB-ARC domains-containing disease re...    527   2e-159   
ref|XP_009374150.1|  PREDICTED: disease resistance protein RGA2-like    518   2e-159   
gb|KDP26031.1|  hypothetical protein JCGZ_21064                         514   5e-159   
gb|EEE68252.1|  hypothetical protein OsJ_26458                          524   1e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008351596.1|  PREDICTED: disease resistance protein RGA2-like    514   1e-158   
emb|CAN78634.1|  hypothetical protein VITISV_013449                     513   2e-158   Vitis vinifera
gb|KDP26047.1|  hypothetical protein JCGZ_21080                         513   7e-158   
ref|XP_008392255.1|  PREDICTED: disease resistance protein RGA2-like    511   1e-157   
ref|XP_007029659.1|  LRR and NB-ARC domains-containing disease re...    513   2e-157   
ref|XP_010024100.1|  PREDICTED: putative disease resistance prote...    510   8e-157   
ref|XP_007204655.1|  hypothetical protein PRUPE_ppa001501mg             509   8e-157   
ref|XP_008240895.1|  PREDICTED: disease resistance protein RGA2-like    509   9e-157   
ref|XP_009334959.1|  PREDICTED: putative disease resistance prote...    508   2e-156   
ref|XP_011001558.1|  PREDICTED: putative disease resistance prote...    509   3e-156   
ref|XP_009376889.1|  PREDICTED: putative disease resistance prote...    507   5e-156   
gb|KCW90192.1|  hypothetical protein EUGRSUZ_A02365                     507   9e-156   
ref|XP_010904851.1|  PREDICTED: putative disease resistance prote...    507   1e-155   
ref|XP_007029656.1|  LRR and NB-ARC domains-containing disease re...    506   9e-155   
gb|KHG07629.1|  Putative disease resistance RGA1                        504   2e-154   
ref|XP_008392218.1|  PREDICTED: putative disease resistance prote...    503   2e-154   
gb|KDO49259.1|  hypothetical protein CISIN_1g001955mg                   506   1e-153   
ref|XP_006451769.1|  hypothetical protein CICLE_v10007328mg             506   3e-153   
ref|XP_007030144.1|  Leucine-rich repeat containing protein isofo...    498   2e-152   
ref|XP_008240993.1|  PREDICTED: disease resistance protein RGA2-like    496   3e-152   
ref|XP_002438921.1|  hypothetical protein SORBIDRAFT_10g028270          497   4e-152   Sorghum bicolor [broomcorn]
gb|KHN32564.1|  Putative disease resistance protein RGA3                497   1e-151   
ref|XP_010024422.1|  PREDICTED: putative disease resistance prote...    496   1e-151   
ref|XP_003624016.1|  Disease resistance protein RGA2                    496   1e-151   
gb|KCW75031.1|  hypothetical protein EUGRSUZ_E03806                     496   2e-151   
ref|XP_006604334.1|  PREDICTED: putative disease resistance prote...    495   5e-151   
ref|XP_009355523.1|  PREDICTED: disease resistance protein RGA2-like    496   6e-151   
ref|XP_003553413.1|  PREDICTED: putative disease resistance prote...    494   1e-150   
ref|XP_003526943.1|  PREDICTED: putative disease resistance prote...    494   1e-150   
ref|XP_007202992.1|  hypothetical protein PRUPE_ppa019012mg             492   2e-150   
ref|XP_010024090.1|  PREDICTED: putative disease resistance prote...    493   3e-150   
ref|NP_001235657.1|  disease resistance protein                         493   4e-150   
gb|KEH42967.1|  disease resistance protein (CC-NBS-LRR class) fam...    492   5e-150   
emb|CBI15532.3|  unnamed protein product                                487   6e-150   
ref|XP_007162222.1|  hypothetical protein PHAVU_001G134300g             491   1e-149   
ref|XP_008240990.1|  PREDICTED: putative disease resistance prote...    490   1e-149   
ref|XP_010646022.1|  PREDICTED: putative disease resistance prote...    485   1e-149   
gb|KCW48021.1|  hypothetical protein EUGRSUZ_K01754                     488   2e-149   
gb|KDO37336.1|  hypothetical protein CISIN_1g036466mg                   486   2e-149   
gb|EMT14627.1|  hypothetical protein F775_52103                         495   2e-149   
ref|XP_006421378.1|  hypothetical protein CICLE_v10006443mg             481   3e-149   
ref|XP_008241001.1|  PREDICTED: putative disease resistance prote...    489   4e-149   
ref|XP_008240304.1|  PREDICTED: putative disease resistance prote...    490   4e-149   
ref|XP_006604363.1|  PREDICTED: putative disease resistance prote...    489   6e-149   
ref|XP_010694190.1|  PREDICTED: putative disease resistance prote...    489   6e-149   
ref|XP_010904853.1|  PREDICTED: putative disease resistance prote...    487   1e-148   
gb|KHN14950.1|  Putative disease resistance protein RGA1                489   1e-148   
ref|XP_007162218.1|  hypothetical protein PHAVU_001G134000g             488   2e-148   
ref|XP_007029660.1|  LRR and NB-ARC domains-containing disease re...    487   5e-148   
ref|XP_004513775.1|  PREDICTED: putative disease resistance prote...    486   6e-148   
ref|NP_001238129.1|  NBS-LRR disease resistance protein                 488   1e-147   
ref|XP_003553414.1|  PREDICTED: disease resistance protein RGA2-like    485   3e-147   
ref|XP_006576493.1|  PREDICTED: disease resistance protein RGA2-like    484   3e-147   
ref|XP_008241007.1|  PREDICTED: putative disease resistance prote...    483   5e-147   
ref|XP_004513778.1|  PREDICTED: putative disease resistance prote...    484   5e-147   
ref|XP_008361183.1|  PREDICTED: putative disease resistance prote...    484   5e-147   
ref|XP_006372437.1|  hypothetical protein POPTR_0017s01630g             483   6e-147   
ref|XP_006604350.1|  PREDICTED: disease resistance protein RGA2-l...    484   7e-147   
ref|XP_006439154.1|  hypothetical protein CICLE_v10010866mg             476   1e-146   
ref|XP_007162196.1|  hypothetical protein PHAVU_001G132300g             483   1e-146   
ref|XP_007029663.1|  LRR and NB-ARC domains-containing disease re...    484   2e-146   
gb|KEH32274.1|  LRR and NB-ARC domain disease resistance protein        482   2e-146   
ref|XP_007162224.1|  hypothetical protein PHAVU_001G134400g             482   3e-146   
gb|KCW48129.1|  hypothetical protein EUGRSUZ_K01864                     481   4e-146   
gb|KHN07374.1|  Putative disease resistance protein RGA1                481   5e-146   
ref|XP_006604341.1|  PREDICTED: disease resistance protein RGA2-like    481   9e-146   
ref|XP_008241003.1|  PREDICTED: putative disease resistance prote...    479   9e-146   
ref|XP_007211031.1|  hypothetical protein PRUPE_ppa019872mg             478   4e-145   
ref|XP_008392254.1|  PREDICTED: putative disease resistance prote...    476   6e-145   
gb|KHN11536.1|  Putative disease resistance protein RGA4                476   7e-145   
ref|XP_010646027.1|  PREDICTED: putative disease resistance prote...    469   2e-144   
gb|KHN14961.1|  Putative disease resistance protein RGA1                477   2e-144   
ref|XP_008238997.1|  PREDICTED: putative disease resistance prote...    477   2e-144   
ref|XP_006604349.1|  PREDICTED: disease resistance protein RGA2-l...    477   2e-144   
ref|XP_011016471.1|  PREDICTED: putative disease resistance prote...    486   3e-144   
ref|NP_001066756.1|  Os12g0477100                                       474   3e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007029665.1|  Leucine-rich repeat containing protein, puta...    477   4e-144   
ref|XP_006372434.1|  hypothetical protein POPTR_0017s01600g             475   5e-144   
ref|XP_007048517.1|  Leucine-rich repeat containing protein, puta...    475   5e-144   
ref|XP_006576824.1|  PREDICTED: putative disease resistance prote...    476   7e-144   
gb|EEC81232.1|  hypothetical protein OsI_24282                          474   7e-144   Oryza sativa Indica Group [Indian rice]
gb|EAY83085.1|  hypothetical protein OsI_38304                          473   8e-144   Oryza sativa Indica Group [Indian rice]
ref|XP_011015122.1|  PREDICTED: putative disease resistance prote...    485   1e-143   
gb|KHG18590.1|  Putative disease resistance RGA1                        474   2e-143   
ref|XP_008241006.1|  PREDICTED: putative disease resistance prote...    482   2e-143   
gb|KDP26027.1|  hypothetical protein JCGZ_21060                         466   4e-143   
ref|XP_006371428.1|  hypothetical protein POPTR_0019s10290g             482   8e-143   
ref|XP_010279527.1|  PREDICTED: putative disease resistance prote...    481   1e-142   
ref|XP_007162225.1|  hypothetical protein PHAVU_001G134500g             472   1e-142   
ref|XP_011038388.1|  PREDICTED: putative disease resistance prote...    471   2e-142   
gb|KDP43576.1|  hypothetical protein JCGZ_16863                         478   2e-142   
gb|KCW48020.1|  hypothetical protein EUGRSUZ_K01752                     470   5e-142   
ref|XP_009339955.1|  PREDICTED: putative disease resistance prote...    476   5e-142   
gb|ADB85254.1|  putative disease resistance protein                     470   5e-142   Phyllostachys edulis [kikko-chiku]
ref|XP_010094550.1|  Disease resistance protein RGA2                    473   7e-142   
ref|XP_009334476.1|  PREDICTED: putative disease resistance prote...    469   7e-142   
gb|ABA98222.1|  NB-ARC domain containing protein, expressed             468   8e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003553415.1|  PREDICTED: disease resistance protein RGA2-like    469   8e-142   
ref|XP_006388824.1|  NBS-LRR resistance gene-like protein ARGH30        469   8e-142   
ref|XP_006421379.1|  hypothetical protein CICLE_v10006930mg             469   9e-142   
ref|XP_011038383.1|  PREDICTED: putative disease resistance prote...    470   1e-141   
gb|KHN14949.1|  Putative disease resistance protein RGA4                470   1e-141   
ref|XP_006661639.1|  PREDICTED: putative disease resistance prote...    468   1e-141   
ref|XP_011038387.1|  PREDICTED: putative disease resistance prote...    469   1e-141   
gb|KDO38042.1|  hypothetical protein CISIN_1g042863mg                   463   1e-141   
ref|XP_011038386.1|  PREDICTED: putative disease resistance prote...    469   1e-141   
ref|XP_011038379.1|  PREDICTED: putative disease resistance prote...    469   2e-141   
gb|KCW75022.1|  hypothetical protein EUGRSUZ_E03801                     467   3e-141   
ref|XP_007210348.1|  hypothetical protein PRUPE_ppa001712mg             465   5e-141   
gb|AGT75398.1|  CC-NBS-LRR disease resistance protein                   468   9e-141   
ref|XP_003616167.1|  Disease resistance protein RGA2                    466   3e-140   
ref|XP_004306372.1|  PREDICTED: disease resistance protein RGA2-like    468   3e-140   
gb|KEH23636.1|  NBS-LRR disease resistance protein                      478   4e-140   
ref|XP_011038385.1|  PREDICTED: putative disease resistance prote...    466   4e-140   
ref|XP_011001928.1|  PREDICTED: disease resistance protein RGA2-like    464   4e-140   
gb|KHN07375.1|  Putative disease resistance protein RGA1                465   6e-140   
ref|XP_007030149.1|  Leucine-rich repeat containing protein             463   9e-140   
gb|KCW90386.1|  hypothetical protein EUGRSUZ_A02528                     463   1e-139   
ref|XP_010058597.1|  PREDICTED: putative disease resistance prote...    462   2e-139   
ref|XP_004301268.1|  PREDICTED: disease resistance protein RGA2-like    464   2e-139   
ref|XP_002318368.1|  NBS-LRR resistance gene-like protein ARGH30        462   3e-139   Populus trichocarpa [western balsam poplar]
ref|XP_007162212.1|  hypothetical protein PHAVU_001G133400g             463   3e-139   
ref|XP_009369141.1|  PREDICTED: putative disease resistance prote...    472   5e-139   
gb|KCW90193.1|  hypothetical protein EUGRSUZ_A02366                     460   6e-139   
gb|KCW90387.1|  hypothetical protein EUGRSUZ_A02530                     459   1e-138   
gb|KCW90191.1|  hypothetical protein EUGRSUZ_A02363                     459   1e-138   
ref|XP_010097657.1|  Putative disease resistance protein RGA4           468   1e-138   
ref|XP_010694939.1|  PREDICTED: putative disease resistance prote...    458   2e-138   
ref|XP_010694946.1|  PREDICTED: putative disease resistance prote...    457   2e-138   
gb|KCW90390.1|  hypothetical protein EUGRSUZ_A02533                     459   2e-138   
ref|XP_010269783.1|  PREDICTED: disease resistance protein RGA2-like    463   4e-138   
ref|XP_003625117.1|  hypothetical protein MTR_7g091140                  464   5e-138   
ref|XP_011038382.1|  PREDICTED: putative disease resistance prote...    460   5e-138   
ref|XP_002519373.1|  leucine-rich repeat containing protein, puta...    469   6e-138   Ricinus communis
ref|XP_010269784.1|  PREDICTED: disease resistance protein RGA2-like    466   1e-137   
ref|XP_007162214.1|  hypothetical protein PHAVU_001G133600g             457   2e-137   
ref|XP_010024364.1|  PREDICTED: disease resistance protein RGA2-like    457   2e-137   
gb|KEH32275.1|  LRR and NB-ARC domain disease resistance protein        455   4e-137   
ref|XP_007162223.1|  hypothetical protein PHAVU_001G134400g             452   5e-137   
ref|XP_006490004.1|  PREDICTED: putative disease resistance prote...    450   5e-137   
ref|XP_010024476.1|  PREDICTED: putative disease resistance prote...    456   6e-137   
ref|XP_006371429.1|  hypothetical protein POPTR_0019s10300g             464   1e-136   
ref|XP_004292330.1|  PREDICTED: disease resistance protein RGA2-like    456   1e-136   
emb|CBI23411.3|  unnamed protein product                                453   2e-136   
ref|NP_001064207.1|  Os10g0161400                                       452   7e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010908948.1|  PREDICTED: putative disease resistance prote...    461   7e-136   
ref|XP_010646017.1|  PREDICTED: putative disease resistance prote...    447   1e-135   
gb|KCW90383.1|  hypothetical protein EUGRSUZ_A02522                     451   2e-135   
ref|XP_010654316.1|  PREDICTED: putative disease resistance prote...    450   3e-135   
ref|XP_004493472.1|  PREDICTED: putative disease resistance prote...    451   4e-135   
ref|XP_010058559.1|  PREDICTED: disease resistance protein RGA2-like    450   7e-135   
ref|XP_010097660.1|  Putative disease resistance protein RGA4           457   7e-135   
ref|XP_010918019.1|  PREDICTED: putative disease resistance prote...    458   1e-134   
gb|AES81335.2|  LRR and NB-ARC domain disease resistance protein        464   1e-134   
ref|XP_009775464.1|  PREDICTED: putative disease resistance prote...    449   1e-134   
ref|XP_010057749.1|  PREDICTED: putative disease resistance prote...    446   2e-134   
ref|XP_007162205.1|  hypothetical protein PHAVU_001G133000g             450   3e-134   
gb|KDP26028.1|  hypothetical protein JCGZ_21061                         439   3e-134   
ref|XP_003624045.1|  Disease resistance protein RGA2                    447   4e-134   
ref|XP_007145621.1|  hypothetical protein PHAVU_007G254300g             448   4e-134   
ref|XP_002525457.1|  leucine-rich repeat containing protein, puta...    457   8e-134   Ricinus communis
gb|KEH41282.1|  NBS-LRR type disease resistance protein                 447   1e-133   
ref|XP_007162219.1|  hypothetical protein PHAVU_001G134100g             446   2e-133   
gb|KHG06754.1|  Disease resistance RGA2                                 444   3e-133   
ref|XP_011011367.1|  PREDICTED: disease resistance protein RGA2-l...    446   4e-133   
ref|XP_008350652.1|  PREDICTED: disease resistance protein RGA2-like    451   4e-133   
ref|XP_004298083.1|  PREDICTED: putative disease resistance prote...    450   5e-133   
gb|KHN43715.1|  Putative disease resistance protein RGA3                445   5e-133   
ref|XP_010024462.1|  PREDICTED: putative disease resistance prote...    444   5e-133   
ref|XP_011011365.1|  PREDICTED: disease resistance protein RGA2-l...    446   6e-133   
ref|XP_011011369.1|  PREDICTED: disease resistance protein RGA2-l...    445   9e-133   
ref|XP_006575252.1|  PREDICTED: putative disease resistance prote...    445   9e-133   
gb|KCW48143.1|  hypothetical protein EUGRSUZ_K01875                     444   1e-132   
ref|XP_007162202.1|  hypothetical protein PHAVU_001G132700g             444   2e-132   
ref|XP_010659380.1|  PREDICTED: disease resistance protein RGA2-l...    448   2e-132   
ref|XP_007204163.1|  hypothetical protein PRUPE_ppa017615mg             441   2e-132   
ref|XP_010918020.1|  PREDICTED: putative disease resistance prote...    451   3e-132   
gb|KCW48061.1|  hypothetical protein EUGRSUZ_K01810                     442   3e-132   
ref|XP_010679788.1|  PREDICTED: putative disease resistance prote...    443   4e-132   
ref|XP_008240999.1|  PREDICTED: putative disease resistance prote...    439   5e-132   
gb|KEH31343.1|  NBS-LRR type disease resistance protein                 442   1e-131   
ref|XP_008354961.1|  PREDICTED: putative disease resistance prote...    449   2e-131   
ref|XP_011011371.1|  PREDICTED: putative disease resistance prote...    441   2e-131   
ref|XP_011011370.1|  PREDICTED: putative disease resistance prote...    441   2e-131   
ref|XP_011011368.1|  PREDICTED: putative disease resistance prote...    441   2e-131   
ref|XP_011011364.1|  PREDICTED: putative disease resistance prote...    441   2e-131   
ref|XP_011011366.1|  PREDICTED: putative disease resistance prote...    441   2e-131   
ref|XP_010917835.1|  PREDICTED: putative disease resistance prote...    446   6e-131   
ref|XP_008810760.1|  PREDICTED: putative disease resistance prote...    446   6e-131   
ref|XP_002265970.1|  PREDICTED: putative disease resistance prote...    449   7e-131   Vitis vinifera
emb|CDP07780.1|  unnamed protein product                                442   7e-131   
ref|XP_006603615.1|  PREDICTED: NBS-LRR disease resistance protei...    436   8e-131   
ref|XP_009587022.1|  PREDICTED: disease resistance protein RGA2-like    440   8e-131   
gb|KDP26034.1|  hypothetical protein JCGZ_21067                         431   8e-131   
emb|CAN67734.1|  hypothetical protein VITISV_017638                     449   1e-130   Vitis vinifera
ref|XP_006421374.1|  hypothetical protein CICLE_v10006631mg             428   1e-130   
gb|AAO37645.1|  NBS-LRR resistance protein RGH1                         443   3e-130   Manihot esculenta [manioc]
ref|XP_010938821.1|  PREDICTED: disease resistance protein RGA2-like    448   3e-130   
ref|XP_010938816.1|  PREDICTED: putative disease resistance prote...    447   4e-130   
ref|XP_003625120.1|  NBS-LRR disease resistance protein                 436   1e-129   
ref|XP_007145620.1|  hypothetical protein PHAVU_007G254200g             435   3e-129   
ref|XP_010938912.1|  PREDICTED: putative disease resistance prote...    439   3e-129   
ref|XP_008779138.1|  PREDICTED: putative disease resistance prote...    429   6e-129   
ref|XP_010058642.1|  PREDICTED: putative disease resistance prote...    432   7e-129   
ref|XP_007052428.1|  LRR and NB-ARC domains-containing disease re...    441   1e-128   
ref|XP_010677314.1|  PREDICTED: uncharacterized protein LOC104892985    456   1e-128   
gb|KCW64144.1|  hypothetical protein EUGRSUZ_G01790                     437   1e-128   
ref|XP_007018346.1|  Nbs-lrr resistance protein, putative               442   2e-128   
ref|XP_008775988.1|  PREDICTED: putative disease resistance prote...    440   2e-128   
ref|XP_004511173.1|  PREDICTED: putative disease resistance prote...    432   2e-128   
ref|XP_011011373.1|  PREDICTED: putative disease resistance prote...    431   4e-128   
gb|KDO39284.1|  hypothetical protein CISIN_1g048833mg                   424   5e-128   
ref|XP_007145625.1|  hypothetical protein PHAVU_007G254700g             431   8e-128   
ref|XP_009354780.1|  PREDICTED: disease resistance protein RGA2-like    436   9e-128   
ref|XP_010066297.1|  PREDICTED: putative disease resistance prote...    437   1e-127   
ref|XP_010649305.1|  PREDICTED: putative disease resistance prote...    422   1e-127   
ref|XP_007145627.1|  hypothetical protein PHAVU_007G254900g             430   2e-127   
ref|XP_010102916.1|  Putative disease resistance protein RGA4           438   2e-127   
ref|XP_008810762.1|  PREDICTED: putative disease resistance prote...    429   2e-127   
ref|XP_009775466.1|  PREDICTED: putative disease resistance prote...    423   3e-127   
ref|XP_007052427.1|  LRR and NB-ARC domains-containing disease re...    440   5e-127   
ref|XP_010058624.1|  PREDICTED: disease resistance protein RGA2-like    423   9e-127   
ref|XP_008231268.1|  PREDICTED: putative disease resistance prote...    421   1e-126   
ref|XP_004493473.1|  PREDICTED: putative disease resistance prote...    427   2e-126   
ref|XP_010938817.1|  PREDICTED: putative disease resistance prote...    438   2e-126   
gb|KDP43109.1|  hypothetical protein JCGZ_27058                         422   2e-126   
ref|XP_008350664.1|  PREDICTED: putative disease resistance prote...    433   2e-126   
ref|XP_010681386.1|  PREDICTED: putative disease resistance prote...    429   3e-126   
ref|XP_006345413.1|  PREDICTED: putative disease resistance prote...    435   4e-126   
ref|XP_010659351.1|  PREDICTED: putative disease resistance prote...    430   7e-126   
gb|AHB64358.1|  NBS-LRR protein                                         424   8e-126   
ref|XP_007018351.1|  Nbs-lrr resistance protein, putative               433   2e-125   
ref|XP_006372436.1|  hypothetical protein POPTR_0017s01620g             423   2e-125   
ref|XP_007021012.1|  Leucine-rich repeat containing protein             431   2e-125   
ref|XP_009626715.1|  PREDICTED: uncharacterized protein LOC104117...    405   2e-125   
ref|XP_008245602.1|  PREDICTED: putative disease resistance prote...    429   3e-125   
ref|XP_010275411.1|  PREDICTED: putative disease resistance prote...    429   4e-125   
ref|XP_010045866.1|  PREDICTED: putative disease resistance prote...    430   6e-125   
ref|XP_009598856.1|  PREDICTED: putative disease resistance prote...    429   1e-124   
ref|XP_010024412.1|  PREDICTED: disease resistance protein RGA2-like    422   1e-124   
gb|KCW48145.1|  hypothetical protein EUGRSUZ_K01877                     421   1e-124   
ref|XP_006372431.1|  hypothetical protein POPTR_0017s01570g             421   2e-124   
gb|AAO37646.1|  NBS-LRR resistance protein RGH2                         427   2e-124   Manihot esculenta [manioc]
emb|CAJ44364.1|  putative CC-NBS-LRR resistance protein                 416   2e-124   Malus domestica [apple tree]
ref|XP_010315162.1|  PREDICTED: putative disease resistance prote...    419   3e-124   
ref|XP_010312107.1|  PREDICTED: uncharacterized protein LOC101268...    402   4e-124   
ref|XP_006351277.1|  PREDICTED: uncharacterized protein LOC102601...    402   4e-124   
emb|CBI23413.3|  unnamed protein product                                417   6e-124   
ref|XP_009776031.1|  PREDICTED: uncharacterized protein LOC104225...    401   8e-124   
ref|XP_004493471.1|  PREDICTED: putative disease resistance prote...    417   8e-124   
gb|KDP41536.1|  hypothetical protein JCGZ_15943                         428   1e-123   
ref|XP_010104551.1|  Putative disease resistance protein RGA3           428   1e-123   
ref|XP_006605210.1|  PREDICTED: putative disease resistance prote...    412   1e-123   
ref|XP_010942285.1|  PREDICTED: putative disease resistance prote...    425   2e-123   
gb|AGT75397.1|  CC-NBS-LRR disease resistance protein                   417   2e-123   
ref|XP_006350264.1|  PREDICTED: putative disease resistance prote...    420   2e-123   
ref|XP_009606669.1|  PREDICTED: uncharacterized protein LOC104100...    400   2e-123   
gb|KEH19261.1|  LRR and NB-ARC domain disease resistance protein        419   3e-123   
ref|XP_003625114.1|  NBS-LRR disease resistance protein                 421   3e-123   
ref|XP_010659407.1|  PREDICTED: putative disease resistance prote...    426   3e-123   
ref|XP_010942284.1|  PREDICTED: putative disease resistance prote...    424   3e-123   
ref|XP_006657032.1|  PREDICTED: putative disease resistance prote...    412   5e-123   
ref|XP_009801207.1|  PREDICTED: putative disease resistance prote...    424   7e-123   
ref|XP_009776027.1|  PREDICTED: uncharacterized protein LOC104225...    398   8e-123   
ref|XP_002527842.1|  leucine-rich repeat containing protein, puta...    414   1e-122   
gb|KHG28874.1|  Putative disease resistance RGA3                        426   1e-122   
ref|XP_010312106.1|  PREDICTED: uncharacterized protein LOC101268...    397   2e-122   
ref|XP_008341433.1|  PREDICTED: putative disease resistance prote...    411   2e-122   
ref|XP_008350673.1|  PREDICTED: putative disease resistance prote...    406   2e-122   
ref|XP_004504716.1|  PREDICTED: putative disease resistance prote...    416   2e-122   
ref|XP_008363331.1|  PREDICTED: putative disease resistance prote...    420   2e-122   
ref|XP_009606666.1|  PREDICTED: uncharacterized protein LOC104100...    397   3e-122   
gb|AAP45185.2|  Disease resistance protein RGA2, putative               418   3e-122   
gb|AGT75396.1|  CC-NBS-LRR disease resistance protein                   416   3e-122   
ref|XP_010038881.1|  PREDICTED: disease resistance protein RGA2-like    408   4e-122   
ref|XP_004489884.1|  PREDICTED: putative disease resistance prote...    420   4e-122   
gb|AHB79189.1|  CC-NBS-LRR disease resistance protein                   419   9e-122   
ref|XP_009598883.1|  PREDICTED: putative disease resistance prote...    419   9e-122   
ref|XP_008778655.1|  PREDICTED: disease resistance protein RGA2-like    410   1e-121   
ref|XP_006372432.1|  hypothetical protein POPTR_0017s01580g             414   1e-121   
ref|XP_008777006.1|  PREDICTED: putative disease resistance prote...    421   2e-121   
ref|XP_009598875.1|  PREDICTED: putative disease resistance prote...    420   2e-121   
ref|XP_010681455.1|  PREDICTED: putative disease resistance prote...    414   2e-121   
ref|XP_003625121.1|  Disease resistance protein                         416   2e-121   
gb|KCW48147.1|  hypothetical protein EUGRSUZ_K01879                     412   3e-121   
ref|XP_008384979.1|  PREDICTED: disease resistance protein RGA2-like    420   4e-121   
ref|XP_009776032.1|  PREDICTED: uncharacterized protein LOC104225...    393   4e-121   
ref|XP_011078962.1|  PREDICTED: uncharacterized protein LOC105162592    393   6e-121   
ref|XP_010038912.1|  PREDICTED: disease resistance protein RGA2-like    412   7e-121   
ref|XP_008231364.1|  PREDICTED: putative disease resistance prote...    418   7e-121   
ref|XP_002271242.2|  PREDICTED: putative disease resistance prote...    422   1e-120   
ref|XP_010917819.1|  PREDICTED: putative disease resistance prote...    413   1e-120   
ref|XP_010046575.1|  PREDICTED: putative disease resistance prote...    417   2e-120   
ref|XP_009606670.1|  PREDICTED: uncharacterized protein LOC104100...    391   2e-120   
ref|XP_011011374.1|  PREDICTED: disease resistance protein RGA2-l...    406   2e-120   
ref|XP_011011375.1|  PREDICTED: disease resistance protein RGA2-l...    405   3e-120   
gb|EAY97677.1|  hypothetical protein OsI_19599                          408   3e-120   
ref|XP_010278462.1|  PREDICTED: putative disease resistance prote...    411   4e-120   
ref|XP_006354430.1|  PREDICTED: putative disease resistance prote...    416   5e-120   
gb|KDP43489.1|  hypothetical protein JCGZ_16776                         415   6e-120   
ref|XP_009354774.1|  PREDICTED: disease resistance protein RGA2-like    412   6e-120   
gb|KCW84397.1|  hypothetical protein EUGRSUZ_B01252                     414   6e-120   
gb|KCW73434.1|  hypothetical protein EUGRSUZ_E01910                     408   7e-120   
ref|XP_010917698.1|  PREDICTED: disease resistance protein RGA2-like    413   7e-120   
ref|XP_008389186.1|  PREDICTED: disease resistance protein RGA2-l...    416   8e-120   
ref|XP_008389184.1|  PREDICTED: disease resistance protein RGA2-l...    416   9e-120   
emb|CAJ44363.1|  putative CC-NBS-LRR resistance protein                 410   1e-119   
gb|ACI16480.1|  NBS-LRR resistance protein                              412   2e-119   
ref|NP_001237395.1|  NBS-LRR disease resistance protein                 403   2e-119   
gb|KDP33008.1|  hypothetical protein JCGZ_13039                         402   2e-119   
ref|XP_010937795.1|  PREDICTED: putative disease resistance prote...    419   2e-119   
ref|XP_007162203.1|  hypothetical protein PHAVU_001G132800g             404   2e-119   
ref|XP_011038392.1|  PREDICTED: putative disease resistance prote...    401   4e-119   
gb|AAR29071.1|  blight resistance protein RGA3                          410   4e-119   
ref|XP_011038395.1|  PREDICTED: putative disease resistance prote...    401   4e-119   
gb|ABO28722.1|  RB                                                      410   5e-119   
ref|XP_010659415.1|  PREDICTED: putative disease resistance prote...    414   5e-119   
gb|ABO28718.1|  RB                                                      409   6e-119   
ref|XP_007029657.1|  LRR and NB-ARC domains-containing disease re...    404   7e-119   
emb|CAN82122.1|  hypothetical protein VITISV_009093                     422   1e-118   
sp|Q7XA42.2|RGA1_SOLBU  RecName: Full=Putative disease resistance...    409   1e-118   
ref|XP_009368142.1|  PREDICTED: disease resistance protein RGA2-like    410   1e-118   
ref|XP_010921564.1|  PREDICTED: putative disease resistance prote...    416   1e-118   
emb|CDP19197.1|  unnamed protein product                                409   2e-118   
gb|AGT75402.1|  CC-NBS-LRR disease resistance protein                   397   3e-118   
ref|XP_010917718.1|  PREDICTED: putative disease resistance prote...    411   3e-118   
gb|KDP42480.1|  hypothetical protein JCGZ_00277                         409   4e-118   
ref|XP_003598563.1|  NBS-containing resistance-like protein             404   6e-118   
ref|XP_008350990.1|  PREDICTED: disease resistance protein RGA2-like    398   7e-118   
ref|XP_002324918.2|  NBS-LRR resistance gene-like protein ARGH30        402   9e-118   
emb|CDP09525.1|  unnamed protein product                                385   9e-118   
ref|XP_010906752.1|  PREDICTED: putative disease resistance prote...    414   1e-117   
ref|XP_006352944.1|  PREDICTED: putative disease resistance prote...    406   2e-117   
ref|XP_008776817.1|  PREDICTED: putative disease resistance prote...    416   3e-117   
ref|XP_009374152.1|  PREDICTED: disease resistance protein RGA2-like    394   3e-117   
emb|CDP19198.1|  unnamed protein product                                396   3e-117   
ref|XP_006372435.1|  hypothetical protein POPTR_0017s01610g             397   5e-117   
ref|XP_006423099.1|  hypothetical protein CICLE_v10027705mg             409   5e-117   
ref|XP_009354793.1|  PREDICTED: disease resistance protein RGA2-like    404   6e-117   
ref|XP_002532127.1|  leucine-rich repeat containing protein, puta...    408   7e-117   
sp|Q7XA40.2|RGA3_SOLBU  RecName: Full=Putative disease resistance...    404   7e-117   
ref|XP_010937794.1|  PREDICTED: disease resistance protein RGA2-like    407   9e-117   
ref|XP_009354779.1|  PREDICTED: disease resistance protein RGA2-like    405   2e-116   
gb|KEH23617.1|  NBS-LRR disease resistance protein                      402   2e-116   
gb|AAR29073.1|  blight resistance protein B149                          402   2e-116   
ref|XP_009354721.1|  PREDICTED: putative disease resistance prote...    404   3e-116   
ref|XP_006573177.1|  PREDICTED: putative disease resistance prote...    399   4e-116   
gb|AAP45174.1|  Putative disease resistance protein RGA4, identical     402   5e-116   
ref|XP_008368959.1|  PREDICTED: disease resistance protein RGA2-like    405   5e-116   
gb|ADB43255.1|  blight resistance protein                               402   7e-116   
ref|XP_007020994.1|  Leucine-rich repeat containing protein             407   7e-116   
ref|XP_009768337.1|  PREDICTED: putative disease resistance prote...    403   1e-115   
ref|XP_008341719.1|  PREDICTED: putative disease resistance prote...    400   1e-115   
ref|XP_009368061.1|  PREDICTED: disease resistance protein RGA2-like    404   1e-115   
ref|XP_010095705.1|  hypothetical protein L484_001124                   379   1e-115   
ref|XP_007162206.1|  hypothetical protein PHAVU_001G1331001g            387   1e-115   
ref|XP_009594900.1|  PREDICTED: uncharacterized protein LOC104091...    378   2e-115   
ref|XP_006479399.1|  PREDICTED: putative disease resistance prote...    404   2e-115   
ref|XP_007033143.1|  Cc-nbs-lrr resistance protein, putative            405   2e-115   
sp|Q7XA39.1|RGA4_SOLBU  RecName: Full=Putative disease resistance...    400   3e-115   
ref|XP_006343286.1|  PREDICTED: putative disease resistance prote...    404   3e-115   
ref|XP_010045867.1|  PREDICTED: putative disease resistance prote...    402   3e-115   
ref|XP_009801804.1|  PREDICTED: uncharacterized protein LOC104247...    377   3e-115   
ref|XP_010645146.1|  PREDICTED: putative disease resistance prote...    405   4e-115   
gb|AAR29076.1|  blight resistance protein T118                          398   5e-115   
ref|XP_003604945.1|  NBS resistance protein                             400   6e-115   
ref|XP_010644943.1|  PREDICTED: putative disease resistance prote...    403   9e-115   
ref|XP_010644951.1|  PREDICTED: putative disease resistance prote...    402   1e-114   
ref|XP_010644950.1|  PREDICTED: putative disease resistance prote...    402   1e-114   
ref|XP_008461435.1|  PREDICTED: putative disease resistance prote...    397   1e-114   
gb|KDP37636.1|  hypothetical protein JCGZ_07835                         400   2e-114   
ref|XP_008240804.1|  PREDICTED: uncharacterized protein LOC103339314    375   2e-114   
ref|XP_010645145.1|  PREDICTED: putative disease resistance prote...    405   2e-114   
ref|XP_009626716.1|  PREDICTED: uncharacterized protein LOC104117...    374   2e-114   
ref|XP_006603646.1|  PREDICTED: NBS-LRR disease resistance protei...    389   2e-114   
ref|XP_004289255.1|  PREDICTED: putative disease resistance prote...    392   3e-114   
ref|XP_002526758.1|  Disease resistance protein RGA2, putative          400   3e-114   
ref|XP_010918012.1|  PREDICTED: disease resistance protein RGA2-like    400   4e-114   
ref|XP_010644910.1|  PREDICTED: putative disease resistance prote...    403   5e-114   
gb|AAR29074.1|  blight resistance protein SH10                          395   7e-114   
gb|ACI25289.1|  late blight resistance protein Rpi-pta1                 395   7e-114   
ref|XP_006492507.1|  PREDICTED: uncharacterized protein LOC102607...    374   7e-114   
gb|AAP45164.2|  Disease resistance protein RGA2, putative               394   7e-114   
gb|ACI25288.1|  late blight resistance protein Rpi-sto1                 395   8e-114   
gb|KCW84381.1|  hypothetical protein EUGRSUZ_B01230                     397   1e-113   
ref|XP_006351278.1|  PREDICTED: uncharacterized protein LOC102601...    372   1e-113   
ref|XP_006352943.1|  PREDICTED: disease resistance protein RGA2-like    395   1e-113   
gb|AES68809.2|  NBS-LRR type disease resistance protein                 392   2e-113   
sp|Q7XBQ9.1|RGA2_SOLBU  RecName: Full=Disease resistance protein ...    394   2e-113   
ref|XP_010905013.1|  PREDICTED: putative disease resistance prote...    400   2e-113   
emb|CAJ44366.1|  putative CC-NBS-LRR resistance protein                 394   2e-113   
ref|XP_004245923.1|  PREDICTED: putative disease resistance prote...    394   3e-113   
ref|XP_010279598.1|  PREDICTED: disease resistance protein RGA2-like    396   3e-113   
ref|XP_010644956.1|  PREDICTED: putative disease resistance prote...    397   4e-113   
ref|XP_004249225.1|  PREDICTED: uncharacterized protein LOC101268...    371   4e-113   
ref|XP_010905012.1|  PREDICTED: putative disease resistance prote...    399   5e-113   
ref|XP_003598558.1|  NBS-containing resistance-like protein             392   5e-113   
ref|XP_006442058.1|  hypothetical protein CICLE_v10021153mg             371   7e-113   
ref|XP_002516740.1|  leucine-rich repeat containing protein, puta...    396   7e-113   
ref|XP_006433725.1|  hypothetical protein CICLE_v10000073mg             397   9e-113   
gb|KHG19991.1|  Putative disease resistance RGA3                        396   1e-112   
ref|XP_007145624.1|  hypothetical protein PHAVU_007G254500g             387   1e-112   
ref|XP_010088665.1|  Putative disease resistance protein RGA3           392   1e-112   
ref|XP_010647976.1|  PREDICTED: putative disease resistance prote...    388   2e-112   
ref|XP_009368038.1|  PREDICTED: disease resistance protein RGA2-like    397   2e-112   
ref|XP_011089014.1|  PREDICTED: putative disease resistance prote...    395   2e-112   
gb|KDP37823.1|  hypothetical protein JCGZ_06725                         369   3e-112   
ref|XP_010088666.1|  Putative disease resistance protein RGA3           395   3e-112   
ref|XP_008368960.1|  PREDICTED: putative disease resistance prote...    393   4e-112   
ref|XP_002269779.2|  PREDICTED: putative disease resistance prote...    393   4e-112   
gb|AAR29075.1|  blight resistance protein SH20                          390   4e-112   
gb|KDO40026.1|  hypothetical protein CISIN_1g046626mg                   377   4e-112   
ref|XP_006352941.1|  PREDICTED: putative disease resistance prote...    390   5e-112   
ref|XP_010325692.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...    402   6e-112   
ref|XP_006574574.1|  PREDICTED: putative disease resistance prote...    384   8e-112   
ref|XP_007202231.1|  hypothetical protein PRUPE_ppa008647mg             367   9e-112   
ref|XP_002268065.2|  PREDICTED: putative disease resistance prote...    392   9e-112   
ref|XP_003604989.1|  NBS resistance protein                             391   1e-111   
ref|XP_003636906.1|  Disease resistance protein                         382   1e-111   
ref|XP_008793943.1|  PREDICTED: putative disease resistance prote...    395   1e-111   
ref|XP_004514999.1|  PREDICTED: putative disease resistance prote...    386   1e-111   
gb|KCW84386.1|  hypothetical protein EUGRSUZ_B01237                     379   1e-111   
ref|XP_010910478.1|  PREDICTED: putative disease resistance prote...    379   1e-111   
ref|XP_007028515.1|  Plant protein 1589 of Uncharacterized protei...    366   2e-111   
ref|XP_003606009.1|  NBS-containing resistance-like protein             384   3e-111   
ref|XP_004136127.1|  PREDICTED: putative disease resistance prote...    391   3e-111   
ref|XP_004237344.1|  PREDICTED: putative disease resistance prote...    365   4e-111   
gb|KEH33021.1|  NBS-LRR type disease resistance protein                 384   5e-111   
ref|XP_006366885.1|  PREDICTED: putative disease resistance prote...    387   6e-111   
ref|XP_003598562.1|  NBS-containing resistance-like protein             385   7e-111   
gb|AES68813.2|  NBS-LRR type disease resistance protein                 385   7e-111   
gb|KCW47984.1|  hypothetical protein EUGRSUZ_K01715                     384   9e-111   
ref|XP_008790484.1|  PREDICTED: putative disease resistance prote...    389   1e-110   
ref|XP_007020999.1|  Leucine-rich repeat containing protein, puta...    388   1e-110   
gb|KCW54594.1|  hypothetical protein EUGRSUZ_I00549                     382   1e-110   
ref|XP_010918023.1|  PREDICTED: putative disease resistance prote...    391   1e-110   
ref|XP_006355884.1|  PREDICTED: putative disease resistance prote...    387   1e-110   
gb|KCW90376.1|  hypothetical protein EUGRSUZ_A02517                     377   1e-110   
ref|XP_006574573.1|  PREDICTED: putative disease resistance prote...    384   2e-110   
ref|XP_010644952.1|  PREDICTED: putative disease resistance prote...    389   2e-110   
gb|KHG04915.1|  Putative disease resistance RGA1                        390   2e-110   
ref|XP_010659175.1|  PREDICTED: putative disease resistance prote...    387   2e-110   
ref|XP_010269796.1|  PREDICTED: putative disease resistance prote...    393   2e-110   
ref|XP_003604981.1|  NBS-containing resistance-like protein             380   2e-110   
ref|XP_010036454.1|  PREDICTED: disease resistance protein RGA2-like    374   3e-110   
gb|EYU23335.1|  hypothetical protein MIMGU_mgv1a018297mg                387   3e-110   
gb|KCW84048.1|  hypothetical protein EUGRSUZ_B00930                     387   3e-110   
ref|XP_008790482.1|  PREDICTED: putative disease resistance prote...    389   7e-110   
ref|XP_010644917.1|  PREDICTED: putative disease resistance prote...    385   8e-110   
gb|KCW48280.1|  hypothetical protein EUGRSUZ_K02012                     380   1e-109   
ref|XP_010644808.1|  PREDICTED: putative disease resistance prote...    386   1e-109   
ref|XP_003598547.1|  NBS-containing resistance-like protein             379   1e-109   
ref|XP_008776815.1|  PREDICTED: putative disease resistance prote...    391   1e-109   
ref|XP_010026779.1|  PREDICTED: putative disease resistance prote...    387   1e-109   
ref|XP_003613319.1|  Resistance protein                                 383   1e-109   
ref|XP_010918018.1|  PREDICTED: disease resistance protein RGA2-like    387   1e-109   
ref|XP_010251864.1|  PREDICTED: putative disease resistance prote...    386   1e-109   
ref|XP_010938818.1|  PREDICTED: putative disease resistance prote...    387   2e-109   
ref|XP_007157502.1|  hypothetical protein PHAVU_002G075000g             383   2e-109   
ref|XP_009374157.1|  PREDICTED: disease resistance protein RGA2-like    369   2e-109   
ref|XP_009385284.1|  PREDICTED: putative disease resistance prote...    384   3e-109   
ref|NP_001058431.1|  Os06g0693100                                       368   4e-109   
ref|XP_002274015.1|  PREDICTED: uncharacterized protein LOC100265...    360   5e-109   
gb|KHG09524.1|  Putative disease resistance RGA1                        380   5e-109   
gb|EAZ02192.1|  hypothetical protein OsI_24284                          367   5e-109   



>ref|XP_006340095.1| PREDICTED: putative disease resistance protein RGA1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340096.1| PREDICTED: putative disease resistance protein RGA1-like isoform 
X2 [Solanum tuberosum]
Length=823

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/830 (67%), Positives = 656/830 (79%), Gaps = 7/830 (1%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL +I E VL+K+ S+A  EI+ AWN+K EL+KLQ+TLSTIKAVL DA+EQQAKNH
Sbjct  1     MAESFLFNIIERVLAKVSSIAVYEITLAWNVKIELRKLQSTLSTIKAVLLDANEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+DWL+KLRDVVYD DDL+DD  T  LL ++        KVRK F+  + +IYRFKI  
Sbjct  61    EVRDWLEKLRDVVYDVDDLMDDLST-QLLLQMHFQKSFRKKVRKFFSSSNPIIYRFKIGR  119

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++EIR  LN+IA+DRRNFHF E+ YV P EN   REQTHSFVR SDIIGRD D+E+IV 
Sbjct  120   KVKEIRELLNEIADDRRNFHFTEHTYVIPAENTS-REQTHSFVRASDIIGRDDDQENIVK  178

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              L+ S DEE+   +S +PIVGLGGLGKTTLVKLVYN++RVVQNFD R+WVS+SEDFSLSK
Sbjct  179   QLIDSHDEEN---ISVIPIVGLGGLGKTTLVKLVYNNNRVVQNFDLRMWVSISEDFSLSK  235

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             VIEKILRSATG+SF HLDMDQLQ  L  VL   RYLLVLDDVWNEDQHKW +LRELLM+ 
Sbjct  236   VIEKILRSATGESFDHLDMDQLQGCLGEVLQQKRYLLVLDDVWNEDQHKWTDLRELLMNC  295

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
               GS+++VTTRS   A ITGT   Y L GL+D DC  LFLKCAF  Q+    NLVEIGKE
Sbjct  296   SRGSKIVVTTRSKMAALITGTVPPYYLEGLADDDCLSLFLKCAFGGQDNLFPNLVEIGKE  355

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KCGGVPLAVKTLG +LY KTDE EWL IR+NEIW+IEQ ++DILPIL+LSY+QMP H
Sbjct  356   IVKKCGGVPLAVKTLGRLLYMKTDENEWLQIRDNEIWEIEQNKSDILPILRLSYEQMPSH  415

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             LRQCFAYC M  KG+EIPRE FIN W+AQGFIQS + +++LE++GNQYF+ELLSRFCF D
Sbjct  416   LRQCFAYCSMLSKGQEIPREDFINRWIAQGFIQSSNRNRKLEDIGNQYFDELLSRFCFLD  475

Query  1515  VVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFP  1694
             VV+AFDGEILACKIHNLVHDLAQSVAGAECLNVK     + E V HL FHA+++SR+ FP
Sbjct  476   VVQAFDGEILACKIHNLVHDLAQSVAGAECLNVKPNAFVVSERVRHLFFHAEDMSRKHFP  535

Query  1695  QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLR  1874
             + LL L+ LR F+YSF +G V+K FVK  L NF+ LR+L+L NL+L+ELP+SIG LK+LR
Sbjct  536   RFLLPLQKLRSFSYSFNIGPVNKFFVKTMLSNFKCLRMLVLNNLDLEELPTSIGHLKELR  595

Query  1875  YLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSL  2054
             YLNLSN+ NIK LP  +SKLVNL TLNLINCEQLKELPR+F ++L+SLKTLYLT+ ++S 
Sbjct  596   YLNLSNSGNIKFLPRSMSKLVNLHTLNLINCEQLKELPRDF-RKLISLKTLYLTTHQISE  654

Query  2055  QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLE  2234
               ++  S   LQFLLL+KC   K   E+ QH   LRVLRIYEC SL  LP+ IR+L  LE
Sbjct  655   GIKNQHSFTSLQFLLLFKCCFPKLQPELVQHFTALRVLRIYECPSLCSLPSSIRYLTSLE  714

Query  2235  KLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPE  2414
             KLWIWNCEELDL  GEGM GL SLQSLLLMGLPKLV+LP  LKD     LKY R+A CP 
Sbjct  715   KLWIWNCEELDLIDGEGMSGLTSLQSLLLMGLPKLVTLPLELKDTAPTTLKYFRIADCPN  774

Query  2415  LTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG  2564
             L  LP+WL NC+ LQRLYIEDCP L+ +P+ I  S NA + IIDCPLL G
Sbjct  775   LMELPEWLPNCSSLQRLYIEDCPVLASIPQGIY-SHNANLHIIDCPLLGG  823



>ref|XP_011078960.1| PREDICTED: putative disease resistance protein RGA1 [Sesamum 
indicum]
Length=827

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/831 (61%), Positives = 636/831 (77%), Gaps = 8/831 (1%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETFL +I + VL +  S+A + ISSAWN K E++KLQNTLSTI+AV+ DAD QQAKNH
Sbjct  1     MAETFLFNIIDRVLGRFSSIALEHISSAWNTKSEVQKLQNTLSTIRAVILDADGQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT--KVRKLFTRPDGLIYRFKI  428
             EV+DWL+KL+D VY+ DDLLDD  T    R +   SGIL   KVR+ F+  + +  RFKI
Sbjct  61    EVRDWLEKLKDAVYEIDDLLDDLTTQVSQRNVEIYSGILILKKVRRFFSSSNPIACRFKI  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
               +++ +R RL++IA+DR  FHF E  +  PV+N  ++EQTHSFVR SDIIGRD DKE+I
Sbjct  121   AQRVKRLRQRLDEIADDRTKFHFSEQAHFIPVDNN-VKEQTHSFVRASDIIGRDGDKENI  179

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             V +L+ S DEED   VS +P+VG+GGLGKTT+VKL YNDDRVVQ+FD  +WVSVSEDF +
Sbjct  180   VQLLLSSKDEED---VSVVPVVGIGGLGKTTVVKLAYNDDRVVQSFDLGMWVSVSEDFGV  236

Query  789   SKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
              KV+EKIL+SATG++  HLDMDQ+Q  L GVL + +YLLVLDDVWNED++KW +LRELLM
Sbjct  237   GKVVEKILKSATGENLAHLDMDQMQSCLAGVLNNKKYLLVLDDVWNEDRNKWMDLRELLM  296

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIG  1148
             +G  GS++IVTTRS  VA ITGTT+ YNL+GLSD DC  LFLKCAFR  +    NLV I 
Sbjct  297   NGRTGSKIIVTTRSKAVALITGTTSPYNLAGLSDDDCLSLFLKCAFRGPDNWLPNLVAIA  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEIV+KCGGVPLAVKTLG +LY  TDEQEWLHI++N+IW+I+QK++DILPIL+LSY+++P
Sbjct  357   KEIVKKCGGVPLAVKTLGGLLYMNTDEQEWLHIKDNDIWEIDQKQSDILPILRLSYEKLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HLRQCFAYC M PKG EIPREVFINLW+AQG + S   ++ELE++GN+YFNELLSRFCF
Sbjct  417   PHLRQCFAYCSMLPKGFEIPREVFINLWIAQGLVSSTSKNRELEDIGNRYFNELLSRFCF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q+VVEAFDGEIL C+IHNLVHDLAQSVAG ECLN K+    I + V HL  H ++LS +E
Sbjct  477   QEVVEAFDGEILVCRIHNLVHDLAQSVAGDECLNFKADIKSISDRVRHLYLHDEDLSEKE  536

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
              P+ L  LKNLR F  +F+   +  TF++   + FRRLRVL+LQ L+L+ELPSSIG L+Q
Sbjct  537   APRTLFRLKNLRSFRCTFKNKPLDMTFIQGIAMKFRRLRVLVLQALDLEELPSSIGGLQQ  596

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRYL+LS++ N+KSLP+   KLVNLQTLNL+NCE+ ++LP NF + L+S+KTLYLT +E+
Sbjct  597   LRYLDLSHSSNLKSLPKSFCKLVNLQTLNLMNCEKFQDLPGNF-RSLVSIKTLYLTCREI  655

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
             SL K+S  S   LQFLLLY C   + P+E +Q +  LRVLRIY+C  L  LP  I++L  
Sbjct  656   SLTKKSLQSFKSLQFLLLYNCDFVQLPSEGFQDLNSLRVLRIYDCPRLASLPDNIKYLTA  715

Query  2229  LEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
             LEKLWIWNCE LDLS G+G+EGL  L+SLLLMGLPKL++LP GL    A  LK+ R+A C
Sbjct  716   LEKLWIWNCEVLDLSDGDGLEGLTCLESLLLMGLPKLINLPMGLTKNVAKTLKFFRIANC  775

Query  2409  PELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLN  2561
                  LP+WL +  LLQR Y+EDCP LS+LP Q+     AKV +  CP L 
Sbjct  776   ANFAMLPEWLLSFNLLQRFYVEDCPNLSFLP-QVVGRHIAKVHVSGCPKLG  825



>gb|EYU20794.1| hypothetical protein MIMGU_mgv1a022167mg [Erythranthe guttata]
Length=782

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/833 (55%), Positives = 576/833 (69%), Gaps = 61/833 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETFL  ITE+VLSK+   A + I +A N+K E+ KL NTLSTI+AV+ DADEQ++ NH
Sbjct  1     MAETFLFLITESVLSKVTFHALNHIGTASNIKTEVTKLHNTLSTIRAVILDADEQRSINH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT--KVRKLFTRPDGLIYRFKI  428
             EV+DW  KL+D VYD DD++DD  T +L R      GIL   KV + F+  + +  RFKI
Sbjct  61    EVRDWFDKLKDAVYDIDDVIDDLSTQALQRDADFRDGILILKKVTRFFSSSNTIATRFKI  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVN-PVENGKLREQTHSFVRPSDIIGRDSDKES  605
               ++  +R RL++IA DR  FHF E   ++ PVE      QTHS+VRPSDIIGRD DKE 
Sbjct  121   GRRVEALRKRLDEIAADRNKFHFTEKRRLSIPVE------QTHSYVRPSDIIGRDDDKEQ  174

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             IV +L+ S +EE+ E  S +PIVG+GGLGKTT+VKL YNDDRV+Q+FD  +WVSVSE+FS
Sbjct  175   IVQLLVMSSNEEE-EGASVIPIVGIGGLGKTTVVKLAYNDDRVIQSFDLGMWVSVSEEFS  233

Query  786   LSKVIEKILRSATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
             + KV+EKIL+SATG +SF HLDMDQ+Q  L  VL   RYLLVLDDVWNED++KW +LREL
Sbjct  234   VGKVVEKILKSATGGESFAHLDMDQMQIRLAEVLSDKRYLLVLDDVWNEDRNKWMDLREL  293

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQ-EYRPRNLV  1139
             LM+   GS++IVT RS  VA+IT T   YNLSGLSD DC  LFLKCAFR   EY P NL+
Sbjct  294   LMNCRSGSKIIVTARSKNVASITSTMPPYNLSGLSDEDCLSLFLKCAFRNSDEYCPPNLL  353

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
              IGKEIV+KCG                          EN+IW+I+QK+TDILP+LKLSY+
Sbjct  354   PIGKEIVKKCG--------------------------ENDIWEIDQKQTDILPLLKLSYE  387

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
             ++P +L+QCFAYC M PKG EIPREVFINLW+AQGFI S +G +++E++GNQYFNELLSR
Sbjct  388   RLPSYLKQCFAYCSMLPKGLEIPREVFINLWIAQGFIHSINGTRQVEDIGNQYFNELLSR  447

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLS  1679
             FCFQ+VVEAFDGEILACKIHNLVHDLAQSVAG             P+   H+  H     
Sbjct  448   FCFQEVVEAFDGEILACKIHNLVHDLAQSVAG-------------PDRARHIYLH-----  489

Query  1680  REEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
              E  P+PL   K +R    +F++  +  + F+     +F+RLRVL+L +LEL+ELPSSIG
Sbjct  490   -ESPPKPLTRSKKVRSLRCAFKIKPSKDEAFITAIARSFKRLRVLILNSLELEELPSSIG  548

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              L+ LRYL+LS + NIK LP  I KLVNLQTLNLINCE  + LPRNFG  L+S+KTLYLT
Sbjct  549   ELRPLRYLDLSQSSNIKILPNSICKLVNLQTLNLINCESFQGLPRNFG-DLISMKTLYLT  607

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
              QE+SL+KR   S   LQFLLLY C   + P+E  +H+  +RVLRIY+C  L  LP  ++
Sbjct  608   CQEMSLRKRGPKSFSSLQFLLLYNCDFVQLPSEGLRHLTSVRVLRIYDCPRLASLPNSMK  667

Query  2217  HLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
              L+ LEKLWIWNCEELDL               LL+  LPKLV  P  L++  +  L++L
Sbjct  668   CLSSLEKLWIWNCEELDLCEGDGLKGLNGLRSLLLMGLLPKLVDFPVQLRENVSKSLQFL  727

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCP  2552
             RVA C   T  P+W+ + TLLQRLYIEDCP L +LP  +R +  +KV I  CP
Sbjct  728   RVANCANFTEFPEWITSFTLLQRLYIEDCPNLFFLPNGVRRNV-SKVHISGCP  779



>ref|XP_009775465.1| PREDICTED: putative disease resistance protein RGA1 [Nicotiana 
sylvestris]
Length=850

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/835 (45%), Positives = 538/835 (64%), Gaps = 20/835 (2%)
 Frame = +3

Query  78    AETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             AE+FL +I  ++L K+ S A  E +  W +K EL KL+ TL TI+ VL DA+EQQ KNHE
Sbjct  3     AESFLFNIANSILGKLGSHALQEFNLIWGVKNELNKLKKTLITIRDVLLDAEEQQIKNHE  62

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLR-KLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             + +WL++L+DV+Y ADD LD+  T    R +L+S  GIL    KL      +++R+K++H
Sbjct  63    LTNWLEELKDVLYVADDFLDEIQTYGQQRQRLKSKVGILLSPFKL------ILFRYKMSH  116

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+EIRGRL+ IA D+  FH  E      ++    R+ T+SF+ PSD++GR ++ E IV 
Sbjct  117   KIKEIRGRLDSIAADKAKFHLSERSIALEMK----RDLTYSFILPSDVVGRRNESEEIVE  172

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM+  +    E +S + IVG+GG+GKTTL KLVY D+RVV++F  R+W+  S+DF + K
Sbjct  173   VLMQ--ENGFDECLSVVSIVGIGGVGKTTLAKLVYRDERVVKHFPLRIWLCASQDFDVIK  230

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +   I+  A+G    + +++Q+   L   L   R+LL++DDVW+ D+ KW  LR LLM G
Sbjct  231   LARNIVNLASGVPCDNFNVEQVHASLQDALRERRFLLIIDDVWSRDRSKWLELRSLLMVG  290

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+V+VTTRS  +A +  +   Y+L  L   DCF LFLK AFR  QE    NL +IG+
Sbjct  291   ARGSKVVVTTRSDYIALMMESVVTYSLKELPHEDCFSLFLKWAFRNGQERHFPNLTKIGE  350

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV+KC GVPLAVKTLGSMLY  TDE+EWL +R++EIW+++Q+  DILP L+LSY+Q+PY
Sbjct  351   DIVKKCKGVPLAVKTLGSMLYATTDEREWLKVRDDEIWQLKQENDDILPALRLSYNQLPY  410

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L+QCFAYC +FPKG+EI   + I LW+AQG I S +  QELE++G +Y  EL SR  F+
Sbjct  411   YLKQCFAYCSIFPKGQEIASIMLIQLWLAQGLIHSSNESQELEDVGVRYVKELCSRSLFE  470

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             + VEA+D   +  K+H+LVHDLA  VA  +C  +K+    I E V H+   + + S +  
Sbjct  471   E-VEAYDS-FITFKMHDLVHDLAVLVAQTDCRVIKNNTDSITEKVRHVTLFSYSPSEKSI  528

Query  1692  PQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             P+ L     +R  FA S      +   V + +  F+ LRVL L++  L+ LP SIG +K 
Sbjct  529   PEILCKQNRIRTIFAPSEGFERYAALLVGQCITRFKYLRVLDLRHSSLETLPDSIGNMKH  588

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRY++ S N NI+ LP  I KL NLQTL L+ C +L++LPR  G  L+SL+ LYLT++E 
Sbjct  589   LRYIDFSGNNNIQMLPTNICKLPNLQTLRLVLCTKLQKLPRELG-NLVSLRHLYLTTKEQ  647

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
             +L +++  SL  LQ L ++ C       E  Q + +LR L I +C  LT LP GI HL+ 
Sbjct  648   NLPEKALGSLALLQSLSIFGCENLVSLFEGIQKLTELRTLVIGDCPRLTALPKGIVHLSA  707

Query  2229  LEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
             LE   I NCE L LS  + ++GL+ ++SL++ GLP LV+LP  LK  D+  LK++R++ C
Sbjct  708   LESFMIVNCEALMLSDWQDIQGLKRIRSLVIGGLPHLVALPEWLKG-DSNSLKFIRISTC  766

Query  2409  PELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV-RIIDCPLLNG*C  2570
                 ALP WL+N T L++L I  CP+LS LP+ + S +  ++ +I  CP L   C
Sbjct  767   LSFVALPAWLENVTALEKLEITGCPQLSSLPDSMSSLTTLRMLKIQKCPGLTRRC  821



>ref|XP_006350193.1| PREDICTED: putative disease resistance protein RGA3-like [Solanum 
tuberosum]
 ref|XP_006350195.1| PREDICTED: putative disease resistance protein RGA3-like [Solanum 
tuberosum]
Length=850

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/834 (44%), Positives = 530/834 (64%), Gaps = 15/834 (2%)
 Frame = +3

Query  78    AETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             A +FL +I  ++L K+ S    E    W +K EL KL  TL TI+ VL DA++QQ+KNHE
Sbjct  3     AASFLFNIANSILGKLGSHGLQEFYLIWGVKNELNKLNKTLVTIRDVLLDAEDQQSKNHE  62

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             + +WL++L+DV+YDADD LD+  T      ++    +  KV  LF+    L++R+++ +K
Sbjct  63    LTNWLKELKDVLYDADDFLDEIQT-----HVQQSQRLKPKVCFLFSPFKFLLFRYRMGYK  117

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGM  617
             ++EIR RL+ IA D+  FH  E      +E  K R  T+ F+ PSD++GR ++ E ++ +
Sbjct  118   VKEIRERLDSIAADKAKFHLSERTVA--LEMNK-RGLTYPFILPSDVVGRRNESEEVIEV  174

Query  618   LMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKV  797
             LM+    +D   +S + IVG+GG+GKTTL KLVY D+R+V+NF  R+W+  S+DF ++K+
Sbjct  175   LMQKGVADDQRGLSVVSIVGIGGVGKTTLAKLVYRDERIVKNFPVRIWLCASQDFDVAKL  234

Query  798   IEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
                I+ SA+G S  + +++Q+   L   L   R+LL++DDVW+ D+ KW  LR LLM G 
Sbjct  235   SRNIVNSASGASCDNFNVEQVHISLQDALRGKRFLLIIDDVWSRDRFKWLELRSLLMVGE  294

Query  978   DGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
              GS+V+VTTRS  +A +  +   YNL  L   DC  LFLK AFR  QE    NL +IG++
Sbjct  295   CGSKVVVTTRSDYIALMMESVVTYNLKELPHEDCLSLFLKWAFRNGQERHFPNLTKIGED  354

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KC GVPLAVKTLGSMLY KTDE+EWL +R++EIW++ Q+  DILP L+LSY+Q+PY+
Sbjct  355   IVKKCKGVPLAVKTLGSMLYAKTDEREWLKVRDDEIWQLNQEGDDILPALRLSYNQLPYY  414

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFAYC +FPKG+EI   + I LW AQG I S +  QELE++G  Y  EL SR  F++
Sbjct  415   LKQCFAYCSIFPKGQEIASSMLIQLWSAQGLIHSSNESQELEDVGVHYVKELCSRSLFEE  474

Query  1515  VVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFP  1694
              VEA+D   ++ K+H+LVHDLA  VA  +C  +K+    I E V H+     + S E  P
Sbjct  475   -VEAYDS-FISIKMHDLVHDLAVFVAQTDCCVIKNNTDSITEKVRHVTLVNYSPSEESIP  532

Query  1695  QPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
               L     +R  FA S      +   V + +  F+ LRVL L++  L+ LP SIG +K L
Sbjct  533   GILCKQNRIRTIFAPSEGFERYAALLVGQCISRFKYLRVLDLRHSSLETLPDSIGNMKHL  592

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             RY++ S N NI+ LP  I KL NLQTL ++ C +L++LPR+ G  L+SL+ LYLT++E +
Sbjct  593   RYIDFSGNNNIQMLPSNICKLPNLQTLRIVLCTKLQKLPRDLG-NLVSLRHLYLTTKEQN  651

Query  2052  LQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
             L ++   SL  LQ L ++ C       E  Q + KLR L I +C  LT LP GI HL+ L
Sbjct  652   LPEKGLGSLALLQSLSIFGCENLVSLFEGIQKLTKLRTLVIGDCPRLTTLPRGIVHLSAL  711

Query  2232  EKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCP  2411
             E   I NCEEL LS  +  EGL+ ++SL++ GLP LVSLP  LK  D+  LK++R++ CP
Sbjct  712   ENFMIVNCEELMLSDWQDFEGLKRIRSLVIGGLPHLVSLPEWLKG-DSNSLKFIRISTCP  770

Query  2412  ELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV-RIIDCPLLNG*C  2570
                A+PDWL+N T L++L I  CP+ S LP+ +   +  ++ +I  CP L   C
Sbjct  771   SFIAMPDWLENSTSLEKLEITGCPKFSSLPDSMSCLTTLRMLKIQKCPELTRRC  824



>ref|XP_009587018.1| PREDICTED: putative disease resistance protein RGA1 [Nicotiana 
tomentosiformis]
Length=850

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/846 (45%), Positives = 540/846 (64%), Gaps = 23/846 (3%)
 Frame = +3

Query  78    AETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             AE+FL +I  ++L K+ S A  E    W +K EL KL+ TL TI+ VL DA+EQQ KNHE
Sbjct  3     AESFLFNIANSILGKLGSHALQEFYLIWGVKNELNKLKKTLLTIRDVLLDAEEQQIKNHE  62

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLR-KLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             + +WL++L+DV+YDADD LD+  T    R + +S  G L    K+      L++R+K+++
Sbjct  63    LTNWLEELKDVLYDADDFLDEIQTYGQQRQRFKSKVGFLLSPFKI------LLFRYKMSY  116

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+EIRGRL+ IA D+  FH  E      ++    R+ T+SF+ PSD++GR ++ E IV 
Sbjct  117   KIKEIRGRLDSIAADKAKFHLSEKTIALEMK----RDLTYSFILPSDVVGRRNEIEEIVE  172

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM+  +    E +S + IVG+GG+GKTTL KLVY D+RVV++F  R+W+  S+D  + K
Sbjct  173   VLMQ--ENGFDECLSVVSIVGIGGVGKTTLAKLVYRDERVVKHFPLRIWLCASQDIDVIK  230

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +   I+  A+G S  + +++Q+   L   L + R+LL++DDVW+ D+ KW  LR LLM G
Sbjct  231   LARNIVNLASGVSCDNFNVEQVHSSLQDALRAKRFLLIIDDVWSRDRSKWLELRSLLMIG  290

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+V+VTTRS  +A++  +   Y+L  L   DCF LFLK AFR  QE    NL +IG+
Sbjct  291   ARGSKVVVTTRSDYIASMMESVVTYSLKELPHEDCFSLFLKWAFRNGQERHFPNLTKIGE  350

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV+KC GVPLAVKTLGSMLY  TDE+EWL +R++EIWK++Q   DILP L+LSY+Q+PY
Sbjct  351   DIVKKCKGVPLAVKTLGSMLYAITDEREWLKVRDDEIWKLKQANDDILPALRLSYNQLPY  410

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L+QCFAYC +FPKG+EI   + I LW+AQG I S +  QELE+ G +Y  EL SR  F+
Sbjct  411   YLKQCFAYCSIFPKGQEIASIMLIQLWLAQGLIHSSNESQELEDDGVRYVKELCSRSLFE  470

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             + VEA+D   +  K+H+LVHDLA  VA  +C  +K+    I E V H+   + + + +  
Sbjct  471   E-VEAYDS-FITFKMHDLVHDLAVLVAQTDCCVIKNNTDSITEKVRHVTLFSYSPAEKSI  528

Query  1692  PQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             P+ L     +R  FA S      +   V K +  F+ LRVL L++  L+ LP SIG +K 
Sbjct  529   PEILCKQNRIRTVFAPSEGFERYAALLVGKCISRFKYLRVLDLRHSRLETLPDSIGNMKH  588

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRY++ S N NI+ LP  I KL NLQTL L+ C +L++LPR  G  L+SL+ LYLT++E 
Sbjct  589   LRYIDFSGNNNIQILPTNICKLPNLQTLRLVLCTKLQKLPRELG-NLVSLRHLYLTTKEQ  647

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
             +L +++  SL  LQ L ++ C       E  Q + KLR L I +C  LT LP GI  L+ 
Sbjct  648   NLPEKALGSLALLQSLSIFGCENLVSLFEGIQKLTKLRTLVIGDCPRLTSLPRGIVLLSA  707

Query  2229  LEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
             LE   I NCE L LS  + ++GL+ ++SL++ GLP LV LP  LK  D+  LK++R++ C
Sbjct  708   LESFMIVNCEALMLSDWQDIQGLKRMRSLVIGGLPHLVDLPEWLKG-DSNSLKFIRISTC  766

Query  2409  PELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV-RIIDCPLLNG*C-GDTG  2582
             P   ALP WL+N T L++L I  CP+LS LP+ + S +  ++ +I  CP L   C  DTG
Sbjct  767   PSFVALPAWLENVTALEKLEITGCPKLSSLPDCMSSLTTLRMLKIQKCPGLTRRCEKDTG  826

Query  2583  TRLSWS  2600
                 WS
Sbjct  827   E--DWS  830



>ref|XP_002277498.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=848

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/821 (44%), Positives = 513/821 (62%), Gaps = 23/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F   I + VL K+ S    E+  AW +K EL++L +TLSTI+AVL DA+E+QA +H
Sbjct  1     MAESFAFAIADRVLGKLGSALIQEVGLAWGVKTELEELNDTLSTIRAVLLDAEEKQATSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL KL+D  YDA+D++D+F   +L +K+ +     TKV   F+ P  L +  K+ H
Sbjct  61    QLRDWLGKLKDGFYDAEDIVDEFEYEALRQKVVASGSFKTKVCSFFSSPKSLAFNLKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             ++++IRGRL++IA D+  F+  E     PV   K RE THSFVR SD+IGRD DKE+IVG
Sbjct  121   RVKKIRGRLDKIAADKSKFNLIEAVANTPVVLSK-REMTHSFVRASDVIGRDDDKENIVG  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM+  D   TE+VS +PIVG+GGLGKTTL  LVYND+RVV  F T++WV VS++F + K
Sbjct  180   LLMQPSD---TENVSVIPIVGIGGLGKTTLAGLVYNDERVVGQFSTKMWVCVSDEFDIEK  236

Query  795   VIEKILRS--ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             +++KIL+      +S+    M QLQ HL   L   ++LLVLDDVWN D+ KW  L++LL+
Sbjct  237   LVKKILKEIRKGDESYSDSSMVQLQSHLRNALDGEKFLLVLDDVWNADREKWLKLKDLLV  296

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIG  1148
              G +GS+++VTTR    A+I GT     + GL   DC  LF+KC+FR+ E    NL++IG
Sbjct  297   DGANGSKILVTTRKKSTASIMGTFPMQEIKGLCHDDCLSLFVKCSFRDGEDEYPNLLKIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+KC GVPLAV++LGS+LY K DE +W+ IR++EIW++EQ E  I+  L+LSY  +P
Sbjct  357   DQIVEKCAGVPLAVRSLGSLLYSKRDEWDWVSIRDSEIWELEQNEDGIMAALRLSYYDLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
             YHL+QCFA C +F K  E      I+ W+A+G I S   + ++E++G +Y NELLSR  F
Sbjct  417   YHLKQCFALCSVFAKDFEFSNVELISTWMAEGLIHSSGQNAKMEDIGERYINELLSRSFF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QDV +   G +   K+H+LVHDLA   A  ECL +     +IP+ V H  F      +EE
Sbjct  477   QDVEQRIPGVLYTFKMHDLVHDLAMFFAQPECLTLNFHKKDIPKRVQHAAFSDTEWPKEE  536

Query  1689  -----FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
                  F + L N+  + YF     V   S++FVK  +L F+ +R L LQ+   + LP+SI
Sbjct  537   SEALRFLEKLNNVHTI-YFQME-NVAPRSESFVKACILRFKCIRRLDLQDSNFEALPNSI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLNLS N  IK LP  I KL +LQ L L  C +L+ELPR     ++SL+T+ +
Sbjct  595   GSLKHLRYLNLSGNKRIKKLPNSICKLYHLQFLTLFGCSELEELPRGI-WSMISLRTVSI  653

Query  2034  TSQEVSL--QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             T ++  L  +++   SL  LQ L +  C   +F ++  + + +LR+L I +C SL  L  
Sbjct  654   TMKQRDLFGKEKGLRSLNSLQHLQIVDCLNLEFLSKGMESLIQLRILVISDCPSLVSLSH  713

Query  2208  GIRHLAKLEKLWIWNCEEL-----DLSVgegmegleslqslllmglPKLVSLPAG-LKDI  2369
              I+ L  LE L I NC++L     +    E ++   SLQ L    LP+L +LP   L   
Sbjct  714   NIKFLTALEVLVIDNCQKLESMDGEAEGQEDIQSFGSLQILFFGDLPQLEALPRWLLHGP  773

Query  2370  DAMKLKYLRVAGCPELTALPD-WLQNCTLLQRLYIEDCPEL  2489
              +  L  L ++ CP L ALP+  LQ    LQ+L IEDCPEL
Sbjct  774   TSNTLHQLHISNCPSLRALPESGLQKLVYLQKLEIEDCPEL  814



>ref|XP_006489981.1| PREDICTED: putative disease resistance protein RGA1-like [Citrus 
sinensis]
Length=874

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/853 (42%), Positives = 522/853 (61%), Gaps = 29/853 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E++     E +L K+ S A +E+    ++K +L+KL+ TL+ +K+V+ DA+E+Q  +H
Sbjct  1     MVESYFP--IEKLLEKLGSFAYEELLLFCSVKNDLQKLKETLTAVKSVVLDAEEKQIHSH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WL+KL+D   DA+D+LD+F    L R++     I  K+R  F   + + +RF++  
Sbjct  59    QLRGWLEKLKDACDDAEDVLDEFEVEDLRRQVMKQRSIGRKLRNFFGSSNPVAFRFRMCQ  118

Query  435   KIREIRGRLNQIAEDRRNFHFK-----ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             +I+++R R ++IA     F         ++ +   E    RE THSFVRPSDI GRD D+
Sbjct  119   QIKKVRERFDEIANMMHKFDLTARLDDRSWRIVHEE----RESTHSFVRPSDIFGRDKDR  174

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+  LM++   E +E+VS +PIVG+GGLGK  L KLVYND RV ++F+ ++W+ VSE+
Sbjct  175   EKIIKALMQASSGE-SETVSVIPIVGIGGLGKIALAKLVYNDQRVEEHFELKIWICVSEN  233

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F   +++ KI++S TG++ G LD DQLQ  L   L   RYLLV+DDVWNED   W+ L+ 
Sbjct  234   FGERQIMTKIIKSITGQNHGDLDTDQLQRILRDRLNGKRYLLVMDDVWNEDPEAWRKLKS  293

Query  960   LLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
             LL+ G +GS+++VTTRS KVA+I GT   TT YNL  L   DC  LF+KCAF++++ +  
Sbjct  294   LLLGGANGSKILVTTRSRKVASIMGTRGGTTGYNLQVLPFEDCLSLFMKCAFKKEQDKHP  353

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
             NL++IG+EIV KCGG+PL V+TLGS+LYC TDE  W ++R+NEIW++EQKE+ ILP L+L
Sbjct  354   NLIKIGEEIVGKCGGIPLVVRTLGSLLYCSTDEHFWEYVRDNEIWQLEQKESGILPALRL  413

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYDQ+P HL+QC AYC +FPK  +    + +  W+A G +QS +  ++LE++G +Y  EL
Sbjct  414   SYDQLPPHLKQCVAYCSIFPKDYQFDSYILVQFWMAHGLLQSHNKKEDLEDIGMRYLKEL  473

Query  1491  LSRFCFQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             LSR  FQD+     G E    K+H+L+HDLA  VA  E L V S    IP+ V HL F A
Sbjct  474   LSRSFFQDLTFGMVGMETFYFKMHDLMHDLALLVAKDEFLVVNSDCQFIPKRVRHLSFGA  533

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
              N SR +F   L +L  +R   +S       S++FV+  +   + LRVL L    ++  P
Sbjct  534   ANASRNDFSSLLSDLGRVRTIFFSTDDDEKTSQSFVESCISKSQFLRVLDLSGSAIEVCP  593

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               +G LK  RYL+LS N  IK LP+ I +L +LQTLNL  C +L+ELP++  + L++L+ 
Sbjct  594   REMGNLKHTRYLDLSKNYKIKKLPKSICELQSLQTLNLAGCLELEELPKDI-RYLVNLRL  652

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L LT+++ SLQ+    SLG L+ L +  C   +   E    +  LR L I  C  L  LP
Sbjct  653   LALTTKQKSLQESGIRSLGSLRCLSISSCWNLEHLFEEIDQLSVLRTLSIESCPRLISLP  712

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----------glPKLVSLPA  2354
               I++L+ LE L++ +CE LDL++   MEG  S                  + +L+ LP 
Sbjct  713   PAIKYLSSLENLYLASCESLDLNLNMEMEGEGSHHDRKNTRPHLRRVFIKEITQLLELPQ  772

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-  2531
              L       L+ L + GCP   ALP+ L+N   L+ L I +CP+LS LPE +   +  K 
Sbjct  773   WLLQGSTDTLQNLLILGCPNFMALPESLRNFEALEGLVIGNCPKLSSLPEDMHHLTTLKS  832

Query  2532  VRIIDCPLLNG*C  2570
             + I  CP L+  C
Sbjct  833   LAIAGCPALSERC  845



>ref|XP_006421373.1| hypothetical protein CICLE_v10004284mg [Citrus clementina]
 gb|ESR34613.1| hypothetical protein CICLE_v10004284mg [Citrus clementina]
Length=873

 Score =   573 bits (1476),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 361/852 (42%), Positives = 519/852 (61%), Gaps = 28/852 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E++ +   E +L K+   A +E+     +K +L KL+ T++ +K+V+ DA+++Q +N 
Sbjct  1     MVESYFS--IEKLLEKLGGFAYEELLLFCGVKKDLGKLKETVTIVKSVVLDAEKKQVQND  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              +  WL  L+D  YDA+D+LD+F    L R++     I  K R  F   + + +RF++  
Sbjct  59    RLSVWLGNLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMCQ  118

Query  435   KIREIRGRLNQIAEDRRNFHFK-----ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             KI+++R R ++IA     F         ++ +   E    RE THSFV PSDIIGRD D+
Sbjct  119   KIKKVRERFDEIANMMHKFDLTARLDDRSWRIVHEE----REPTHSFVHPSDIIGRDKDR  174

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +LM++ D E +E+VS +PIVGLGGLGKT L KLVYND RV ++F+ ++W+ VSED
Sbjct  175   EKIIELLMQTSDGE-SETVSVVPIVGLGGLGKTALAKLVYNDQRVEEHFELKIWICVSED  233

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F   +++ KI++S TG++ G LD DQLQ  L   L S RYLLV+DDVWNED   W+ L+ 
Sbjct  234   FDEKQLMTKIIKSITGQNQGDLDTDQLQRTLRDRLNSKRYLLVMDDVWNEDPEAWRKLKS  293

Query  960   LLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
             LL+ G +GS+++VTTRS KVA+I GT   TT YNL GL   DC  LF+KCAF+E+  +  
Sbjct  294   LLLGGANGSKILVTTRSRKVASIMGTRGGTTGYNLQGLPFEDCLSLFMKCAFKEERDKHP  353

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
             NLV+IG+EIV+KCGG+PLAV+TLGS+LY  TDE +W ++R+NEIWK+EQK  DILP+L+ 
Sbjct  354   NLVKIGEEIVKKCGGIPLAVRTLGSLLYDSTDEHDWEYVRDNEIWKLEQKANDILPVLRF  413

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYDQ+P  L+QC AYCC+FPK  E      +  W+A G +QS + ++ELE++G +Y  EL
Sbjct  414   SYDQLPPRLKQCVAYCCIFPKDFEFSSYALVQFWMAHGLLQSHNKNEELEDIGMRYVKEL  473

Query  1491  LSRFCFQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             LSR  FQD+     G E  + K+H+L+HDLAQ V   E L V S    IP+SV HL F  
Sbjct  474   LSRSFFQDLTFGMSGMETFSFKMHDLMHDLAQQVVKDEFLVVNSDCQSIPKSVRHLSFAT  533

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
              N SR +F   L +L  +R   +S      S++FV+  +   + LRVL L    ++    
Sbjct  534   ANASRNDFSSLLSDLGRVRTIFFSIDDEKTSQSFVESCISKSQFLRVLNLSKSSIEVCSR  593

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              +G LK +RYL+LS N  IK LP+ I +L +LQTLNL+ C +L+ELP++  + L+SL+ L
Sbjct  594   KMGNLKHMRYLDLSRNSKIKKLPKSICELQSLQTLNLMGCLELEELPKDI-RYLVSLRML  652

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
              LT+++ SLQ+    SLG L+ L +  C   +   E    +  LR L I +C  L  LP 
Sbjct  653   GLTTKQKSLQESGIRSLGSLRCLTISGCRDLEHLFEEIDQLSVLRALLIDDCPRLISLPP  712

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----------glPKLVSLPAG  2357
              I++L+ LE L + NCE LDL++   M+G  S                  + +L+ LP  
Sbjct  713   AIKYLSSLETLLLLNCESLDLNLNVKMKGEGSHHDRKNTRPHLRRVFIGEITQLLELPQW  772

Query  2358  LKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVR  2537
             L       L    ++ CP   ALP  L++   L+ L I  CP+LS LPE +   +  K  
Sbjct  773   LLQCCTDTLHSWVISRCPNFMALPGSLKDLEALETLIIAGCPKLSSLPEDMHHVTTLKSL  832

Query  2538  II-DCPLLNG*C  2570
             +I  CP L+  C
Sbjct  833   LIGGCPALSERC  844



>gb|KDO42049.1| hypothetical protein CISIN_1g041348mg [Citrus sinensis]
Length=867

 Score =   570 bits (1469),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 357/850 (42%), Positives = 523/850 (62%), Gaps = 30/850 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+FL    E +  K+ S A  E+ + + +K + +KL+ TL+T+K+V+ DA+E+Q   H
Sbjct  1     MVESFLP--LEKLTEKLGSRAFQELLALYCVKNDAEKLKETLTTVKSVVLDAEEKQVHIH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL+KL+D  YDA+D+LD+F    L R++     I  K+R  F   + + +RF++  
Sbjct  59    QLRDWLEKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKLRNFFGSSNPIAFRFRMCQ  118

Query  435   KIREIRGRLNQIAEDRRNFHFK-----ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             +I+++R R ++IA     F         ++ +   E    RE THSFVRPSDIIGRD D+
Sbjct  119   QIKKVRERFDEIANMMHKFDLTARLDDRSWRIVHEE----RESTHSFVRPSDIIGRDKDR  174

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E ++  LM++   E +E+VS +PIVG+GGLGKT L +LV+ND RV ++F+ ++W+ VSED
Sbjct  175   EKVIEALMQASSGE-SETVSVIPIVGIGGLGKTALAQLVFNDQRVEEHFELKIWICVSED  233

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F   +++ KI++S TG++ G LD++QLQ  L   L   RYLLV+DDVWNED   W  L+ 
Sbjct  234   FGERQIMTKIIKSITGQNQGDLDIEQLQRILRVCLNGKRYLLVMDDVWNEDPKVWDKLKS  293

Query  960   LLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
             LL  G  GS+++VTTRS KVA+I GT   TT YNL GL   DC  LF+KCAF+E+  +  
Sbjct  294   LLSGGAKGSKILVTTRSNKVASIMGTRGGTTGYNLQGLPFEDCLSLFMKCAFKEERDKHS  353

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
             NLV+IG+EIV+KCGG+PLAV+TLGS+LYC TDE +W ++R+NEIWK+EQK  DILP+L+ 
Sbjct  354   NLVKIGEEIVKKCGGIPLAVRTLGSLLYCSTDEHDWEYVRDNEIWKLEQKANDILPVLRF  413

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYDQ+P  L+QC AYCC+FPK  +      +  W+AQG +   + + EL+++G +   +L
Sbjct  414   SYDQLPPRLKQCVAYCCIFPKDYQFSSVYLVQFWMAQGLLHPLNENDELDDIGMRSLKQL  473

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHAD  1670
              SR  F D+V  F  E+   K+H+L+HDLAQ VA  E L V S    IP+ V HL F   
Sbjct  474   CSRSFFHDLVRGF--EMFTFKMHDLIHDLAQLVAKGEFLIVNSDCQSIPKRVRHLSFVGA  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             N SR++F   L +L  +R   +S     VS++FV+  +   + LRVL L    ++ LP  
Sbjct  532   NASRKDFSSFLSDLGRVRTIFFSINDEKVSQSFVRSCISKSQFLRVLNLSGSAIEALPRE  591

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK +RYL+LS N  IK LP  I +L +LQTLNL  C +L+ELP++  + L+SL+   
Sbjct  592   IGNLKHMRYLDLSRNYKIKKLPNAICELHSLQTLNLEECLELEELPKDI-RYLVSLRVFE  650

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +T+++ SLQ      L  L+ L++  C   ++  +    +  LR L I +C  L  LP  
Sbjct  651   VTTKQKSLQDSGIGCLVSLRCLIISHCRNLEYLFDDIDQLSVLRSLLIADCPRLISLPPA  710

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg----------lPKLVSLPAGL  2360
             +++L+ LE L    CE L L++   +EG  S Q+               +  L+ LP  L
Sbjct  711   MKYLSSLETLMFGVCESLSLNLSMQLEGEGSHQARNTTRPHLRKLLIAGVTPLLELPQWL  770

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRI  2540
               + A  L+ L +A CP  TALP+ L+N   L+ L I +CP+LS LPE +       +RI
Sbjct  771   LQVSARTLQNLFIANCPNFTALPESLRNFEALEGLVIGNCPKLSSLPEDMLHLKT--LRI  828

Query  2541  IDCPLLNG*C  2570
               CP L+  C
Sbjct  829   KGCPALSDRC  838



>ref|XP_006421375.1| hypothetical protein CICLE_v10004287mg [Citrus clementina]
 gb|ESR34615.1| hypothetical protein CICLE_v10004287mg [Citrus clementina]
Length=867

 Score =   567 bits (1462),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 352/850 (41%), Positives = 520/850 (61%), Gaps = 30/850 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+FL    E +  K+ S A  E+ + + +K + +KL+ TL+T+K+V+ DA+E+Q  +H
Sbjct  1     MVESFLP--LEKLTEKLGSRAFQELLALYCVKNDAEKLKETLTTVKSVVLDAEEKQVHSH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL+KL+D   DA+ +LD+F    L R++     I  K+R  F   + + +RF++  
Sbjct  59    QLRDWLEKLKDACDDAEGVLDEFEVEDLRRQVMKQRSIGRKLRNFFGSSNPVAFRFRMCQ  118

Query  435   KIREIRGRLNQIAEDRRNFHFK-----ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             +I+++R R ++IA     F         ++ +   E    RE THSFV PSDIIGRD D+
Sbjct  119   QIKKVRERFDEIANMMHKFDLTARLDDRSWRIVHEE----RESTHSFVSPSDIIGRDKDR  174

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E ++  LM++   E +E+VS +PIVG+GGLGKT L +LV+ND RV ++F+ ++W+ VSED
Sbjct  175   EKVIEALMQASSGE-SETVSVIPIVGIGGLGKTALAQLVFNDQRVEEHFELKIWICVSED  233

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F   +++ KI++S TG++ G LD++QLQ  L   L   RYLLV+DDVWNED   W  L+ 
Sbjct  234   FGERQIMTKIIKSITGQNHGDLDIEQLQRILRVCLTGKRYLLVMDDVWNEDPKVWDKLKS  293

Query  960   LLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
             LL  G  GS+++VTTRS KVA+I GT   TT YNL GL   DC  LF+KCAF+E+  +  
Sbjct  294   LLSGGAKGSKILVTTRSNKVASIMGTRGGTTGYNLQGLPFEDCLSLFMKCAFKEERDKHP  353

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
             NLV+IG+EIV+KCGG+PLAV+TLGS+LYC TDE +W ++R+NEIWK+EQK  DILP+L+ 
Sbjct  354   NLVKIGEEIVKKCGGIPLAVRTLGSLLYCSTDEHDWEYVRDNEIWKLEQKANDILPVLRF  413

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYDQ+P  L+QC AYCC+FPK  +      +  W+AQG +   + + EL+++G +   +L
Sbjct  414   SYDQLPPRLKQCVAYCCIFPKDYQFSSVYLVQFWMAQGLLHPLNENDELDDIGMRSLKQL  473

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHAD  1670
              SR  F D+V  F  E+   K+H+L+HDLAQ VA  E L V S    IP+ V HL F   
Sbjct  474   CSRSFFHDLVRGF--EMFTFKMHDLIHDLAQLVAKGEFLIVNSDCQSIPKRVRHLSFVGA  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             N SR++F + L +L  +R   +S     VS++FV+  +   + LRVL L    ++ LP  
Sbjct  532   NASRKDFSRFLSDLGRVRTIFFSINDEKVSQSFVRSCISKSQFLRVLNLSGSAIEALPRE  591

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK +RYL+LS N  IK LP  I KL +LQTLNL  C +L+ELP++  + L+SL+   
Sbjct  592   IGNLKHMRYLDLSRNYKIKKLPNAICKLQSLQTLNLEECLELEELPKDI-RYLVSLRVFE  650

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +T+++ SLQ      L  L+ L++  C   ++  +    ++ LR L I  C  L  LP  
Sbjct  651   VTTKQKSLQDSGIGCLVSLRCLIISHCRNLEYLFDDIDQLRVLRSLLIAGCPRLISLPPA  710

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----------glPKLVSLPAGL  2360
             +++L+ LE L    CE L L++   +EG  S Q+               +  L+ LP  L
Sbjct  711   MKYLSSLETLMFVQCESLSLNLSMQLEGEGSHQARNTTRPHLRKLLIGEVTPLLELPQWL  770

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRI  2540
                    L++L +A CP   ALP+ L+N   L+ L I +CP+LS LPE +      ++R 
Sbjct  771   LQGSTGTLQHLFIANCPNFMALPESLRNFEALEGLVIGNCPKLSSLPEDMLHLKTLRIR-  829

Query  2541  IDCPLLNG*C  2570
               CP L+  C
Sbjct  830   -GCPALSDRC  838



>ref|XP_007029648.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
 gb|EOY10150.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
Length=870

 Score =   566 bits (1459),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 361/854 (42%), Positives = 528/854 (62%), Gaps = 30/854 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F  +I+ENVLSK+ ++A  EI  AW ++ +L KL+ TL+TIKAVL DA+E+QA ++
Sbjct  1     MAESFAFNISENVLSKLANIAYQEIRLAWGVQSDLAKLKTTLTTIKAVLLDAEEKQAHDN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WLQ+LRD  YDADD+LD+F   +L +++     I  KV   F+  + L +RFK+ H
Sbjct  61    QLRVWLQELRDACYDADDVLDEFEIEALRKQVVKQRSIGKKVSHFFSSSNPLAFRFKLAH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+++  R  +IA  + NFH  E +   P    +L  +THSFV+ S++IGRD +KE  + 
Sbjct  121   KIKKVTERFVEIAALKNNFHLIERHD-GPGHVVRLDRETHSFVQASEVIGRDEEKERFIK  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             MLM+  D  D E +S LPIV +GGLGKT L KLV+ND RV  +F   +WV VS+DF L +
Sbjct  180   MLMQ--DPADEEDISVLPIVAIGGLGKTALAKLVFNDGRVDGHFGLTMWVCVSDDFDLKR  237

Query  795   VIEKILRSAT--GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             ++ KI+++        G++D++QLQ  L   L   +YLL+LDDVWNED  KW+ L++LL+
Sbjct  238   LVLKIIKAGKEGDGDLGNMDLEQLQRVLRHCLNGKKYLLILDDVWNEDNRKWQELKQLLV  297

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEI  1145
              G +GS+++VTTRS +V  + GT   +NL GL       LFLK AF+  +E R  NLV+I
Sbjct  298   GGANGSKIVVTTRSNQVGKMVGTIPPHNLEGLPYDQSLSLFLKFAFKGGEEKRHPNLVKI  357

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G+EIV+KC GVPL VKTLGS+L+ K  E EW  ++++E+W++ +KE +I  +LKLSYDQ+
Sbjct  358   GEEIVRKCKGVPLVVKTLGSLLFSKFSEGEWNRLKDSEMWELMEKENEIFSVLKLSYDQL  417

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK         +  W+A G I+    +++LE++G QY N+LLSR  
Sbjct  418   PPHLKQCFAYCSLFPKDYGFDEVDTVQFWMAHGLIRPSKKNEDLEDIGRQYLNDLLSRCF  477

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD     D   +A K+H+L+HDLA SVA  EC  +   +  I + V HL    +  S E
Sbjct  478   FQDYEYGLD--FIAFKMHDLLHDLALSVAKNECCTINPSEQNIAQGVRHLCL-TNCDSPE  534

Query  1686  EFPQPLLN-LKNLRYF-AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
             E    LLN +++ R F      +G  +K+F++  L  F+ LRVL  +   L+ LP  IG 
Sbjct  535   EGDFKLLNKVRHWRSFRCTDTNIGPSNKSFIEACLKRFQHLRVLDFKRSNLEVLPKRIGD  594

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL+L+NN +IK LP  I KL NLQTL L  C++L+ELPR+ G  L SL+ L +T+
Sbjct  595   LKHLRYLDLTNNHSIKKLPNSICKLQNLQTLYLDGCDKLEELPRDMG-YLTSLRALTITT  653

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++  L  R    L  L++L +  C   ++  E  +++  L++L I  C +L  LP G+++
Sbjct  654   KQKLL--RGLECLKSLRYLFIQDCKNLEYLFEGIENLTSLQLLGISGCRNLISLPYGLKY  711

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmgl-------------PKLVSLPAGL  2360
             L  L  L I +C +LDL++  G +  E      L+G              PKL +LP  L
Sbjct  712   LTALHTLVIGDCVKLDLNMTLGFKEKEDDNQDYLVGSSLCLLKLVILGPLPKLEALPQWL  771

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRI  2540
                 A  LK L +A C  LT L +W  N T L++L I DCP+LS LPE+++   +  ++ 
Sbjct  772   LQRSANTLKCLFIAECENLTTLSEW-HNLTSLEKLEIMDCPKLSTLPEKMQRLKHLTIQ-  829

Query  2541  IDCPLLNG*CGDTG  2582
              +CP+L+  C   G
Sbjct  830   -ECPVLSERCEPEG  842



>ref|XP_002278041.1| PREDICTED: putative disease resistance protein RGA4 [Vitis vinifera]
Length=849

 Score =   563 bits (1450),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 363/821 (44%), Positives = 508/821 (62%), Gaps = 22/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F   I E+VL K+ S    E+  AW +K EL +L++TLSTI A+L DA+E+QA N 
Sbjct  1     MAESFAFAIAESVLGKLGSTLIQEVGLAWGVKTELGELKDTLSTIHALLLDAEEKQATNL  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             ++ DWL KL+ V+YDA+D+LD+F   +L +++  S S I +KVR   + P  L +R K+ 
Sbjct  61    QISDWLGKLKLVLYDAEDVLDEFDYEALRQQVVASGSSIRSKVRSFISSPKSLAFRLKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+++ +R RL++IA D+  F+         V   + + +THSFVR SDIIGRD DKE+IV
Sbjct  121   HRVKNLRERLDKIAADKSKFNLSVGIANTHVVQRERQRETHSFVRASDIIGRDDDKENIV  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
             G+L +S    DTE+VS +PIVG+GGLGKTTL KLVYND+RVV +F  ++WV VS++F + 
Sbjct  181   GLLKQS---SDTENVSVIPIVGIGGLGKTTLAKLVYNDERVVGHFSIKMWVCVSDEFDVK  237

Query  792   KVIEKILRSATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             K++++IL+   G +++    + QLQ  L   L   ++LLVLDDVWN D+ KW  L++LLM
Sbjct  238   KLVKEILKEIKGDENYSDFSLQQLQSPLRNALAGEKFLLVLDDVWNTDREKWLELKDLLM  297

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVE  1142
              G  GS+++VTTR   VA+I GT     L GLS  DC  LF+KCAF+  E E  P NL++
Sbjct  298   DGAIGSKILVTTRKKAVASIMGTFPMQELRGLSLEDCLSLFVKCAFKDGEDEQHP-NLLK  356

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IG +I++KC GVPLAV++LGS+LY K DE++W+ I+E+ IWK+EQ E  I+  LKLSY  
Sbjct  357   IGDQIIEKCAGVPLAVRSLGSLLYSKRDERDWVSIKESGIWKLEQDENRIMAALKLSYYD  416

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P+HLRQCFA C +F K  E    + I+ W+AQG IQS   +  +E++G  Y NELLSR 
Sbjct  417   LPHHLRQCFALCSVFAKDFEFANVLLISFWMAQGLIQSSGQNARMEDIGESYINELLSRS  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
              FQDV +   G + + K+H+LVHDLA   A  EC+ +     +IPE V H+ F   +   
Sbjct  477   LFQDVKQNVQG-VYSFKMHDLVHDLALFFAQPECVTLHFHSKDIPERVQHVSFSDIDWPE  535

Query  1683  EEFP--QPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
             EEF   + L  L N+R   +    V   S +FV   +L F+ +RVL L     + LP+SI
Sbjct  536   EEFEALRFLEKLNNVRTIDFQIENVAPRSNSFVAACVLRFKCIRVLDLTESSFEVLPNSI  595

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
               LK LR L LS N  IK LP  I KL +LQTL L NC +L+ELP++ G  ++SL+ L+L
Sbjct  596   DSLKHLRSLGLSANKRIKKLPNSICKLYHLQTLILTNCSELEELPKSIG-SMISLRMLFL  654

Query  2034  TSQEVSL--QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             T ++  L  +K+    L  LQ+L L  C   +      +    LR+L IY C SL  L  
Sbjct  655   TMKQRDLFGKKKELRCLNSLQYLRLVNCLNLEVLFRGMESRFALRILVIYNCPSLVSLSR  714

Query  2208  GIRHLAKLEKLWIWNCEELDL-----SVgegmegleslqslllmglPKLVSLPAG-LKDI  2369
              I+ L  LE L I +CE+L+         E ++   SLQ L    LP L +LP   L   
Sbjct  715   SIKFLNALEHLVIDHCEKLEFMDGEAKEQEDIQSFGSLQILQFEDLPLLEALPRWLLHGP  774

Query  2370  DAMKLKYLRVAGCPELTALP-DWLQNCTLLQRLYIEDCPEL  2489
              +  L +L ++ C  L ALP D +Q  T L++L I DCPEL
Sbjct  775   TSNTLHHLMISSCSNLKALPTDGMQKLTSLKKLEIHDCPEL  815



>ref|XP_006421380.1| hypothetical protein CICLE_v10006925mg [Citrus clementina]
 gb|ESR34620.1| hypothetical protein CICLE_v10006925mg [Citrus clementina]
Length=851

 Score =   563 bits (1450),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 348/815 (43%), Positives = 506/815 (62%), Gaps = 28/815 (3%)
 Frame = +3

Query  180   KKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSC  359
             +KL+ TL+T+K+V+ DA+E+Q   H+++DWL+KL+D  YDA+D+LD+F    L R++ + 
Sbjct  18    QKLKETLTTVKSVVLDAEEKQVHIHQLRDWLEKLKDACYDAEDVLDEFEVEDLRRQVMTQ  77

Query  360   SGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKE-----NYYVNPV  524
               I  K+R  F   + + +RF++  +I+++R R ++IA     F         ++ +   
Sbjct  78    RSIGRKLRNFFGSSNPIAFRFRMCQQIKKVRERFDEIANMMHKFDLTARLDDCSWRIVHE  137

Query  525   ENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttl  704
             E    RE THSFVRPSDIIGRD D+E ++  LM++   E +E+VS +PIVG+GGLGKT L
Sbjct  138   E----RESTHSFVRPSDIIGRDKDREKVIEALMQASSGE-SETVSVIPIVGIGGLGKTAL  192

Query  705   vklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVL  884
              +LV+ND RV ++F+ ++W+ VSEDF   +++ KI++S TG++ G LD++QLQ  L   L
Sbjct  193   AQLVFNDQRVEEHFELKIWICVSEDFGERQIMTKIIKSITGQNQGDLDIEQLQRILRVCL  252

Query  885   CSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGT---TTAYNL  1055
                RYLLV+DDVWNED   W  L+ LL  G  GS+++VTTRS KVA+I GT   TT YNL
Sbjct  253   NGKRYLLVMDDVWNEDPKVWDKLKSLLSGGAKGSKILVTTRSNKVASIMGTRGGTTGYNL  312

Query  1056  SGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQE  1235
              GL   DC  LF+KCAF+E+  +  NLV+IG+EIV+KCGG+PLAV+TLGS+LYC TDE +
Sbjct  313   QGLPFEDCLSLFMKCAFKEERDKHSNLVKIGEEIVKKCGGIPLAVRTLGSLLYCSTDEHD  372

Query  1236  WLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWV  1415
             W ++R+NEIWK+EQK  DILP+L+ SYDQ+P  L+QC AYCC+FPK  +      +  W+
Sbjct  373   WEYVRDNEIWKLEQKANDILPVLRFSYDQLPPRLKQCVAYCCIFPKDYQFSSVYLVQFWM  432

Query  1416  AQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAG  1595
             AQG +   + + EL+++G +   +L SR  F D+V  F  E+   K+H+L+HDLAQ VA 
Sbjct  433   AQGLLHPLNENDELDDIGMRSLKQLCSRSFFHDLVRGF--EMFTFKMHDLIHDLAQLVAK  490

Query  1596  AECLNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVK  1775
              E L V S    IP+ V HL F   N SR++F   L +L  +R   +S     VS++FV+
Sbjct  491   GEFLIVNSDCQSIPKRVRHLSFVGANASRKDFSSFLSDLGRVRTIFFSINDEKVSQSFVR  550

Query  1776  KTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLN  1955
               +   + LRVL L    ++ LP  IG LK +RYL+LS N  IK LP  I KL +LQTLN
Sbjct  551   SCISKSQFLRVLNLSGSAIEALPREIGNLKHMRYLDLSRNYKIKKLPNAICKLQSLQTLN  610

Query  1956  LINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAE  2135
             L  C +L+ELP++  + L+SL+   +T+++ SLQ      L  L+ L++  C   ++  +
Sbjct  611   LEECLELEELPKDI-RYLVSLRVFEVTTKQKSLQDSGIGCLVSLRCLIISHCRNLEYLFD  669

Query  2136  IWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqsl  2315
                 +  LR L I +C  L  LP  +++L+ LE L    CE L L++   +EG  S Q+ 
Sbjct  670   DIDQLSVLRSLLIADCPRLISLPPAMKYLSSLETLMFGVCESLSLNLSMQLEGEGSHQAR  729

Query  2316  llmg----------lPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRL  2465
                           +  L+ LP  L  + A  L+ L +A CP  TALP+ L+N   L+ L
Sbjct  730   NTTRPHLRKLLIAGVTPLLELPQWLLQVSARTLQNLFIANCPNFTALPESLRNFEALEGL  789

Query  2466  YIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*C  2570
              I +CP+LS LPE +       +RI  CP L+  C
Sbjct  790   VIGNCPKLSSLPEDMLHLKT--LRIKGCPALSDRC  822



>ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis]
 gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis]
Length=860

 Score =   558 bits (1437),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 367/851 (43%), Positives = 523/851 (61%), Gaps = 25/851 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+ +I E+VL K+ SLA  E+  AW L+ + +KL+  LSTIKAVL DA+++Q KNH
Sbjct  1     MAEIFMYNIAESVLKKLGSLAVQEVILAWGLEADCEKLEEVLSTIKAVLLDAEQKQVKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++DWL KLRDV+  A+D+LDDF   +L R++ +  G  + KVR  F+  + + +R ++ 
Sbjct  61    RIQDWLGKLRDVLCAAEDVLDDFECEALRRQVAANQGSTSRKVRGFFSSSNPVAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++IR R+ +IA  + +F   E  +   VE  + RE THSFV   D+IGR++DKE I+
Sbjct  121   HKIKKIRERIVEIASLKSSFELTEGVHDTSVEI-REREMTHSFVHAEDVIGREADKEIII  179

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L +  +  + ES+S +PIVG+GGLGKT L KLVYND+RV + F+ ++W+ VS+DF++ 
Sbjct  180   EHLTE--NPSNGESLSVIPIVGIGGLGKTALAKLVYNDERVERYFELKMWICVSDDFNIK  237

Query  792   KVIEKILRSAT-----GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             K++EKI++SA      G+++  L++DQLQ  +   +   +Y LVLDDVWN+D+ KW  L+
Sbjct  238   KLMEKIIKSAINSTTFGENYSSLELDQLQRVMREQISEKKYFLVLDDVWNDDRTKWNELK  297

Query  957   ELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRN  1133
             ELL     GS+++VTTRS  VA+I GT  AYNLSGL D  C  LFL+CAF E QE    N
Sbjct  298   ELLRGCAYGSKIMVTTRSKVVASIVGTAPAYNLSGLPDDKCLSLFLRCAFNEGQEKLYPN  357

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             LV+IG EIV+KCGGVPLAV+T+G+ L+ KTDE +W  ++E++IW+++Q   DILP L++S
Sbjct  358   LVKIGSEIVKKCGGVPLAVRTVGTQLFLKTDEADWNLVKESDIWELDQNPNDILPALRIS  417

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELL  1493
             Y Q+P +L+QCFA C +FPK  E      I  W+A G +QSPD  Q  E LG +Y  EL 
Sbjct  418   YQQLPSYLKQCFASCSVFPKDYEFNSLKLIQFWMAHGLLQSPDQVQLPEYLGLKYLKELF  477

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN  1673
             SR  FQD+ +         K+H+LVHDLAQSVA  E L  KSG     + V HL F    
Sbjct  478   SRCFFQDIEDC--SFYFVFKMHDLVHDLAQSVAQRESLIPKSGRHYSCKRVRHLTFFDPE  535

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
             +  ++  +   +L +++    +  +  VSK+  +  +  F+ LRVL L     + LP SI
Sbjct  536   VLSKDPRKLFHDLDHVQ----TILIAGVSKSLAQVCISGFQNLRVLDLAWSTFEVLPRSI  591

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYL+L+NN  I+ LP  I  L +LQTL L  CE+L+ LPRN  + ++SL  L++
Sbjct  592   GTLKHLRYLDLTNNVKIRRLPSSICNLQSLQTLILSGCEELEGLPRNM-KCMISLSFLWI  650

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRK--FPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             T++   L       L  L+ L +  C   +  F   I  ++  LR L +  C +L  LP 
Sbjct  651   TAKLRFLPSNRIGCLQSLRTLGIGGCGNLEHLFDDMIGLNLIALRTLVVGGCRNLIYLPH  710

Query  2208  GIRHLAKLEKLWIWNCEELDL----SVgegmegleslqslllmglPKLVSLPAGLKDIDA  2375
              I++L  LE L I  CE LDL    +V +       L++L L  LP LV+LP  L    A
Sbjct  711   DIKYLTALENLTIATCENLDLLIDGNVVDNEHCGFKLKTLSLHELPLLVALPRWLLQWSA  770

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCP  2552
               L+ + +  C  L  LP+WLQ+   LQ+L I  CP LS LP  + R +S  K+ + DCP
Sbjct  771   CSLESIAIWRCHNLVMLPEWLQDFISLQKLDILGCPGLSSLPIGLHRLTSLRKLTVEDCP  830

Query  2553  LLNG*CG-DTG  2582
              L   C  +TG
Sbjct  831   ALAESCNPETG  841



>ref|XP_002277987.2| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010653782.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=906

 Score =   558 bits (1438),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 367/863 (43%), Positives = 519/863 (60%), Gaps = 50/863 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F  D+   VL KI SLA  E++ AW +  +L  L++TLS I+AV+ DA+EQQ+ + 
Sbjct  33    MAESFAFDLANKVLGKIASLALQEVALAWGVTADLDGLKDTLSVIQAVISDAEEQQSNSR  92

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++ DWL+KL+  +Y+A+D+LDDF   +L RK+     I  +V   F+  + L + FK+  
Sbjct  93    QIADWLRKLKKALYEAEDVLDDFEYEALRRKVAKAGSITKQVHSFFSTSNPLPFSFKMGR  152

Query  435   KIREIRGRLNQIAEDRRNFHFKEN--YYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
             K++ ++ RL++IA DR  F+  E            + RE THS+V  S+IIGR+ DKE+I
Sbjct  153   KMKNLKERLDKIAADRSKFNLTERAVVVDTTHVVHRKREMTHSYVDVSNIIGREQDKENI  212

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS-EDFS  785
             V +LMKS  +E  E+VS +PI+G+GG+GKT L KLVYND RVV++FD R+WV VS ED  
Sbjct  213   VSILMKSSSDEQ-ENVSVIPIIGIGGMGKTALAKLVYNDGRVVKHFDKRMWVCVSDEDNE  271

Query  786   LSKVIEKILRSATGKSFGHLDMDQ---------------LQEHLNGVLCSGRYLLVLDDV  920
             +  + +KIL SAT    G L MDQ               LQ  L   L   RYLLVLDDV
Sbjct  272   IETLTKKILISATMGGTGTLSMDQFQNLRFSLAEFSMDELQTQLRNALDDKRYLLVLDDV  331

Query  921   WNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKC  1100
             WN D+ KW  L+ELLM    GS+++VTTR   VA++ GT  A  L GL D DC  LFLKC
Sbjct  332   WNSDREKWLKLKELLMGSAGGSKIVVTTRKKSVASVLGTFPAQELKGLPDEDCQSLFLKC  391

Query  1101  AFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQ  1277
             AF++ Q  +  NLV+IG +IV+KCGGVPLAV++LG +LY K +E++W  +R+NEIW +E+
Sbjct  392   AFKDGQGKQYPNLVKIGNQIVKKCGGVPLAVRSLGGLLYSKLEERDWELVRDNEIWTLEE  451

Query  1278  KETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQEL  1457
             K+  ILP LKLSYD++P HL+ CF +C MFPK  E+     I LW+A+G IQ    +QEL
Sbjct  452   KDDGILPALKLSYDELPSHLKPCFVFCSMFPKDYELNNVELIQLWMARGLIQPSSHNQEL  511

Query  1458  ENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGD--PE  1631
             E++GNQ   EL SR  FQD VE +   +   K+H+LVHDLA S+   E   V+       
Sbjct  512   EDIGNQCIIELCSRSFFQD-VEDYKVSVF-FKMHDLVHDLALSIKKIESKEVEDASITDN  569

Query  1632  IPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVL  1811
             +PE +  L+   +N+    FP   +N       A +  VGT S          F+ +RVL
Sbjct  570   VPEQILALLQEKNNIRTIWFPYSEIN-------ATAEYVGTCSS--------RFKYMRVL  614

Query  1812  MLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPR  1991
              L+  + +ELPSSIG +K LRYL++  N  +K LP  I KL  L TL+   C +L+ELPR
Sbjct  615   DLRGTDFEELPSSIGNMKHLRYLDICGNKRVKKLPASICKLYLLLTLSFKECTELEELPR  674

Query  1992  NFGQQLMSLKTLYLTSQEVSLQKRSS--VSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRV  2165
             + G   +SL+ L +T+++ +  ++ +    L  L++LL+ +C+  +F  E  Q++  LR 
Sbjct  675   DMG-NFISLRFLAITTKQRAWPRKGNGLACLISLRWLLIAECNHVEFMFEGLQNLTALRS  733

Query  2166  LRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL------SVgegmegleslqslllmg  2327
             L I  C SL  LP  ++HL  LE L I+NCE  +          +       L+SL+++ 
Sbjct  734   LEIRRCPSLVSLPPSVKHLPALETLMIFNCEMFNFMDEDGDEENDIQGISCRLRSLMVVD  793

Query  2328  lPKLVSLPAGL-KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
             LPKL +LP  L + + A  L YL +  C +  ALP+ L+N T LQ L I+DCP+LS L  
Sbjct  794   LPKLEALPGWLIQGLAASTLHYLLIRRCHKFKALPESLENLTSLQELRIDDCPQLSTLSG  853

Query  2505  QIRSSSNAKV-RIIDCPLLNG*C  2570
              +   +  KV  I DCP L+  C
Sbjct  854   GMHRLTTLKVLSIRDCPELSKRC  876



>gb|KDO39460.1| hypothetical protein CISIN_1g038265mg [Citrus sinensis]
Length=883

 Score =   557 bits (1436),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 348/843 (41%), Positives = 509/843 (60%), Gaps = 34/843 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+F     E +L K+ S A +E+     +K +L+KL+ TL+T+K+V+ DA+E+Q  +H
Sbjct  1     MVESFFP--IEKLLEKLGSFAYEELLLFCGVKNDLEKLKETLTTVKSVVLDAEEKQVHSH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL+KL+D  YDA+D LD+F    L R++     I  K+R  F   + + + F++ H
Sbjct  59    QLRDWLEKLKDACYDAEDALDEFEVEDLRRQVIKQRSIGRKLRNFFGSSNPIAFCFRMGH  118

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             ++++IR R ++IA     F+       +     + RE THSFVR SDIIGR  D E I+ 
Sbjct  119   QLKKIRERFDEIANMMGKFNLTLRLDDHRRVVHEEREPTHSFVRTSDIIGRYEDGEKIIE  178

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM++ D E +E+VS +PIVG+GGLGKT L KLVYND +               DF   +
Sbjct  179   LLMQTSDGE-SETVSVIPIVGIGGLGKTALAKLVYNDQK---------------DFGKRQ  222

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++ KI+ S  G + G+LD D++Q+ L   L   RYLLV+DDVWNED   W  L+ LL+ G
Sbjct  223   IMTKIINSVIGGNHGNLDPDRMQKVLRDSLNGKRYLLVMDDVWNEDPRAWGELKSLLLGG  282

Query  975   CDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
              +GS+++VTTRS KVA I GT   TT YNL  L   DC  LF+KCAF+E + +  NLV+I
Sbjct  283   AEGSKILVTTRSNKVALIMGTMRGTTGYNLQELPYKDCLSLFMKCAFKEGKEKHPNLVKI  342

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G++I++KC G+PLAV+T+GS+LY  TDE +W H+R+N+IWK+ Q   DILP L+LSYDQ+
Sbjct  343   GEKIMEKCRGIPLAVRTVGSLLYGSTDEHDWEHVRDNDIWKLRQAPDDILPALRLSYDQL  402

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK  +      +  W+AQG +QSP+ ++ELE +G +YF EL SR  
Sbjct  403   PPHLKQCFAYCSIFPKDYKFASVHLVQFWMAQGLLQSPNENEELEKIGMRYFKELCSRSF  462

Query  1506  FQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
             FQD+ +   G E+  C+IH+L+HDLA  VA  ECL V S    IP+SV HL F + N  R
Sbjct  463   FQDLGDLLPGLEVFNCQIHDLMHDLALLVAKGECLMVNSAGQSIPKSVRHLSFVSANALR  522

Query  1683  EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
              +F   L +L  +R           S++FV   +   + LRVL+L N  ++ LP  +G L
Sbjct  523   NDFASFLPDLGRVRTIMLPIDDERTSQSFVTSCISKSKSLRVLVLMNSAIEVLPRKMGNL  582

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQ  2042
             +QLR+L+LS N  IK LP  I +L +LQTLNL +C +L+ELP++  + L+SL+   +T++
Sbjct  583   RQLRHLDLSGNRKIKKLPNSICELQSLQTLNLGDCLELEELPKDI-RYLVSLRMFVVTTK  641

Query  2043  EVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             + SL +     L  L+FL++  C   ++  E    +  LR L I  C  L  LP  +++L
Sbjct  642   QKSLLESGIGCLSSLRFLMISDCGNLEYLFEDIDQLSVLRSLVINSCPRLISLPPAMKYL  701

Query  2223  AKLEKLWIWNCEELDLSVgegme----------gleslqslllmglPKLVSLPAGLKDID  2372
             + LE L +  CE LDL++   ME              L++L +  L +L+ LP  L    
Sbjct  702   SSLETLILLKCESLDLNLNMEMEEEGSHHDCNNVRSHLRTLCVAELTQLLELPQWLLQGS  761

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DC  2549
             +  L+ L +  CP   ALP  L++   L+ L I  CP+LS LPE +   +  K   I +C
Sbjct  762   SKTLQMLTIGDCPNFMALPRSLKDLEALENLLITSCPKLSSLPEGMHHLTTLKTLAIEEC  821

Query  2550  PLL  2558
             P L
Sbjct  822   PAL  824



>ref|XP_007029651.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
 gb|EOY10153.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
Length=870

 Score =   554 bits (1427),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 356/874 (41%), Positives = 520/874 (59%), Gaps = 78/874 (9%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+F  +I ENVLSK+ ++A  EI  AW ++ +L+KL+ TL+TIKAVL DA+E+QA ++
Sbjct  1     MVESFAFNIAENVLSKLANIAYQEIRLAWGVQSDLEKLKTTLTTIKAVLLDAEEKQAHDN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WLQ+LRD  YDADD+LD+F   +L +++     +  KV   F+  + L +RFK+ H
Sbjct  61    QLRVWLQELRDACYDADDVLDEFEIEALRKQVVKQRSVGKKVSHFFSSSNPLAFRFKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+++     +IA  + NFH  E +   P    +L  +THSFV+ S++IGRD +KE I+ 
Sbjct  121   KIKKVTESFVEIAALKNNFHLIERHD-GPGHVVRLDRETHSFVQASEVIGRDEEKERIIK  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             MLM+  D  D E +S LPIVG+GGLGKT L KLV+ND RV  +F  ++WV VS+DF L +
Sbjct  180   MLMQ--DPADEEDISVLPIVGIGGLGKTALAKLVFNDGRVDMHFGLKMWVCVSDDFDLKR  237

Query  795   VIEKILRSAT--GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             ++ KI+++        G++D++QLQ+ L   L   +YLL+LDDVW+ED  KW+ L++LL+
Sbjct  238   LVLKIIKAGKEGDGDLGNMDLEQLQKVLRDCLKGNKYLLILDDVWSEDNRKWQELKQLLV  297

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEI  1145
              G +GS+++VTTRS +V    GT   + L GL       LFLK AF+  E +   NLV+I
Sbjct  298   GGANGSKIVVTTRSNQVGKTVGTIPPHKLEGLPYDQSLSLFLKFAFKGGEEKQHPNLVKI  357

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G+EIV+KC GVPL VKTLGS+L+ K  E EW  ++++E W++ +KE +I  +LKLSYDQ+
Sbjct  358   GEEIVKKCKGVPLVVKTLGSLLFSKISEHEWKLVKDSETWELMEKENEIFSVLKLSYDQL  417

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK         +  W+A G IQ+   +++LE++G QY N+LLSR  
Sbjct  418   PPHLKQCFAYCSLFPKDYGFNEFDTVQFWMAHGLIQTSKNNEDLEDIGRQYLNDLLSRCF  477

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSR  1682
             FQD     D   +  K+H+L+HDLA SVA  EC  + +    I + V HL   + D+   
Sbjct  478   FQDYEYGLD--FIEFKMHDLLHDLALSVAKNECCTINASKQNIVQGVRHLCLTNCDSPGE  535

Query  1683  EEFPQPLLN-LKNLRYF-AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
              +F   LLN +++ R F      +G  +K+F++  L  F+ LRVL L+   L+ LP  IG
Sbjct  536   SDFK--LLNKVRHWRSFRCADTNIGPTNKSFIEACLKRFQHLRVLDLEGSNLEVLPKRIG  593

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRYL+LSNN NIK LP  I KL NLQTL L  C++L+ELPR+ G  L+SL+   LT
Sbjct  594   DLKHLRYLDLSNNHNIKKLPNSICKLQNLQTLYLDGCDKLEELPRDMGY-LISLRAWTLT  652

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             + +  L  R    L  L++L +  C   ++  E  +++  L++L IY C +L  LP G++
Sbjct  653   TNQKLL--RGLECLKSLRYLCIRDCKNLEYLFEGIENLTSLQLLGIYGCRNLISLPNGLK  710

Query  2217  HLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLR  2396
             +L  L  L I +C +LDL+                           GLK+ +     YL 
Sbjct  711   YLTALHTLIIGDCAKLDLNTT------------------------VGLKEKEDDNQDYLV  746

Query  2397  VAGC-----------PELTALPDWL-------------------------QNCTLLQRLY  2468
              +G            P+L ALP WL                         +N TLL++L 
Sbjct  747   GSGLCLQTLGIVGPLPKLEALPQWLLQGSANTLKHLTIGGCENLTTSPEWKNLTLLEKLE  806

Query  2469  IEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*C  2570
             I DCP+LS LPE+++     K+ I DCP+L+  C
Sbjct  807   IMDCPKLSTLPEKMQRLK--KLWIKDCPVLSERC  838



>ref|XP_002277526.2| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=1146

 Score =   559 bits (1441),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 352/813 (43%), Positives = 504/813 (62%), Gaps = 22/813 (3%)
 Frame = +3

Query  102   TENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKL  281
             TE VL K+ S    E+  AW +K EL++L++TLSTI A+L DA+E+QA N ++ DWL KL
Sbjct  305   TEGVLGKLGSALIQEVGLAWGVKTELEELKDTLSTIHALLLDAEEKQATNRQISDWLGKL  364

Query  282   RdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             + V+YDA+D+LD+F   +L +++  S S I +KVR   +    L +R K+ H+++ IR R
Sbjct  365   KLVLYDAEDVLDEFDYEALRQQVVASGSSITSKVRSFISSSKSLAFRLKMGHRVKSIRER  424

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDE  638
             L++IA D+  F+  E      V   + + +THSFVR SD+IGRD DKE+IVG+L +S D 
Sbjct  425   LDKIAADKSKFNLTEGIANTRVVQRERQRETHSFVRASDVIGRDDDKENIVGLLRQSSD-  483

Query  639   EDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRS  818
               TE+VS +PIVG+GGLGKTTL KLVYND+RVV +F  ++WVSVS++F + K++++IL+ 
Sbjct  484   --TENVSVIPIVGIGGLGKTTLAKLVYNDERVVGHFSIKMWVSVSDEFDVKKLVKEILKE  541

Query  819   ATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVI  995
               G +++    + QLQ  L   L   ++LLVLDDVWN D+ KW  L++LLM G  GS+++
Sbjct  542   IKGDENYSDFSLQQLQSPLRNALDGEKFLLVLDDVWNTDREKWLELKDLLMDGASGSKIL  601

Query  996   VTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEIGKEIVQKC  1169
             VTTR   VA+I GT     L GLS  DC  LF+KCAF+  E E  P NL++IG++I++KC
Sbjct  602   VTTRKKAVASIMGTFPMQELRGLSLEDCLSLFVKCAFKDGEDEQHP-NLLKIGEQIIEKC  660

Query  1170  GGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCF  1349
              GVPLAV++LGS+L+ K DE++W+ I+E+EIWK+EQ E  I+  LKLSY  +P+H RQCF
Sbjct  661   AGVPLAVRSLGSLLHLKRDERDWVSIKESEIWKLEQDENRIMAALKLSYYDLPHHFRQCF  720

Query  1350  AYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAF  1529
             A C +FPK  E    + I++W+AQG IQS   + ++E++G  Y NELLSR  FQDV +  
Sbjct  721   ALCSIFPKDFEFDNRLLISIWMAQGLIQSSGQNAKMEDIGENYINELLSRSLFQDVKQNV  780

Query  1530  DGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFP--QPL  1703
              G I A K+H+LVHDLA   A  E + +     +I + V H+ F  ++  +EEF   + L
Sbjct  781   PGVIYAFKMHDLVHDLAIFFAQPEYVTLNFHSKDISKRVQHVAFSDNDWPKEEFEALRFL  840

Query  1704  LNLKNLRYFAYSF-RVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYL  1880
               L N+R   +    V   S +FV   +L F+ +RVL L     + LP SI  LK LR+L
Sbjct  841   EKLNNVRTIDFQMDNVAPRSNSFVMACVLRFKCMRVLDLTESSFEVLPDSIDSLKHLRFL  900

Query  1881  NLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQK  2060
             NLS N  IK LP  I KL +LQTL L  C +L+E PR  G  ++SL+ L +T ++  L +
Sbjct  901   NLSKNERIKKLPNSICKLYHLQTLMLGECSELEEFPRGIG-SMISLRMLIITMKQKDLSR  959

Query  2061  RSS--VSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLE  2234
             +      L  LQ+L    C   +F  +  + +  LR+L I  C SL  L   I+ L  LE
Sbjct  960   KEKRLRCLNSLQYLQFVDCLNLEFLFKGMKSLIALRILSISNCPSLVSLSHSIKLLIALE  1019

Query  2235  KLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAG-------LKDIDAMKLKYL  2393
              L I +CE+++   GE     E +QS   + L + ++LP         L    +  L +L
Sbjct  1020  VLAIRDCEKIEFMDGEVERQEEDIQSFGSLKLLRFINLPKFEALPKWLLHGPTSNTLYHL  1079

Query  2394  RVAGCPELTALP-DWLQNCTLLQRLYIEDCPEL  2489
             ++  CP     P D LQ  T L++L I+DCPEL
Sbjct  1080  QIWNCPNFKGFPNDGLQKLTSLKKLEIKDCPEL  1112


 Score =   218 bits (554),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 172/239 (72%), Gaps = 6/239 (3%)
 Frame = +3

Query  537   LREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklv  716
             ++ +THSFVR SD+IGRD DKE+IVG+L +S D   TE+VS +PIVG+GGLGKTTL KLV
Sbjct  1     MQRETHSFVRASDVIGRDDDKENIVGLLRQSSD---TENVSVIPIVGIGGLGKTTLAKLV  57

Query  717   YNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGR  896
             YND+RVV +F  ++WVSVS++F + K++ +IL+   G       + QLQ  L   L   +
Sbjct  58    YNDERVVGHFSIKIWVSVSDEFDVKKLVREILKEIKGDENYSDFLQQLQSPLRNALDGEK  117

Query  897   YLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHD  1076
             +LLVLDDVWN D+ KW  L++LLM G +GS+++VTTR   VA+I GT     L GLS  D
Sbjct  118   FLLVLDDVWNTDREKWLELKDLLMDGANGSKILVTTRKKAVASIMGTFPMQELRGLSLED  177

Query  1077  CFDLFLKCAFR--EQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHI  1247
             C  L++KCAF+  E E  P NL++IG +I++KC GVPLAV++LGS+LY K DE++ + +
Sbjct  178   CLSLYVKCAFKDGEDEQHP-NLLKIGDQIIEKCAGVPLAVRSLGSLLYLKRDERDCVSV  235



>ref|XP_006490005.1| PREDICTED: putative disease resistance protein RGA1-like [Citrus 
sinensis]
 gb|KDO37514.1| hypothetical protein CISIN_1g036168mg [Citrus sinensis]
Length=846

 Score =   546 bits (1406),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 345/822 (42%), Positives = 505/822 (61%), Gaps = 20/822 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+FL    E ++ K+ S A +E+S  + +K + +KL+ TL+T+K V+ DA+E+Q  NH
Sbjct  1     MVESFLP--LEKLMEKLGSRAFEELSLFYCVKNDAEKLKETLTTVKCVVLDAEEKQVHNH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL+KL+D  YDA+DLLDDF   +L R++     I   +R  F   + + +R ++ H
Sbjct  59    QLRDWLEKLKDACYDAEDLLDDFEVEALRRQVMKQRSIGRNLRNFFGSSNPIAFRCRMGH  118

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR R ++IA     F+             + RE +HSFV PS+IIGRD D+E I+ 
Sbjct  119   QIKKIRERFDEIANMMHKFNLTPGLDDRRRRAVQEREPSHSFVLPSEIIGRDEDREKIIE  178

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM++ D E +E+VS +PIVGLGGLGKT L KLVYND  V ++F  ++W+ VSEDF   +
Sbjct  179   LLMQTNDGE-SETVSVIPIVGLGGLGKTALAKLVYNDQSVQEHFKLKIWICVSEDFEQRQ  237

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++ KI++S TG++ G LD DQL+  L   L    YLLV+DDVWNED   W  L+ LL+  
Sbjct  238   IMTKIIKSITGQNPGDLDTDQLRRILRDRLNGEIYLLVMDDVWNEDPKVWDELKSLLLGS  297

Query  975   CDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
               GS+++VTTRS KVA+I GT   T  Y L GL    C  LF+KCAF+E +++  NLV+I
Sbjct  298   AKGSKILVTTRSNKVASIMGTMRGTAGYKLEGLPYESCLSLFMKCAFKEGQHKHPNLVKI  357

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G+EIV+KCGG+PLAV+TLGS+LY  TDE  W ++R+NEIWK+EQK+ DILP L+LSYDQ+
Sbjct  358   GEEIVKKCGGIPLAVRTLGSLLYGSTDEHYWEYVRDNEIWKLEQKKNDILPALRLSYDQL  417

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK  +    + I  W+A G +QSP+ ++E EN+G +Y NELLSR  
Sbjct  418   PPHLKQCFAYCSIFPKDYDFTSVLLIRFWMAHGLLQSPNENEEPENIGVRYLNELLSRSF  477

Query  1506  FQDVVEAF--DG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
             FQD       +G EI   K+H+L+HDLAQ VA  E L + S    IP+ V HL F   N 
Sbjct  478   FQDFTNGMLPEGFEIFFFKMHDLMHDLAQLVAKGEFLILGSDCQSIPKRVRHLSFVGANT  537

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             S  +F   L + +  R   +       +++ +   +   + LRV+ L +  ++ L   IG
Sbjct  538   SINDFSSLLSDSRRARTILFPINDEKTNQSILTSCISKSQFLRVIDLSDSAIEVLSREIG  597

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRYL+LS +  IK LP  I +L +LQT+ L  C +L+ELP++  + L++L+   ++
Sbjct  598   NLKHLRYLDLSGHDKIKKLPNSICELHSLQTVCLGGCRELEELPKDI-RYLVNLRMFVVS  656

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +++ SL +     L  L+FL++  C   ++  +    +  LR + I +C  L  LP  ++
Sbjct  657   TKQKSLLESGIGCLSSLRFLMISDCENLEYLFDDIDQLCVLRTIFIADCPRLISLPPAVK  716

Query  2217  HLAKLEKLWIWNCEELDLSVgegmeglesl----------qslllmglPKLVSLPAGLKD  2366
             +L+ LE L + +CE L L++   MEG ES           + L + GLP L+ LP  L  
Sbjct  717   YLSSLETLMLEDCESLTLNLKIEMEGEESHCDRNKTRLHLRKLFVEGLPPLLELPQWLLQ  776

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
                  LK L +  CP   ALP+ L+N   L+ L I  CP LS
Sbjct  777   GSTKTLKTLIIRNCPNFMALPESLRNLEALETLAIGGCPALS  818



>ref|XP_007029652.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY10154.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=870

 Score =   541 bits (1394),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 356/863 (41%), Positives = 528/863 (61%), Gaps = 35/863 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F  +I ENVLSK+ ++A  EI  A  ++ +L KL+ TL+TIKAVL DA+E+QA ++
Sbjct  1     MAESFAFNIAENVLSKLANIAYQEIRLARGVQSDLVKLKTTLTTIKAVLLDAEEKQAHDN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WLQ+LRD  YDA+D+LD+F   +L +++     I  +V   F+  + L +RF++ H
Sbjct  61    QLRVWLQELRDACYDAEDVLDEFEIEALRKQVVKQRSIGKQVSHFFSSSNPLAFRFRMAH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++++  R  +IA  + NFH  E +   P    +L  +THSFV+ S++IGRD +KE I+ 
Sbjct  121   KVKKVTERFVEIAALKNNFHLIERHD-GPGHVVRLDRETHSFVQASEVIGRDEEKERIIK  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             MLM+  D  D E +S LPIVG+GGLGKT L KLV+ND R+ ++F  ++WV VS+DF L +
Sbjct  180   MLMQ--DPADEEDISVLPIVGIGGLGKTALAKLVFNDGRIDRHFGLKMWVCVSDDFDLKR  237

Query  795   VIEKILRSAT--GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             ++ KI+++        G++D++QLQ+ L   L   +YLL+LDDVW+ED  KW+ L++LL+
Sbjct  238   LVLKIIKAGKEGDGDLGNMDLEQLQKVLRDCLKGNKYLLILDDVWSEDNRKWQELKQLLV  297

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF-REQEYRPRNLVEI  1145
              G  GS+++VTTRS +V  I GT    NL GL       LFLK AF R +E +  NLV+I
Sbjct  298   GGASGSKIVVTTRSNQVTKIVGTIPPQNLEGLPYDQSLSLFLKFAFKRGEEKQHPNLVKI  357

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G++IV+KC GVPL VKTLGS+L+ K  E EW  ++++E+W++ +KE +I  +LKLSYDQ+
Sbjct  358   GEDIVKKCKGVPLVVKTLGSLLFSKISEHEWRLVKDSEMWELMEKENEIFSVLKLSYDQL  417

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFA+C ++PK         I  W+A G +QS   +++ E++G QY N L SR  
Sbjct  418   PPHLKQCFAHCSVYPKDYAFVEFELIQFWMAHGLLQSSKKNEDPEDIGRQYLNHLSSRCF  477

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSR  1682
             FQD  +   G ++  K+H+L+HDLA SVA  EC  + S +  IP+ V H+   + D+L  
Sbjct  478   FQDYQDK--GFLIEFKMHDLLHDLALSVAKNECSTLNSFEQNIPQGVRHVYLDNCDSLEE  535

Query  1683  EEFPQPLLN-LKNLRYFAY-SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             + F   LLN   ++R F       G  +K+F++  L  F+ LRVL L    L+ LP  IG
Sbjct  536   KAF--ELLNKAGHVRTFMLPDVDTGPGNKSFMETCLKRFQHLRVLELSRSNLEILPKGIG  593

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LR+L L +N NIK LP  I KL NLQTL    C +++ELPR   + L++L+ L LT
Sbjct  594   NLKHLRFLYLCDNPNIKKLPNSICKLQNLQTLLFAGCYKIEELPREM-RYLINLRFLSLT  652

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +++  L  R    L  L+ L +  C   ++  E  Q++  L+ L I  C +LT LP G++
Sbjct  653   TKQRDL--RGLEHLKSLRTLCIINCKNLEYLFEGIQNLTSLQTLCISRCRNLTSLPHGLK  710

Query  2217  HLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl-------------PKLVSLPAG  2357
             +L  L+ L I  C +LDL++  G EG E      L+               P L +LP  
Sbjct  711   YLTALQTLSIRVCVKLDLNMTMGFEGKEEDNQDYLVDSGLCLQRLGITGPLPNLEALPQW  770

Query  2358  LKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVR  2537
             L    A  LK L +  C  LT  P+W +  T L+RL+I  CP+LS LPE+++     ++ 
Sbjct  771   LLQGSANTLKQLDIERCENLTTTPEW-KTLTSLERLWIFKCPKLSTLPEKMQRLK--RLS  827

Query  2538  IIDCPLLNG*CG-DTGTRLSWSS  2603
             II+CP+L+  C  +TG    W S
Sbjct  828   IIECPILSERCKPETGE--DWPS  848



>ref|XP_003634282.2| PREDICTED: putative disease resistance protein RGA3, partial 
[Vitis vinifera]
Length=702

 Score =   528 bits (1360),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 315/712 (44%), Positives = 462/712 (65%), Gaps = 20/712 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F   I E+VL K+ S    E+  AW +K EL +L++TLSTI A+L DA+E+QA N 
Sbjct  1     MAESFAFAIAESVLGKLGSTLIQEVGLAWGVKTELGELKDTLSTIHALLLDAEEKQATNL  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             ++ DWL KL+ V+YDA+D+LD+F   +L +++  S S I +KVR   + P+ L +R K+ 
Sbjct  61    QISDWLGKLKLVLYDAEDVLDEFDYEALRQQVVASGSSIRSKVRSFISSPNSLAFRLKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+++ IR RL++IA D+  F+  E      V    ++ +THSFVR SD+IGRD DKE+IV
Sbjct  121   HRVKNIRERLDKIAADKSKFNLSEGIANTRV----VQRETHSFVRASDVIGRDDDKENIV  176

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
             G+L +S D   TE++S +PIVG+GGLGKT+LVKLVYND+RVV +F  ++WV VS++F + 
Sbjct  177   GLLKQSSD---TENISVIPIVGIGGLGKTSLVKLVYNDERVVGHFSIKMWVCVSDEFDVK  233

Query  792   KVIEKILRSATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             K++++IL+   G +++    + QLQ  L   L   ++LLVLDDVWN D+ KW  L++LLM
Sbjct  234   KLVKEILKEIKGDENYSDFSLQQLQSPLRNALDGEKFLLVLDDVWNTDREKWLELKDLLM  293

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEI  1145
              G  GS+++VTTR   +A+I GT     + GLS  DC  LF+KCAF + +E R   L++I
Sbjct  294   DGAKGSKILVTTRKKSIASIMGTFPMQEIKGLSHEDCLSLFVKCAFMDGEEKRYPTLLKI  353

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G +IV+KC GVPLAV++LGS+LY K DE +W+ IR++EIW++EQ E  I+  L+LSY  +
Sbjct  354   GDQIVEKCAGVPLAVRSLGSLLYSKRDEWDWVSIRDSEIWELEQNEDGIMAALRLSYYDL  413

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             PYHL+QCFA C +FPK  E    V I+ W+A+G I S   + ++E++G +Y NELLSR  
Sbjct  414   PYHLKQCFALCSLFPKDYEFSNVVLISTWMAEGLIHSSGQNAKMEDIGERYINELLSRSF  473

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQDV +   G +   K+H+LVHDLA   A  ECL +     +IP+ V H  F      +E
Sbjct  474   FQDVEQLILGVLYTFKMHDLVHDLAMFFAQPECLILNFHSKDIPKRVQHAAFSDTEWPKE  533

Query  1686  E-----FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             E     F + L N+  + YF     V   S++FVK  +L F+ +R+L LQ+   + LP S
Sbjct  534   ECKALKFLEKLNNVHTI-YFQMK-NVAPRSESFVKACILRFKCIRILDLQDSNFEALPKS  591

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LR+L+LS N  IK LP  I KL +LQ L+L  C +L+ELPR  G  ++SL+ + 
Sbjct  592   IGSLKHLRFLDLSGNKRIKKLPNSICKLYHLQALSLSRCSELEELPRGIG-SMISLRMVS  650

Query  2031  LTSQEVSL--QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYE  2180
             +T ++  L  +++   SL  LQ L +  C   +F ++  + + +LR+L I +
Sbjct  651   ITMKQRDLFGKEKGLRSLNSLQRLEIVDCLNLEFLSKGMESLIELRMLVITD  702



>ref|XP_009374159.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=839

 Score =   530 bits (1366),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 356/849 (42%), Positives = 506/849 (60%), Gaps = 59/849 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++ S+A + I  AW ++ +L+KL  T+STI+ VL DA+E+QA+N  ++ WL++
Sbjct  8     LASKLIGRLSSIASEAICLAWGVQADLQKLGRTMSTIRDVLLDAEEKQARNSGLRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + + +R ++ H+I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVRRSGTTRKVRRFFSRSNPVAFRLRVGHEIKDIRER  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQ---THSFVRPSDIIGRDSDKESIVGMLMKS  629
             L+Q+ +D+ NF      + +P     +RE    THSFVR S++IGR+++K  IV +LM  
Sbjct  128   LHQLKDDK-NFADLRTVHHHPHLGDHVRENMNTTHSFVRASEVIGRETEKNKIVDLLMIQ  186

Query  630   CDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
              D+    D  +VS +PIVGLGGLGKTTL + VYND RVV +FD R+W  VS +F L+++ 
Sbjct  187   GDDHQGGDNGNVSVIPIVGLGGLGKTTLAQSVYNDQRVVGSFDLRMWQHVSVNFDLTRLT  246

Query  801   EKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             ++IL SA G      L +DQLQ  L   L   ++LLVLDDVWN D+ KW  LR+LL+ G 
Sbjct  247   KEILGSALGTQISEGLSLDQLQAQLRDALKDKKFLLVLDDVWNADRIKWSELRDLLVDGA  306

Query  978   D-GSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
               GS+++VTTR+I VA+I GT  T  NL GLS  DC  LF+KCAF+E QE +  +L E+G
Sbjct  307   KIGSKILVTTRNISVASIMGTVGTCINLEGLSFEDCMKLFVKCAFKEGQERQHPSLYEMG  366

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIE-QKETDILPILKLSYDQM  1325
             K+IV+KCGGVPLAVKTLGS LY KTDE+ W  I+++EIW++E   +  ILP L+LSY Q+
Sbjct  367   KDIVRKCGGVPLAVKTLGSQLYSKTDERRWKLIKDSEIWELEPDGDGHILPALRLSYTQL  426

Query  1326  PYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSR  1499
             P HL+ C A C + PK   E      I  W+A G ++S + GD ELE++G  YF EL  R
Sbjct  427   PSHLKLCLASCSILPKDNFEFDTMALIYHWMAHGILESREHGDMELEDVGELYFKELWDR  486

Query  1500  FCFQ-----DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVF  1661
               FQ     D+   FD       +H+L+HDL QSVA  E L V S G   + E+V HL F
Sbjct  487   SFFQNVKDCDISYTFD-------MHDLIHDLVQSVAQGESLTVDSAGTKGVSENVRHLTF  539

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
                    +     L  L  +R  +       + ++F+   +  F+ LRVL L +   + L
Sbjct  540   LEVG---QNVSTTLQKLNKVRTLSVE-NCENIDQSFLSTCISRFKYLRVLSLNDSPCELL  595

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             PSSIG LK LR LNL  N  I +LP  I KL +LQTL L  C  L+ELPR+  ++L+SL+
Sbjct  596   PSSIGSLKHLRSLNLDGNERITALPNSICKLQSLQTLGLCGCGNLEELPRDM-RKLISLR  654

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L +T+++ S                        FP      +  LR L I ECS+LTCL
Sbjct  655   CLVITTKQSS------------------------FPENGVGCLTSLRSLYIVECSNLTCL  690

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             P    +LA L  L I +CE+LDL +         LQ L +  +P++V+LP   +      
Sbjct  691   PRDTSYLASLRTLIIGDCEQLDLVMENYQVIPLRLQKLGIGVVPRMVALPEWFQGA-TNT  749

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPLL  2558
             L+ L +  C  L ALP WL + T L+ L +E CP+L  LP ++ R ++  +V+I+DCP L
Sbjct  750   LQVLTIGDCENLEALPGWLTSFTSLKWLILESCPKLLSLPNEMHRLTALTEVKIVDCPDL  809

Query  2559  NG*CG-DTG  2582
                C  DTG
Sbjct  810   ERRCQRDTG  818



>ref|XP_006489979.1| PREDICTED: putative disease resistance protein RGA1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006489980.1| PREDICTED: putative disease resistance protein RGA1-like isoform 
X2 [Citrus sinensis]
Length=755

 Score =   524 bits (1350),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 327/744 (44%), Positives = 465/744 (63%), Gaps = 17/744 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+F     E +L K+ S A +E+     +K +L KL+  L+T+K+V+ DA+E+Q  N 
Sbjct  1     MVESFFP--IEKLLEKLGSSAYEELLLFCGVKNDLHKLKEKLTTVKSVVLDAEEKQNHNR  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              + DWL KL+D  YDA+D+LD+F      R++     I  K R  F   + + +RF++ H
Sbjct  59    RLSDWLGKLKDACYDAEDVLDEFEVEDQRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMGH  118

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR R ++IA+    F+  E    +     K RE T S V P DIIGRD D+E I+ 
Sbjct  119   QIKKIRERFDEIAKLSGEFNLIERLDDHRRVVHKEREVTQSLV-PLDIIGRDKDREKIIE  177

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM++ D + +E+VS +PIVG+GGLGKT + +LVYND RV ++F+ R+W+ V EDF   +
Sbjct  178   LLMQTSDGK-SETVSVVPIVGIGGLGKTVVAQLVYNDQRVKEHFELRIWIRVFEDFGTRQ  236

Query  795   VIEKILRS-----ATGKSF-GHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             ++ KI+ S      T   F G L+   LQ  L   L   RYLLV+DDVWNED   W+ L+
Sbjct  237   IMRKIMESIIVQIMTNYVFQGDLNTHGLQRILRDRLNGKRYLLVMDDVWNEDPEAWRKLK  296

Query  957   ELLMSGCDGSRVIVTTRSIKVATITG---TTTAYNLSGLSDHDCFDLFLKCAFREQEYRP  1127
              LL+ G +GS+++VTTRS KVA+I G    TT YNL GL   DC  LF+KCAF E+  + 
Sbjct  297   SLLLGGANGSKILVTTRSRKVASIMGRRGGTTGYNLQGLPFEDCLSLFMKCAFEEERDKH  356

Query  1128  RNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              NLV+IG+EIV+KCGG+PLAV+TLGS+LYC TDE +W ++R+NEIW++E KE  ILP L+
Sbjct  357   PNLVKIGEEIVKKCGGIPLAVRTLGSLLYCLTDEHDWEYVRDNEIWQLEPKERGILPALR  416

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSYDQ+P  L+QC AYC +FPKG +   +  +  W+A G +QS +  +ELE++G +Y  E
Sbjct  417   LSYDQLPPPLKQCVAYCSIFPKGYQFYGDSLVQFWMAHGLLQSHNKKEELEDIGMRYLKE  476

Query  1488  LLSRFCFQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             LLSRF FQD+     G E  + K+H+L+HDLAQ VA  E L V S    IP+SV HL F 
Sbjct  477   LLSRFFFQDLSFGMLGMETFSFKMHDLMHDLAQQVAKDEFLVVNSDCQSIPKSVRHLSFA  536

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
             A N SR  F   L +L  +R   +S       S++FV+  +   + LRVL L    ++  
Sbjct  537   A-NASRNNFSSLLSDLGRVRTIFFSTDDDEKTSQSFVESCISKSQFLRVLDLSGSAIEVC  595

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P  +G LK  RYL+LS N  IK LP+ I +L +LQTLNL  C +L+ELP++  + L++L+
Sbjct  596   PREMGNLKHTRYLDLSKNYKIKKLPKSICELQSLQTLNLAGCLELEELPKDI-RYLVNLR  654

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L LT+++ SLQ+    SLG L+ L +  C   +   E    +  LR L I  C  L  L
Sbjct  655   LLALTTKQKSLQESGIRSLGSLRCLSISSCWNLEHLFEEIDQLSVLRTLSIESCPRLISL  714

Query  2202  PAGIRHLAKLEKLWIWNCEELDLS  2273
             P  I++L+ LE L++ +CE LDL+
Sbjct  715   PPAIKYLSSLENLYLASCESLDLN  738



>ref|XP_006372558.1| hypothetical protein POPTR_0017s02790g [Populus trichocarpa]
 gb|ERP50355.1| hypothetical protein POPTR_0017s02790g [Populus trichocarpa]
Length=875

 Score =   526 bits (1356),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 350/877 (40%), Positives = 516/877 (59%), Gaps = 74/877 (8%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  +++I   +  ++  L Q +I  A  ++ +LKKL+NTLSTI +VL  A+E+  KN 
Sbjct  1     MAEAVISNIVGTITKELAPLIQQQIELACGVEEQLKKLKNTLSTINSVLHAAEEEHDKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+DWL KL++ VYDADD++D++ T ++ R++     ++ KV    +  + +++RF++  
Sbjct  61    EVRDWLGKLKEAVYDADDVIDEYQTDNVQRQVLVYRSLIKKVCNFCSLSNPILFRFQLGQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL----REQTHSFVRPSDIIGRDSDKE  602
             K+++IR  +++IAEDR  FHF     V    +GK     REQT S V  S++IGR+ DKE
Sbjct  121   KLKKIRENMDEIAEDRSKFHFT----VQSGRDGKAVPLKREQTGSVV-SSEVIGREVDKE  175

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTR-LWVSVSED  779
             +I+ +L+ S    + E+V+ +PIVG+GGLGKTTL +LV+NDDRV  +F  R +W+ VS+D
Sbjct  176   AIIKLLLSS---NEKENVTIIPIVGMGGLGKTTLAQLVFNDDRVASHFGYRKIWMCVSDD  232

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F + ++ ++I      + +GHLD D LQ  L   + + +YLLVLDDVWNED+ KW  L++
Sbjct  233   FHVRQISQRIAEKLDHRKYGHLDFDLLQIILKQQMSTSKYLLVLDDVWNEDRVKWFRLKD  292

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTT--AYNLSGLSDHDCFDLFLKCAFREQEYRPRN  1133
             LLM+G  GS+V+VTTR   +A++  T T   YNLSGL    C DLFL   F   + RP+N
Sbjct  293   LLMNGARGSKVLVTTRGRMIASMMATDTRYVYNLSGLPYDKCLDLFLSWTFDRIQDRPQN  352

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             LV IGK+IV+KCGG+PLA +TLG  LY +  E EWL ++ +EIW++ QKE D+LP+L+L+
Sbjct  353   LVAIGKDIVRKCGGLPLAARTLGCFLY-RKGEDEWLLVKNSEIWELAQKEDDVLPVLRLT  411

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELL  1493
             YDQMP +L+ CFA+C +FPK   I +E  I++W+AQGF+QS DG   +E +G++Y NELL
Sbjct  412   YDQMPQYLKPCFAFCSLFPKDHSIDKETLIHMWMAQGFLQSSDG-SPIEKIGHRYVNELL  470

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIP-ESVHHLVFHAD  1670
             S    +D  +  D E   CK+H+L+HDLA+ VAG EC ++ +  P+IP + V H+     
Sbjct  471   SMSLLEDEHKYPDDEARHCKMHDLIHDLARLVAGTEC-SIITAHPKIPSKKVRHVSVFGS  529

Query  1671  NLS-------REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
              L        ++   + L N K LR   Y   V   +KT +   L N + LR+L+L   E
Sbjct  530   GLPENSSSKVKDSISEFLCNAKKLRTLYYHLLVEQ-NKTVI-NLLANLKYLRILILTESE  587

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
                LPSSIG L  LRYL+LS N +I+ LP  I KL NLQ L L +C+QL+ELP+    ++
Sbjct  588   FDGLPSSIGTLLHLRYLDLSKNYHIRRLPHSICKLQNLQKLKLYSCKQLEELPKG-TWKI  646

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
              +L+ L +TS++  L  +    L  L+ L ++ C          QH+  L+ L + +C +
Sbjct  647   ATLRHLEITSKQEFLPNKGIECLTSLRSLSIHNCYRLSTLVRGMQHLTALQKLCLIDCPN  706

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPA-----  2354
             LT L   +  L  LE L I NC  LDLS    ++  E         LP L+++       
Sbjct  707   LTSLEFSLNSLISLESLEIRNCSGLDLS--GQLKKKEEDSLEGRWRLPSLLNIVGLNYKK  764

Query  2355  --------------GLKDIDAM-------------KLKY-------LRVAGCPELTALPD  2432
                           GL+ + ++             +LKY       L ++ C  L++LPD
Sbjct  765   EQIEDEEKKEEGHQGLQKLRSLTFVQLPKLIELPNELKYAASSLQYLSISYCDRLSSLPD  824

Query  2433  WLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII  2543
             WL  C  L+RL IE CP L   P     S N    II
Sbjct  825   WLPRCMALKRLEIERCPILPSPP----GSQNGSYTII  857



>ref|XP_008392220.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=833

 Score =   522 bits (1345),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 354/842 (42%), Positives = 508/842 (60%), Gaps = 54/842 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++ S+A +EI  AW +K +L+KL  T+STIK VL DA E+QA+N +++ WL +
Sbjct  8     LAAKLIERLSSIASEEICLAWGVKADLEKLGRTMSTIKDVLVDAQEKQARNSDLRSWLXQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R +   SG   KVR  F+R + + +R ++ H+I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRLVVHGSGTTRKVRXFFSRSNPVAFRLRVGHEIKDIRER  127

Query  459   LNQIAEDR-----RNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLM  623
             LN++ +D+     R  H   +   +  EN   R  THS+VR S++IGR++DK  IV +LM
Sbjct  128   LNELKDDKNFADLRTVHHHPHLGDHVXEN---RNTTHSYVRXSEVIGRETDKNEIVBLLM  184

Query  624   KSCDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
                D+    D  +VS +PIVGLGG GKTTL + VYND RVV++F+ R+W  VS DF +++
Sbjct  185   IQGDDHQGGDNGNVSVIPIVGLGGXGKTTLAQSVYNDQRVVESFELRMWQHVSVDFDVTR  244

Query  795   VIEKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             + ++IL SA G      L +DQLQ  L   L   ++LL+LDDVWN D+ KW  LR+LL+ 
Sbjct  245   LTKEILGSALGTKINEGLSLDQLQAQLRDALKDKKFLLILDDVWNXDRIKWSGLRDLLVE  304

Query  972   GCD-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVE  1142
             G   G++++VTTR+I VA+I G    Y NL  LS  DC  LF+KCAF E QE +  +L E
Sbjct  305   GAKVGTKILVTTRNISVASIMGPVGTYINLEVLSFEDCXKLFVKCAFDEGQEGQHPSLYE  364

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK-ETDILPILKLSYD  1319
             +GK+IV+KCGGVPLAVKTLGS LY K DE++W  IR++EIW++EQ+ +  ILP LKLSY+
Sbjct  365   MGKDIVRKCGGVPLAVKTLGSQLYSKADERQWKLIRDSEIWELEQEGDGHILPALKLSYN  424

Query  1320  QMPYHLRQCFAYCCMFPKG--EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNEL  1490
             Q+P HL+QC A C + PK   E   REV I+ W+A G ++S D G+ ELE++G  YF EL
Sbjct  425   QLPSHLKQCLACCSILPKNYIEFDSREV-ISHWMAHGILESRDHGNMELEDVGELYFKEL  483

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVFHA  1667
               R  FQ+V +     +    +H+L+HDL QSVA  E   V S G     E+V HL F  
Sbjct  484   WERSFFQNVKDHIIFYVF--DMHDLIHDLVQSVAQGESFVVNSAGTKGXSENVRHLSFLE  541

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
                +     Q L  ++ ++  A S +   + ++F++  +  F+ LRVL L ++  + LPS
Sbjct  542   IGQNVSTTLQKLNKVRTVK--ATSCK--NIDESFLRTCISRFKYLRVLTLMSVSCELLPS  597

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LK LR LNL+ N  I  +P  I KL +LQTLN   C  L+ELPR+   +L+SL+ L
Sbjct  598   SIGSLKHLRSLNLAGNEIITQVPNSICKLQSLQTLNFYGCVNLEELPRDM-SKLISLRYL  656

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
               T+++ S                        FP      +  LR L I++CS+LTCLP 
Sbjct  657   DFTTKQSS------------------------FPENGLGCLTSLRYLGIWDCSNLTCLPR  692

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
                +LA L  L I NCE+LDL +         LQ L + G+P++V+LP   +      L+
Sbjct  693   DAFYLASLRTLIIGNCEQLDLVMVNYQVIPLRLQKLFIRGVPQMVALPEWFQGA-TNTLQ  751

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPLLNG  2564
             +L +  C  L ALP WL + T L+ L +  CP+L  LPE++ R ++  K+RI  CP L  
Sbjct  752   HLVIRYCENLEALPGWLTSFTSLRTLVLRSCPKLLSLPEEMHRLTALTKLRIRKCPDLGR  811

Query  2565  *C  2570
              C
Sbjct  812   RC  813



>ref|XP_009374154.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
 ref|XP_009374155.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
Length=833

 Score =   521 bits (1343),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 357/843 (42%), Positives = 510/843 (60%), Gaps = 49/843 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE    ++   ++ +++S+A +EI  AW +K +L++L  T+STI+ VL DA+E+QA N 
Sbjct  1     MAELAF-ELAAKLIERLISIASEEICLAWGVKADLQRLGRTMSTIRDVLLDAEEKQAHNK  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WLQ+L DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + + +R ++ H
Sbjct  60    QLRSWLQQLNDVFLDAEDLLDEFECEALRRQVVRGSGTTRKVRRFFSRSNPVAFRLRVGH  119

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQ---THSFVRPSDIIGRDSDKES  605
             +I++IR RL+++ +D +NF      + +P     +RE    THSFV  S++IGR+++K  
Sbjct  120   EIKDIRERLHELKDD-KNFADLRTVHHHPHLGDHVRENRNTTHSFVPASEVIGRETEKNK  178

Query  606   IVGMLMKSCDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE  776
             IV +LM   D+    D  ++S +PIVG GGLGKTTL KLVYND++VV +F+ R+W  VS 
Sbjct  179   IVDLLMVQGDDHQGGDNRNMSIIPIVGFGGLGKTTLAKLVYNDEKVVGSFELRMWQYVSV  238

Query  777   DFSLSKVIEKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNL  953
             DF ++++ ++IL SA G      L +DQLQ  L   L    +LLVLDDVWNED+ KW  L
Sbjct  239   DFDVTRLTKEILGSALGTQISEGLSLDQLQAQLRDALKDKNFLLVLDDVWNEDRIKWCQL  298

Query  954   RELLMSGCD-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFRE-QEYR  1124
             R+LL  G   GS+++VTTR+I VA+I GT   Y NL  LS  D   LF+KCAF E QE +
Sbjct  299   RDLLKDGAKIGSKILVTTRNISVASIMGTVGTYINLEVLSFEDSLSLFVKCAFEEGQERQ  358

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPI  1301
               +L E+GK+IV+KCGGVPLAVKTLGS LY KTDE++W  IR++EIW++E++    ILP 
Sbjct  359   HPSLYEMGKDIVRKCGGVPLAVKTLGSQLYSKTDERQWKLIRDSEIWELEREGAGHILPA  418

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSPD-GDQELENLGNQ  1475
             L+LSY+Q+P HL+QC A C + PK   EI   V IN W+A G ++S + GD ELE++G  
Sbjct  419   LRLSYNQLPTHLKQCLACCSILPKNYIEINSRVLINDWMAHGILESREHGDMELEDVGEL  478

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHH  1652
             YF EL  R  FQ+V   +        +H+L+HDL QSVA  + L V S G   I E+V H
Sbjct  479   YFKELWQRSFFQNVKYYY--FFYEFDMHDLIHDLVQSVAQGQSLIVDSAGTKGISENVRH  536

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLEL  1832
             L+F     S +     L  L  +R  A   R   + ++F+   +  F+ LRVL L N   
Sbjct  537   LLFFE---SGQNVSTALQKLNKVRTVAVE-RCENIDESFLSTCISRFKYLRVLRLFNSPC  592

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
             + LP+SIG LK LR L+L+ N  I  +P  I KL +LQTLN   C  L+ELP N  ++L+
Sbjct  593   ELLPTSIGSLKHLRSLDLAGNEIITQVPNSICKLQSLQTLNFYKCVNLEELPGNM-RKLI  651

Query  2013  SLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSL  2192
             SL+ L LT+++ S                        FP      +  LR L I++CS+L
Sbjct  652   SLRWLELTTKQSS------------------------FPENGVGCLTSLRYLSIWKCSNL  687

Query  2193  TCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDID  2372
             TCLP     LA L  L I NCE+LDL +         LQ L + G+P++  LP   +   
Sbjct  688   TCLPRDTSFLASLCTLIIGNCEQLDLVMENYQVIPLRLQKLWIQGVPRMTILPEWFQGA-  746

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDC  2549
                L+ L +  C  L ALP+WL + T L+ L +  CP+L  LPE++R  ++  +V II+C
Sbjct  747   TNTLQVLFIRDCENLEALPEWLTSFTSLRILGLRSCPKLLSLPEEMRRLTALTQVTIINC  806

Query  2550  PLL  2558
             P L
Sbjct  807   PEL  809



>ref|NP_001175444.1| Os08g0224000 [Oryza sativa Japonica Group]
 dbj|BAH94172.1| Os08g0224000 [Oryza sativa Japonica Group]
Length=845

 Score =   522 bits (1344),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 345/809 (43%), Positives = 480/809 (59%), Gaps = 17/809 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L+    +VL K    A  EI SAWN K E++KL+ +L +I  VL+DA+ +Q+ + 
Sbjct  1     MAEVHLSSFAISVLGKAAFCAASEIKSAWNFKKEVRKLERSLKSICGVLKDAERKQSTSC  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              +K WL+ L+DVVYD DD+LDD  T  L +K+ +  G    V +       L+Y F+++H
Sbjct  61    ALKVWLEDLKDVVYDIDDVLDDVATKDLEQKVHN--GFYAGVSR------QLVYPFELSH  112

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI  +R +L++IA +RR F   E        +   RE THSF+   DI+GRD  K  IV 
Sbjct  113   KITVVRQKLDEIAANRREFALTEEIIDTQFFSSNTRE-THSFINELDIVGRDEAKNKIVE  171

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +++ + D     + S LPIVGLGG+GKT L KLVYND R+ + F+  LW  VS  F L K
Sbjct  172   IILSAAD---AYAFSVLPIVGLGGIGKTALAKLVYNDMRIKKMFEKNLWACVSNVFDLKK  228

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +++ I++S TG+S   L +  LQ  L G L   +YLLVLDD+W+++ + W+ L+ LL SG
Sbjct  229   ILDDIIQSDTGESNKQLSLQTLQNKLRGFLQENKYLLVLDDIWSDNVNDWEQLKNLLSSG  288

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
               GS V+VTTR++ VA++  T   Y +  LS  +C  +F++ AFR++E +   L+EIGK 
Sbjct  289   GRGSVVVVTTRNMNVASVVKTLEPYYVPELSFDECMQVFIRYAFRDEEKKDTLLLEIGKC  348

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KC GVPLA KTLGS+L+ K D +EWL I++  +W IEQ + DILP LKLSYD +P H
Sbjct  349   IVEKCHGVPLAAKTLGSVLFGKQDVKEWLRIKDANLWNIEQNKCDILPALKLSYDALPPH  408

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+ CF+   +FPK   I RE+ I  W+A G +       E+E +G QYFNEL  R  FQD
Sbjct  409   LKACFSCLSVFPKDYVILRELLIMFWMALGLLHKTREGDEIETIGGQYFNELDQRSLFQD  468

Query  1515  VVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE-EF  1691
                 ++G I +CK+H+LVH+LA  V   E   V     ++ E V HLV+   + S E EF
Sbjct  469   HYVIYNGSIQSCKMHDLVHNLAMFVCHKEHAIVNCESKDLSEKVRHLVWDRKDFSTEIEF  528

Query  1692  PQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
             P+ L      R FA     GT++K F+   L  F  LRVL+  +++  ELPSSIG LK L
Sbjct  529   PKHLRKANKARTFASIDNNGTMTKAFLDNFLSTFTLLRVLIFSDVDFDELPSSIGNLKHL  588

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             RYL+L  N  IK LP  + KLVNLQTL L  C+QL+++P++   +L+SL+ L LT +   
Sbjct  589   RYLDLQWNGKIKFLPNSLCKLVNLQTLQLSRCDQLEKMPKDV-HRLISLRFLCLTLKNKY  647

Query  2052  LQKRSSV-SLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
             L +     SL  L FL L  C+        +  +  LR L I+ C  L  LP+ +  L+ 
Sbjct  648   LSEHDGFCSLTSLTFLFLNSCAELSSLTNGFGSLTSLRKLYIFNCPKLATLPSTMNQLST  707

Query  2229  LEKLWIWNCEELD-LSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             L+ L I NC ELD L   E M GL  L  L L+GLPKLV  P       A  L+Y  +  
Sbjct  708   LQTLSINNCHELDLLEPSEAMGGLACLDVLQLVGLPKLVCFPGSFISA-ATSLQYFGIGN  766

Query  2406  CPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             C  L  LPD++Q+ T L+++ I  CPELS
Sbjct  767   CNGLMKLPDFIQSFTSLKKIVINGCPELS  795



>ref|XP_008366914.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=811

 Score =   520 bits (1340),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 350/850 (41%), Positives = 517/850 (61%), Gaps = 65/850 (8%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE    ++   V  K+ SLA DEI  AW +K +L+KL +T+STI+ VL DA+E+QA N 
Sbjct  1     MAELAF-ELAVRVTEKLGSLAYDEICLAWGVKSDLRKLADTMSTIEGVLLDAEEKQANNK  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             +++ WL+++++V  DA+D+LD+F    L +++     G   KVR  F+  + + +RF++ 
Sbjct  60    QLRSWLRQVKNVFLDAEDVLDEFDCEXLQKQVVEKFHGTCGKVRLFFSPSNPIAFRFRVA  119

Query  432   HKIREIRGRLNQIAEDRRNFH--------FKENYYVNPVENGKLREQTHSFVRPSDIIGR  587
             H+I+E+R RL ++  +R  F         + +++  N     K RE THSFVR SD++GR
Sbjct  120   HEIKELRERLEELKANRSIFDSLTSHSKGYHDDHDSNLKHMIKARE-THSFVRASDVVGR  178

Query  588   DSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVS  767
               +KE +V  L++  D+     VS +P+VG+GGLGKTTL KLVYND RV++NF+  +W  
Sbjct  179   RFEKEELVDRLIEQGDDH----VSVIPVVGIGGLGKTTLAKLVYNDTRVIKNFELMIWQY  234

Query  768   VSEDFSLSKVIEKILRSATGKSF-GHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             VSEDF ++++ ++IL S  G +  G L M+QLQE L   L   ++LLVLDDVWNED +KW
Sbjct  235   VSEDFDVARLTKEILGSVLGTNISGELSMNQLQEKLRDALKDKKFLLVLDDVWNEDAYKW  294

Query  945   KNLRELLMSGCD-GSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFREQE  1118
               L++LL+ G   GS+V+VTTR++ VA+I GT  T  NL  LS  DC  LF+KCAF+E E
Sbjct  295   DALKDLLVEGAKLGSKVLVTTRNVTVASIMGTVPTNINLQTLSGEDCMSLFVKCAFKEGE  354

Query  1119  YRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD--  1289
              R   NL+EIGK+IV+KCGGVPLAVK L   L  KTDE+EW  IR++ IW++E+ E +  
Sbjct  355   EREHPNLLEIGKDIVRKCGGVPLAVKILXCQLLSKTDEREWXMIRDSAIWELEELEREGV  414

Query  1290  --ILPILKLSYDQMPYHLRQCFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQEL  1457
               +LP L+LSY ++P HLR+C AYC + P+   +    + I  W+A G ++S D G+ EL
Sbjct  415   AHVLPALRLSYTRLPPHLRRCLAYCSLLPRTYXKXDSRLLIXXWMANGILESHDHGNLEL  474

Query  1458  ENLGNQYFNELLSRFCFQDVVEAFDGEILACK--IHNLVHDLAQSVAGAECLNVK-SGDP  1628
             E++G  YF EL  R  FQ+V E F    L CK  +H+L+HDL +SVA  EC  V   G  
Sbjct  475   EDVGELYFKELWERSFFQNV-EDFS---LXCKFDMHDLIHDLVRSVAQDECXAVDFEGTK  530

Query  1629  EIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRV  1808
             EI E+V HL   +     +  P  L     LR       +  ++++F++     F+ LR+
Sbjct  531   EISENVRHLSVWS---PAQNVPSILDKRNRLRSITL-MAIEDINESFLQTCFSRFKYLRM  586

Query  1809  LMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELP  1988
             L+L +   +  PSSI  LK++RYL LS N +I  LP+ + KL +L+ LN++ C  L+ELP
Sbjct  587   LVLFDSTFEAFPSSIASLKRMRYLQLSGNASITKLPDAVCKLQSLEILNVLGCVNLEELP  646

Query  1989  RNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVL  2168
             R+  + L+SL++L +T+++ S                        FP  +   MK LR L
Sbjct  647   RDISK-LISLRSLEVTTKQTS------------------------FPDNVVGCMKSLRYL  681

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSL  2348
              I +C +LT LP  + +L  L  L IW+C++LDL+ G        L+SLL+ G+P++V+L
Sbjct  682   SIGDCGNLTSLPRDMSYLDALHTLIIWDCKQLDLANGNYQLIQLRLRSLLIAGVPRVVAL  741

Query  2349  PAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNA  2528
             P  L+   A  L+ L + GC  L ALP+WL + T L+ L++  CP+L  LPE +      
Sbjct  742   PEWLQGA-ANTLRVLCIWGCENLDALPEWLTSFTSLRILHLRRCPKLVSLPEGMHP---L  797

Query  2529  KVRIIDCPLL  2558
             +V+I DCP L
Sbjct  798   EVKIADCPQL  807



>ref|XP_007028725.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007028726.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY09227.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY09228.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
Length=870

 Score =   522 bits (1344),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 345/851 (41%), Positives = 509/851 (60%), Gaps = 31/851 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSL-------AQDEISSAWNLKPELKKLQNTLSTIKAVLRDAD  233
             MAE+    I E +L K+++L       A  EI  AW +K +L+KL+ TLST+KAVL DA+
Sbjct  1     MAESLAFTIGEQLLEKLLNLPEKLGTAAYQEICLAWGIKSDLEKLKGTLSTVKAVLLDAE  60

Query  234   EQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLI  413
             E+Q  NHE+++WL KL++  YDA+D+LD+F   +L R++     +  KV   F+R + + 
Sbjct  61    EKQTHNHELREWLAKLKNAYYDAEDVLDEFEVEALRRQVLKQRSLGRKVCHFFSRSNPVA  120

Query  414   YRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSF--VRPSD----  575
               F++ HKI+ IR R ++IA  +  FH  E        +G   E + S   +R SD    
Sbjct  121   SAFRMGHKIKSIRERFDEIAALKVKFHLVER-------DGPDHEDSRSLLQMRESDSSLE  173

Query  576   --IIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFD  749
               ++GR+ DKE I+ MLM   D    E++  LPIVG+ GLGKT L KLV+ND+R+ ++F 
Sbjct  174   PNVVGRNEDKEKIIEMLMHPTDG-IGEAIPVLPIVGIAGLGKTVLAKLVFNDERIDKHFR  232

Query  750   TRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNE  929
              ++WV VSEDF   +++ K ++SATG++   +  +QL + L   L   RYLL+LDDVWNE
Sbjct  233   LKIWVCVSEDFDFKQLMMKTIKSATGENCSDMTKEQLYKVLRRCLGGKRYLLILDDVWNE  292

Query  930   DQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR  1109
             +   W + + LLM   +GS++IVTTRS +VA ITGT   YNL  L   +   LFL+ AF+
Sbjct  293   EIRDWID-QALLMDRVNGSKIIVTTRSNRVAAITGTLPQYNLKDLPYEESLSLFLQHAFK  351

Query  1110  E-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
             +  E +P NLV+IG+EIV+KC G+PLAVKTL S L  +T E EW  +R+NEIW++EQ+  
Sbjct  352   KGNEKQPLNLVKIGEEIVKKCKGIPLAVKTLASQLCFETAEDEWKRVRDNEIWELEQEGK  411

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
              I P L+LSYD++P HL++CFAYC +F K   I     ++ WVA G ++S   ++ LE +
Sbjct  412   GIFPALRLSYDRLPPHLKRCFAYCSVFTKDYVISNIQMVSFWVALGLLKSSKENEGLEAV  471

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
             G +Y  EL +R  FQ+  E     ++  K+H+L+HD AQ +A  EC  VKS   ++ ++V
Sbjct  472   GKRYLRELWARSLFQEFQET--PFLIRFKMHDLLHDFAQRLAKDECSVVKSCSQDLSQTV  529

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
              HL     +L  +  P+ L     ++   +       S +F+++ +    RLRVL L   
Sbjct  530   RHLSIVNPHLLHQGAPRFLDKAGRVQTLFFPNMEKFNSVSFIEECVSRCSRLRVLDLSVS  589

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
               + LP +IG  K LRYLNLS+N +IK LP  ISKL +LQTL L  C  ++ELPR   + 
Sbjct  590   SFEILPRNIGKWKHLRYLNLSDNISIKRLPNSISKLQSLQTLFLAGCTAIEELPRGI-RY  648

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECS  2186
             ++SL+ L++T+++  L +     L  LQFL   +C   ++  +  Q++  LR + I  C 
Sbjct  649   MISLRMLFITTKQRVLPENEIGCLKSLQFLSFSECDNLEYLFQGMQNLTSLRTMLILLCP  708

Query  2187  SLTCLPAGIRHLAKLEKLWIWNCEE--LDLSVgegmegleslqslllmglPKLVSLPAGL  2360
             SL  LP GI++L  L+ L IW CE+  LD+ +    +   SLQSL +  LPKLV+LP  L
Sbjct  709   SLVSLPHGIKYLTALQGLVIWGCEKLSLDMELEFEGKQDGSLQSLAIGELPKLVALPKWL  768

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNA-KVR  2537
                    L+ L + GC  LTALPDW Q+   LQ L I  CP+LS LP+ ++  +   ++ 
Sbjct  769   LLGSTKTLQQLIIMGCENLTALPDWFQDVAALQLLKIAGCPKLSSLPDGMQHLTFLNQLA  828

Query  2538  IIDCPLLNG*C  2570
             I  CP L+  C
Sbjct  829   IQACPTLSKRC  839



>ref|XP_007203026.1| hypothetical protein PRUPE_ppa018734mg [Prunus persica]
 gb|EMJ04225.1| hypothetical protein PRUPE_ppa018734mg [Prunus persica]
Length=835

 Score =   520 bits (1339),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 349/839 (42%), Positives = 509/839 (61%), Gaps = 48/839 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S A D+I  AW +K +LKKLQ T+STIK VL DA+++QA N +++ WL++
Sbjct  8     LATKLIEKLGSFASDQICLAWGVKADLKKLQRTMSTIKDVLLDAEQKQAHNQQIRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+DV  DA+DLLD+F   +L R++  +  G   KVR+ F+R + + +R ++ H+++EIR 
Sbjct  68    LKDVFLDAEDLLDEFECDALRREVVETFHGTTGKVRRFFSRSNPIAFRLRVGHEMKEIRE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQ--THSFVRPSDIIGRDSDKESIVGMLMKS  629
             RL+++  ++  F    +   +            THSFVR S +IGR+S+K+ I+ +LM+ 
Sbjct  128   RLDELKSNKAIFDSLTSIDHHGGGGEHHERVNVTHSFVRASKVIGRESEKKQIINLLMEQ  187

Query  630   CDEEDTES--VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
              D+  + +  VS +PIVG+GGLGKTTL KLVY+D+ VV +F+ R+WVSVS DF ++++I+
Sbjct  188   GDDNQSGNGNVSVIPIVGIGGLGKTTLAKLVYDDEGVVGHFEKRMWVSVSVDFEITRLIK  247

Query  804   KILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-  977
              IL SA+       L +DQLQ  L   L   ++LLVLDDVWNED  KW  LR+LL+ G  
Sbjct  248   MILSSASDTEMSDKLSLDQLQGRLRHALKDKKFLLVLDDVWNEDSIKWSELRDLLIEGAK  307

Query  978   DGSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIGK  1151
              GS+++VTTR+  VA + GT  T+ NL  LS  DC  LF++CAF+E   +   NL E+GK
Sbjct  308   SGSKILVTTRNTWVAEMMGTIPTSINLEFLSFEDCLSLFVECAFKEGRNKDYPNLFEMGK  367

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMP  1328
             +IV+KCGGVPLAVKTLGS LY KTDE+EW  +R++EIW+++Q++   ILP L+LSY ++P
Sbjct  368   DIVRKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWELKQEDAGHILPALRLSYTRLP  427

Query  1329  YHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFI-QSPDG-DQELENLGNQYFNELLSR  1499
             +HLRQC A C    K   E      I  W+A G + QS D  + ELE++G  YF +L  R
Sbjct  428   HHLRQCLACCSHLQKDMIEFSSTYLIRYWMAHGILDQSRDHRNMELEDIGELYFKDLWVR  487

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESVHHLVFHADNL  1676
               FQ+V++  +G      +H+L+HDL QSVA  EC  VKS +  ++ E+V HL F     
Sbjct  488   SFFQNVID--NGMFYRFDMHDLIHDLVQSVAQGECFTVKSANTKDMSENVRHLTFLE---  542

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             + +     L  L  +R    + +   + ++FV      F+ LRVL L    L+ LPSSIG
Sbjct  543   AGQNVSTTLQKLNKVR--TITVQETEIDESFVCTCFSRFKYLRVLELSTCSLQVLPSSIG  600

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRY+NL++N  I  LP  I +L +LQTLNL NCE L+ELPR+   +L+SL +L++T
Sbjct  601   SLKHLRYMNLNSNEAITKLPNAICRLQSLQTLNLCNCENLQELPRDIS-KLISLTSLWIT  659

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +++ S  +                  C          +K LR L I  C +LT LP    
Sbjct  660   TKQTSFTENG--------------VGC----------LKSLRFLSIPSCCNLTSLPREKS  695

Query  2217  HLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLR  2396
             +L  L  L I NCE+LDL           LQ L ++ LP++V+LP   +   A  L+ L 
Sbjct  696   YLTSLRTLLIRNCEQLDLGNVNYQGTPLRLQKLGIINLPRMVALPEWFQGA-ANTLQVLV  754

Query  2397  VAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DCPLLNG*C  2570
             +  C  L ALP+WL + T L +L I++C +LS LPE +RS ++ +  +I DCP L   C
Sbjct  755   IGMCENLEALPEWLASFTSLTKLIIDECQKLSSLPEGMRSLTSLRELVIDDCPELERRC  813



>ref|XP_007045385.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY01217.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=1192

 Score =   527 bits (1358),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 312/658 (47%), Positives = 444/658 (67%), Gaps = 15/658 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE FL +I + +L K+ +L   E+   W +K EL+KL+NT+STIKAVL DA+EQ AK+H
Sbjct  8     MAEAFLFNIADGILGKLGNLTLQEMGLIWGVKEELEKLKNTVSTIKAVLLDAEEQHAKSH  67

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV DWL KL+D VYDADDLLDDF T  L R++        +V  LF++ + + Y  KI H
Sbjct  68    EVIDWLGKLKDAVYDADDLLDDFSTHVLQRQVMMQGKRGKQVSFLFSKANQVAYNLKIGH  127

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVN-PVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             +I+ IR RL+ IA D+  +HF +   V+ PV   + R+QTHSFVR   ++GR+ DKE+I+
Sbjct  128   QIKAIRQRLDAIAADKTKYHFTDRSLVSIPVVKVE-RKQTHSFVRKEGVVGREGDKEAIM  186

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+   D +  ++VS +PIVG+GG GKTT+ +LVYND+++V++F+ R+WV VS+ F + 
Sbjct  187   KRLL---DSDVADNVSVIPIVGIGGQGKTTVAELVYNDEKIVKHFELRIWVCVSDVFDVK  243

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              + +K+L SAT   F +L+MD LQ HL   +   +YLL+LDDVWN+++ +W+NLR+LLM+
Sbjct  244   LIAQKMLESATNAKFENLEMDSLQTHLRKRIDGRKYLLILDDVWNDNRERWRNLRDLLMN  303

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
             G  GS++IVTTR+  VA+ITGTT  Y L GL +   + L  K AF+E +E     LV IG
Sbjct  304   GARGSKIIVTTRAQVVASITGTTEPYLLEGLPEDMSWSLLEKMAFKEGREPNNSRLVAIG  363

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             K+IV++C G PLA++T+G +LY K  E EWL ++E ++  I QK+ D+LPILKLSY+Q+P
Sbjct  364   KDIVKRCAGNPLAIRTIGGVLYTKDTETEWLSLKEGQLLMITQKD-DVLPILKLSYEQLP  422

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              +L+QCFAYC +FP+  EI +++ I LW+A+GFIQS  G Q LE LG+QYF +LL R  F
Sbjct  423   SYLKQCFAYCSLFPRDYEINKQMLITLWMAEGFIQSLQGMQRLEELGDQYFMDLLRRSFF  482

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QDV     G +++CK+H+L+HDLAQ VAG++   V      I E + H+ F+A+  S  +
Sbjct  483   QDVEYDEWGNVISCKMHDLMHDLAQLVAGSDSSMVDLDCKNISERIRHVSFNAELDSSWK  542

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKK-----TLLNFRRLRVLMLQNLELKELPSSI  1853
              P PLL    +R F     V  V +  + K      + +FR LR+L L N  +  LPSSI
Sbjct  543   IPTPLLKATKIRTFL--LPVQPVHRVILDKVDHETVISSFRLLRLLDLHNTGIDILPSSI  600

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             G LK LRYL+LS N  I+ LP  I++L+NLQTL L +C++L+ELPR   + + SL+ L
Sbjct  601   GTLKHLRYLDLSKNEVIRRLPSSITELLNLQTLKLCSCKRLEELPRKL-RNMTSLRHL  657


 Score = 84.0 bits (206),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 91/184 (49%), Gaps = 32/184 (17%)
 Frame = +3

Query  2124  FPAEIWQHMKKLRVLRIYECSSLTCLP----------------------AGIRHLAKLEK  2237
             FP +   H+  L+ L I  C  L CLP                       G RHL  LE+
Sbjct  994   FPEKGLHHLTSLQHLSIANCPKLVCLPEEGLNSLRFFFISGCDMLKSLSKGFRHLTALEE  1053

Query  2238  LWIWNCEELDLSVgegmegle-----slqslllmglPKLVSLPAGLKDIDAMKLKYLRVA  2402
             L I  C ELDLS       +E     SL++L +  +PKL SLP GL+ +    LKYL+++
Sbjct  1054  LEIKECRELDLSKDVEENVMELRFLRSLRTLKIGDMPKLNSLPDGLQHVTT--LKYLQIS  1111

Query  2403  GCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNA--KVRIIDCPLLNG*CGD  2576
              C  L +LP+W+ N T+LQR  I DCP+L  L +Q   S NA   + I  CPLL   C +
Sbjct  1112  SCSNLKSLPEWICNLTVLQRFEIFDCPQLVSL-QQALCSLNALQYLEISGCPLLMDTCQN  1170

Query  2577  TGTR  2588
               ++
Sbjct  1171  KTSK  1174



>ref|XP_009374150.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=867

 Score =   518 bits (1333),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 355/876 (41%), Positives = 506/876 (58%), Gaps = 85/876 (10%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++ S+A + I  AW ++ +L+KL  T+STI+ VL DA+E+QA+N  ++ WL++
Sbjct  8     LASKLIGRLSSIASEAICLAWGVQADLQKLGRTMSTIRDVLLDAEEKQARNSGLRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + + +  ++ H+I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVRRSGTTRKVRRFFSRSNPVAFCLRVGHEIKDIRER  127

Query  459   LNQIAEDR---------------------------RNFHFKENYYVNPVENGKLREQ---  548
             L+Q+ +D+                           +NF      + +P     +RE    
Sbjct  128   LHQLKDDKNFADLRRLRVGHEIKDIRERLHQLKDDKNFADLRTVHHHPHLGDHVRENMNT  187

Query  549   THSFVRPSDIIGRDSDKESIVGMLMKSCDEE---DTESVSFLPIvglgglgkttlvklvY  719
             THSFVR S++IGR+++K  IV +LM   D+    D  +VS +PIVGLGGLGKTTL + VY
Sbjct  188   THSFVRASEVIGRETEKNKIVDLLMIQGDDHQGGDNGNVSVIPIVGLGGLGKTTLAQSVY  247

Query  720   NDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGH-LDMDQLQEHLNGVLCSGR  896
             ND RVV +FD R+W  VS +F L+++ ++IL SA G      L +DQLQ  L   L   +
Sbjct  248   NDQRVVGSFDLRMWQHVSVNFDLTRLTKEILGSALGTQISEGLSLDQLQAQLRDALKDKK  307

Query  897   YLLVLDDVWNEDQHKWKNLRELLMSGCD-GSRVIVTTRSIKVATITGTT-TAYNLSGLSD  1070
             +LLVLDDVWN D+ KW  LR+LL+ G   GS+++VTTR+I VA+I GT  T  NL GLS 
Sbjct  308   FLLVLDDVWNADRIKWSELRDLLVDGAKIGSKILVTTRNISVASIMGTVGTCINLEGLSF  367

Query  1071  HDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHI  1247
              DC  LF+KCAF+E QE +  +L E+GK+IV+KCGGVPLAVKTLGS LY KTDE+ W  I
Sbjct  368   EDCMKLFVKCAFKEGQERQHPSLYEMGKDIVRKCGGVPLAVKTLGSQLYSKTDERRWKLI  427

Query  1248  RENEIWKIE-QKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQ  1421
             +++EIW++E   +  ILP L+LSY Q+P HL+ C A C + PK   E      I  W+A 
Sbjct  428   KDSEIWELEPDGDGHILPALRLSYTQLPSHLKLCLASCSILPKDNFEFDTMALIYHWMAH  487

Query  1422  GFIQSPD-GDQELENLGNQYFNELLSRFCFQ-----DVVEAFDGEILACKIHNLVHDLAQ  1583
             G ++S + GD ELE++G  YF EL  R  FQ     D+   FD       +H+L+HDL Q
Sbjct  488   GILESREHGDMELEDVGELYFKELWDRSFFQNVKDCDISYTFD-------MHDLIHDLVQ  540

Query  1584  SVAGAECLNVKS-GDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVS  1760
             SVA  E L V S G   + E+V HL F       +     L  L  +R  +       + 
Sbjct  541   SVAQGESLTVDSAGTKGVSENVRHLTFLEVG---QNVSTTLQKLNKVRTLSVE-NCENID  596

Query  1761  KTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVN  1940
             ++F+   +  F+ LRVL L +   + LPSSIG LK LR LNL  N  I +LP  I KL +
Sbjct  597   QSFLSTCISRFKYLRVLSLNDSPCELLPSSIGSLKHLRSLNLDGNERITALPNSICKLQS  656

Query  1941  LQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCR  2120
             LQTL L  C  L+ELPR+  ++L+SL+ L +T+++ S                       
Sbjct  657   LQTLGLCGCGNLEELPRDM-RKLISLRCLVITTKQSS-----------------------  692

Query  2121  KFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegle  2300
              FP      +  LR L I ECS+LTCLP    +LA L  L I +CE+LDL +        
Sbjct  693   -FPENGVGCLTSLRSLYIVECSNLTCLPRDTSYLASLRTLIIGDCEQLDLVMENYQVIPL  751

Query  2301  slqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDC  2480
              LQ L +  +P++V+LP   +      L+ L +  C  L ALP WL + T L+ L +E C
Sbjct  752   RLQKLGIGVVPRMVALPEWFQGA-TNTLQVLTIGDCENLEALPGWLTSFTSLKWLILESC  810

Query  2481  PELSYLPEQI-RSSSNAKVRIIDCPLLNG*CG-DTG  2582
             P+L  LP ++ R ++  +V+I+DCP L   C  DTG
Sbjct  811   PKLLSLPNEMHRLTALTEVKIVDCPDLERRCQRDTG  846



>gb|KDP26031.1| hypothetical protein JCGZ_21064 [Jatropha curcas]
Length=804

 Score =   514 bits (1325),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 330/813 (41%), Positives = 489/813 (60%), Gaps = 26/813 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL +  E+VL K+ +LA  E   AW L+ +LK ++  L TIKAVL DA+E+Q+++ 
Sbjct  1     MAESFLFNTAESVLGKLTALALQEFFLAWGLEDDLKGIKKMLLTIKAVLYDAEERQSQSQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              +K WL  L+DV+YD +D++D+F   +L R++        KVR+ F+  + L +R K+ H
Sbjct  61    RIKLWLGMLKDVLYDTEDVIDEFECEALRRQVVKSGSTTRKVRRFFSTSNPLAFRLKLGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +++ IR R+ +IA  + +F   E    N V + + RE THSFV  +++ GR+ D E I+ 
Sbjct  121   ELKNIRKRVAEIASLKSDFGLNERINDNYVIH-REREMTHSFVDAANVTGRNQDAEFIIK  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              L+ + + ++   VS +PIVG+GG+GKTTL +LVYND RVV +F+ +LWV VS++F L  
Sbjct  180   NLLSAAENDN---VSIIPIVGIGGMGKTTLAQLVYNDPRVVTHFELKLWVCVSDNFHLQT  236

Query  795   VIEKILRS-ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             VI KIL   +TG+ +  LD++QLQ  L   L   RYLLVLDD+WNED+ KW +L+ LLM 
Sbjct  237   VIIKILNCVSTGQRYVGLDIEQLQRALREALQRKRYLLVLDDIWNEDRKKWVDLKTLLMV  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGK  1151
             G +GS +I TTRS  VA I GT  +Y L  L + DC  LF +CAF E + +  NL+  G+
Sbjct  297   GANGSTIIATTRSNDVAKIMGTVASYALGRLPEPDCLSLFFRCAFGEVQNQNPNLIHYGE  356

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV KC GVPLAV TLG++LY  TDE  W  + ++EIWK++QK+ DI+P LKLSY+ MP 
Sbjct  357   QIVSKCKGVPLAVITLGTLLYSVTDESAWKFVMDSEIWKLKQKDNDIMPALKLSYELMPA  416

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L++CFAYC +FPK         +  W++ G +QS + ++ELEN+G +YF EL SR CF 
Sbjct  417   YLKRCFAYCSIFPKDYVFDDLELVYFWMSHGLVQSSNENEELENVGLRYFQELCSR-CFF  475

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
                + + G +  CK+H+L+HDLA SV   ECL   +           L    D    ++ 
Sbjct  476   QEFDIYYGTV-RCKMHDLIHDLALSVTQIECLKAAN---------LILYIKIDEQRCQDL  525

Query  1692  PQPLLNLKNLRYFAY--SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
             P PL +L ++R  ++      G  S+ F++  +  F+ LR L L    +  LP  I  LK
Sbjct  526   PTPLQDLHSVRTVSFLNERSRGVASEIFIETCISKFQYLRALDLDFSRVAVLPKRIAKLK  585

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQE  2045
              L+Y +L  N  I+ LPE I KL +LQTL L +C  L+ELP++  + L+SL+ L++T+++
Sbjct  586   HLKYFSLCGNLLIERLPESICKLQSLQTLLLGDCYSLRELPKDI-KYLISLRWLWITTRQ  644

Query  2046  VSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLA  2225
               L       L  L++L +  C   ++     Q +KKL+ L I  C SL  LP  ++ LA
Sbjct  645   RYLPNGGIGCLWSLRYLFITGCKNLEYLFGDIQGLKKLQTLVILHCDSLVSLPPSVKFLA  704

Query  2226  KLEKLWIWNCEELDLSVgegmegleslqslllm------glPKLVSLPAGLKDIDAMKLK  2387
              L+ L + +CE LDL + EG++  +S   L  +      GLPKLV  P  L  I    LK
Sbjct  705   ALKTLVVADCENLDLIMEEGIDSQDSTSQLFSVCKLEIEGLPKLVDFPQWLLHISNTGLK  764

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPE  2486
              ++V  C      P+++ N   L+ L I DCP+
Sbjct  765   VIKVGRCNNFRNFPNYMHNIPSLE-LSITDCPQ  796



>gb|EEE68252.1| hypothetical protein OsJ_26458 [Oryza sativa Japonica Group]
Length=1148

 Score =   524 bits (1350),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 345/813 (42%), Positives = 482/813 (59%), Gaps = 17/813 (2%)
 Frame = +3

Query  63    PRASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
              + +MAE  L+    +VL K    A  EI SAWN K E++KL+ +L +I  VL+DA+ +Q
Sbjct  300   AKQNMAEVHLSSFAISVLGKAAFCAASEIKSAWNFKKEVRKLERSLKSICGVLKDAERKQ  359

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRF  422
             + +  +K WL+ L+DVVYD DD+LDD  T  L +K+ +  G    V +       L+Y F
Sbjct  360   STSCALKVWLEDLKDVVYDIDDVLDDVATKDLEQKVHN--GFYAGVSR------QLVYPF  411

Query  423   KITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
             +++HKI  +R +L++IA +RR F   E        +   RE THSF+   DI+GRD  K 
Sbjct  412   ELSHKITVVRQKLDEIAANRREFALTEEIIDTQFFSSNTRE-THSFINELDIVGRDEAKN  470

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              IV +++ + D     + S LPIVGLGG+GKT L KLVYND R+ + F+  LW  VS  F
Sbjct  471   KIVEIILSAAD---AYAFSVLPIVGLGGIGKTALAKLVYNDMRIKKMFEKNLWACVSNVF  527

Query  783   SLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              L K+++ I++S TG+S   L +  LQ  L G L   +YLLVLDD+W+++ + W+ L+ L
Sbjct  528   DLKKILDDIIQSDTGESNKQLSLQTLQNKLRGFLQENKYLLVLDDIWSDNVNDWEQLKNL  587

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVE  1142
             L SG  GS V+VTTR++ VA++  T   Y +  LS  +C  +F++ AFR++E +   L+E
Sbjct  588   LSSGGRGSVVVVTTRNMNVASVVKTLEPYYVPELSFDECMQVFIRYAFRDEEKKDTLLLE  647

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IGK IV+KC GVPLA KTLGS+L+ K D +EWL I++  +W IEQ + DILP LKLSYD 
Sbjct  648   IGKCIVEKCHGVPLAAKTLGSVLFGKQDVKEWLRIKDANLWNIEQNKCDILPALKLSYDA  707

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P HL+ CF+   +FPK   I RE+ I  W+A G +       E+E +G QYFNEL  R 
Sbjct  708   LPPHLKACFSCLSVFPKDYVILRELLIMFWMALGLLHKTREGDEIETIGGQYFNELDQRS  767

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
              FQD    ++G I +CK+H+LVH+LA  V   E   V     ++ E V HLV+   + S 
Sbjct  768   LFQDHYVIYNGSIQSCKMHDLVHNLAMFVCHKEHAIVNCESKDLSEKVRHLVWDRKDFST  827

Query  1683  E-EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
             E EFP+ L      R FA     GT++K F+   L  F  LRVL+  +++  ELPSSIG 
Sbjct  828   EIEFPKHLRKANKARTFASIDNNGTMTKAFLDNFLSTFTLLRVLIFSDVDFDELPSSIGN  887

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL+L  N  IK LP  + KLVNLQTL L  C+QL+++P++   +L+SL+ L LT 
Sbjct  888   LKHLRYLDLQWNGKIKFLPNSLCKLVNLQTLQLSRCDQLEKMPKDV-HRLISLRFLCLTL  946

Query  2040  QEVSLQKRSSV-SLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +   L +     SL  L FL L  C+        +  +  LR L I+ C  L  LP+ + 
Sbjct  947   KNKYLSEHDGFCSLTSLTFLFLNSCAELSSLTNGFGSLTSLRKLYIFNCPKLATLPSTMN  1006

Query  2217  HLAKLEKLWIWNCEELD-LSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
              L+ L+ L I NC ELD L   E M GL  L  L L+GLPKLV  P       A  L+Y 
Sbjct  1007  QLSTLQTLSINNCHELDLLEPSEAMGGLACLDVLQLVGLPKLVCFPGSFISA-ATSLQYF  1065

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              +  C  L  LPD++Q+ T L+++ I  CPELS
Sbjct  1066  GIGNCNGLMKLPDFIQSFTSLKKIVINGCPELS  1098


 Score =   182 bits (461),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 189/310 (61%), Gaps = 12/310 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L+    +VL K    A  EI SAWN K E++KL+ +L +I  VL+DA+ +Q+ + 
Sbjct  1     MAEVHLSSFAISVLGKAAFCAASEIKSAWNFKKEVRKLERSLKSICGVLKDAERKQSTSC  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              +K WL+ L+DVVYD DD+LDD  T  L +K+ +  G    V +       L+Y F+++H
Sbjct  61    ALKVWLEDLKDVVYDIDDVLDDVATKDLEQKVHN--GFYAGVSR------QLVYPFELSH  112

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI  +R +L++IA +RR F   E        +   RE THSF+   DI+GRD  K  IV 
Sbjct  113   KITVVRQKLDEIAANRREFALTEEIIDTQFFSSNTRE-THSFINELDIVGRDEAKNKIVE  171

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +++ + D     + S LPIVGLGG+GKT L KLVYND R+ + F+  LW  VS  F L K
Sbjct  172   IILSAAD---AYAFSVLPIVGLGGIGKTALAKLVYNDMRIKKMFEKNLWACVSNVFDLKK  228

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +++ I++S TG+S   L +  LQ  L G L   +YLLVLDD+W+++ + W+ L+ LL SG
Sbjct  229   ILDDIIQSDTGESNKQLSLQTLQNKLRGFLQENKYLLVLDDIWSDNVNDWEQLKNLLSSG  288

Query  975   CDGSRVIVTT  1004
               GS V+VTT
Sbjct  289   GRGSVVVVTT  298



>ref|XP_008351596.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=826

 Score =   514 bits (1325),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 341/832 (41%), Positives = 499/832 (60%), Gaps = 53/832 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++  +A +EI  AW +K +L+KL  T+STIK VL DA+E+QA+N E++ WL +
Sbjct  8     LAAKLIERLSPIASEEICLAWGVKADLQKLXRTMSTIKDVLLDAEEKQARNKELRSWLLQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+D   DA+DLLD+F   +L R++   SG   KVR+ F+R + + +R  +   I++IR R
Sbjct  68    LKDAFLDAEDLLDEFECEALRRQVVRGSGTTRKVRRFFSRSNPVAFRLGVCQGIKDIRER  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDE  638
             L+++ ED+     +  +  + V        THSFVR S++IGR+++K  +V +L++  D 
Sbjct  128   LHELKEDKNFADLRTVHLCDHVRENS--NTTHSFVRASEVIGRETEKNEVVDLLVQGDDH  185

Query  639   EDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRS  818
             +   +VS +PIVG GGLGKTTL KLVYND+RVV  F+ R+W +VS DF ++++ ++IL S
Sbjct  186   QGNRNVSVIPIVGFGGLGKTTLAKLVYNDERVVGCFNLRMWQNVSVDFDITRLAKEILGS  245

Query  819   ATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD-GSRV  992
             A G      L MD LQE L   L   ++LLVLDDVWNED+ KW  LR+LL+ G   G+++
Sbjct  246   ALGTRISEGLSMDHLQEQLRDXLKDKKFLLVLDDVWNEDRIKWTELRDLLIEGAKVGTKI  305

Query  993   IVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFR-EQEYRPRNLVEIGKEIVQK  1166
             +VTTR+I VA+I GT   Y NL  LS  D   LF+KCAF   QE +   L E+GK+IV+K
Sbjct  306   LVTTRNIPVASIMGTVGTYINLDVLSFEDSLSLFVKCAFEGGQERQHPILYEMGKDIVRK  365

Query  1167  CGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPYHLRQ  1343
             CGGVPLAVKTLGS LY KTDE++W  I+++EIW++E++    ILP L+LSY Q+P HL+Q
Sbjct  366   CGGVPLAVKTLGSQLYXKTDERQWKLIKDSEIWELEREGAGHILPALRLSYSQLPSHLKQ  425

Query  1344  CFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSRFCFQDV  1517
             C A C + PK   +      I+ W+A G ++S D G+ +LE++G   F EL  R  FQ+V
Sbjct  426   CLACCSILPKNYTDFDSRELISHWMAHGILESRDHGNMQLEDVGELXFKELWERSFFQNV  485

Query  1518  VE-----AFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVFHADNLS  1679
              +      FD       +H+L+HDL QSVA  E   V S G   + E+V HL F      
Sbjct  486   KDCTFCYTFD-------MHDLIHDLVQSVAQGESFTVDSEGTIGLSENVRHLTFLEIG--  536

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              +     L  L  +R  + +     + ++F++  +  F+ LRVL L N+  + LPSS+G 
Sbjct  537   -QNVSXXLQKLNKVRTIS-AVSCKNIDESFLRTCISRFKYLRVLRLVNVSWELLPSSVGS  594

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LR L+ ++N  I  LP  I KL +LQTL+L  C  L+ELPR+   +L+SL+ L LT+
Sbjct  595   LKHLRSLDFTDNGGITXLPNSICKLQSLQTLHLGGCVNLEELPRDM-SKLISLRYLELTT  653

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++ S                        FP      +K LR L I+ECS+LTCLP    +
Sbjct  654   KQTS------------------------FPENGVGCLKSLRYLSIWECSNLTCLPCDTSY  689

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             L  L  L I NC++LDL +         LQ L ++G+P++V+LP   +      L+ L +
Sbjct  690   LVSLRTLIIDNCKQLDLVMENYQVIPLRLQKLGIVGVPRMVALPEWFQGA-TNTLQVLVI  748

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCP  2552
             + C  L ALP WL + T L+RL +  CP+L  LPE++ R ++   + IIDCP
Sbjct  749   SDCENLXALPGWLTSFTSLRRLVLGSCPKLLSLPEEMHRLTALTHLVIIDCP  800



>emb|CAN78634.1| hypothetical protein VITISV_013449 [Vitis vinifera]
Length=813

 Score =   513 bits (1321),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 337/825 (41%), Positives = 490/825 (59%), Gaps = 61/825 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I +NV+ KI S+   EI  AW +K EL KL+ TL+TIK+VL DA+E+Q K+ 
Sbjct  1     MAESFLFSIADNVVGKIGSITLHEIGLAWGVKTELTKLEATLTTIKSVLLDAEEKQWKDQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL KL+ V YD +D+LD+F   +L R++ S   + TKV   F+  + L + FK+ H
Sbjct  61    QLRDWLGKLKHVCYDVEDVLDEFQYQALQRQVVSHGSLKTKVLGFFSSSNSLPFSFKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I+E+R RL+ IA DR  F+ +      P+     RE THSFV   D+ GR  DKE ++ 
Sbjct  121   RIKEVRERLDGIAADRAQFNLQTCMERAPL---VYRETTHSFVLDRDVFGRGKDKEKVLE  177

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM S D  D ES+S +PIVGLGGLGKTTL KLVYND  VV +F  R+WV VS DF + K
Sbjct  178   LLMNSSD--DDESISVIPIVGLGGLGKTTLAKLVYNDQWVVGHFKKRIWVCVSNDFDMKK  235

Query  795   VIEKILRSAT-----GKSFG-----HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             VI  I+ S       G   G      L+M+Q Q  L   L +  + LVLDD+WN D+ KW
Sbjct  236   VIIDIINSINTTVEGGSGLGLPNHNDLNMEQSQTLLRRTLGNENFFLVLDDMWNGDRQKW  295

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               LR  LM+G  G++++VTTR   VA+I GT  AY L GL   DC  +FLK AF E QE 
Sbjct  296   IELRTFLMNGAKGNKIVVTTRDNSVASIMGTVPAYILEGLPHVDCLSVFLKWAFNEGQEK  355

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
                NLV+IG +IV+KC GVPLA +TLGS+L+ K ++++WL++R+N+IWK++Q+E DILP 
Sbjct  356   XHPNLVKIGDDIVKKCNGVPLAARTLGSLLFSKFEQRDWLYVRDNDIWKLKQEEGDILPA  415

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             L+LSY+Q+P +L+ CFAYC +FPK      E  +++W AQG I++    QEL+++GN+Y 
Sbjct  416   LRLSYEQLPSYLKCCFAYCSIFPKDHVFCNEELVDMWSAQGLIETSKKKQELDDIGNRYI  475

Query  1482  NELLSRFCFQDVVE-AFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              ELLSR  FQD  +  F  E    K+H+L+HDLA  ++ +EC  +    P +   V H+ 
Sbjct  476   KELLSRSFFQDFEDRHFYFEF---KMHDLMHDLASFISQSECTFIDCVSPTVSRMVRHVS  532

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV-SKTFVKKTLLNFRRLRVLMLQNLELK  1835
             F  D L  +E  + +  L ++R   + F   T   + F+K  +  F+ +++L L +    
Sbjct  533   FSYD-LDEKEILRVVGELNDIRTIYFPFVQETSHGEPFLKACISRFKCIKMLDLSSSNFD  591

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LP+SI  LK LR L+L+ N  IK LP  I KL +LQ L+L+ CE  + LP+ FG  L+S
Sbjct  592   TLPNSISNLKHLRLLDLNENKKIKKLPNSICKLFHLQKLSLLGCEGFENLPKEFG-NLIS  650

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQ----FLLLYKCSCRKFPAEIWQHMKKLRVLRIYEC  2183
             L+ L +T+++     R+   +G L+     L ++KC   +F  +  Q +  LR L I +C
Sbjct  651   LRHLQITTKQ-----RALTGIGRLESLQTHLKIFKCQNLEFLLQGTQSLTTLRSLFIRDC  705

Query  2184  SSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLK  2363
               L  L   ++ L  LE L I++C+ L+                         SL    +
Sbjct  706   RRLVSLAHSMKQLPLLEHLVIFDCKRLN-------------------------SLDGNGE  740

Query  2364  D-IDAM-KLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             D +  +  L+ L +   P+L ALP  + + T L +L IE+CP+L+
Sbjct  741   DHVPGLGNLRVLMLGKLPKLEALP--VCSLTSLDKLMIEECPQLT  783



>gb|KDP26047.1| hypothetical protein JCGZ_21080 [Jatropha curcas]
Length=846

 Score =   513 bits (1320),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 332/822 (40%), Positives = 492/822 (60%), Gaps = 26/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQ--QAK  248
             MAE+F   + E VL  + S    EI  AW+ + E+KKL+  LSTIKAVL DA+E+  QA 
Sbjct  1     MAESFAFAVAERVLEMLASNTYKEIRLAWDYEGEVKKLEEILSTIKAVLLDAEEKKKQAT  60

Query  249   NHEVKDWLQKLRdvvydaddllddFG-TLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFK  425
             N+E++ WL +L+  +YDA+++LD++   ++  R L+     + KV + F+  + L++RFK
Sbjct  61    NNELRVWLARLKGALYDAENVLDEYEYEITRRRVLQLYGTAIKKVGRFFSSSNSLVFRFK  120

Query  426   ITHKIREIRGRLNQIAEDRRNFHFKE---NYYVNPVENGKLREQTHSFVRPSDIIGRDSD  596
             + +KI++IR RL +IA  +  FH  E   N +V      + R+ THS+V  S+IIGRD D
Sbjct  121   MGNKIKQIRERLEEIASHKAKFHLSELNENRHVL----HRTRDMTHSYVEASNIIGRDVD  176

Query  597   KESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE  776
             KE I+ +LM   ++     +S + + G+G      LV   +ND RV   F  ++WV VSE
Sbjct  177   KEKILDLLMNPSEDRKIYVISIIGLGGMGKTALAKLV---FNDIRVDSQFKHKMWVCVSE  233

Query  777   DFSLSKVIEKILRSATGKS--FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKN  950
             +F + K++E+I++SA   +    +L+M+QLQ  L   +   +Y LVLDDVWNE   KW  
Sbjct  234   NFHIKKLVEEIIKSAASSTENLINLEMEQLQRKLRETIGGKKYFLVLDDVWNEQPIKWNE  293

Query  951   LRELLMSGCDGSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFRE-QEYR  1124
             L+ELL  G +GS+++VTTRS KVA+I GT   AY LSGLSD +   LF K AF+E QE  
Sbjct  294   LKELLCMGANGSKILVTTRSKKVASIVGTIPAAYELSGLSDDESKALFTKFAFKEGQEKD  353

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               NL++IG EI++KC GVPLAVKTL S+L  +TDE  W +IRENE+W +EQKE +ILP L
Sbjct  354   YPNLLKIGDEILKKCKGVPLAVKTLASLLLSQTDEDYWKYIRENELWNLEQKEDEILPAL  413

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             +LSY+Q+P HL+ CFAY  +FPK         + +W+A G + S + ++ELE++G +Y  
Sbjct  414   RLSYEQLPSHLKTCFAYFSLFPKDYNFVGVELVQVWMAHGLVHSRNKNEELEDVGKRYIE  473

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             EL SR  FQD  ++F  E L  K+H+L+HDLA S+   EC  +     +I ESV  L F 
Sbjct  474   ELASRSFFQDFQDSFGFEFLRFKMHDLIHDLALSLTKNECAIITCSTKQISESVRLLSFA  533

Query  1665  ADNLSREEFPQPLLNLKNLRY--FAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
                   E+ P  L  L  ++   F  +  +G  +++ +   L  F   R+L L      +
Sbjct  534   KPTSLPEDLPMMLQQLDGVQTISFGNTKDLGLNNQSILNLCLSKFHYQRMLDLSWYSNVD  593

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP  IG LK LRYL + +N  IK LP+ I KL +LQ L+L  C++++ELP++  + L++L
Sbjct  594   LPKQIGTLKHLRYLRVVSNSKIKRLPKSICKLHHLQALDLWRCDEIEELPKDI-RCLVNL  652

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTC  2198
             + L +T+++  L K    SL  L+ L +  C   K+  E  Q ++ L++L I +C+ L  
Sbjct  653   RHLKITTKQECLPKNGIGSLKSLRKLSIVFCPNLKYLFEDMQGLRNLQLLLIVKCNQLIS  712

Query  2199  LPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslq----slllmglPKLVSLPAGLKD  2366
             LP  +++L  L+ L+I NC+ LDL++ E     E        L+L+ LPKLV+LP  L  
Sbjct  713   LPQSVKYLVTLKTLFISNCQNLDLTIEEEKINEELSAFCVLELILIRLPKLVNLPLWLFQ  772

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
                +K  YLR   C  L  LP  L+N   L++L I +C EL 
Sbjct  773   GYTLKSLYLR--NCDNLRELPACLRNIESLRQLEIRNCGELG  812



>ref|XP_008392255.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=834

 Score =   511 bits (1317),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 345/838 (41%), Positives = 499/838 (60%), Gaps = 58/838 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+A +EI  AW +K +L+KL  T+S IK VL DA+E+Q  N +++ WLQ+
Sbjct  8     LASRLIEKLTSIASEEICLAWGVKADLQKLGYTMSIIKDVLLDAEEKQKHNKQLRSWLQQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + + +R ++ H+I++IR R
Sbjct  68    LNDVFLDAEDLLDEFECEALRRQVVRGSGTTRKVRRFFSRSNPVAFRLRVGHEIKDIRER  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKL---REQTHSFVRPSDIIGRDSDKESIVGMLMKS  629
             L+++ +D +NF      + +P     +   R  THSFV  S++IGR+++K  IV +LM  
Sbjct  128   LHELKDD-KNFSDLRTVHHHPHLGDHVRGNRNTTHSFVHASEVIGRETEKNEIVDLLMVQ  186

Query  630   CDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
              D+    D  +VS +PIVGLGGLGKTTL KLVYND+R+V +F+ R+W  VS DF ++++ 
Sbjct  187   GDDHQGGDNRNVSIIPIVGLGGLGKTTLAKLVYNDERLVGSFELRMWQXVSVDFDVTRLT  246

Query  801   EKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             ++IL SA G      L +DQLQ  L   L   ++LLVLDDVWNED+ KW  LR+LL+ G 
Sbjct  247   KEILGSALGTQISEGLSLDQLQAQLRDALKDKKFLLVLDDVWNEDRIKWSELRDLLIEGA  306

Query  978   D-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
               GS+++VTTR+I VA+I  T   Y NL  LS  D   LF+KCAF E QE +  +L E+G
Sbjct  307   KIGSKILVTTRNISVASIMSTVGTYINLEVLSFEDSLSLFVKCAFEEGQERQHPSLYEMG  366

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK-ETDILPILKLSYDQM  1325
             K+IV+KC GVPLAVKTLGS LY KTDE++W  IR++EIW++EQ+ +  ILP LKLSY Q+
Sbjct  367   KDIVRKCXGVPLAVKTLGSQLYSKTDERQWKLIRDSEIWELEQEGDGHILPALKLSYTQL  426

Query  1326  PYHLRQCFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSR  1499
             P HL+QC A C + PK   E      IN W+A G ++S D G+ ELE++G  YF EL  R
Sbjct  427   PSHLKQCLACCSILPKNYXEFDSRELINNWMAHGILESRDHGNMELEDVGELYFKELWDR  486

Query  1500  FCFQDVVE-----AFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVF  1661
               FQ+V +      FD       +H+++HDL QSVA  E   V S G   + E+V HL F
Sbjct  487   SFFQNVKDYTFRYRFD-------MHDVIHDLVQSVAQGESFIVDSAGTKGVSENVRHLTF  539

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
                  +     Q L  ++ ++  +       + ++F+   +  F+ LRVL L N   + L
Sbjct  540   LEVGQNVSTTLQKLNKVRTIQVESCE----NIDESFLSTCISRFKYLRVLKLTNASWELL  595

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             PSSIG LK L+ LNL+ N  I  +P  I KL +LQTL+L  C  L+ELPR+  ++L+SL+
Sbjct  596   PSSIGSLKHLKSLNLAGNAIITQVPNSICKLQSLQTLSLSRCVNLEELPRDM-RKLISLR  654

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L  T+++ S                        FP      +  L  L I+ECS LTCL
Sbjct  655   YLDFTTKQSS------------------------FPDNGVGCLTSLXNLSIFECSXLTCL  690

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             P    +LA L  L I NC++LDL +          Q L +  +P++ +LP   +      
Sbjct  691   PRDTSYLASLRTLMIGNCKQLDLVMENYQGXPLRFQKLGIRKVPRMATLPEWFQGA-TNT  749

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCP  2552
             L+ L +  C  L +LP WL + T L+RL +  CP+L  LP+++ R ++  +VRI +CP
Sbjct  750   LQVLVIRDCENLESLPGWLTSFTSLRRLVLTSCPKLLSLPDEMHRLTALTEVRIRNCP  807



>ref|XP_007029659.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY10161.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=902

 Score =   513 bits (1322),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 345/854 (40%), Positives = 518/854 (61%), Gaps = 32/854 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETF  +I ENV+ K+ ++A  EIS AW ++ + ++L + L+T+K VL DA+E QA  +
Sbjct  1     MAETFAFNIVENVVQKLATVAHQEISLAWGVQSDFQRLNDILTTVKDVLLDAEENQAHTN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++++WLQKL D  YDA+D+LD+F   +L +++     I  KV   F+  + L +RF++  
Sbjct  61    QLRNWLQKLTDACYDAEDVLDEFEIEALRKQVLKQRNIGKKVSHFFSSSNPLAFRFRMAQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYY-VNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             KI+++  R  +IA  + NFH  E +Y    V  G  RE THSFV+ +DIIGRD DKE I+
Sbjct  121   KIKKVTLRFGEIAALKANFHLAERHYDTRHVVMGPDRE-THSFVQAADIIGRDEDKEKII  179

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               LM+  D  D E++S LPIVG+GGLGKT L KLV ND+ +   F  ++WV VS+DF L 
Sbjct  180   KSLMQ--DPPDGENISVLPIVGIGGLGKTALAKLVLNDEIIDGEFQLKIWVCVSDDFHLK  237

Query  792   KVIEKILRSAT--GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             ++I KI+++     + + ++D+DQLQ+ L   L   +YLL+LDD+W ED  KW  L++LL
Sbjct  238   RLIIKIIKAVKKVNEDWSNMDLDQLQKVLRDCLDGKKYLLILDDLWKEDDIKWNELKQLL  297

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVE  1142
             + G  GS+++VTTRS +VA ITGT   +NL GL   +   LFL+ AF+++E     NLV+
Sbjct  298   VEGGRGSKIVVTTRSSRVAEITGTIPTHNLEGLPKEEALSLFLQFAFKKREMNQYSNLVK  357

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IG+EIV+ C G+PL +KTLGS+L CKT E +W  +R++E+WK+ QKE +I PILKLSYDQ
Sbjct  358   IGEEIVKSCNGIPLVLKTLGSLLLCKTSEYDWKLVRDSEMWKLMQKENNIFPILKLSYDQ  417

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P +L+QCFAY  +FPK  E      I+ W+A   +QS +   +  ++G +Y N+L SR 
Sbjct  418   LPPYLKQCFAYLSVFPKDYEFNYMELIHFWMAHDLLQSSNESDDPIDIGRRYLNDLSSRS  477

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLS  1679
              FQD  ++   +    K+H+L+HDLA  VA   C  + S    I   + HL   ++D L 
Sbjct  478   FFQDFDKSLSRQYF-FKMHDLLHDLAVLVAKNGCSTINSFKQIITPGIRHLCLENSDFLE  536

Query  1680  RE--EFPQPLLNLKNLRYFAY-SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             +   +F   +  L +LR F + + +    S++F++K L  F++LRVL LQ   L+ +P  
Sbjct  537   KNSCDFFD-IDKLCHLRTFRFENMKADANSESFIEKCLSRFQKLRVLTLQGSSLEVVPKR  595

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             I  LK LRYL+LS N NIK LP  + KL  LQTL LI    ++ELP N  + ++SL+ L 
Sbjct  596   ISGLKHLRYLDLSGNTNIKKLPNFMCKLPCLQTLLLIQA-GIEELPSNM-RYMISLRMLS  653

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +++++  L K     L  L++LL+  C   ++  +  +++  L  L I +C +L  LP G
Sbjct  654   ISTKQKVLSKSGLEYLKSLRYLLIAYCENLEYLFDGIRNLTSLHSLIIVDCKNLIALPQG  713

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmeglesl--------------qslllmglPKLVSL  2348
             I+ L  L+ L I NCE+L L++    +   +               Q+L++  LP+L +L
Sbjct  714   IKALTALKILVISNCEKLHLNMILASKARGNEDDSQDHHIGSGLRLQTLIIGRLPRLEAL  773

Query  2349  PAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNA  2528
             P  L    A  L+ L +  C  LT L  W QN T L+R  I +CP+LS LPE +      
Sbjct  774   PNWLLGESANTLQILVIEECKNLTTLAKW-QNLTSLERFSIGECPKLSSLPESMPCLR--  830

Query  2529  KVRIIDCPLLNG*C  2570
             ++ I+ CP+LN  C
Sbjct  831   ELSIMHCPILNERC  844



>ref|XP_010024100.1| PREDICTED: putative disease resistance protein RGA1 [Eucalyptus 
grandis]
Length=853

 Score =   510 bits (1314),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 330/806 (41%), Positives = 493/806 (61%), Gaps = 20/806 (2%)
 Frame = +3

Query  120   KIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvyd  299
             K+ S+A +EI   W ++ + +KL+N L  I+ VL DA+++Q  +  V+ WL KL+D  YD
Sbjct  15    KLASMASEEIQLMWGVEDDQEKLKNLLEMIEKVLTDAEQKQTTSDAVRLWLSKLKDFCYD  74

Query  300   addllddFGTLSLLRKLRSCSGILTK--VRKLFTRPDGLIYRFKITHKIREIRGRLNQIA  473
             ADD+LD+F   +L R++R    +  K  VR LF+     I++FK+ HK++E+R RL++I 
Sbjct  75    ADDVLDEFEVNALRRRVRLTEHLTLKRRVRYLFSWLSNFIFQFKMAHKMKELRTRLHEIN  134

Query  474   EDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTES  653
             E++   H   N    P ++   R++THSFV  S+++GR+ DK+ I+ +LM++ D++    
Sbjct  135   EEKNKLHLSSNV---PDKSIVQRKETHSFVLVSNVVGRNKDKQRIIELLMRT-DDDGASK  190

Query  654   VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKS  833
             ++ +PIVG+GG+GKTTL K VY DDR+ ++FD ++W+S+  DF + K I  I+ S + ++
Sbjct  191   IAVVPIVGIGGIGKTTLAKWVYMDDRISKHFDHKVWLSML-DFEVKKTIRDIIESFSHEA  249

Query  834   -FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRS  1010
                   +++LQ HL  ++ + R L V+DDVW      W+ LR+LL     GS+VIVTT +
Sbjct  250   KCDSWSLEKLQNHLRSIVENKRCLFVMDDVWEVSWENWEGLRDLLEVVSKGSKVIVTTWN  309

Query  1011  IKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLA  1187
               VA+I GT   +NL+ LS  D   LF+KCAF + QE    +L+ IGKEIV KCGG P+A
Sbjct  310   KSVASIMGTVPPHNLANLSQEDSLTLFMKCAFEQGQERYFPDLMVIGKEIVNKCGGNPMA  369

Query  1188  VKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMF  1367
             VKTLGS+L+ KT++  W  IR++EIW+++   TDILP L++SYD MP +L+QCFAYC +F
Sbjct  370   VKTLGSLLHSKTNQSNWKSIRDSEIWQLQ---TDILPSLRISYDLMPSYLKQCFAYCSIF  426

Query  1368  PKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILA  1547
             PK  E      I LW+A G IQ    + ELE +G QY+ EL SR  F DVVE  D   L 
Sbjct  427   PKNYEFNNLELIQLWIANGLIQPNRNNTELEEIGQQYWEELWSRSFFDDVVE--DYLFLK  484

Query  1548  CKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN-LSREEFPQPLLNLKNLR  1724
              K+H+L+  LA SVA  +  NV     ++  +  H+ F   + L  +E P  L  L  +R
Sbjct  485   FKMHDLIRALAISVAQNDSSNVNMRTQDVSLTTRHISFSDPSLLPEDELPGYLSELSGIR  544

Query  1725  YFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCN  1901
                +  +  G+  ++F++  +  F+ LRVL L +    +LP+SIG LK LR+ +L  N N
Sbjct  545   TIMFPIKKEGSTGESFLEMCISRFKHLRVLYLHDSSFDQLPNSIGGLKHLRFFHLCGNRN  604

Query  1902  IKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLG  2081
             IK LP  I +L +LQ+L L  CE+L+ELP +  + ++SL+ L +T+++    +     L 
Sbjct  605   IKKLPNSICELHHLQSLGLARCEELEELPADI-KNMISLRFLDVTTKQRRFPESGIGCLT  663

Query  2082  FLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEE  2261
              L+ L +  C   +      Q +  LR L I  C  LT LP  I++L  LE LWI NCE 
Sbjct  664   SLRCLFIGDCKNLEALFNDMQSLTSLRKLFIGGCPKLTSLPQDIKNLKALENLWICNCEN  723

Query  2262  LDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDW  2435
             L L     +    +  LQS++ +GLPK+VS P  LK   A  ++ + VA CP L+ LP W
Sbjct  724   LKLQEGGSDEPRSMSRLQSMMFVGLPKIVSFPRWLKG-SARTMQAIDVAHCPNLSTLPYW  782

Query  2436  LQNCTLLQRLYIEDCPELSYLPEQIR  2513
             LQNC+ L++L IEDCP++S LP+ IR
Sbjct  783   LQNCSSLRKLKIEDCPKMSSLPDGIR  808


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 107/226 (47%), Gaps = 22/226 (10%)
 Frame = +3

Query  1629  EIPESV---HHLVFHADNLSR----EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLL  1787
             ++P S+   HHL   +  L+R    EE P  + N+ +LR+      V T  + F +  + 
Sbjct  607   KLPNSICELHHL--QSLGLARCEELEELPADIKNMISLRFLD----VTTKQRRFPESGIG  660

Query  1788  NFRRLRVLMLQNLE-LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLIN  1964
                 LR L + + + L+ L + +  L  LR L +     + SLP+ I  L  L+ L + N
Sbjct  661   CLTSLRCLFIGDCKNLEALFNDMQSLTSLRKLFIGGCPKLTSLPQDIKNLKALENLWICN  720

Query  1965  CEQLK------ELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKF  2126
             CE LK      + PR+  + L S+  + L  + VS  +    S   +Q + +  C     
Sbjct  721   CENLKLQEGGSDEPRSMSR-LQSMMFVGLP-KIVSFPRWLKGSARTMQAIDVAHCPNLST  778

Query  2127  PAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEEL  2264
                  Q+   LR L+I +C  ++ LP GIRH+  L +LWI +C EL
Sbjct  779   LPYWLQNCSSLRKLKIEDCPKMSSLPDGIRHIPTLRELWIDDCREL  824



>ref|XP_007204655.1| hypothetical protein PRUPE_ppa001501mg [Prunus persica]
 gb|EMJ05854.1| hypothetical protein PRUPE_ppa001501mg [Prunus persica]
Length=813

 Score =   509 bits (1310),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 350/852 (41%), Positives = 507/852 (60%), Gaps = 59/852 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     +   ++ K+ S+A ++IS AW++K +LKKLQ T+STIK VL DA+++QA N 
Sbjct  1     MAEVAFP-LAAKLIEKLGSIASEQISLAWSVKADLKKLQRTMSTIKDVLLDAEQKQAHNQ  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             +++ WL++L+DV  DADDLLD+F   +L R++  +  G   KVR+ F+R + + +R ++ 
Sbjct  60    QIRSWLRQLKDVFLDADDLLDEFECEALRREVVETFHGTTGKVRRFFSRSNPIAFRLRVG  119

Query  432   HKIREIRGRLNQIAEDRRNFH--FKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKES  605
             H+I+EIR RL+++  ++  F      +++ +  ++ +    THSFVR S +IGR+S+K+ 
Sbjct  120   HQIKEIRERLDELKSNKAIFDSLTSIDHHGSGGDHHERVNVTHSFVRASKVIGRESEKKQ  179

Query  606   IVGMLMKSCDEEDTES--VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             I+ +LM+  D+  + +  VS +PIVG+GGLGKTTL KLVY+D+RV   F+ ++WVSVS D
Sbjct  180   IINLLMEQGDDNQSGNGNVSVIPIVGIGGLGKTTLAKLVYDDERVC--FEKKMWVSVSVD  237

Query  780   FSLSKVIEKILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             F ++++I+ IL SA+       L +DQLQ  L   L   ++LLVLDDVWNED+ KW  LR
Sbjct  238   FEITRLIKMILSSASDTEMSDKLTLDQLQGRLRHALKDKKFLLVLDDVWNEDRIKWSELR  297

Query  957   ELLMSGC-DGSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
             +LL+ G   GS+++VTTR+  VA + GT  T  NL  LS  DC  LF++CAF+E   +  
Sbjct  298   DLLIEGAKSGSKILVTTRNTWVAEMMGTIPTNINLQFLSFEDCLSLFVECAFKEGRDKDY  357

Query  1131  -NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK-ETDILPIL  1304
              NL E+GK+IV+KCGGVPLAVKTLGS L+ KTDE+EW  +R++EIWK+E++  + ILP L
Sbjct  358   PNLFEMGKDIVRKCGGVPLAVKTLGSQLHSKTDEREWKLVRDSEIWKLEREGASHILPAL  417

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSP--DGDQELENLGNQ  1475
             +LSY Q+P HLR C AYC   PK + +      I  W+A G +      G+ ELE++G  
Sbjct  418   RLSYTQLPPHLRLCLAYCSHLPKDQFQFSSFHLIRYWMAHGILDQSRFHGNMELEDIGEL  477

Query  1476  YFNELLSRFCFQDVVEAFDGEILACK--IHNLVHDLAQSVAGAECLNVKSGDP-EIPESV  1646
             YF +L +R  FQ+V    +   + C+  +H+L+HDL QS+A  EC  VKS +  +I E+V
Sbjct  478   YFKDLCARSFFQNV----NDRNIYCRFDMHDLIHDLVQSIAQGECFTVKSANTKDISENV  533

Query  1647  HHL-VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQN  1823
              HL V  A +         L  L  +R    +     + ++F++     F+ LRVL L  
Sbjct  534   RHLTVLEAGH----NVSTTLQKLNKVRTLISA--QTKIDESFMRTCFSGFKYLRVLQLPT  587

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
               L+ LPSSIG LK LRYL +S N  I  LP  I KL +LQTL  + C+ L+ELPR+  +
Sbjct  588   CSLQVLPSSIGSLKHLRYLGISFNEAITKLPSAICKLQSLQTLRFLGCDNLEELPRDISK  647

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYEC  2183
              L        T Q                           FP      +K LR L I +C
Sbjct  648   LLSLTSLELTTKQT-------------------------SFPKNGVGCLKSLRFLGIVKC  682

Query  2184  SSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLK  2363
             S+LT LP    +LA L+ LWI  C++LDL           LQ L +  + ++V+LP   +
Sbjct  683   SNLTSLPRETSYLASLQTLWIVECKQLDLGKVNYQGPQLRLQKLFIRDVSRMVALPEWFQ  742

Query  2364  DIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVR--  2537
                A  L+ L +  C  L ALPDWL+N T L +L I  C +LS LPE IRS ++ ++R  
Sbjct  743   KA-ANTLQVLVIRMCENLEALPDWLENFTSLTKLVISSCQKLSSLPEGIRSLTSLRLREL  801

Query  2538  -IIDCPLLNG*C  2570
              I DCP L   C
Sbjct  802   VIEDCPKLERRC  813



>ref|XP_008240895.1| PREDICTED: disease resistance protein RGA2-like [Prunus mume]
Length=836

 Score =   509 bits (1312),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 347/840 (41%), Positives = 505/840 (60%), Gaps = 50/840 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+  ++I  AW ++ +LKKLQ T+S IK VL DA+++Q  N +++ WL++
Sbjct  8     LATKLIEKLGSITSEQIFLAWGVEADLKKLQRTMSIIKDVLLDAEQKQEHNQQIRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+D   DA+DLLD+F   +L R++  +  G   KVR+ F+R + + +RF++ ++I+EIR 
Sbjct  68    LKDAFLDAEDLLDEFECEALRREVVETFHGTTGKVRRFFSRSNPIAFRFRVGNEIKEIRE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQ--THSFVRPSDIIGRDSDKESIVGMLMKS  629
             RL+ +  D+  F    +   +            THSFVR S +IGR+S+K+ IV +LM+ 
Sbjct  128   RLDGLKSDKAMFDSLTSIDHHGGGGDHHERVNVTHSFVRASKVIGRESEKKQIVNLLMEQ  187

Query  630   CDEEDTES--VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
              D++ + +  VS +PIVG+GGLGKTTL KLVY+D+RVV +F  R+WVSVS DF ++++I+
Sbjct  188   GDDDQSGNGNVSVIPIVGIGGLGKTTLAKLVYDDERVVGHFQKRMWVSVSVDFEITRLIK  247

Query  804   KILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-  977
              +L SA     G  L +DQLQ  L   L   ++LLVLDDVWNED  KW  LR+LL+ G  
Sbjct  248   MVLSSALDTEMGDKLSLDQLQGRLRHALKDNKFLLVLDDVWNEDPIKWSELRDLLIEGAK  307

Query  978   DGSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIGK  1151
              GS+++VTTR+  VA + GT  T+ NL  LS  DC  LF++CAF+E   +   NL E+GK
Sbjct  308   SGSKILVTTRNTSVAEMMGTIPTSINLEFLSFKDCLSLFVECAFKEGRDKGYPNLFEMGK  367

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIE-QKETDILPILKLSYDQMP  1328
             +IV+KCGGVPLAVKTLGS LY KTDE+EW  +R++EIWK+E +    ILP LKLSY Q+P
Sbjct  368   DIVRKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWKLEGEGAGHILPALKLSYTQLP  427

Query  1329  YHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQS--PDGDQELENLGNQYFNELLSR  1499
              HLRQC AYC    K   +      I  W+A G +      G+ ELE++G  YF +L +R
Sbjct  428   PHLRQCLAYCSHLQKDWIKYSSYELIRYWIAHGILDQYHVHGNMELEDIGELYFKDLWAR  487

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESVHHL-VFHADN  1673
               FQ+V++  +       +H+L+HDL QS+A  EC  VKS +  +I ++V HL V  AD 
Sbjct  488   SFFQNVID--NHIFFKFDMHDLIHDLVQSIAQGECFTVKSANTKDISKNVRHLTVLEAD-  544

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
                +     L  L  +R    +     + ++F+       + LRV++L    L+ LPSSI
Sbjct  545   ---QNVLTTLQKLNKVR--TITAEETKIDESFMCTCFSRLKYLRVVVLPRCSLQVLPSSI  599

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LR LNLS N  I  LP  I KL +LQ+L+L  C  L+ELPR+   +L+SL +L+L
Sbjct  600   GSLKHLRNLNLSYNEAITKLPNTICKLQSLQSLDLDGCGNLEELPRDVS-KLISLTSLWL  658

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+++ SL +     L  LQF                        L I +CS+LT LP  I
Sbjct  659   TTKQTSLTENGVGCLKSLQF------------------------LGIVKCSNLTSLPCEI  694

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
              +LA L  L +  CE+LDL           LQ L ++ LP++V+LP  L+ + A  L++L
Sbjct  695   SYLASLRTLVLDKCEQLDLGKVNYQGTPLRLQKLWIINLPRMVALPEWLQGV-ANTLQFL  753

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLLNG*C  2570
              +  C  L ALP+WL + T L++L I  C +LS LPE +RS ++ + + I+DCP L   C
Sbjct  754   AIDVCENLEALPEWLASFTSLKKLVIGSCQKLSSLPEGMRSLTSLRDLVIVDCPELERRC  813



>ref|XP_009334959.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=833

 Score =   508 bits (1309),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 347/844 (41%), Positives = 497/844 (59%), Gaps = 58/844 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+A +EI  AW +K +L+ L  T+STI+ VL DA+E+QA+N++++ WL++
Sbjct  8     LASRLIEKLASIASEEICLAWGVKVDLQNLGRTMSTIRDVLLDAEEKQARNNDLRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + + +  ++ H I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVRGSGTTRKVRRFFSRSNPVAFDLRVGHGIKDIRAR  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQ---THSFVRPSDIIGRDSDKESIVGMLMKS  629
             L ++ ED+ NF      + +P     LRE    THSFVR S++IGRD++K +IV +LM+ 
Sbjct  128   LQELKEDK-NFGDLRPCHHHPHLGDHLRENRNTTHSFVRASEVIGRDTEKNTIVDLLMQQ  186

Query  630   CDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
              D+    D  +VS +P VG GGLGKTTL + VYND RVV +FD R+W  VS +F ++++ 
Sbjct  187   GDDHQGGDNGNVSVIPTVGFGGLGKTTLAQSVYNDQRVVGSFDLRMWQHVSVNFDVTRLT  246

Query  801   EKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             ++IL SA G      L +DQLQ  L   L   ++LLVLDDVWN D+ KW  LR+LL+ G 
Sbjct  247   KEILGSALGTQISEGLSLDQLQAQLRDALKDKKFLLVLDDVWNADRIKWSELRDLLVEGA  306

Query  978   D-GSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
               GS+++VTTR+I VA+I GT  T  NL GLS  DC  LF+KCAF E QE +  +L E+G
Sbjct  307   KIGSKILVTTRNISVASIMGTVGTCINLEGLSFEDCMKLFVKCAFDEGQERQHPSLYEMG  366

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK-ETDILPILKLSYDQM  1325
             K+IV KCGGVPLAVKTLGS LY KTDE++W  IR++EIW++E+  +  ILP L+LSY Q+
Sbjct  367   KDIVSKCGGVPLAVKTLGSQLYSKTDERQWKLIRDSEIWELERGGDCHILPALRLSYTQL  426

Query  1326  PYHLRQCFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSR  1499
             P HL+ C   C   PK   +      IN W+A G ++S + GD ELE++G  YF  L  R
Sbjct  427   PPHLKHCLVCCSTLPKNYTKFDSRELINHWMAHGILESREHGDMELEDVGELYFKVLWDR  486

Query  1500  FCFQDVVEA-----FDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE-IPESVHHLVF  1661
               FQ+V ++     FD       +H+L+HDL QSV   E L V S   + I ++V HL  
Sbjct  487   SFFQNVKDSCFFYEFD-------MHDLIHDLVQSVGQGESLIVDSAKTKGISKNVRHLTI  539

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
                  +     Q L  ++ +   +Y      + ++F+   +  F+ LR L L N   + L
Sbjct  540   LKSGQNISTTLQKLSKVRTIGVESYE----NIDESFLSTCISRFKYLRCLGLVNASWELL  595

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             PSSIG LK LR LNL+ N  I +LP  I KL +LQ L L  C  L+ELP +   +L+SL+
Sbjct  596   PSSIGSLKHLRSLNLAGNERITALPNSICKLQSLQALTLGRCVNLEELPGDV-SKLISLR  654

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L  T ++ S                        FP      +  LR L I ECS+LTCL
Sbjct  655   CLEFTIKQSS------------------------FPENGVGCLPSLRYLCIQECSNLTCL  690

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             P    +L  L  L I NC++L L +         LQ L ++G+P++V+LP   +      
Sbjct  691   PHDTSYLESLRTLIIANCKQLGLVMENYQGIQLRLQKLWIVGVPRMVALPEWFQGA-TNT  749

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPLL  2558
             L+ L +  C  L ALP WL + T L+RL +E CP+L  LPE++ R ++  ++RI  CP L
Sbjct  750   LQDLGIEECENLEALPGWLTSFTSLRRLMLESCPKLLSLPEEMHRLTALTELRITKCPDL  809

Query  2559  NG*C  2570
                C
Sbjct  810   ERRC  813



>ref|XP_011001558.1| PREDICTED: putative disease resistance protein RGA3 [Populus 
euphratica]
Length=873

 Score =   509 bits (1312),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 344/866 (40%), Positives = 522/866 (60%), Gaps = 39/866 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  +++I   + + +  L Q  I  A  ++ +L+KL++ L +I+ VL  A+E+  KN 
Sbjct  1     MAEAAISNIVGTITNGLAPLIQQRIELACGVEEQLEKLKDILFSIEPVLHAAEEEHDKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+ WL KL++ V+DADD++D++ T ++ R++     ++ KVR   +  + +++RF++  
Sbjct  61    EVRVWLGKLKEAVHDADDVIDEYQTDNVQRQVLVYRSLIKKVRNFCSLSNPILFRFQLGQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFK-ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             K++EIR  + +IA+DR NFHF  ++  V+ V   K REQT S V  S++IGR+ DKE+++
Sbjct  121   KLKEIREIIAEIAKDRSNFHFTVQSARVDRVVPLK-REQTGSDV-SSEVIGREDDKEALI  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTR-LWVSVSEDFSL  788
              +L+ S ++E+   V+ +PIVG+GGLGKTTL +LV+NDDRV  +F+ R +W+ VS+DF++
Sbjct  179   KLLLSSTEKEN---VTIIPIVGMGGLGKTTLAQLVFNDDRVASHFEYRKIWMCVSDDFNV  235

Query  789   SKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
              ++ ++I      K++GHLD D LQ  L   + + +YLLVLDDVWN+D+ KW  L++LLM
Sbjct  236   RQISQRIAEKLDLKNYGHLDFDLLQIILKKQMSTSKYLLVLDDVWNDDRVKWFRLKDLLM  295

Query  969   SGCDGSRVIVTTRSIKVATITGTTT--AYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVE  1142
             +G  GS+V+VTTR   +A++  T T   YNLSGL    C DLFL  AF     RP+NLV 
Sbjct  296   NGARGSKVLVTTRGRMIASMMATDTRYVYNLSGLPYDRCLDLFLSWAFDRIHDRPQNLVA  355

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IGK+IV KCGG+PLA +TLG  LY K DE EWL ++ +EIW++ QKE D+LP+L+L+YDQ
Sbjct  356   IGKDIVSKCGGLPLAARTLGCFLYQK-DEDEWLLVKNSEIWELAQKEDDVLPVLRLTYDQ  414

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             MP++L+QCFA+C +FPK   I +E  I++W+AQGF+QS DG    E +G++Y NELLS  
Sbjct  415   MPHYLKQCFAFCSLFPKDHSIDKETLIHMWMAQGFLQSSDGSPP-EKIGHRYVNELLSMS  473

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPE------SVHHLVFH  1664
               +D ++  D E   CK+H+L+HDLA+ VAG EC ++ +   +IP       SV  L  +
Sbjct  474   LLEDELKYPDDEARHCKMHDLIHDLARLVAGTEC-SIITAHSKIPSKKVRHVSVFGLPEN  532

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
             + +  ++   + L N   LR   Y   +   +KT +   L N + LR+L+L   +   LP
Sbjct  533   SSSKVKDSISELLCNATKLRTLYYHL-LPEQNKTVI-NLLANLKYLRILILTESKFYGLP  590

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             SSIG L  LRYL+LS N +I+ LP  I KL NLQ L L  C QL+ELP+    ++ +L+ 
Sbjct  591   SSIGSLLHLRYLDLSKNYHIRRLPHSICKLQNLQKLKLYACRQLEELPKG-TWKIATLRH  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +TS++  L K+    L  L+ L ++ C          QH+  L+ L + +C SLT L 
Sbjct  650   LEITSKQEFLPKKGIECLTSLRSLSIHNCYRLSTLVRGMQHLTALQKLCLIDCPSLTSLE  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPA------GLKD  2366
               +  L  LE L I NC  L+LS    ++  E         LP L+++         ++D
Sbjct  710   FSLNSLISLESLEIRNCSGLELSA--QLKKREEDGLEGRRRLPSLLNIVGLNYKKEQIED  767

Query  2367  IDA--------MKLKYLRVAGCPELTALPDWLQN-CTLLQRLYIEDCPELSYLPEQI-RS  2516
              +          KL+ L     P+L  LP  L+N  + LQ L I  C  LS LP+ + + 
Sbjct  768   EEKKEEGHQGLQKLRSLTFVQLPKLIELPSELKNAASSLQYLSISYCERLSSLPDWLPQC  827

Query  2517  SSNAKVRIIDCPLLNG*CGDTGTRLS  2594
              +  ++ I  CP+L    G    R S
Sbjct  828   MALKRLEIERCPILPSPPGSQNGRYS  853



>ref|XP_009376889.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
Length=834

 Score =   507 bits (1306),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 342/838 (41%), Positives = 504/838 (60%), Gaps = 47/838 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++ S+A +EI  AW ++ +L+KL  T+STI+ VL DA+E+QA+N  ++ WL++
Sbjct  8     LAAKLIERLSSIASEEICLAWGVQADLQKLGRTMSTIRDVLLDAEEKQARNSGLRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SG   KV + F+R + + +R ++ H+I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVRVSGTTRKVCRFFSRSNPVAFRLRVGHEIKDIRER  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENG--KLREQTHSFVRPSDIIGRDSDKESIVGMLMKSC  632
             L+Q+ +D++    + +++ + + +   + R  T   V  S +IGR+++K  +V +LM   
Sbjct  128   LHQLKDDKKFADLRPDHHHHQISDNLRENRNTTDYLVTSSKVIGRETEKNKVVDLLMVQG  187

Query  633   DEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
             D+    D  +VS +PIVGLGGLGK+TL  LVYNDDRVV +F  R+W  VS DF ++++ +
Sbjct  188   DDHQGGDNGNVSVIPIVGLGGLGKSTLANLVYNDDRVVGSFKLRMWTKVSVDFDITRLAK  247

Query  804   KILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD  980
             +ILRSA+G      L   QLQE L   L   ++LLVLDDVWNED++KW  LR++L  G  
Sbjct  248   EILRSASGTKISEGLSPHQLQEQLRDALKDKKFLLVLDDVWNEDRNKWCQLRDMLTEGAK  307

Query  981   -GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
              G++V+VTTR+  VA+I  T  + NL  LS  DC  LF+KCAF+E QE +  +L E+GK+
Sbjct  308   VGTKVLVTTRNSSVASIMCTVESINLDLLSFEDCLSLFVKCAFKEGQERQHPSLYEMGKD  367

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK-ETDILPILKLSYDQMPY  1331
             IV+KCGGVPLAVKTLGS LY KTDE++W  I+++EIW++E+  +  ILP L+LSY Q+P 
Sbjct  368   IVRKCGGVPLAVKTLGSQLYSKTDERQWKLIKDSEIWELERDGDGHILPALRLSYTQLPS  427

Query  1332  HLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSRFC  1505
             HL+ C A C + PK          I  W+A G ++S + GD ELE++G  YF EL  R  
Sbjct  428   HLKLCLASCSILPKNYIGFSTMDLIENWMAHGILESREHGDMELEDVGELYFKELWDRSF  487

Query  1506  FQDVVE-AFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVFHADNLS  1679
             FQ+V + AF        +H+L+HDL QSVA  E L V S G   I E+V HL F     S
Sbjct  488   FQNVKDYAF---FYQFDMHDLIHDLVQSVAQGESLTVDSAGTKRISENVRHLTFLK---S  541

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              +     L  L  +R      R   + K+F+   +  F+ LRVL L +   + LPSSIG 
Sbjct  542   GQNISTNLQKLSKVRTILVRSR-ENIGKSFLCTCISRFKYLRVLSLYDSPCELLPSSIGS  600

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LR LNL+ N  I +LP  I KL +LQTL L  C  L+E PR+  + L+SL+ L +T+
Sbjct  601   LKHLRCLNLAGNERITALPNLICKLQSLQTLVLRGCVSLEEFPRDM-RNLISLRWLVITT  659

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++ S                        FP      +  LR L I+ECS+LTCLP    +
Sbjct  660   KQSS------------------------FPENGVGCLTSLRYLSIWECSNLTCLPRDTSY  695

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             LA L  L I +C++LDL +         LQ L ++G+P++++LP   +      L+ L +
Sbjct  696   LASLRTLMIGDCKQLDLVMENYQVIPLRLQKLGIIGVPRMLALPEWFQGCKNT-LRVLVI  754

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPLLNG*C  2570
               C  L ALP WL + T L+RL +  CP+L  LP+++ R ++  +VRI+ CP L   C
Sbjct  755   GDCENLEALPGWLTSFTSLRRLTLGSCPKLLSLPDEMHRLTALTEVRIVACPDLERRC  812



>gb|KCW90192.1| hypothetical protein EUGRSUZ_A02365 [Eucalyptus grandis]
Length=835

 Score =   507 bits (1305),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 328/802 (41%), Positives = 490/802 (61%), Gaps = 20/802 (2%)
 Frame = +3

Query  132   LAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddl  311
             +A +EI   W ++ + +KL+N L  I+ VL DA+++Q  +  V+ WL KL+D  YDADD+
Sbjct  1     MASEEIQLMWGVEDDQEKLKNLLEMIEKVLTDAEQKQTTSDAVRLWLSKLKDFCYDADDV  60

Query  312   lddFGTLSLLRKLRSCSGILTK--VRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRR  485
             LD+F   +L R++R    +  K  VR LF+     I++FK+ HK++E+R RL++I E++ 
Sbjct  61    LDEFEVNALRRRVRLTEHLTLKRRVRYLFSWLSNFIFQFKMAHKMKELRTRLHEINEEKN  120

Query  486   NFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFL  665
               H   N    P ++   R++THSFV  S+++GR+ DK+ I+ +LM++ D++    ++ +
Sbjct  121   KLHLSSNV---PDKSIVQRKETHSFVLVSNVVGRNKDKQRIIELLMRT-DDDGASKIAVV  176

Query  666   PIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKS-FGH  842
             PIVG+GG+GKTTL K VY DDR+ ++FD ++W+S+  DF + K I  I+ S + ++    
Sbjct  177   PIVGIGGIGKTTLAKWVYMDDRISKHFDHKVWLSML-DFEVKKTIRDIIESFSHEAKCDS  235

Query  843   LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVA  1022
               +++LQ HL  ++ + R L V+DDVW      W+ LR+LL     GS+VIVTT +  VA
Sbjct  236   WSLEKLQNHLRSIVENKRCLFVMDDVWEVSWENWEGLRDLLEVVSKGSKVIVTTWNKSVA  295

Query  1023  TITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTL  1199
             +I GT   +NL+ LS  D   LF+KCAF + QE    +L+ IGKEIV KCGG P+AVKTL
Sbjct  296   SIMGTVPPHNLANLSQEDSLTLFMKCAFEQGQERYFPDLMVIGKEIVNKCGGNPMAVKTL  355

Query  1200  GSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGE  1379
             GS+L+ KT++  W  IR++EIW+++   TDILP L++SYD MP +L+QCFAYC +FPK  
Sbjct  356   GSLLHSKTNQSNWKSIRDSEIWQLQ---TDILPSLRISYDLMPSYLKQCFAYCSIFPKNY  412

Query  1380  EIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIH  1559
             E      I LW+A G IQ    + ELE +G QY+ EL SR  F DVVE  D   L  K+H
Sbjct  413   EFNNLELIQLWIANGLIQPNRNNTELEEIGQQYWEELWSRSFFDDVVE--DYLFLKFKMH  470

Query  1560  NLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN-LSREEFPQPLLNLKNLRYFAY  1736
             +L+  LA SVA  +  NV     ++  +  H+ F   + L  +E P  L  L  +R   +
Sbjct  471   DLIRALAISVAQNDSSNVNMRTQDVSLTTRHISFSDPSLLPEDELPGYLSELSGIRTIMF  530

Query  1737  SFRV-GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSL  1913
               +  G+  ++F++  +  F+ LRVL L +    +LP+SIG LK LR+ +L  N NIK L
Sbjct  531   PIKKEGSTGESFLEMCISRFKHLRVLYLHDSSFDQLPNSIGGLKHLRFFHLCGNRNIKKL  590

Query  1914  PECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQF  2093
             P  I +L +LQ+L L  CE+L+ELP +  + ++SL+ L +T+++    +     L  L+ 
Sbjct  591   PNSICELHHLQSLGLARCEELEELPADI-KNMISLRFLDVTTKQRRFPESGIGCLTSLRC  649

Query  2094  LLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL-  2270
             L +  C   +      Q +  LR L I  C  LT LP  I++L  LE LWI NCE L L 
Sbjct  650   LFIGDCKNLEALFNDMQSLTSLRKLFIGGCPKLTSLPQDIKNLKALENLWICNCENLKLQ  709

Query  2271  -SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNC  2447
                 +    +  LQS++ +GLPK+VS P  LK   A  ++ + VA CP L+ LP WLQNC
Sbjct  710   EGGSDEPRSMSRLQSMMFVGLPKIVSFPRWLKG-SARTMQAIDVAHCPNLSTLPYWLQNC  768

Query  2448  TLLQRLYIEDCPELSYLPEQIR  2513
             + L++L IEDCP++S LP+ IR
Sbjct  769   SSLRKLKIEDCPKMSSLPDGIR  790


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 107/226 (47%), Gaps = 22/226 (10%)
 Frame = +3

Query  1629  EIPESV---HHLVFHADNLSR----EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLL  1787
             ++P S+   HHL   +  L+R    EE P  + N+ +LR+      V T  + F +  + 
Sbjct  589   KLPNSICELHHL--QSLGLARCEELEELPADIKNMISLRFLD----VTTKQRRFPESGIG  642

Query  1788  NFRRLRVLMLQNLE-LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLIN  1964
                 LR L + + + L+ L + +  L  LR L +     + SLP+ I  L  L+ L + N
Sbjct  643   CLTSLRCLFIGDCKNLEALFNDMQSLTSLRKLFIGGCPKLTSLPQDIKNLKALENLWICN  702

Query  1965  CEQLK------ELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKF  2126
             CE LK      + PR+  + L S+  + L  + VS  +    S   +Q + +  C     
Sbjct  703   CENLKLQEGGSDEPRSMSR-LQSMMFVGL-PKIVSFPRWLKGSARTMQAIDVAHCPNLST  760

Query  2127  PAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEEL  2264
                  Q+   LR L+I +C  ++ LP GIRH+  L +LWI +C EL
Sbjct  761   LPYWLQNCSSLRKLKIEDCPKMSSLPDGIRHIPTLRELWIDDCREL  806



>ref|XP_010904851.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Elaeis guineensis]
 ref|XP_010904852.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Elaeis guineensis]
Length=841

 Score =   507 bits (1305),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 330/811 (41%), Positives = 498/811 (61%), Gaps = 16/811 (2%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F   I E VL K+  L  DEISSA  ++ EL KL+++++ +KAVL DA+++Q+    ++ 
Sbjct  4     FAFTIAEKVLKKLGGLVYDEISSARGMEKELDKLKDSITLVKAVLMDAEKKQSTTQGLRV  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIRE  446
             WL+ L++V YDA+D+L+DF    L R++ S   IL KV +  +R + LI+R  ++HK+++
Sbjct  64    WLELLKNVFYDAEDILNDFEVEDLRRQVVSRGDILRKVHRFCSRSNPLIFRTNMSHKLKK  123

Query  447   IRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMK  626
             +  RL+ I   + +F   E    N     +  ++ HSFVR S+IIGRD DKE I+ +L+ 
Sbjct  124   LNERLDGIVRKKIDFQLVEGPVNNYRPLFQEEKEKHSFVRASNIIGRDEDKEKIIELLLH  183

Query  627   SCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEK  806
                + +   ++ +PIVG+GGLGKTTL KLVYND+R++++F+ ++WV VS+DF   K++E 
Sbjct  184   PNTDRN---INVIPIVGIGGLGKTTLAKLVYNDERIIRHFELKMWVYVSKDFGERKLMEN  240

Query  807   ILRSATG--KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD  980
              +++ATG  + +G+  MDQLQ  L   +   + LLVLDDVWNED+ KW+ L++LLM G  
Sbjct  241   TVKTATGDGQDYGNFTMDQLQIGLRDAIKDKKILLVLDDVWNEDRKKWEELKDLLMVGAS  300

Query  981   GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEI  1157
             GS ++VTTRS  VA+I  TT  YNL GL   +C  LF++ AF E QE +  NLV+IG +I
Sbjct  301   GSMIMVTTRSHLVASIMCTTPTYNLLGLRHDECLSLFVRYAFMEGQERQYPNLVKIGDDI  360

Query  1158  VQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD--ILPILKLSYDQMPY  1331
             V+KCGGVPLAV TL   L+  T E++W  I+++ IW+IE+KET+  ILP L++SY+Q+P 
Sbjct  361   VRKCGGVPLAVMTLAGQLFLNTRERDWNVIKDSGIWEIEEKETESGILPALRVSYEQLPS  420

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L++CFAYC +FPK  E      +  W+A G I   +  QELE++G +Y  +L   F  Q
Sbjct  421   PLKRCFAYCSIFPKDYEFNDFEVVQFWMALGLIVPMNERQELEDVGFRYLEKLGHGFFVQ  480

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             D  + +   ++  ++H+++H+LA SV+  EC  V +   +I ++V HL F   +   ++ 
Sbjct  481   DFRDHYG--VVRFRMHDVMHELALSVSKDECSVVTANRQKIAKNVRHLSFPDPDSLPQDL  538

Query  1692  PQPLLNLKNLRYFAY-SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             P  L +L  +R   + S + G   K+ ++  L  F+ LRVL L   +  +LP  IG  K 
Sbjct  539   PTILQDLDRVRTVCFQSAKEGPSCKSVIETCLSRFQYLRVLNLSRSQFDQLPKGIGNFKH  598

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRYL+LS N  I+ LP  I KL NLQTL L  C+++++LPRN  + ++SL+ L +T+++ 
Sbjct  599   LRYLDLSWNHKIRKLPSSIYKLQNLQTLILAGCDEIEKLPRNL-RYMVSLRFLCITTRQK  657

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
             SL K     L  L+ L +Y C   +   E  Q +  LR L I  C SL  LP  I+ L  
Sbjct  658   SLPKGEIGCLKSLRVLWIYSCENVEHLFEDMQALTNLRTLYICTCQSLVSLPPCIKQLTA  717

Query  2229  LEKLWIWNCEELDLSVge----gmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLR  2396
             LE L I  CE L+L+             SL+ L++  + ++V LP  L    A  L+YLR
Sbjct  718   LEILLISGCESLNLARVGGQDDQNSSQFSLRKLVISFVTEMVELPQWLLGKSADTLEYLR  777

Query  2397  VAGCPELTALPDWLQNCTLLQRLYIEDCPEL  2489
             V  CP LT LP++L+N   L++L+I  CP L
Sbjct  778   VEFCPGLTELPEYLKNFKSLEQLWILGCPLL  808



>ref|XP_007029656.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY10158.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=902

 Score =   506 bits (1303),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 335/852 (39%), Positives = 510/852 (60%), Gaps = 28/852 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETF  +I E+++ K+ ++A  E S AW ++ + ++L + L+T+K VL DA+E QA N+
Sbjct  1     MAETFAFNIVESLVQKLATVAYQETSLAWGVQSDFQRLNDILTTVKDVLLDAEEIQAHNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++++WLQ L+D  YDA+D+LD+F   +L +++     I  KV   F+  + L +RF++  
Sbjct  61    QLRNWLQNLKDACYDAEDVLDEFKIEALRKQVLRQRSIGKKVSHFFSSSNPLAFRFRMAQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+++  R  +IA  + NFH  E +Y        L  +THSFV+ +DIIGRD DKE I+ 
Sbjct  121   KIKKVTLRFGEIAALKANFHLAERHYDTRHVVMGLDRETHSFVQAADIIGRDEDKEKIIR  180

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              LM+  D  D E++  LPIVG+GGLGKT L KLV ND+ +   F  ++WV VS+DF L +
Sbjct  181   ALMQ--DPTDGENICVLPIVGIGGLGKTALAKLVLNDEIIDGEFQLKMWVCVSDDFHLKR  238

Query  795   VIEKILRSAT--GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             +I KI+++A      + ++D+DQLQ+ L   L   +YLL+LDD+WNED  KW  L++LL+
Sbjct  239   IIIKIIKAAKKINGDWSNMDLDQLQKVLRHSLDGKKYLLILDDLWNEDNIKWNELKQLLV  298

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEI  1145
              G  GS+++VTTRS +VA I GT   +NL GL + D   LFL+ AF+++E     NLV+I
Sbjct  299   GGGRGSKIVVTTRSSRVAEIMGTIPTHNLEGLPEKDALSLFLQFAFKKREMNQYSNLVKI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G+EIV+ C G+PL +KTLGS+L  KT E +W  +R++E+WK+ QKE ++ P+LKLSYDQ+
Sbjct  359   GEEIVKSCNGIPLVLKTLGSLLLGKTSEYDWKLVRDSEMWKVMQKENNVFPVLKLSYDQL  418

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P +L+ CFA+  +FPK  E      I+ W+A   +QS + + +  ++G +Y N+L SR  
Sbjct  419   PPYLKLCFAHLSVFPKDYEFNYMELIHFWMAHDLLQSSNENDDPIDIGCRYLNDLSSRSF  478

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD  ++   +    K+H+L+HDLA S+A  EC  + S    I   + HL     +  ++
Sbjct  479   FQDFDKSLSKQYF-FKMHDLLHDLAVSMAKHECSRINSFKQIITSGIRHLYLENSDFFKK  537

Query  1686  EFPQ--PLLNLKNLRYFAY-SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
                    +  L +LR F + + +    S++F+KK L  F++LRVL LQ   L+ +P  I 
Sbjct  538   NSCDFFDIYKLCHLRTFRFENMKADAKSESFIKKCLSKFQKLRVLTLQGSSLEVVPKRIS  597

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRYL+LS+N NIK LP  I KL+ LQTL LI+   ++ELP N  + ++SLK L ++
Sbjct  598   GLKHLRYLDLSSNSNIKKLPNFICKLLCLQTLLLIHA-GIEELPSNM-RYMISLKMLSIS  655

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +++  L K     L  L++LL   C   ++  +  Q++  L  L I +C +L  LP GI+
Sbjct  656   TKQKDLSKNGLEYLKSLRYLLFASCENLEYLFDGIQNLTSLHTLIIVDCKNLIALPQGIK  715

Query  2217  HLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl--------------PKLVSLPA  2354
              L  L+ L I NCE+L L++    +            +              P+L +LP 
Sbjct  716   ALTALKILVISNCEKLHLNMTLASKARGKEDDSQDHHIGSGLRLQTLIIGWLPRLEALPN  775

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV  2534
              L    A  L+ L +  C  LT L +W QN T L+R  IE+CP+LS LPE +      ++
Sbjct  776   WLLGESANTLQILVIEECKNLTTLAEW-QNLTSLERFSIEECPKLSSLPESMPCLR--EL  832

Query  2535  RIIDCPLLNG*C  2570
              I+ CP LN  C
Sbjct  833   SIMHCPSLNERC  844



>gb|KHG07629.1| Putative disease resistance RGA1 [Gossypium arboreum]
Length=854

 Score =   504 bits (1297),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 354/844 (42%), Positives = 505/844 (60%), Gaps = 29/844 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETFL +I E V+ KIV L  DE+  A+N+K +LKKL++T+ +IKAVL DA+ QQ +N 
Sbjct  1     MAETFLFNIAERVVEKIVFLTVDEVRLAFNVKTDLKKLEDTMISIKAVLLDAERQQHQNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK--LRSCSGILTKVRKLFTRPDGLIYRFKI  428
             +++  + KLRD+ YDA+D++DDF   +L ++  +   +    KVR L +    L +  K+
Sbjct  61    KLRLCMWKLRDIFYDAEDVIDDFKCEALRKQDAINHPNINNLKVRVLGSFRLPLSFSLKM  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
             +HKI++I GRL + A +  +F  ++      V     R +T SFV  SD+IGRD DKE+I
Sbjct  121   SHKIKDINGRLGEFATEWNSFDLRQCNDSRHV----FRRETISFVDSSDVIGRDEDKENI  176

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + MLMK  ++ +   V  +PIVG+GGLGKTTL +LVYNDDRV   F  ++W+ VSE+F L
Sbjct  177   ISMLMKPSEDRN---VPVIPIVGIGGLGKTTLAQLVYNDDRVTSFFPLKIWIYVSEEFDL  233

Query  789   SKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             S+++  I++S  G     L ++ LQ  L  +L   ++LLVLDDVWNE+Q KW  LR LL 
Sbjct  234   SRLLNLIIQSVNGVKCDDLTLEVLQARLRSLLNDKKFLLVLDDVWNENQAKWVGLRNLLR  293

Query  969   S--GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLV  1139
             S  G   S++IVTTRS+ VA+I  +   Y L GL   DC  LF K AF +  E +  NL+
Sbjct  294   STDGFSPSKIIVTTRSLNVASIMSSIPPYILKGLPLEDCLTLFTKWAFNDGDETQYSNLI  353

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIR-ENEIWKIEQKETDILPILKLSY  1316
              IG+EIV+KC GVPLAV+TLGS+L+ KTDE +W++IR + EIW++EQ E DILP+LKLSY
Sbjct  354   RIGEEIVKKCKGVPLAVRTLGSLLFQKTDESDWIYIRDQTEIWRLEQHENDILPVLKLSY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             + +P HL++C A+  ++ K E    +  I LW+A G ++ P+ +QE E++G +Y NELLS
Sbjct  414   NHLPSHLQRCLAFLSLYRKDEMYYSDKVIRLWMANGLLEHPEQNQEWEDVGKRYLNELLS  473

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
             R   Q   E   G     K+H+LVHDLA  V+  EC  V S    + E+V HL+   D L
Sbjct  474   RCLIQK--ERDFGLYFTFKMHDLVHDLALDVSQKECKIVNSETETVDENVRHLLLCDDKL  531

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTF----VKKTLLNFRRLRVLMLQNLELKELP  1844
              +   P  L  ++N+R       V   SKTF    +   + NF+ LR L L    L  LP
Sbjct  532   VK--VPHVLEEMENVRTIIIH-DVLVESKTFHESVINLCVSNFKYLRALELWGSPLTALP  588

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             +SIG LK LR L+L    +I+ LP    KL +LQ+LNL     L++LP +  Q+L+ L+ 
Sbjct  589   NSIGTLKHLRDLDLGGCRSIRELPRSFDKLRSLQSLNL-GYTGLQQLP-DCVQRLIELRH  646

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T +   L++  +     LQ+L+LY+C   +   E  Q++K LR L +  C+ L  LP
Sbjct  647   LVITIKATHLKEIQAGCWTSLQYLVLYECKELECLPEGMQYLKSLRTLVLCFCTKLVSLP  706

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl----PKLVSLPAGLKDID  2372
               ++ L KLE L I  C +++L +    E  + LQ  L          L  LP  L    
Sbjct  707   RSLKFLTKLEHLAIGCCVQINLKMEAEEEEDKDLQLSLKTLSLDNLYALTDLPRLLLQGS  766

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID-C  2549
             +  L+ LR+  CP+L+ LP WL N T L +L IEDC  LS LPE I   +N +   ID C
Sbjct  767   SSTLRQLRIMRCPKLSILPAWLLNLTSLHKLEIEDCRNLSALPEGIDRLTNLRELTIDGC  826

Query  2550  PLLN  2561
             P L+
Sbjct  827   PELS  830



>ref|XP_008392218.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=833

 Score =   503 bits (1295),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 343/840 (41%), Positives = 490/840 (58%), Gaps = 50/840 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++ S+A +EI  AW +K +L+ L+ T+STIK VL DA+E+QA+N ++  WL++
Sbjct  8     LAAKLIERLSSIASEEICLAWGVKADLQNLRRTMSTIKDVLLDAEEKQARNDDLSSWLRE  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SGI  KVR+ F+R + + +  ++ H I+EIR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVHGSGIXRKVRRFFSRSNPVAFDLRVGHGIKEIRAR  127

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQ---THSFVRPSDIIGRDSDKESIVGMLMKS  629
             L ++ ED+ NF     ++ +P     LRE    THSFVR S++IGRD++K ++V +LM+ 
Sbjct  128   LQELKEDK-NFADLRPFHHHPXLGDHLRENRNTTHSFVRASEVIGRDTEKNTVVDLLMQQ  186

Query  630   CDEE---DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
              D+    D  +VS +PIVG GGLGKTTL + VYND RVV +FD R+W  VS DF ++ + 
Sbjct  187   GDDHQGGDNGNVSVIPIVGFGGLGKTTLAQSVYNDQRVVGSFDLRMWQHVSVDFDVTSLT  246

Query  801   EKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             ++IL SA G      L +DQLQ  L   L   ++LLVLDD+WN D+ KW  LR+LL+ G 
Sbjct  247   KEILGSALGTQISEGLSLDQLQAQLRDALKDKKFLLVLDDLWNXDRIKWSELRDLLVEGA  306

Query  978   D-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
               GS+++VTTR+I +A+I GT   Y NL  L   DC  LF+KCAF E QE +  +L E+G
Sbjct  307   KIGSKILVTTRNISIASIMGTVGTYINLEVLXFEDCMKLFVKCAFEEGQERQHPSLYEMG  366

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQM  1325
             ++IV+KC GVPLAVKTLGS LY KTDE++W  IR++EIW++E+     ILP L++SY Q+
Sbjct  367   EDIVRKCRGVPLAVKTLGSQLYSKTDERQWRLIRDSEIWELERDGAGHILPALRVSYTQL  426

Query  1326  PYHLRQCFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSR  1499
             P HL+ C   C   PK   +      IN W+A G ++S + GD ELE++G  YF EL  R
Sbjct  427   PSHLKHCLVCCSTLPKNYTKFDSRELINNWMAHGILESREHGDMELEDVGELYFKELWDR  486

Query  1500  FCFQDVVE-AFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVFHADN  1673
               FQ+V + AF  E     +H+L+HDL QSV   E L V S G   + E+V HL+F    
Sbjct  487   SFFQNVKDYAFFYEF---DMHDLIHDLVQSVGQGESLIVGSAGTKGVTENVRHLLFLE--  541

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
              S +     L  L  +R          + ++F+   +  F+ LR L L N   + LPSSI
Sbjct  542   -SGQNVSTTLQKLNKVRTIGV-VDCKDIDESFLXTCISRFKYLRCLGLVNASWELLPSSI  599

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LR LNL+ N  I +LP  I KL +LQ L L  C  L+ELP +   +L+SL+ L  
Sbjct  600   GSLKHLRSLNLAGNVRITALPNSICKLQSLQALTLGRCVXLEELPGDM-SKLISLRCLEF  658

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+++ S                        FP      +  LR L I +CS LTCLP   
Sbjct  659   TTKQSS------------------------FPENGVGCLTSLRYLCIQDCSXLTCLPXDT  694

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
              +L  L  L I NC++L L +         LQ L ++G P++V+LP   +      L+ L
Sbjct  695   SYLXSLRTLIIANCKQLGLVMENYQGIPLXLQKLWIVGXPRMVALPEWFQGA-TNTLQDL  753

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDCPLLNG*C  2570
              +  C  L ALP WL +   L+R+ +  CP+L  LPE+     +  ++RI  CP L   C
Sbjct  754   GIEDCENLEALPGWLTSFKSLRRVGLRSCPKLLSLPEEXHXLPALTELRITKCPDLERRC  813



>gb|KDO49259.1| hypothetical protein CISIN_1g001955mg [Citrus sinensis]
Length=991

 Score =   506 bits (1303),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 306/661 (46%), Positives = 429/661 (65%), Gaps = 12/661 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA-KN  251
             MAE  L D    +L  + S    EI  A+ ++ ++  L++T+ TI+AVL DA+++ + K+
Sbjct  1     MAEGLLFDTVGKILEVLASQIFHEIGLAYGVQDDISNLRDTVDTIQAVLLDAEDKHSRKD  60

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
             H V  WL++L+D VY A+DLLDDF T  L RKL S S +  +V   F++ +   Y  ++ 
Sbjct  61    HAVTIWLRRLKDAVYAAEDLLDDFSTEFLRRKLMSGSRVTKEVLLFFSKYNQFAYALEMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KI+ IR RL  I  DR+ FH  +  Y   VEN   R +THSFV   DIIGRD DK  I+
Sbjct  121   RKIKAIRERLESIKNDRQ-FHLLQQPYERRVENT--RRETHSFVHKEDIIGRDGDKNEII  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+ S + E  ESV+ +PIVG+GGLGKT + +LVYND+ V  +F+ R+WV VS+ F ++
Sbjct  178   DRLLDSSESE-IESVAVIPIVGIGGLGKTAVAQLVYNDEDVKTHFNLRMWVCVSDIFDVT  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++EK++RSAT +    LD+DQLQE L G +   RYLLVLDDVWNE++ KW  L  LLM+
Sbjct  237   TIVEKMIRSATNRESEKLDLDQLQERLRGEIDGKRYLLVLDDVWNENRDKWLELEALLMN  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRN--LVEI  1145
             G  GS+++VTTRS +VA IT     + L GL +   + LF + AF EQ   P++  LV+I
Sbjct  297   GVSGSKIVVTTRSERVARITSKLPFHALRGLPEDMSWSLFTRMAF-EQGSEPKDSKLVQI  355

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK++V KC GVPLA++T+G +LY    E  WLH R++E+ K+ Q+E+DILP LKLSYD +
Sbjct  356   GKDVVGKCAGVPLAIRTIGRLLYYNNTETYWLHFRDDELSKVPQEESDILPKLKLSYDHL  415

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P  L+QCFAYC +FPK   I +E  + LW+AQGF+     +Q  E++G++YF  LLSR  
Sbjct  416   PSPLKQCFAYCALFPKDYLIVKEQLVLLWMAQGFLGLSIDNQCPEDVGHEYFMSLLSRSF  475

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD      G I+ CKIH+L+HDLA+SVAG EC  VK     + E  HH+   +   S  
Sbjct  476   FQDAEYDEWGNIIRCKIHDLMHDLAESVAGTECAKVKLDARNVNERTHHISCVSGFDSSL  535

Query  1686  EFPQPLLNLKNLRYF---AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             EFP  LL  KNLR F    YS     +++++  K + +F+ LR L L N E++ +PS IG
Sbjct  536   EFPTALLRAKNLRTFLSTVYSSSDRQLNESYCNKIVSSFKCLRTLNLSNSEIETVPSLIG  595

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRY NLS+N +IKSLP+ +S+L+NLQTL+L  C+ L ELPR+ G +++SL+ L + 
Sbjct  596   KLKHLRYFNLSHNADIKSLPDSVSRLLNLQTLDLSCCDDLVELPRDIG-KMVSLRHLAIE  654

Query  2037  S  2039
             S
Sbjct  655   S  655



>ref|XP_006451769.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
 ref|XP_006464819.1| PREDICTED: putative disease resistance protein RGA3-like [Citrus 
sinensis]
 gb|ESR65009.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
Length=1024

 Score =   506 bits (1303),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 306/661 (46%), Positives = 429/661 (65%), Gaps = 12/661 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA-KN  251
             MAE  L D    +L  + S    EI  A+ ++ ++  L++T+ TI+AVL DA+++ + K+
Sbjct  1     MAEGLLFDTVGKILEVLASQIFHEIGLAYGVQDDISNLRDTVDTIQAVLLDAEDKHSRKD  60

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
             H V  WL++L+D VY A+DLLDDF T  L RKL S S +  +V   F++ +   Y  ++ 
Sbjct  61    HAVTIWLRRLKDAVYAAEDLLDDFSTEFLRRKLMSGSRVTKEVLLFFSKYNQFAYALEMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KI+ IR RL  I  DR+ FH  +  Y   VEN   R +THSFV   DIIGRD DK  I+
Sbjct  121   RKIKAIRERLESIKNDRQ-FHLLQQPYERRVENT--RRETHSFVHKEDIIGRDGDKNEII  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+ S + E  ESV+ +PIVG+GGLGKT + +LVYND+ V  +F+ R+WV VS+ F ++
Sbjct  178   DRLLDSSESE-IESVAVIPIVGIGGLGKTAVAQLVYNDEDVKTHFNLRMWVCVSDVFGVT  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++EK++RSAT +    LD+DQLQE L G +   RYLLVLDDVWNE++ KW  L  LLM+
Sbjct  237   TIVEKMIRSATNRESEKLDLDQLQERLRGEIDGKRYLLVLDDVWNENRDKWLELEALLMN  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRN--LVEI  1145
             G  GS+++VTTRS +VA IT     + L GL +   + LF + AF EQ   P++  LV+I
Sbjct  297   GVSGSKIVVTTRSERVARITSKLPFHALRGLPEDMSWSLFTRMAF-EQGSEPKDSKLVQI  355

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK++V KC GVPLA++T+G +LY    E  WLH R++E+ K+ Q+E+DILP LKLSYD +
Sbjct  356   GKDVVGKCAGVPLAIRTIGRLLYYNNTETYWLHFRDDELSKVPQEESDILPKLKLSYDHL  415

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P  L+QCFAYC +FPK   I +E  + LW+AQGF+     +Q  E++G++YF  LLSR  
Sbjct  416   PSPLKQCFAYCALFPKDYLIVKEQLVLLWMAQGFLGLSIDNQCPEDVGHEYFMSLLSRSF  475

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD      G I+ CKIH+L+HDLA+SVAG EC  VK     + E  HH+   +   S  
Sbjct  476   FQDAEYDEWGNIIRCKIHDLMHDLAESVAGTECAKVKLDARNVNERTHHISCVSGFDSSL  535

Query  1686  EFPQPLLNLKNLRYF---AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             EFP  LL  KNLR F    YS     +++++  K + +F+ LR L L N E++ +PS IG
Sbjct  536   EFPTALLRAKNLRTFLSTVYSSSDRQLNESYCNKIVSSFKCLRTLNLSNSEIETVPSLIG  595

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRY NLS+N +IKSLP+ +S+L+NLQTL+L  C+ L ELPR+ G +++SL+ L + 
Sbjct  596   KLKHLRYFNLSHNADIKSLPDSVSRLLNLQTLDLSCCDDLVELPRDIG-KMVSLRHLAIE  654

Query  2037  S  2039
             S
Sbjct  655   S  655



>ref|XP_007030144.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao]
 gb|EOY10646.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao]
Length=855

 Score =   498 bits (1283),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 339/850 (40%), Positives = 506/850 (60%), Gaps = 26/850 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL +I E VL KI  LA +E+   +N++ +L++LQ+T++ IKAVL DA+ QQ +N 
Sbjct  1     MAESFLFNIAERVLEKIALLAVEEVRLLFNVENDLEELQDTMTHIKAVLLDAERQQHQNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++  + KLRD+  DA+D++D+    +L +++ +      KVR L +    L +  K+ H
Sbjct  61    ALRLSIWKLRDLFDDAEDVIDEIECEALRKRVVNYPSTSIKVRCLPSCFVPLAFSSKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGK-LREQTHSFVRPSDIIGRDSDKESIV  611
             KI+EI  R++ IA +   F        + V+N + +  +T+SFV  SD+IGRD D+E I+
Sbjct  121   KIKEINKRIDTIATEWDRFKL----VTHQVDNRRVIHRETYSFVNSSDVIGRDEDREKII  176

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L +  DE  + ++  +PIVG+GGLGKTTL + VYND+RV++ F  R+WV VSE+F L 
Sbjct  177   NLLKEPSDE--SGNIPVIPIVGIGGLGKTTLAQFVYNDERVIKLFSLRIWVCVSEEFDLR  234

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +++++++ S + K+     +D LQ  L  +L    +LLVLDDVWNED+ KW   + LLMS
Sbjct  235   RLLKEMICSVSKKNCDDSQIDILQTQLRSLLNENNFLLVLDDVWNEDRAKWIQFKNLLMS  294

Query  972   GCDGSR--VIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVE  1142
               + SR  +IVTTRS+KVA+I  +  +Y L GL   DC  LF K AF +  E R  NL+ 
Sbjct  295   MGNLSRSKIIVTTRSLKVASIMSSCDSYVLKGLFYEDCLTLFTKWAFNDGDERRYPNLMR  354

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IGK+IV+KC GVPLAV+TLGS+L+ KTDE+EW+ +R+NEIW++EQ E DILP+LKLSY  
Sbjct  355   IGKKIVEKCKGVPLAVRTLGSLLFSKTDEREWILLRDNEIWRLEQSENDILPVLKLSYHY  414

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P HL++C  Y  +FPK      +  I  W+A G + S + ++E E++G  YF EL  R 
Sbjct  415   LPSHLQRCLTYLSLFPKDYLYDTDYIIQFWMAYGLLASSNQNEEWEDIGITYFKELWLRC  474

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
               QDV +   G     K+H+L+HDL  +++  ECL V     ++ E V HL F  D  S 
Sbjct  475   FVQDVTD--HGSFYRFKMHDLIHDLTLNLSQRECLTVNRQQMKVIEKVRHLSFSLD--SP  530

Query  1683  EEFPQPLLNLKNLRYFA-----YSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
                PQ L  LK +R        +S    ++ ++FV   +LNF+ LR+L L    L+ELP 
Sbjct  531   LGVPQSLKKLKRVRTIVVPPLPFSTENRSIDESFVNACILNFKYLRLLDLSYTLLEELPE  590

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LK LRYL+LS    ++ +P  I KL +L TL L     L E+P +  Q L+SL+ L
Sbjct  591   SIGTLKHLRYLDLSLCRRMRKIPSSICKLQSLLTLRLFGVP-LIEVPESL-QSLISLRFL  648

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
              +T+  + L+         LQFL L+KC   +   +  QH+  LR L I  C  L  LP 
Sbjct  649   EITTDALLLRVIQPGCWSSLQFLFLHKCDRLESIFDGMQHLTSLRRLGIRGCVRLISLPR  708

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegle----slqslllmglPKLVSLPAGLKDIDA  2375
              ++ L KLE++ I +C++++L +       +    SL++  ++    L  LP  L    A
Sbjct  709   SLKFLTKLEEINIKSCQKINLCMEVEEAEDQDLHLSLKAFSVLWSDALTDLPRLLLKGSA  768

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCP  2552
               L+ +++ GC     LP+WLQN T LQ+L I  C +LS LPE + R ++   ++I  CP
Sbjct  769   NTLQSIQIIGCKNFEVLPEWLQNLTSLQKLEISYCRKLSSLPEGMDRLTALRLLKIKGCP  828

Query  2553  LLNG*CGDTG  2582
              L+  C   G
Sbjct  829   TLSERCRRDG  838



>ref|XP_008240993.1| PREDICTED: disease resistance protein RGA2-like [Prunus mume]
Length=815

 Score =   496 bits (1278),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 350/851 (41%), Positives = 510/851 (60%), Gaps = 60/851 (7%)
 Frame = +3

Query  90    LADITENVLSKIV----SLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             +AD+   + SK++    S+A DEI   W +K +L+KL  T+S IKAVL DA+E+QA N E
Sbjct  1     MADVAFELASKLIEKLSSIAYDEICLVWGVKADLQKLGRTMSAIKAVLLDAEEKQAHNKE  60

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             ++ WLQ+L+DV  DA+DLLD+F   +L ++  +  G   KVR  F+  + + +R K  H+
Sbjct  61    LRSWLQQLKDVFLDAEDLLDEFECQALRKQ--TYHGTTRKVRHFFSPSNPIAFRLKAGHE  118

Query  438   IREIRGRLNQIAEDRRNF------HFKENY--YVNPVENGKLREQ-THSFVRPSDIIGRD  590
             I+ IR RL+++  ++  F      H   N+  + + V+N  +RE  THSFVRPS++IGRD
Sbjct  119   IKGIRERLDELKANKAIFDLLSIDHHGRNHDDHHSSVKNMMMRENMTHSFVRPSEVIGRD  178

Query  591   SDKESIVGMLMKSCDEE--DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWV  764
             S+K+ IV +L++  D +  + ++VS +PIVG+GGLGKTTL KL+YND+RVV+NF+ R+WV
Sbjct  179   SEKKEIVDLLLQQGDNQSGNNKNVSVIPIVGIGGLGKTTLAKLLYNDERVVRNFELRMWV  238

Query  765   SVSEDFSLSKVIEKILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
              VS DF L ++ ++IL SA        L +DQLQ  L   L   ++ LVLDDVW +D+ K
Sbjct  239   YVSVDFDLIRITKEILSSALDTEISDKLSIDQLQGKLRDALKDKKFFLVLDDVWIDDRIK  298

Query  942   WKNLRELLMSGCD-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAF-RE  1112
             W   R++L+ G   GS+++VTTR+I VA++T T   Y NL GLS+ DC  LF+KCAF  E
Sbjct  299   WSEFRDVLIDGAKLGSKILVTTRNISVASVTSTVRTYVNLKGLSNEDCLSLFVKCAFVEE  358

Query  1113  QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-  1289
              E +  NL +IGK+IV+KCGGVPLAV+TLGS LY +TDE++W  IR++EIW++E++    
Sbjct  359   DEKKHPNLFQIGKDIVRKCGGVPLAVRTLGSQLYSETDERKWKLIRDSEIWELEREGAGH  418

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREV-FINLWVAQGFIQSPDGDQ-ELEN  1463
             ILP L+LSY Q+P HL+ C AYC + PKG      +  I  W+A G +Q  D +  ELE+
Sbjct  419   ILPALRLSYTQLPSHLKNCLAYCLLLPKGTFGYYSLDLIYCWMAHGILQPRDHENLELED  478

Query  1464  LGNQYFNELLSRFCFQDV--VEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIP  1637
             +G  YF EL +R  F+ V  V           +H+L+HDL QS+A  E   V S    I 
Sbjct  479   VGELYFKELWARSFFEHVELVNYHYNLSYRFSMHDLIHDLVQSLAEGEFSIVNSSTKNIS  538

Query  1638  ESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLML  1817
             E+V HL       +     + L  ++ +     + R   + ++F+   L  F+ LR+L L
Sbjct  539   ENVRHLPILELGQNGSTMLRKLNKVRTI-----TARGIIIDESFLHTCLSRFKYLRMLGL  593

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              +L LK LPSSIG LK LRYL+L+ N  IK LP  I KL +LQ+L L+ CE L+ LPR+ 
Sbjct  594   FDLSLKGLPSSIGTLKHLRYLDLAGNDEIKKLPNTICKLQSLQSLGLLGCENLENLPRD-  652

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIY  2177
                L  L+ L+LT+++ S  +                  C          +K LR L I+
Sbjct  653   TSNLTCLRLLFLTTKQTSFSENG--------------VGC----------LKSLRFLCIW  688

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAG  2357
              C +LT LP+ + +LA L  L I+ C+ L+L  G        LQ L++ G+PK+++LP  
Sbjct  689   NCGNLTSLPSDMSYLAALRTLVIYKCKRLELVNGNYQVIALRLQKLVIDGVPKMLALPEW  748

Query  2358  LKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVR  2537
             L+   A  L+   +  C  L ALP WL N T L++L +E C +L YLPE++      ++ 
Sbjct  749   LQGA-AETLQDCYIIHCDNLEALPGWLTNFTSLRKLVLESCRKLLYLPEKVHP---LELT  804

Query  2538  IIDCPLLNG*C  2570
             I +CP L   C
Sbjct  805   IENCPKLERRC  815



>ref|XP_002438921.1| hypothetical protein SORBIDRAFT_10g028270 [Sorghum bicolor]
 gb|EER90288.1| hypothetical protein SORBIDRAFT_10g028270 [Sorghum bicolor]
Length=830

 Score =   497 bits (1279),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 332/830 (40%), Positives = 486/830 (59%), Gaps = 24/830 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSL----AQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
             MA+  L     +VL K  S     A +EI SAWN+K E++KL+ +L +I AVL+DA+ +Q
Sbjct  1     MAQVILYSFATSVLQKASSFGTEWAINEIKSAWNIKKEIRKLEKSLMSICAVLQDAERKQ  60

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRF  422
             + +H ++ WL  L+DVVYD DD+LDD  T +L ++L    G  +++R+L      L+Y  
Sbjct  61    SSSHALQVWLDNLKDVVYDIDDVLDDVSTRALEQELHK--GFHSRLRQL------LVYPL  112

Query  423   KITHKIREIRGRLNQIAEDRRNFHFKENYY-VNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             +++H+I+E+R +L++IA ++  F   E    ++P       ++THS +  SDIIGRD  K
Sbjct  113   ELSHRIKEVRDKLDEIATNKAQFGLTERLIDISPARRNS--KETHSSIHESDIIGRDGAK  170

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
               I+  ++ + D   T  +S LPIVGLGG+GKT L KL+YN   + + F+ +LW  +S+ 
Sbjct  171   NEIIARILTAADS--TCPLSVLPIVGLGGIGKTALAKLIYNVTHITKKFELKLWACISDV  228

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             F L K++E IL    GKS  +L ++ + + L G+L   RY LVLDD+WN+   +W+ LR 
Sbjct  229   FDLKKILEDILELGIGKSSKYLKLETVHKKLCGLLQGKRYFLVLDDMWNDKTREWEELRS  288

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLV  1139
             LL  G  GS ++VTTRSI VA++  T   Y++  L  ++C  +F++ AFR++E++   LV
Sbjct  289   LLSIGGAGSVILVTTRSINVASLVNTLEPYDVQTLPHYECMQVFIRHAFRDKEHKDPKLV  348

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
             +IG+ IV+KC GVPLA KTLGS+L    D +EW  I  + +W +EQ +  +LP LKLSYD
Sbjct  349   KIGELIVKKCCGVPLAAKTLGSLLSNCRDVKEWRDIEGDNLWNVEQDKDGMLPALKLSYD  408

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
              +P HLR CFA    FPK   + REV +  W+A G +   +G  +   +G +YF+ELL R
Sbjct  409   ALPPHLRACFASMSTFPKDYVLFREVLVMFWMALGLLHRGNGSGDTLCIGERYFHELLGR  468

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLS  1679
               F D    FD  I +CK+H+L HDL+  V+  E   V     ++PES+ HLV+   + S
Sbjct  469   SLFHDQDLVFDETIESCKMHDLNHDLSIKVSQKERAVVSCRKFDVPESIRHLVWDRQDFS  528

Query  1680  RE-EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
              E  FP+ L   +  R F   +  GTVSK F++   L F+ LRVL+   ++ +ELPS I 
Sbjct  529   TEMRFPKQLKKARRARIFISRYNYGTVSKAFLEYIFLTFKHLRVLVFAEVQFEELPSLIV  588

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              L+ LRYL+L  N  IK LP    KLVNLQTL+L  C+QL ELP      L++L  L LT
Sbjct  589   NLRHLRYLDLQWNMEIKYLPNSFCKLVNLQTLHLGRCDQLVELPSGV-NGLVNLMWLDLT  647

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +Q+  L +R       L FL L  C       E   ++  LR + I+ C  L  LP+ +R
Sbjct  648   TQQKYLFRRGFAGWSSLVFLQLDNCLELISLTEEIGNLTALREIHIFNCPKLASLPSAMR  707

Query  2217  HLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
              L+ L++L+I NC ELDL    E M GL  L+SL+   LPKLV  P   +   A  L+ +
Sbjct  708   QLSTLQRLFINNCAELDLMEPEEAMSGLCCLRSLVFATLPKLVGFPKSFRSA-ASSLECI  766

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII  2543
              +  C  L  LP  +Q  T L+++ I DCP    L  + R  S+   R+I
Sbjct  767   FIDNCKGLERLPGLIQGFTSLKKIVIVDCP---MLRRRCRVGSSKDYRLI  813



>gb|KHN32564.1| Putative disease resistance protein RGA3 [Glycine soja]
Length=876

 Score =   497 bits (1280),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 336/847 (40%), Positives = 503/847 (59%), Gaps = 37/847 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE ++++I+ ++L K+ S   +E S A+ +  +L+ +++ LS +  VL  A+E++ +  
Sbjct  1     MAEIYVSNISASLLGKLASHVYEEASRAYVVYEDLQGIKDPLSIVNGVLLGAEEKKEQRQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V YDA+D+LD+F  L L +++   SG  + KV   F+  + L++R ++T
Sbjct  61    GLREWLRQIQNVCYDAEDVLDEFECLKLRKQVVKASGSTSMKVGHFFSSLNPLVFRLRVT  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE---NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
              +I+++R RL++IA D   F  +    ++ + P      RE THS V  S +IGR +D+E
Sbjct  121   RRIKDVRERLDKIAADGNKFGLERIGGDHRLVPR-----REMTHSHVDASGVIGRGNDRE  175

Query  603   SIVGMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS  773
              I+ +LM+S    D +  +S+  +PIVG+GGLGKTTL KLV+ND R+ + F  ++WV VS
Sbjct  176   EIIKLLMQSHPHGDGDGDKSLCVIPIVGIGGLGKTTLAKLVFNDKRMDELFQLKMWVCVS  235

Query  774   EDFSLSKVIEKILRSA---------TGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
             +DF + ++I KI+ SA         T ++   LD++QLQ  L   L   ++LLVLDD WN
Sbjct  236   DDFDIRQMIIKIINSAAYASAPAIATQENISSLDIEQLQSRLRYKLSGQKFLLVLDDTWN  295

Query  927   EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
             +D+ KW  L++L+  G  GS++IVTTRS  +A++ GT  +Y L GLS  +C  LF+K AF
Sbjct  296   DDRAKWTELKDLIKVGAAGSKIIVTTRSNSIASMIGTVPSYILEGLSIENCLSLFVKWAF  355

Query  1107  RE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE  1283
             +E +E +  NLVEIGKEIV+KC GVPLAV+TLGS L+   D + W  +R+NEIW ++QK+
Sbjct  356   KEGEEKKYPNLVEIGKEIVKKCQGVPLAVRTLGSSLFLNFDLERWEFVRDNEIWNLQQKK  415

Query  1284  TDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN  1463
              DI P LKLSYDQMP +LR CFA+  ++PK       +  NLW A G ++SP G Q++EN
Sbjct  416   NDISPALKLSYDQMPSYLRHCFAFFSLYPKDFGFTGALIANLWAALGLLRSPVGSQKMEN  475

Query  1464  LGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES  1643
             +  QY +EL SR   +D V+   G     K+H+LVHDLA  V+  E L V      IPE 
Sbjct  476   IARQYVDELHSRSFLEDFVDL--GHFYYFKVHDLVHDLALYVSKGELLVVNYRTRNIPEQ  533

Query  1644  VHHL-VFHADNLSREEFPQPLLNLKNLRYFAYS-FRVGTVSKTFVKKTLLNFRRLRVLML  1817
             V HL V   D LS   FP+     + +R   +  + +G  SK  +   +  ++ LRVL L
Sbjct  534   VRHLSVVENDPLSHVVFPKS----RRMRTILFPIYGMGAESKNLLDTWIKRYKYLRVLDL  589

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              +  ++ LP+SI  L+ LR L+L+NNC IK LP  I KL NLQ L+L  C +L+ LP+  
Sbjct  590   SDSSVETLPNSIAKLQHLRALHLTNNCKIKRLPHSICKLQNLQYLSLRGCIELETLPKGL  649

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIY  2177
             G  L+SL+ LY+T+++  L +    SL  LQ L    C   KF     Q +  L VL I 
Sbjct  650   G-MLISLRKLYITTKQSILSEDDFASLSNLQTLSFEYCDNLKFLFRGAQ-LPYLEVLLIQ  707

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl-PKLVSLPA  2354
              C SL  LP  I  L KLE L++  CE L+LS              L +    +  +LP 
Sbjct  708   SCGSLESLPLHI--LPKLEVLFVIRCEMLNLSFNYESPMPRFRMKFLHLEHCSRQQTLPQ  765

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV  2534
              ++   A  L+ L +   P L  LP+WL   T L+ L+I +CP+L YLP  +   +  + 
Sbjct  766   WIQGA-ADTLQTLLILHFPSLEFLPEWLATMTRLKILHIFNCPQLLYLPSDMLGLTALER  824

Query  2535  RIID-CP  2552
              IID CP
Sbjct  825   LIIDACP  831



>ref|XP_010024422.1| PREDICTED: putative disease resistance protein RGA3 [Eucalyptus 
grandis]
 gb|KCW90377.1| hypothetical protein EUGRSUZ_A02518 [Eucalyptus grandis]
 gb|KCW90378.1| hypothetical protein EUGRSUZ_A02518 [Eucalyptus grandis]
Length=837

 Score =   496 bits (1277),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 330/841 (39%), Positives = 510/841 (61%), Gaps = 23/841 (3%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   ++ K+ S A +EI     +K + +KL+NTL  I+ VL DA+++Q K+  V  W
Sbjct  5     VSSILGTLVEKLTSSAVEEIQLVRGVKDDREKLKNTLEMIQTVLADAEQKQIKDKAVHLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGIL--TKVRKLFTRPDGLIYRFKITHKIR  443
             L +L++  YDA+D LD+F   +L R++RS   +    KVR L++    +I++FK+ H ++
Sbjct  65    LLRLKNWCYDAEDALDEFEARALWRQVRSTEHLTLKRKVRYLYSWISKMIFQFKVAHNMK  124

Query  444   EIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLM  623
             E+R  L+ I E++  F+   + +   +    LR +THSFV  S++IGR+ +KESI+ ML 
Sbjct  125   ELRKSLDGIDEEKTRFNLSTDVHERTI---VLRRETHSFVPASNVIGRNEEKESIIEML-  180

Query  624   KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNF--DTRLWVSVSEDFSLSKV  797
             +  D+    ++  LPI+G+GG GKTTL  LVYND+RV ++F  + ++W+S+  +F++  +
Sbjct  181   RRWDDVGARNIEVLPIIGMGGTGKTTLATLVYNDERVKEHFTENNQVWLSMPLEFNMKNI  240

Query  798   IEKILRS-ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             I  I++S   G  F   +++ LQ  L  ++ + R L V+DDVW   +  W  L +LL   
Sbjct  241   IRDIIKSLGGGAKFDDYNLEMLQNDLRKLVQNQRCLFVMDDVWATSRKDWLELIDLLGGI  300

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+VIVT+R+  +A I GT    NL+ LS  D   LF+K AF + QE    +L++IG+
Sbjct  301   SRGSKVIVTSRNQVIAEIMGTVPPVNLANLSPEDSLTLFVKHAFEQGQEKNHPDLIKIGR  360

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV KCGG P+AVKTLGS+LY K+   +W ++R++E+W++E   TDILP L++SYD M  
Sbjct  361   QIVSKCGGNPMAVKTLGSLLYSKSSRSDWEYVRDSEVWQLE---TDILPSLRISYDLMSS  417

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQ-ELENLGNQYFNELLSRFCF  1508
             HL+QCFAYC +FPK  E      I LW++ GFI+S   +Q ELE +G QYF EL+SR  F
Sbjct  418   HLKQCFAYCSIFPKNYEFVNIDLIQLWISNGFIRSSGTNQEELEEIGQQYFEELISR-SF  476

Query  1509  QDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSR  1682
              +VV+  D   +L C++H+L+++LA SVA  E  N+K    +I +   H+ F +  ++S+
Sbjct  477   FNVVDVEDTYSLLVCEMHDLIYELAISVAKTESSNMKEWKQDISQMTRHISFPNPLDVSK  536

Query  1683  EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLN-FRRLRVLMLQNLELKELPSSIGF  1859
             +E    L  L  +R         + S+ F  +T ++ F+ LR L L++    +LPSSIG 
Sbjct  537   DELRDCLSKLSRVRTIVCKRLGSSDSEAFFLETCVSRFKYLRALWLEDSSFDQLPSSIGG  596

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL L  N +I  LP+ + +L NLQTL+L  CE+L+ LP N  + ++SL+ L +T+
Sbjct  597   LKHLRYLRLRGNKSINKLPKSVCELRNLQTLDLGGCEELEALPANI-KNMISLRLLIITT  655

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++    +     L  L++L +  C   +   +  Q +  LR L I EC  L  LP GI++
Sbjct  656   KQQRFPESGIGCLTSLRWLYIVFCEYLEALFDDIQSLSSLRKLCIAECPKLASLPQGIQN  715

Query  2220  LAKLEKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
             L  LE L + +CE L L          +  LQSL+L  LP+LVSLP  L+   A  L+ +
Sbjct  716   LKALEHLMMLDCESLRLPEGDSHEPRSMFRLQSLILHKLPELVSLPEWLEG-SASTLQKI  774

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*CG  2573
             ++  CP L+ALP WLQNC+ L+ L IE CP+LS LP+ +R     K++I DC  L+  CG
Sbjct  775   KIEDCPNLSALPRWLQNCSSLRTLEIEYCPKLSSLPDGVRLIPTLKLKIFDCEELSS-CG  833

Query  2574  D  2576
             +
Sbjct  834   E  834



>ref|XP_003624016.1| Disease resistance protein RGA2 [Medicago truncatula]
 gb|ABN08495.1| Disease resistance protein [Medicago truncatula]
 gb|AES80234.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=853

 Score =   496 bits (1277),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 339/843 (40%), Positives = 502/843 (60%), Gaps = 35/843 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  + E+ ++K+ S A +E S A  +  +L++++NT+S IKAVL DA+ +Q +NH
Sbjct  1     MAESFLFSLAESFITKVASRAVEEASLALGVYDDLREIKNTVSLIKAVLLDAELKQKQNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WLQ+++ V YDA+D+++DF   +L + + + SG I  KVR+  +  + L+YR K+ 
Sbjct  61    ELREWLQQIKRVFYDAEDVINDFECEALRKHVVNTSGSIRRKVRRYLSSSNPLVYRLKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ I  RLN+ A  R NF  + N   N V   K RE THS V  SD+IGRD DK+ I+
Sbjct  121   HQIKHINKRLNKNAAARHNFGLQINDSDNHVV--KRRELTHSHVVDSDVIGRDYDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++   +   +S+S +PIVG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  179   DLLLQ---DSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQ  235

Query  792   KVIEKILRSAT----------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
              ++ KIL SA+           ++  +LD+ QLQ HL   L   ++LLVLDDVW+ED+ K
Sbjct  236   HLLIKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVK  295

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
             W  ++ LL  G +GS+V+VTTRS  +A +  T T+Y L GLS  D   +F+K AF+E +E
Sbjct  296   WIEVKNLLQVGDEGSKVLVTTRSHSIAKMMCTNTSYTLQGLSREDSLSVFVKWAFKEGEE  355

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
              +   L+EIGKEIVQKCGG+PLA++TLGS+L+ K D +EW  +R+NEIW + QKE DILP
Sbjct  356   KKYPKLIEIGKEIVQKCGGLPLALRTLGSLLFLKDDIEEWKFVRDNEIWNLPQKEDDILP  415

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              +KLS+DQ+P +L++CFA   +F K  +        LW A  F+ SP+  + LE++GNQ+
Sbjct  416   AIKLSFDQLPSYLKRCFACFSLFEKDFKFVTYTVTVLWEALDFLPSPNKGKTLEDVGNQF  475

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +EL SR   QD      G +   K+H+LVHDLA  VA  E   +K  +  I ++V HL 
Sbjct  476   LHELQSRSFLQDFY--VSGNVCVFKLHDLVHDLALYVARDEFQLLKLHNENIIKNVLHLS  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
             F  ++L  +  P P      LR   +      V+  F+       + LRVL L +   + 
Sbjct  534   FTTNDLLGQT-PIP----AGLRTILFPLEANNVA--FLNNLASRCKFLRVLRLTHSTYES  586

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP SIG LK LRYLNL  N  +KSLP+ + KL NLQTL L  C +L++LP   G  L+SL
Sbjct  587   LPRSIGKLKHLRYLNLKGNKELKSLPDSVCKLQNLQTLILEGCLKLEKLPNGIG-NLISL  645

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSC-RKFPAEIWQHMKKLRVLRIYECSSLT  2195
             + L++T+ + S   +    L +L+FL +  CSC           +  L+ L I  C ++T
Sbjct  646   RQLHITTMQSSFPDKEIAKLTYLEFLSI--CSCDNLESLLGELELPNLKSLSIIYCGNIT  703

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDID  2372
              LP  ++ +  ++ L I NC +L LS+G         L+ L +  LP+L+S P  L+   
Sbjct  704   SLP--LQLIPNVDSLMISNCNKLKLSLGHENAIPKLRLKLLYIESLPELLSFPQWLQGC-  760

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDC  2549
             A  L  L +  C  L  LP+W      L  L I +CP+L  LP+ +    N + + + DC
Sbjct  761   ADTLHSLFIGHCENLEKLPEWSSTFICLNTLTIRNCPKLLSLPDDVHCLPNLECLEMKDC  820

Query  2550  PLL  2558
             P L
Sbjct  821   PEL  823



>gb|KCW75031.1| hypothetical protein EUGRSUZ_E03806 [Eucalyptus grandis]
Length=861

 Score =   496 bits (1277),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 339/846 (40%), Positives = 499/846 (59%), Gaps = 22/846 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  I + VL KI S A  E  + ++++ ++ +L+NTL+ I AVL DA+EQQAKNH
Sbjct  1     MAESLLFSIAQGVLGKIASSAFQEAVAIYSVEYQIHELKNTLAAITAVLLDAEEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS-CSGILTKVRKLFTRPDGLIYRFKIT  431
             +++ WL +LRDV+YDA+D+LD+     L +++ S   G+  KV   F+  + LI R KI+
Sbjct  61    KLQLWLGRLRDVLYDAEDVLDELECEVLRKRVISRYGGVKKKVHHFFSLSNPLILRAKIS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR  L++I+ ++  F        N + + + RE T+SF+   D++GRD DK+ I+
Sbjct  121   HKIKEIRETLSKISIEKNQFDLNVRSVDNGMVHSRSREMTYSFINKLDVVGRDVDKQKII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LM    + D +++S +PIVG+GGLGKT L KLVYNDD V + F  RLWV V EDF L 
Sbjct  181   EILM----QPDNKNLSVIPIVGIGGLGKTALAKLVYNDDSVKEQFKLRLWVCVPEDFDLK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K I+ I+   TG +  +LD+ Q Q  L   +   ++LLVLDD+W+ D+ +W+ L+ LL  
Sbjct  237   KTIDGIINDVTGGNLSNLDIQQSQTFLRDTIKDKKFLLVLDDIWSNDRSRWEELKALLTG  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G  GS+VIVTTRS +VA++ GT   +NL GLS  D   LF K AF ++E +P  NL++IG
Sbjct  297   GAHGSKVIVTTRSSEVASMMGTHPTHNLEGLSHEDSMALFKKWAFDQKEKQPCPNLLDIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+KC GVPL VKT+GS+LY K +EQ W HIR++EIWK+ +++ D+LP+LKLSYD +P
Sbjct  357   NDIVKKCQGVPLLVKTMGSLLYTKDEEQYWAHIRDSEIWKLVEQKKDVLPVLKLSYDHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL++CFA   +FP+G+    +V I LW++ G I S      LE++G  Y   L  R   
Sbjct  417   SHLKRCFATFSLFPRGKVFRGDVLIMLWISLGLISSSTKKLALEDVGADYIRVLWKRSLI  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL---S  1679
             Q+VVE+     L  K+H+LVH LA  VA  +C  V     EI E V ++ F  D+L   S
Sbjct  477   QEVVESESS--LMFKMHDLVHSLAMIVAQDDCSIVGLDTVEISERVRYISFSTDSLEGIS  534

Query  1680  REEFPQPLL---NLKNLRYFAYSFRV--GTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K L      F V  G +++ FV   +     LR L L+    +ELP
Sbjct  535   NFDGVPPFLRKPTSKRLHAIDLQFNVDDGVITREFVGTCISKCNHLRWLDLRFGSFEELP  594

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             SSI  LKQLR L L +N  +K LP+ I +L +L  L L +C +L +LP+   ++L+SL+ 
Sbjct  595   SSICNLKQLRSLFLGDNKRLKKLPDSICELQSLLYLYLDDCSELGDLPKKM-KRLISLRQ  653

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T++++S+Q+     L  L+ L  +KC   +   E    +  LR L I +C     LP
Sbjct  654   LIVTTKQMSMQESGIQYLENLELLAFHKCQNLRVLFEGACRLTCLRKLEIIDCVGPISLP  713

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKL  2384
                  L  LE L I NC +L L+         +L +L +    +++ L   L D  A  L
Sbjct  714   --FVELIALESLVIINC-KLKLTQDNRSNLPSNLHTLSITKSEQVMELLQCL-DESAYTL  769

Query  2385  KYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLLN  2561
             ++  V  CP  T +P WL N   L+ + +  CP LS +P++I+S +  K +RI  C  L+
Sbjct  770   EFFAVYDCPRFTVIPVWLPNHIRLRVIRLIRCPNLSSIPQEIQSLTALKELRIEYCGELS  829

Query  2562  G*CGDT  2579
               C  T
Sbjct  830   ERCRPT  835



>ref|XP_006604334.1| PREDICTED: putative disease resistance protein RGA1-like [Glycine 
max]
Length=872

 Score =   495 bits (1275),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 340/854 (40%), Positives = 500/854 (59%), Gaps = 43/854 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+  I E++++K+ S +  E S    L   L+ LQ TLS +KAVL DA+++Q  NH
Sbjct  1     MAELFIFSIAESLITKLASHSFQEASRVVGLYDHLRDLQKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDA+D+LD+F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYDAEDVLDEFECQTLRKQVLKAHGTIKDEVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE+I
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRATSRMTHSRVSDSDVIGREHDKENI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDGKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDECFSLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ S          ++   +D++QLQ  L   L   ++LLVLDDVWN D+ KW 
Sbjct  241   NQLIIKIINSVNVNDAPLRQQNLDMVDLEQLQNQLTSKLAGQKFLLVLDDVWNNDRVKWV  300

Query  948   NLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
              LR LL  G   GS+++VTTR   +A + GT T++ L  LS  +   LF++ AF+E +E 
Sbjct  301   ELRNLLQEGVAAGSKILVTTRIDSIAFMMGTVTSHKLQSLSPENSMSLFVRWAFKEGEEE  360

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  +L+ IGKEIV+KC GVPLAV+TLGS L+ K +  EW ++R+NEIW + QK+ DILP 
Sbjct  361   KHPHLLNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLSQKKDDILPA  420

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPR-EVFINLWVAQGFIQSPDGDQELENLGNQY  1478
             LKLSYD +P +LRQCFA   ++PK       EV I LW A G + SP  ++ LEN+  QY
Sbjct  421   LKLSYDFLPSYLRQCFALFSLYPKDYAFASFEVHI-LWGALGLLASPRKNETLENVVKQY  479

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +ELLSR   QD ++   G +   KIH+LVHDLA  VA  ECL +KS    IPE + HL 
Sbjct  480   LDELLSRSFLQDFIDT--GTMCQFKIHDLVHDLALFVAKDECLLIKSHIQNIPEIIRHLS  537

Query  1659  FHADNLSREEFPQPLLNLKNLRY--FAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLEL  1832
             F   N     F    + ++ + +   A    V  +  T V K    F+ LRVL L++   
Sbjct  538   FAEYNFIGNSFTSKSVAVRTIMFPNGAEGANVEALLNTCVSK----FKLLRVLDLRDSTC  593

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
               LP SIG LK LRY ++ NN NIK LP  I KL NLQ LN+  CE+L+ LP+   ++L+
Sbjct  594   NTLPRSIGKLKHLRYFSIENNRNIKRLPNSICKLQNLQLLNVSGCEELEALPKGL-RKLI  652

Query  2013  SLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLR  2171
             SL+ L +T+++  L      +L  L  L +             KFPA        L+ L 
Sbjct  653   SLRLLEITTKQPVLPYSEITNLISLAHLCISSSHNMESIFGGVKFPA--------LKTLY  704

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSV----gegmegleslqslllmglPKL  2339
             + +C SL  LP  + +  +LE L + +C  LDL +     E       L+ +  +GLP+L
Sbjct  705   VVDCHSLKSLPLDVTNFPELETLVVQDCVNLDLDLWKEHHEEQNPKLRLKFVAFVGLPQL  764

Query  2340  VSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-  2516
             V+LP  L++  A  L+ L +  C  L  LP+WL   T L+ L+I  CPEL  LP+ I   
Sbjct  765   VALPQWLQET-ANSLQSLAIKNCDNLEMLPEWLSTLTNLKVLHILACPELISLPDNIHHL  823

Query  2517  SSNAKVRIIDCPLL  2558
             ++  ++RI  CP L
Sbjct  824   TALERLRIAYCPEL  837



>ref|XP_009355523.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=913

 Score =   496 bits (1277),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 333/822 (41%), Positives = 481/822 (59%), Gaps = 90/822 (11%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ ++  +A +EI  AW +K +L+KL  T+STIK VL DA+E+QA+N E++ WL +
Sbjct  8     LAAKLIERLSPIASEEICLAWGVKVDLQKLGRTMSTIKDVLLDAEEKQARNKELRSWLLQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD+F   +L R++   SG   KVR+ F+R + +++R  + H I++IR R
Sbjct  68    LKDVFLDAEDLLDEFECEALRRQVVRGSGTTRKVRRFFSRSNPVVFRLGVCHGIKDIRER  127

Query  459   LNQIAEDR-----RNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLM  623
             L+++ ED+     R  H  ++   N       R  THSFVR S++IGR+++K  ++ +L+
Sbjct  128   LHELKEDKNFSDLRTVHLGDHVREN-------RNTTHSFVRASEVIGRETEKNEVIDLLV  180

Query  624   KSCDEE--DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKV  797
             +  D +  +  +VS +PIVG GGLGKTTL KLVYND+RVV  F+ R+W +VS DF ++++
Sbjct  181   QGDDHQGGNNRNVSVIPIVGFGGLGKTTLAKLVYNDERVVGCFNLRMWQNVSVDFDIARL  240

Query  798   IEKILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
              ++IL SA G      L MDQLQE L   L   ++LLVLDDVWNED+ KW  LR+LL+ G
Sbjct  241   AKEILGSALGTKISEGLSMDQLQEQLRDALKDKKFLLVLDDVWNEDRIKWTELRDLLIEG  300

Query  975   CD-GSRVIVTTRSIKVATITGTTTAY-NLSGLSDHDCFDLFLKCAFR-EQEYRPRNLVEI  1145
                G++++VTTR+I VA+I GT   Y NL  LS  D   LF+KCAF   QE +   L E+
Sbjct  301   AKVGTKILVTTRNIPVASIMGTVGTYINLDVLSFEDSLSLFVKCAFEGGQERQHPILYEM  360

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQ  1322
             GK+IV+KCGGVPLAVKTLGS LY KTDE++W  I+++EIW++E++    ILP L+LSY Q
Sbjct  361   GKDIVRKCGGVPLAVKTLGSQLYSKTDERQWQLIKDSEIWELEREGAGHILPALRLSYSQ  420

Query  1323  MPYHLRQCFAYCCMFPKG-EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLS  1496
             +P HL+QC A C + PK   +      I+ W+A G ++S D G+ +LE++G  YF EL  
Sbjct  421   LPSHLKQCLACCSILPKNYTDFDSRELISHWMAHGILESRDHGNMQLEDVGELYFKELWE  480

Query  1497  RFCFQDVVE-----AFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLV  1658
             R  FQ+V +      FD       IH+L+HDL QSVA  E   V S G   + ++V HL 
Sbjct  481   RSFFQNVKDCTFCYTFD-------IHDLIHDLVQSVAQGESFTVDSEGTIGLSKNVRHLT  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
             F     +     Q L  ++ +     +     + ++F+   +  F+ LRVL L N+  + 
Sbjct  534   FLEIGQNVSTILQKLNKVRTIS----AVSCKNIDESFLHTCISRFKYLRVLRLVNVSWEL  589

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LPSSIG LK LR L+ ++N  I  LP  I KL +LQTL+L  C  L+ELP++   +L+SL
Sbjct  590   LPSSIGSLKHLRSLDFTDNGGITELPNSICKLQSLQTLHLGGCVNLEELPKDM-SKLISL  648

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTC  2198
             + L LT+++ S                        FP      +K LR L I+ECS+LTC
Sbjct  649   RYLELTTKQTS------------------------FPENGVGCLKSLRYLSIWECSNLTC  684

Query  2199  LPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAM  2378
             LP    +L  L  L I NC++LDL +                       +P        +
Sbjct  685   LPCDTSYLVSLRTLIIDNCKQLDLVMENYQ------------------EIP--------L  718

Query  2379  KLKYLRVAGCPELTALPDWLQNCT-LLQRLYIEDCPELSYLP  2501
             +L+ L + G P + ALP+W Q  T  LQ L I DC  L  LP
Sbjct  719   RLQKLGIVGVPRMVALPEWFQGATNTLQVLVISDCENLVALP  760



>ref|XP_003553413.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine 
max]
Length=881

 Score =   494 bits (1273),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 335/849 (39%), Positives = 500/849 (59%), Gaps = 34/849 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+  I E++L K+ S   +E S A+++  +L+ ++ TLS +K VL DA+E++ + H
Sbjct  1     MAESFVFHIAESLLQKLASYVSEEASRAYDVYEDLQVIKGTLSIVKGVLLDAEEKKEQKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL ++++V +DA+D+LD F   +L +++   SG    KV   F+  + L++R  + 
Sbjct  61    GLREWLMQIQNVCFDAEDVLDGFECQNLRKQVVKASGSTRMKVGHFFSSSNSLVFRLSMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I+ +R RL++IA D   F  +     + +   + RE T+S +  S +IGRD+D+E I+
Sbjct  121   RQIKHVRCRLDKIAADGNKFGLERISVDHRLV--QRREMTYSHIDASGVIGRDNDREEII  178

Query  612   GMLMK---SCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+     D +  +SV  +PIVGLGG+GKTTL KLV+ND R+ + F  ++WV VS+DF
Sbjct  179   KLLMQPHPHGDGDGDKSVCVIPIVGLGGMGKTTLAKLVFNDKRIDELFQLKMWVCVSDDF  238

Query  783   SLSKVIEKILRSATG------------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
              + ++I KI+  A+             +S  +LD++QLQ  L   L    YLLVLDD+WN
Sbjct  239   DIRQIIIKIINCASASTSAPSIALAHHESINNLDIEQLQSQLRHKLSGLTYLLVLDDIWN  298

Query  927   EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
             +D+ KW  L +L+  G  GS+++VTTRS  +A++ GT  +Y L GLS  +C  LF+K AF
Sbjct  299   DDRAKWIELNDLIKVGAVGSKILVTTRSDSIASMVGTVPSYVLEGLSVENCLSLFVKWAF  358

Query  1107  RE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE  1283
             +E +E +  NLV+IGKE+V+KC GVPLAV+TLGS L+   D + W  +R++EIW + QK+
Sbjct  359   KEGEEKKYPNLVDIGKEMVKKCQGVPLAVRTLGSSLFLNFDLERWEFVRDHEIWNLNQKK  418

Query  1284  TDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN  1463
              DILP LKLSYDQMP +LRQCFAY  +FPK        F++LW + G ++SP G Q++EN
Sbjct  419   DDILPALKLSYDQMPSYLRQCFAYFSLFPKDFGHIGSHFVSLWGSFGLLRSPSGSQKVEN  478

Query  1464  LGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES  1643
             +  QY  EL SR   +D V+   G +   K+H+LVHDLA  VA  E L V S    IP+ 
Sbjct  479   IARQYIAELHSRSFLEDFVDF--GHVYYFKVHDLVHDLASYVAKEEFLVVDSRTRNIPKQ  536

Query  1644  VHHL-VFHADNLSREEFPQPLLNLKNLRYFAYS-FRVGTVSKTFVKKTLLNFRRLRVLML  1817
             V HL V   D+LS   FP+     +++R   +  F VG  S+  +   +  ++ LRVL L
Sbjct  537   VRHLSVVENDSLSHALFPKS----RSVRTIYFPMFGVGLDSEALMDTWIARYKYLRVLHL  592

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              +   + LP+SI  L+ LR LNL+NNC IK LP  I KL NLQ L+L  C +L+ LP+  
Sbjct  593   SDSSFETLPNSIAKLEHLRALNLANNCKIKRLPHSICKLQNLQVLSLRGCMELQTLPKGL  652

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIY  2177
             G  LMSL+  Y+T+++  L +     L  L  L    C   KF  ++ Q +  L VL + 
Sbjct  653   G-MLMSLRKFYITTKQSILSEDEFARLRNLHTLSFEYCDNLKFLFKVAQ-VSSLEVLIVQ  710

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLVSLPA  2354
              C SL  LP  I  L KLE L++  CE L+LS           ++ L L   P+   LP 
Sbjct  711   SCGSLESLPLHI--LPKLESLFVKRCERLNLSFNSESPIQKLRMKLLHLEHFPRQQILPQ  768

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAK  2531
              ++      L+ L +     L  LP+WL   T ++ L+I +CP L Y P  + R S+   
Sbjct  769   WIEGA-TNTLQTLFIVNFHSLEMLPEWLTTMTHVKMLHIVNCPRLLYFPSDMNRLSALED  827

Query  2532  VRIIDCPLL  2558
             + I  CP L
Sbjct  828   LDIDGCPEL  836



>ref|XP_003526943.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine 
max]
Length=876

 Score =   494 bits (1272),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 335/847 (40%), Positives = 501/847 (59%), Gaps = 37/847 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE ++++I  ++L K+ S   +E S A+ +  +L+ ++++LS +  VL  A+E++    
Sbjct  1     MAEIYVSNIAASLLGKLASHVYEEASRAYVVYEDLQGIKDSLSIVNGVLLGAEEKKELRQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V YDA+D+LD+F    L +++   SG  + KV   F+  + L++R ++T
Sbjct  61    GLREWLRQIQNVCYDAEDVLDEFECQKLRKQVVKASGSTSMKVGHFFSSLNPLVFRLRVT  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE---NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
              +I+++R RL++IA D   F  +    ++ + P      RE THS V  S +IGR +D+E
Sbjct  121   RRIKDVRERLDKIAADGNKFGLERIGGDHRLVPR-----REMTHSHVDASGVIGRGNDRE  175

Query  603   SIVGMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS  773
              I+ +LM+     D +  +S+  +PIVG+GGLGKTTL KLV+ND R+ + F  ++WV VS
Sbjct  176   EIIKLLMQPHPHGDGDGDKSLCVIPIVGIGGLGKTTLAKLVFNDKRMDELFQLKMWVCVS  235

Query  774   EDFSLSKVIEKILRSA---------TGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
             +DF + ++I KI+ SA         T ++   LD++QLQ  L   L   ++LLVLDD WN
Sbjct  236   DDFDIRQMIIKIINSAAYASAPAIATQENISSLDIEQLQSRLRYKLSGQKFLLVLDDTWN  295

Query  927   EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
             +D+ KW  L++L+  G  GS++IVTTRS  +A++ GT  +Y L GLS  +C  LF+K AF
Sbjct  296   DDRAKWTELKDLIKVGAAGSKIIVTTRSNSIASMIGTVPSYILEGLSIENCLSLFVKWAF  355

Query  1107  RE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE  1283
             +E +E +  NLVEIGKEIV+KC GVPLAV+TLGS L+   D + W  +R+NEIW ++QK+
Sbjct  356   KEGEEKKYPNLVEIGKEIVKKCQGVPLAVRTLGSSLFLNFDLERWEFVRDNEIWNLQQKK  415

Query  1284  TDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN  1463
              DILP LKLSYDQMP +LR CFA+  ++PK       +  NLW A G ++SP G Q++EN
Sbjct  416   NDILPALKLSYDQMPSYLRHCFAFFSLYPKDFGFTGALIANLWAALGLLRSPVGSQKMEN  475

Query  1464  LGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES  1643
             +  QY +EL SR   +D V+   G     K+H+LVHDLA  V+  E L V      IPE 
Sbjct  476   IARQYVDELHSRSFLEDFVDL--GHFYYFKVHDLVHDLALYVSKGELLVVNYRTRNIPEQ  533

Query  1644  VHHL-VFHADNLSREEFPQPLLNLKNLRYFAYS-FRVGTVSKTFVKKTLLNFRRLRVLML  1817
             V HL V   D LS   FP+     + +R   +  + +G  SK  +   +  ++ LRVL L
Sbjct  534   VRHLSVVENDPLSHVVFPKS----RRMRTILFPIYGMGAESKNLLDTWIKRYKYLRVLDL  589

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              +  ++ LP+SI  L+ LR L+L+NNC IK LP  I KL NLQ L+L  C +L+ LP+  
Sbjct  590   SDSSVETLPNSIAKLQHLRALHLTNNCKIKRLPHSICKLQNLQYLSLRGCIELETLPKGL  649

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIY  2177
             G  L+SL+ LY+T+++  L +    SL  LQ L    C   KF     Q +  L VL I 
Sbjct  650   G-MLISLRKLYITTKQSILSEDDFASLSNLQTLSFEYCDNLKFLFRGAQ-LPYLEVLLIQ  707

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl-PKLVSLPA  2354
              C SL  LP  I  L KLE L++  CE L+LS              L +    +  +LP 
Sbjct  708   SCGSLESLPLHI--LPKLEVLFVIRCEMLNLSFNYESPMPRFRMKFLHLEHCSRQQTLPQ  765

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV  2534
              ++   A  L+ L +   P L  LP+WL   T L+ L+I +CP+L YLP  +   +  + 
Sbjct  766   WIQGA-ADTLQTLLILHFPSLEFLPEWLATMTRLKILHIFNCPQLLYLPSDMLGLTALER  824

Query  2535  RIID-CP  2552
              IID CP
Sbjct  825   LIIDACP  831



>ref|XP_007202992.1| hypothetical protein PRUPE_ppa019012mg [Prunus persica]
 gb|EMJ04191.1| hypothetical protein PRUPE_ppa019012mg [Prunus persica]
Length=830

 Score =   492 bits (1267),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 343/851 (40%), Positives = 497/851 (58%), Gaps = 62/851 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     +   ++ K+ S+A ++I  AW +K +LKKLQ T+STIK VL DA+++QA N 
Sbjct  1     MAEVAFP-LATKLIEKLGSIASEQICLAWGVKADLKKLQRTMSTIKDVLLDAEQKQAHNQ  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             +++ WL++L+DV  DA+DLLD+F   +L R++  +  G   KVR+ F+R + + +RF++ 
Sbjct  60    QIRSWLRQLKDVFLDAEDLLDEFECEALRREVVETFHGTTGKVRRFFSRSNPIAFRFRVG  119

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             ++I+EIR RL+++  ++  F   ++  + P   G   +    FV  S +IGR+S+KE IV
Sbjct  120   NEIKEIRERLDELKSNKAIF---DSLTILPHGYGG-EDHERPFVPASKVIGRESEKEEIV  175

Query  612   GMLMKSCDEEDT----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
              +LM+  D++ +      VS +PIVG+GGLGKTTL K VY+D RVV +F+ R+W SV  D
Sbjct  176   NLLMQQGDDDQSGNSNNKVSVIPIVGIGGLGKTTLAKWVYDDKRVVGHFELRMWASVPVD  235

Query  780   FSLSKVIEKILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             F L+K+   IL SA        L +DQLQ  L   L    +LLVLDDVW +D  KW  LR
Sbjct  236   FELTKLTRLILGSALNTEISDKLTLDQLQGKLREALKDKTFLLVLDDVWKDDALKWSQLR  295

Query  957   ELLMSGC-DGSRVIVTTRSIKVATITGTTTA-YNLSGLSDHDCFDLFLKCAFRE-QEYRP  1127
             +L++ G   GS+++VTTRS  VA I GT     NL  LS  +C  LF++CAF+E  E   
Sbjct  296   DLVIEGAKSGSKILVTTRSTTVAEIMGTIPENINLEFLSFEECLSLFVECAFKEGHEKEY  355

Query  1128  RNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              NL ++G+EIV+KCGGVPLAVKTLGS LY KTD++EW  +R+++IWK++Q+++ ILP L+
Sbjct  356   PNLFKMGEEIVRKCGGVPLAVKTLGSQLYSKTDQREWKLVRDSDIWKLKQEDSHILPALR  415

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSP--DGDQELENLGNQY  1478
             LSY ++P HLRQC AYC    K   E      I+ W+A G +      G+ ELE++G  Y
Sbjct  416   LSYTRLPPHLRQCLAYCFHLRKDRIEFNSSDLISYWMAHGILDQSRVHGNMELEDIGELY  475

Query  1479  FNELLSRFCFQDVVE-----AFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE-IPE  1640
             F +L +R  FQ+V++      FD       +H+L+HDL QSVA  EC  VKS + E   E
Sbjct  476   FKDLWARSFFQNVIDLDIYYRFD-------MHDLIHDLVQSVAQGECFTVKSANTEDKSE  528

Query  1641  SVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQ  1820
             +V HL       +     Q L  ++ +           + ++F+      F+ LRV+ L 
Sbjct  529   NVRHLTVLEAGQNVSTTLQKLNKVRTITAVETK-----IDESFMCTCFSRFKYLRVVELL  583

Query  1821  NLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG  2000
                L+ LPSSIG LK LRYL+LS N  I  LP  I +L +LQ+L LI C  L+ELPR+  
Sbjct  584   TCSLQVLPSSIGSLKHLRYLDLSYNEAITKLPNAICRLQSLQSLYLIGCVNLEELPRDIS  643

Query  2001  QQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYE  2180
              +L+S+ TL LT+++ S  K    SL                        K LR L I  
Sbjct  644   -KLISIITLELTTKQTSFPKNGVGSL------------------------KSLRFLTISR  678

Query  2181  CSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGL  2360
             CS+LT LP    +LA L  L ++ CE+LDL           LQ L +  LP++V+LP   
Sbjct  679   CSNLTSLPHETSYLASLRTLMLYKCEKLDLWNVNYPGTPLRLQELDIENLPRMVALPEWF  738

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRI  2540
             +   A  L++L +  C  L ALP+WL + T L++L I+ C +L  LPE + S ++ +  +
Sbjct  739   QGA-ANTLQFLYIGMCENLEALPEWLASFTSLKKLVIDSCQKLLSLPEGMCSLTSLRELV  797

Query  2541  I-DCPLLNG*C  2570
             I DCP L   C
Sbjct  798   IDDCPELERRC  808



>ref|XP_010024090.1| PREDICTED: putative disease resistance protein RGA1 [Eucalyptus 
grandis]
Length=845

 Score =   493 bits (1268),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 329/836 (39%), Positives = 494/836 (59%), Gaps = 29/836 (3%)
 Frame = +3

Query  111   VLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdv  290
             ++ ++VS A +EI     +K +  KL+N L  IK  L DA+++Q  N  V+ WL K++D 
Sbjct  7     LVGRLVSAALEEIQKLLGVKGDQDKLKNLLEMIKKTLADAEQKQTTNQAVRIWLSKVKDF  66

Query  291   vydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQI  470
              YDA+D+LD+F   +L R+ R       KV   F+     I++F++ +K++E+R RL +I
Sbjct  67    CYDAEDVLDEFEAKALWRRARP----KRKVHYWFSWLSNFIFQFEMANKMKELRKRLLEI  122

Query  471   AEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTE  650
              E++   H   N     +   K   +THSFV  S++IGR+ DK+ I+ +LM++ D++   
Sbjct  123   NEEKNELHLSSNVCDKSIVQWK---ETHSFVTISNVIGRNKDKQRIIELLMRT-DDDGVG  178

Query  651   SVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGK  830
              V  + IVG+GG+GKTTL K VY DDR+ + FD ++W+S+S DF + K+I  I+ S + +
Sbjct  179   KVGVISIVGMGGIGKTTLAKWVYMDDRISKYFDLKVWLSMSVDFEVKKIIRDIIESLSHE  238

Query  831   S-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTR  1007
             +      +++LQ HL  ++ + R LLV+DDVW   +  W+ LR+LL    +GS+VIVT+ 
Sbjct  239   AKCDSWSLEKLQNHLRSIVENKRCLLVMDDVWEVSRENWEGLRDLLEGVSEGSKVIVTSW  298

Query  1008  SIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPL  1184
             +  + +  GT   +NL+ LS  D   LF+KCAF + QE    +L+ IGKEIV KC G P+
Sbjct  299   NKSIVSTMGTVPPHNLANLSQEDSLTLFMKCAFDQGQEKNHPDLMAIGKEIVSKCAGNPM  358

Query  1185  AVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCM  1364
             AVKTLGS+LY KT    W  IR++EI +++   T ILP L++SYD MP+HL+QCFAYC +
Sbjct  359   AVKTLGSLLYSKTKLSNWECIRDSEILQLQ---TGILPSLRISYDLMPFHLKQCFAYCSI  415

Query  1365  FPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEIL  1544
             FPK  +      I LW+A G IQS    QELE +G QY+ EL SR  F DVVE  D   L
Sbjct  416   FPKNYKFNNLELIQLWIANGLIQSSGNTQELEEIGQQYWEELWSRSFFDDVVE--DYLFL  473

Query  1545  ACKIHNLVHDLAQSVAGAECLNVKSG--DPEIPESVHHLVFHADN-LSREEFPQPLLNLK  1715
               K+H+L+H LA SVA  E  NV       ++  +  H+ F   + L  +E P  L  L 
Sbjct  474   TFKMHDLIHQLAISVAQTESSNVNMNMRTQDVSPTTQHISFSDPSLLPEDELPSYLSKLS  533

Query  1716  NLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSN  1892
              +R   +  +  G+  ++F++  +  F++LRVL L +    +LPSSI  LKQLRYL+L  
Sbjct  534   RVRTIMFPIKKEGSTGESFLEMCISRFKQLRVLYLHDSSFDQLPSSISGLKQLRYLHLCG  593

Query  1893  NCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSV  2072
             N +IK LP  I +L NLQ+L L  CE+L+ELP +  + +++L+ L +T+++    ++   
Sbjct  594   NRSIKKLPNSICELHNLQSLGLAGCEELEELPVHI-KSMINLRFLDITTKQQRFPEKGIG  652

Query  2073  SLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWN  2252
              L  L+ L++  C   +      + +  LR L I  C  L  LP  I++L  LE LWI N
Sbjct  653   CLTSLRCLIIGDCKNLEVLFNDMESLMLLRKLFIGGCPKLASLPQCIKNLKALENLWICN  712

Query  2253  CEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTAL  2426
             CE L L    G+    +  L+S++ +GLPK+VS P  L+      L+ + V  CP L  L
Sbjct  713   CENLKLPEGEGDEPRSMSRLRSVMFVGLPKIVSFPRWLEG-STRTLQKIDVVHCPNLGTL  771

Query  2427  PDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*CGDTGTRLS  2594
             P+WLQNC  L++L IEDCP+LS LP+ IR  +  +   ID       CG+  +R++
Sbjct  772   PEWLQNCFSLRKLKIEDCPKLSSLPDGIRHIATLRELWIDD------CGEISSRIA  821



>ref|NP_001235657.1| disease resistance protein [Glycine max]
 gb|ACM89625.1| disease resistance protein [Glycine max]
Length=863

 Score =   493 bits (1268),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 335/846 (40%), Positives = 499/846 (59%), Gaps = 27/846 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAESFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDA D+LD+F   +L ++L    G I  +V   F+  + L +R K+ 
Sbjct  61    ELQEWLRQLKSVFYDAQDVLDEFECQTLRKQLLKAHGTIKDEVSHFFSSSNPLGFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE +
Sbjct  121   QQIKDLSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKL  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +++S +PIVG+GGLGKTTL K V+ND+RV + F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDDKNLSVIPIVGIGGLGKTTLAKFVFNDERVDECFKLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
              ++  KI+ SA         ++   +D++QLQ  L  +L   ++LLVLDDVWN+D+ KW 
Sbjct  241   YQLFIKIINSANVADAPLPQQNLDMVDLEQLQNQLRNILAGQKFLLVLDDVWNDDRLKWV  300

Query  948   NLRELL-MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
              LR L+ + G  GSR++VTTR   +A++ GT T++ L  LS  +   LF+K AF+E +E 
Sbjct  301   ELRNLIKVGGAAGSRILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEE  360

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  +LV IGKEIV+KC GVPLAV+TLGS L+ K +  EW ++R+NEIW + Q + DILP 
Sbjct  361   KHPHLVNIGKEIVKKCRGVPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQNKGDILPA  420

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             LKLSYD +P +L+QCFA   ++PK      +    LW A G + SP  D   EN+  QY 
Sbjct  421   LKLSYDFLPSYLKQCFALFSLYPKDYSFNSDEVARLWGALGLLASPRKDATPENIVKQYL  480

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
             +ELLSR   QD ++   G I   KI  LVHDLA  VA  ECL V S    IP+++ HL F
Sbjct  481   DELLSRSFLQDFIDF--GTICLFKIPYLVHDLALFVAKDECLLVNSHTQNIPDNILHLSF  538

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
                N     F    + ++ +  F      G+V ++ +   +  F+ LRVL L++   K L
Sbjct  539   AEYNFLGNSFTSKSVAVRTI-IFPNGAEGGSV-ESLLNTCVSKFKLLRVLDLKDSTCKTL  596

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P SIG LK LRY ++ NN NI+ LP  I KL NLQ LN+  C++L+ LP+  G +L+SL+
Sbjct  597   PRSIGKLKHLRYFSIENNRNIERLPNSICKLQNLQLLNVWGCKKLEALPKGLG-KLISLR  655

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMK--KLRVLRIYECSSLT  2195
              L++T+++  L      +L  +    LY  S     + I+  +K   L+ L +  C SL 
Sbjct  656   LLWITTKQPVLPYSEITNL--ISLAHLYIGSSYNMES-IFGRVKLPALKTLNVAYCDSLK  712

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSV----gegmegleslqslllmglPKLVSLPAGLK  2363
              L   + +  +LE L +  C  LDL +     E   G   L+ L    LP+LV+LP  L+
Sbjct  713   SLTLDVTNFPELETLIVVACVNLDLDLWKEHHEERNGKLKLKLLGFRDLPQLVALPQWLQ  772

Query  2364  DIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRI  2540
             +  A  L+ LR++GC  L  LP+WL   T L+ L I DCP+L  LP+ I   +  + +RI
Sbjct  773   ET-ANSLQSLRISGCDNLEILPEWLSTMTNLKVLLISDCPKLISLPDNIDHLAALEWLRI  831

Query  2541  IDCPLL  2558
             + CP L
Sbjct  832   VGCPEL  837



>gb|KEH42967.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=847

 Score =   492 bits (1266),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 328/838 (39%), Positives = 498/838 (59%), Gaps = 31/838 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + K+ S A  + S A  +  +L+++++T+S IKAVL DA+++Q +N 
Sbjct  1     MAESLLFGLAESFIVKLASSAVKQASLALGVYQDLQEIRDTISFIKAVLLDAEKKQHQNQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGIL-TKVRKLFTRPDGLIYRFKIT  431
             E+++W+++++ +   A+D++DDF   +L +++ + SG    KVR+  +  + ++YR KI 
Sbjct  61    ELREWMRQIKRIFSKAEDIIDDFECEALQKQVVNTSGSRRKKVRRFLSSSNPIVYRLKIA  120

Query  432   HKIREIRGRLNQIAEDRRNF--HFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKES  605
             H+I+ I+  LN++AE R  F  H KE+      +    R +THS V  SD+IGR+ DK+ 
Sbjct  121   HRIQHIKESLNKVAEIRDKFGLHIKESD-----DRVVQRRETHSHVNDSDVIGREQDKQK  175

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             IV +L    D+ D +++S + IVGLGG+GKTTL K+V+ND  VV +F  ++W+ VS+DF 
Sbjct  176   IVELLF---DDSDDKNLSVVAIVGLGGMGKTTLAKVVFNDKSVVDSFPLKMWICVSDDFD  232

Query  786   LSKVIEKILRSATGKS----FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNL  953
             +  ++ KI+ SA  ++      +  ++QL+  L  +L   ++LLVLDDVWNED+ KW+  
Sbjct  233   VKNLLVKIIGSAPDQNHQENIKNFSLEQLKNRLRDILAGQKFLLVLDDVWNEDRVKWEEF  292

Query  954   RELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPR  1130
             R L+ +G  GS+V+VT+RS  VA + GT T+YNL GLS  D   +F+K AF+E +E +  
Sbjct  293   RGLIPAGAQGSKVLVTSRSDTVANMMGTYTSYNLQGLSKEDSLSVFVKWAFKEGEESKHP  352

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
              L+EIGK+IV KCGG+PLA++TLGS L+ K D QEW  +R+NEIW + QK+ DILP +KL
Sbjct  353   ELMEIGKDIVLKCGGLPLALRTLGSSLFLKVDIQEWKFVRDNEIWNLPQKDEDILPAIKL  412

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYDQ+P +L+QCFA   +F K         I LW A GF+QSP+    L+++GN++  EL
Sbjct  413   SYDQLPSYLKQCFACFSLFEKDFHFNSFHTIVLWEALGFLQSPNKGDTLKDIGNKFLKEL  472

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHAD  1670
              SR   QD ++   G     K+H+LVHDLA  V+  E   + S    I E+  HL F  +
Sbjct  473   RSRSFLQDFIDY--GYACKFKLHDLVHDLALYVSRDEFQLLNSHSDNISENALHLSFTKN  530

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
              L  +  P P    + LR     F VG  ++ F+   +     LRVL + N   + LPSS
Sbjct  531   YLFGKT-PLP----RGLRTIL--FPVGVNNEAFLNTLVSRCTCLRVLQINNSGYESLPSS  583

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LRYLNL +N  +KS+P+ + KL NL  L+L  C +L+ELP   G  L+SL+ L+
Sbjct  584   IGKLKHLRYLNLEDNEKLKSVPDSVCKLQNLINLDLSGCIKLQELPNGIG-NLISLQQLH  642

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +T+ +          L FL+ L L  C   +   E  + +  L+ L IY C SL  +P  
Sbjct  643   ITTLQSKFPDNEIAKLTFLEILTLVDCDNLESLFEGIEELPSLKFLDIYSCKSLRSVPLH  702

Query  2211  IRHLAKLEKLWIWNCEELDLSV-gegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
             +  +  LE L I NC  L+LS+  +       L+ L L  LP+L++ P  L+      L+
Sbjct  703   V--IPNLESLSIGNCYRLNLSMGHDNQIAKLRLKLLALESLPQLLAFPEWLQG-SVNTLQ  759

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLL  2558
              L +  C  L  LP+WL     L+ L I+DCP L  LP+ +    N + ++I  CP L
Sbjct  760   SLVIVDCDHLKDLPEWLSTMIYLKTLSIQDCPTLLSLPDGVHHLRNLEYLKIKGCPEL  817



>emb|CBI15532.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   487 bits (1253),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 307/721 (43%), Positives = 442/721 (61%), Gaps = 53/721 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F   I E+VL K+ S    E+  AW +K EL +L++TLSTI A+L DA+E+QA N 
Sbjct  1     MAESFAFAIAESVLGKLGSTLIQEVGLAWGVKTELGELKDTLSTIHALLLDAEEKQATNL  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++ DWL KL+ V+YDA+D+LD+F     LR+    SG   + +  F   +G         
Sbjct  61    QISDWLGKLKLVLYDAEDVLDEF-DYEALRQQVVASGSSIRSKSKFNLSEG---------  110

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
                        IA  R                  ++ +THSFVR SD+IGRD DKE+IVG
Sbjct  111   -----------IANTRV-----------------VQRETHSFVRASDVIGRDDDKENIVG  142

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L +S    DTE++S +PIVG+GGLGKT+LVKLVYND+RVV +F  ++WV VS++F + K
Sbjct  143   LLKQS---SDTENISVIPIVGIGGLGKTSLVKLVYNDERVVGHFSIKMWVCVSDEFDVKK  199

Query  795   VIEKILRSATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             ++++IL+   G +++    + QLQ  L   L   ++LLVLDDVWN D+ KW  L++LLM 
Sbjct  200   LVKEILKEIKGDENYSDFSLQQLQSPLRNALDGEKFLLVLDDVWNTDREKWLELKDLLMD  259

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
             G  GS+++VTTR   +A+I GT     + GLS  DC  LF+KCAF + +E R   L++IG
Sbjct  260   GAKGSKILVTTRKKSIASIMGTFPMQEIKGLSHEDCLSLFVKCAFMDGEEKRYPTLLKIG  319

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+KC GVPLAV++LGS+LY K DE +W+ IR++EIW++EQ E  I+  L+LSY  +P
Sbjct  320   DQIVEKCAGVPLAVRSLGSLLYSKRDEWDWVSIRDSEIWELEQNEDGIMAALRLSYYDLP  379

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
             YHL+QCFA C +FPK  E    V I+ W+A+G I S   + ++E++G +Y NELLSR  F
Sbjct  380   YHLKQCFALCSLFPKDYEFSNVVLISTWMAEGLIHSSGQNAKMEDIGERYINELLSRSFF  439

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QDV +   G +   K+H+LVHDLA   A  ECL +     +IP+ V H  F      +EE
Sbjct  440   QDVEQLILGVLYTFKMHDLVHDLAMFFAQPECLILNFHSKDIPKRVQHAAFSDTEWPKEE  499

Query  1689  -----FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
                  F + L N+  + YF     V   S++FVK  +L F+ +R+L LQ+   + LP SI
Sbjct  500   CKALKFLEKLNNVHTI-YFQMK-NVAPRSESFVKACILRFKCIRILDLQDSNFEALPKSI  557

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LR+L+LS N  IK LP  I KL +LQ L+L  C +L+ELPR  G  ++SL+ + +
Sbjct  558   GSLKHLRFLDLSGNKRIKKLPNSICKLYHLQALSLSRCSELEELPRGIG-SMISLRMVSI  616

Query  2034  TSQEVSL--QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             T ++  L  +++   SL  LQ L +  C   +F ++  + + +LR+L I +C SLT    
Sbjct  617   TMKQRDLFGKEKGLRSLNSLQRLEIVDCLNLEFLSKGMESLIELRMLVITDCPSLTFKAL  676

Query  2208  G  2210
             G
Sbjct  677   G  677



>ref|XP_007162222.1| hypothetical protein PHAVU_001G134300g [Phaseolus vulgaris]
 gb|ESW34216.1| hypothetical protein PHAVU_001G134300g [Phaseolus vulgaris]
Length=860

 Score =   491 bits (1264),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 332/853 (39%), Positives = 489/853 (57%), Gaps = 48/853 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++KI S A  E S    L   L  L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAESFLFTIAESLITKIASHAFQEASRLVGLYDNLPDLTKTLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             ++++WL +L+ V  DA+DLLD+F   +L  K+    G    KV   F+  + L++R+K+ 
Sbjct  61    QLREWLTQLKIVFSDAEDLLDEFECQTLRNKVVKAHGTTKDKVSHFFSSSNPLLFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD+IGR  DKE 
Sbjct  121   QQIKDISNRLDKVAADRHKFSLQ----ITDVDTRVVHRRDMTHSRVSDSDVIGRKQDKEK  176

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +L+     +   S+S +P+VG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF 
Sbjct  177   IIDLLILQNSNDGDTSLSVIPLVGMGGLGKTTLAKFVFNDSRIQECFPLKMWVCVSDDFD  236

Query  786   LSKVIEKILRSATGK-------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             + ++I KI+ SA  +       +   LD++QLQ  L   +   ++LLVLDDVWNED+ KW
Sbjct  237   IKQLIIKIINSANDQYAPPHQQNLNMLDLEQLQNQLKNKISGKKFLLVLDDVWNEDRVKW  296

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               LR L+     GS+++VTTRS  +A++ G+  ++ L GLS+ D   LF+K AF+E +E 
Sbjct  297   VELRNLIQVSAAGSKILVTTRSHSIASMMGSVPSHILEGLSEEDSLSLFVKWAFKEGEEE  356

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  +LV IG+EIV+K  GVPLAV+TLGS+L+ K +  EW ++ ENEIW +  ++ DILP 
Sbjct  357   KHDHLVNIGREIVKKSRGVPLAVRTLGSLLFSKFEASEWEYVSENEIWNLPHEKDDILPA  416

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             LKLSYD MP +LRQCFA   +FPK  EI      +LW A G I  P  ++ LE++ N+Y 
Sbjct  417   LKLSYDFMPSYLRQCFAMFSLFPKDYEINSYEISSLWGALGLIAVPKKNRTLEDVANKYL  476

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
             +ELLSR   QD      G + +  IH+LVHDLA  VA  +CL V S    IP++V HL F
Sbjct  477   HELLSRSFLQDFTNF--GTVYSFTIHDLVHDLALFVAKDDCLYVSSNIQNIPDNVRHLSF  534

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTV---SKTFVKKTLLNFRRLRVLMLQNLEL  1832
                +L    + +  + ++ +      FR G+    S+  +   +  F+ LRVL L    +
Sbjct  535   AESSLFNNLYHKKSVAMRTIL-----FRYGSKEINSEALINTCVSKFKYLRVLNLWASTM  589

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
             + LP +I  LK LRYL++S N NIK LPE I KL +LQ L L  C++L+ +P+   ++L+
Sbjct  590   ETLPRTIAKLKHLRYLDISQNLNIKRLPESICKLQSLQVLKLEECKELEAMPKGL-RKLI  648

Query  2013  SLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLR  2171
             SL+ L  ++++  L      SLG L  L +             KFP         L+VL 
Sbjct  649   SLRHLEFSTKQSILPDNDIASLGNLANLSITLSPNLESIFGGVKFPI--------LKVLS  700

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSV-----gegmegleslqslllmglPK  2336
             IY C SL       +   +LE L + +C+ LDL +      E       L+S+    L +
Sbjct  701   IYHCQSLMSFRLDGKFFPELETLSVESCDNLDLELWKGNHFEEQSHKLKLKSVRFSNLSQ  760

Query  2337  LVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS  2516
             LV+LP  LK++ A  L+ L V  C  +  LPDWL     L+ L+I+ CP L  LP+ I  
Sbjct  761   LVALPKWLKEV-ANSLQCLVVENCDNIETLPDWLTTLIDLKTLFIKSCPNLVSLPDNIHY  819

Query  2517  SSNAKVRIID-CP  2552
              +  +  II  CP
Sbjct  820   LTTIETLIIQGCP  832



>ref|XP_008240990.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=835

 Score =   490 bits (1262),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 343/838 (41%), Positives = 497/838 (59%), Gaps = 52/838 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+  DEIS AW +K +L+KL+ T+S IK VL DA+++QA N ++  WLQ+
Sbjct  8     LATRLIEKLGSIVSDEISLAWGVKADLQKLEQTMSIIKDVLLDAEQKQAHNQQLCSWLQQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+ V  DA+DLLD+F   +L R++  +      KVR+ F+  + + +R ++ H+I+EI+ 
Sbjct  68    LKHVFLDAEDLLDEFECETLRRQVVETFHPTTGKVRRFFSHSNPMAFRSRVGHQIKEIKE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCD  635
             RL+++   R  F       +   ++ +    THSFVR S +IGR+SDK+ IV +LM+  D
Sbjct  128   RLDELKSIRAIFD-----SLTRTDHHETVNMTHSFVRASKVIGRESDKKQIVSLLMQQGD  182

Query  636   EEDTES--VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE-DFSLSKVIEK  806
             ++ + +  VS +PIVG+GGLGKTTL KLVY+D++VV +F+ ++W  VS  DF L+++   
Sbjct  183   DDQSGNGNVSVIPIVGIGGLGKTTLAKLVYDDEKVVGHFELKMWAYVSSVDFELARLTRL  242

Query  807   ILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-D  980
             IL SA        L +DQLQ  L   L   ++LLVLDDVWN+D  KW  LR+L++ G   
Sbjct  243   ILGSALDTEISDKLTLDQLQAKLRHALKDKKFLLVLDDVWNDDPIKWSELRDLVIDGAKS  302

Query  981   GSRVIVTTRSIKVATITGT-TTAYNLSGLSDHDCFDLFLKCAFREQ-EYRPRNLVEIGKE  1154
             GS+++VTTR+  VA + GT +T  NL  LS  DC  LF++CAF+E  + +  +L ++GK+
Sbjct  303   GSKILVTTRNTSVAKMMGTISTNINLEFLSFEDCLSLFVECAFKEGCDKQYPSLFKMGKD  362

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPY  1331
             IV+KCGGVPL VKTLGS LY KTDE EW  +R++EIW+++Q++   ILP L+LSY Q+P 
Sbjct  363   IVKKCGGVPLVVKTLGSQLYSKTDEHEWKMVRDSEIWELKQEDDGHILPALRLSYTQLPP  422

Query  1332  HLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFI-QSPD-GDQELENLGNQYFNELLSRF  1502
             HLRQC AYC    K          I  W+A G + QS D G+ ELEN+G QYF +L +R 
Sbjct  423   HLRQCLAYCSHLRKDTIRFSSLNLIRYWMAHGILYQSHDYGNTELENIGEQYFKDLWARS  482

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE-IPESVHHLVFHADNLS  1679
              FQ+VV+   G      +H+L+HDL QSVA  EC  VKS D + I ++V HL F     +
Sbjct  483   FFQNVVD--HGICFTFDMHDLIHDLVQSVAKDECFTVKSVDTKGIYKNVRHLTFLK---A  537

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              +     L  L  +R      R+  + ++F+      F+ LRVL+L  + L+ LPSSIG 
Sbjct  538   GQNVSTTLQKLNKVRTVTAD-RID-IDESFLCTCFSRFKYLRVLLLWTVSLEVLPSSIGS  595

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL L  N  I  LP  I +L +LQTLNL+ C  L+ELPR+  + L++L TL  T+
Sbjct  596   LKHLRYLVLFYNEAITKLPNAICRLQSLQTLNLVGCVNLEELPRDISK-LINLTTLGFTT  654

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++ S  K     L  LQFL                         I+ CS+LT LP    +
Sbjct  655   KQTSFTKNGVGCLKSLQFL------------------------TIHLCSNLTSLPRETSY  690

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             L  L  L I  CE+LDL           LQ+L ++ +P++V+LP   +   A  L+ L +
Sbjct  691   LTTLRALCICKCEQLDLENKNYQGTPLRLQNLHIIDVPRMVALPKWFQGA-ADTLQLLCI  749

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDCPLLNG*C  2570
               C  L ALP+WL + T L +L +  C +LS LPE +RS  S  ++ I +CP L   C
Sbjct  750   GNCENLEALPEWLASFTSLTKLILASCHKLSSLPEGMRSLISLRELEIQNCPELERRC  807



>ref|XP_010646022.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=694

 Score =   485 bits (1249),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 296/672 (44%), Positives = 424/672 (63%), Gaps = 21/672 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I +NV+ KI S+   EI  AW +K EL KL+ TL+TIK+VL DA+E+Q K+ 
Sbjct  1     MAESFLFSIADNVVGKIGSITLHEIGLAWGVKTELTKLEATLTTIKSVLLDAEEKQWKDQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL KL+ V YD +D+LD+F   +L R++ S   + TKV   F+  + L + FK+ H
Sbjct  61    QLRDWLGKLKHVCYDVEDVLDEFQYQALQRQVVSHGSLKTKVLGFFSSSNPLRFSFKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I+E+R RL+ IA DR  F+ +      P+     RE THSFV   D+ GR  DKE ++ 
Sbjct  121   RIKEVRERLDGIAADRAQFNLQTCMERAPL---VYRETTHSFVLDRDVFGRGKDKEKVLE  177

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM S D  D ES+S +PIVGLGGLGKTTL KLVYND  VV +F  R+WV VS DF + K
Sbjct  178   LLMNSSD--DDESISVIPIVGLGGLGKTTLAKLVYNDQWVVGHFKKRIWVCVSNDFDMKK  235

Query  795   VIEKILRSAT-----GKSFG-----HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             VI  I+ S       G   G      L+M+Q Q  L   L +  + LVLDD+WN D+ KW
Sbjct  236   VIIDIINSINTTVEGGSGLGLPNHNDLNMEQSQTLLRRTLGNENFFLVLDDMWNGDRQKW  295

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               LR  LM+G  G++++VTTR   VA+I GT  AY L GL   DC  +FLK AF E QE 
Sbjct  296   IELRTFLMNGAKGNKIVVTTRDNSVASIMGTVPAYILEGLPHVDCLSVFLKWAFNEGQEK  355

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  NLV+IG +IV+KC GVPLA +TLGS+L+ K ++++WL++R+N+IWK++Q+E DILP 
Sbjct  356   KHPNLVKIGDDIVKKCNGVPLAARTLGSLLFSKFEQRDWLYVRDNDIWKLKQEEGDILPA  415

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             L+LSY+Q+P +L+ CFAYC +FPK      E  +++W AQG I++    QEL+++GN+Y 
Sbjct  416   LRLSYEQLPSYLKCCFAYCSIFPKDHVFCNEELVDMWSAQGLIETSKKKQELDDIGNRYI  475

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
              ELLSR  FQD  +         K+H+L+HDLA  ++ +EC  +    P +   V H+ F
Sbjct  476   KELLSRSFFQDFEDRH--FYFEFKMHDLMHDLASFISQSECTFIDCVSPTVSRMVRHVSF  533

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTV-SKTFVKKTLLNFRRLRVLMLQNLELKE  1838
               D L  +E  + +  L ++R   + F   T   + F+K  +  F+ +++L L +     
Sbjct  534   SYD-LDEKEILRVVGELNDIRTIYFPFVQETSHGEPFLKACISRFKCIKMLDLSSSNFDT  592

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP+SI  LK LR L+L+ N  IK LP  I KL +LQ L+L+ CE  + LP+ FG  L+SL
Sbjct  593   LPNSISNLKHLRLLDLNENKKIKKLPNSICKLFHLQKLSLLGCEGFENLPKEFG-NLISL  651

Query  2019  KTLYLTSQEVSL  2054
             + L +T+++ +L
Sbjct  652   RHLQITTKQRAL  663



>gb|KCW48021.1| hypothetical protein EUGRSUZ_K01754 [Eucalyptus grandis]
Length=769

 Score =   488 bits (1255),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 309/742 (42%), Positives = 463/742 (62%), Gaps = 18/742 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L+ I E VL KI SL   E  + + ++ ++ +L+ TL+ I AVL DA+EQQAKNH
Sbjct  1     MAESLLSGIAEGVLVKIASLVLQEAVAIYGVENQISELRETLTAINAVLLDAEEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS-CSGILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +LRDV+YDA+D+LD+FG  +L +++ S   G+  KV + F+  + LI R K++
Sbjct  61    RLQVWLDRLRDVLYDAEDVLDEFGCEALRKQVISRHGGVKEKVCRFFSLSNPLIVRAKLS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KI+EIRGRL++I+ ++  F        N V   + +E T+SFV  SD+IGRD DK+ I+
Sbjct  121   DKIKEIRGRLSRISTEKDQFDLTMRNADNDVAQTRSQEMTYSFVNKSDVIGRDIDKQKII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              ML++S ++++   +S +PIVG+GGLGKT L KL+YNDD V + F+ R+WV V +DF L 
Sbjct  181   DMLLQSANDKN---LSVIPIVGIGGLGKTALAKLIYNDDSVKEQFELRMWVLVPQDFDLK  237

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K IE+I++ A G+S  +L++ QLQ HL G++   +YLLVLDDVW+ D+++W+ LR+LL +
Sbjct  238   KTIEEIIKVAIGQSLSNLNIQQLQTHLLGIIKDKKYLLVLDDVWSNDRNRWQELRDLLSN  297

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIG  1148
             G   S+VIVTTRS++VA++ GT  A+NL GLS  D   LF+K AF E+E + R NL+EIG
Sbjct  298   GASESKVIVTTRSLEVASMMGTFPAHNLEGLSLKDSMALFIKWAFNEKEKQSRPNLLEIG  357

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+K GGVPL VKTLGS+LY K D++ W  +R++E WK+ + + DILP+LKLSYD +P
Sbjct  358   NDIVKKSGGVPLLVKTLGSLLYSKHDDRHWTRVRDSETWKLVETKKDILPVLKLSYDHLP  417

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
             +HL++CFA   + P+  +      + +W+A GFI S     EL ++G +Y  EL  R   
Sbjct  418   FHLKRCFATFSLLPREAKHYSTFIVQIWIALGFISSTRETLELGDVGEEYIKELWKRSLI  477

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA---DNLS  1679
             Q+V E  +G  L  ++H+LVH LA SVA  +C        EI E V H+  +    + +S
Sbjct  478   QEVKER-EG-YLTFQVHDLVHYLAASVAQHDCFIFSIDTTEILEGVRHISLYRTPLEGIS  535

Query  1680  REEFPQPLL---NLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
                   P L     K LR        V  +++ F +        LR L L     +ELPS
Sbjct  536   NFNGVLPFLRKPTSKKLRAIIQVKHHVEVITREFARTCTFKCNSLRYLSLAYGTFEELPS  595

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SI  L+QLR L+L  N  +K LP  I +L +L +L+L  C +L  LP+N  ++L SL  L
Sbjct  596   SICNLRQLRSLDLRENKRLKKLPNTICELQSLLSLHLGGCSELGNLPKNM-KRLSSLTFL  654

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLR---VLRIYECSSLTC  2198
              +T+++ SLQ+     L  L +L +  C   +   E    + +LR   +++  +C +L  
Sbjct  655   VVTTKQSSLQESGIQFLENLHWLAIEDCQNLRVLFEGTCRLTRLRKVDIIQCEQCPNLLS  714

Query  2199  LPAGIRHLAKLEKLWIWNCEEL  2264
             +P GI+ L  L++L+I +C EL
Sbjct  715   MPHGIQSLTALKELYIKHCGEL  736



>gb|KDO37336.1| hypothetical protein CISIN_1g036466mg [Citrus sinensis]
Length=727

 Score =   486 bits (1251),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 300/723 (41%), Positives = 431/723 (60%), Gaps = 47/723 (7%)
 Frame = +3

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR R ++IA     F+  +    +     + RE THSFVRPSDIIGR  D E I+ 
Sbjct  4     QIKKIRERFDEIANMVGKFNLTQRLDDHRRVVQEEREPTHSFVRPSDIIGRYEDGEKIIE  63

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L ++ D E +E+VS +PIVG+GGLGKT L KL+YND RV ++F+ ++W+ VSED    +
Sbjct  64    LLTQTSDGE-SETVSVIPIVGIGGLGKTALAKLLYNDQRVEEHFELKIWICVSEDSGKRQ  122

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++ KI+ S TG + G+LD D+LQ+ L   L   RYLLV+DDVWNED   W  L+ LL+ G
Sbjct  123   IMTKIINSVTGGNHGNLDPDRLQKVLRDSLNGKRYLLVMDDVWNEDPRAWGELKSLLLGG  182

Query  975   CDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
              +GS+++VTTRS KVA I  T   TT YNL  L   DC  LF+KCAF+  + +  NLV+I
Sbjct  183   AEGSKILVTTRSNKVALIMATMRGTTGYNLQELPYKDCLSLFMKCAFKVGQEKHPNLVKI  242

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G++IV+KC G+PLAV+T+GS+LY  TDE +W ++R+N+IWK+ Q   DILP L+LSYDQ+
Sbjct  243   GEKIVEKCRGIPLAVRTVGSLLYGSTDEHDWEYVRDNDIWKLRQAPDDILPALRLSYDQL  302

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK  E      + LW+A G +QSP+ ++ELEN+G +YF EL SR  
Sbjct  303   PPHLKQCFAYCSIFPKDYEFASVHLVQLWMAHGLLQSPNKNEELENIGMRYFKELCSRSF  362

Query  1506  FQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
             FQD+ +   G E+   +IH+L+HDLA  VA  ECL V S        V  ++F  D+   
Sbjct  363   FQDLGDLLPGLEVFNFQIHDLMHDLALLVAKGECLTVNSTG-----RVRTILFPIDD---  414

Query  1683  EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
                                      S++FV   +   + LRVL+L N  ++ LP  +G L
Sbjct  415   ----------------------ERTSQSFVTSCISKSKSLRVLVLTNSAIEVLPRKMGNL  452

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQ  2042
             KQLR+L+LS N  IK LP  I +L +LQTLNL +C +L+ELP++  + L+SL+   +T++
Sbjct  453   KQLRHLDLSGNRKIKKLPNSICELQSLQTLNLGDCLELEELPKDI-RYLVSLRMFVVTTK  511

Query  2043  EVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             + SL +     L  L+FL++  C   ++  E    +  LR L +  C  L  LP  +++L
Sbjct  512   QKSLLESGIGCLSSLRFLMISNCGNLEYLFEDIDQLSVLRSLVVNACPRLNLLPPAMKYL  571

Query  2223  AKLEKLWIWNCEELDLSVgegme----------gleslqslllmglPKLVSLPAGLKDID  2372
             + LE+L    CE L LS+   M+              L++L +  L  L+ LP  L    
Sbjct  572   SSLERLIFDECESLSLSLNMEMKEEGSHHDRKNVGSHLRTLYVARLTPLLELPQWLLQGS  631

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DC  2549
             +  L+ L +  CP   ALP  L++   L+ L I  CP+LS LPE +   +  K   I +C
Sbjct  632   SKTLQTLAIGDCPNFMALPGSLKDLEALENLVIGICPKLSSLPEGMHHLTTLKTLAIEEC  691

Query  2550  PLL  2558
             P L
Sbjct  692   PAL  694



>gb|EMT14627.1| hypothetical protein F775_52103 [Aegilops tauschii]
Length=1018

 Score =   495 bits (1275),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 329/812 (41%), Positives = 473/812 (58%), Gaps = 24/812 (3%)
 Frame = +3

Query  84    TFLADITENVLSKIVSLAQD----EISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             + ++ +  +VL K  S   D    EI SAWN + EL KL+N+L  I  VLRDA+++++ +
Sbjct  181   SVVSSLATSVLGKAASFGTDWAVNEIKSAWNAQEELHKLENSLKFICGVLRDAEDRESAS  240

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
             H + +WL  L+D VYD DDLLDD  T +L+ ++      +  +  L T P      FK++
Sbjct  241   HVLHEWLDCLKDAVYDIDDLLDDASTEALILQVHKGLSRIQSMSLLITGP------FKLS  294

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI ++R +L++IA+DR  F   E   ++         +THSF+  SDIIGR   K+ I+
Sbjct  295   HKIEQVRKKLDEIAKDRGQFGLNEQPIIDSRMFRSSNRETHSFITESDIIGRAEAKKKII  354

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               ++ +   +D++ +S LPIVGLGG+GKT L K +YND +V QNF+ +LWV VS+ F+L 
Sbjct  355   EKILTA---KDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLK  411

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K+++ I++S TG+S   L+++ LQ  L  +L   RY LVLDD+WN+    W+ LR LL S
Sbjct  412   KILDDIIQSGTGESNMKLNLEMLQRKLCELLKERRYFLVLDDLWNDKLADWEELRRLLSS  471

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEI  1145
             G  GS +IVTTRS  VA++  T   Y++  L D  C  +F + AFR  E++   + LV I
Sbjct  472   GGRGSVIIVTTRSSNVASMVKTMEPYDVEKLPDDKCMQIFTQYAFRGEEEDMMDQQLVSI  531

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G+ IV+KC GVPLA +TLGS+L    D +EW H+ E+ +W +EQ   DILP LKLSYD +
Sbjct  532   GESIVKKCCGVPLAARTLGSLLSRCRDIEEWRHVLEDNLWNMEQNTDDILPALKLSYDAL  591

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HLR CF+   +FPKG  I +++ I  W+A G I+  +   +L+  G +YF ELL R  
Sbjct  592   PPHLRPCFSCLTVFPKGHTIYQDILIMFWMALGLIRPSNKRTQLQT-GEKYFKELLGRSL  650

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD     D  +  CK+H+L+HDLA  V+  E   V S    + ESV HLV+  +N S  
Sbjct  651   FQDQCVLSDNRVFYCKMHDLIHDLATLVSQKEHAIVSSEKVTVSESVRHLVWDRENFSIG  710

Query  1686  -EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
               FP+ L      R F      GTVSK+F+     +F  LR +    ++ + LPSSIG L
Sbjct  711   LNFPEELKKANKTRTFTIRSSFGTVSKSFIDDLFSSFTLLRAVTFFGVDFEVLPSSIGDL  770

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQ  2042
             K LRYL +  N  ++ LP+ + KLVNL+ L+L  C QL+E P N  + L+SL    LTS+
Sbjct  771   KHLRYLLIQFNGKLRLLPKSLGKLVNLEMLHLYGCNQLEEFP-NEARNLVSLVYFNLTSK  829

Query  2043  EVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             +  L+     SL  L+    Y+    +   E +  ++ LR L I++C   T LP+ I  L
Sbjct  830   QKYLRLCGWSSLAILKMSYCYELISLE---EGFDSLRALRELLIFDCPKPTALPSSIWQL  886

Query  2223  AKLEKLWIWNCEELDLSVgegmegle--slqslllmglPKLVSLPAGLKDIDAMKLKYLR  2396
             + L  L I  CEELDL V  G       SLQ+L L  LPK+  LP   K   +  L+Y+ 
Sbjct  887   STLVALSISGCEELDLMVPAGEASGGLYSLQNLQLGRLPKVTHLPESFKSASS-SLQYIE  945

Query  2397  VAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             + GC  L  LP ++Q+   L+R  I  CPELS
Sbjct  946   IVGCGNLERLPSYIQDFRFLKRAVINGCPELS  977



>ref|XP_006421378.1| hypothetical protein CICLE_v10006443mg [Citrus clementina]
 gb|ESR34618.1| hypothetical protein CICLE_v10006443mg [Citrus clementina]
Length=607

 Score =   481 bits (1239),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 292/621 (47%), Positives = 405/621 (65%), Gaps = 32/621 (5%)
 Frame = +3

Query  147   ISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFG  326
             + S + ++  L+KL+ TL+T+K+V+ DA+E+Q  NH + DWL KL+D  YDA+D+LD+F 
Sbjct  2     VESYFPIEKLLEKLE-TLTTVKSVVLDAEEKQIHNHRLSDWLGKLKDACYDAEDVLDEFE  60

Query  327   TLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKEN  506
               +L R++     I  K R  F   + + +RF++ H+I++IR R ++IA+ R  F+  E 
Sbjct  61    VENLRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMGHQIKKIRERFDEIAKLRGEFNLIER  120

Query  507   YYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgg  686
                +     K RE THSFV  SDIIGRD D+E I+ +LM++ D E +E+VS +PIVGLGG
Sbjct  121   LDDHQRVVHKEREPTHSFVLSSDIIGRDKDREKIIELLMQTSDGE-SETVSVVPIVGLGG  179

Query  687   lgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQE  866
             LGKT L KLVYND RV ++F+ ++W+ VSEDF   +++ KI++S TG++ G LD DQLQ 
Sbjct  180   LGKTGLAKLVYNDQRVEEHFELKIWICVSEDFDEKQLMTKIIKSITGQNQGDLDTDQLQR  239

Query  867   HLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGT---  1037
              L   L S RYLLV+DDVWNED   W+ L+ LL+ G +GS+++VTTRS KVA+I GT   
Sbjct  240   TLRDRLNSKRYLLVMDDVWNEDPEAWRKLKSLLLGGANGSKILVTTRSRKVASIMGTRGG  299

Query  1038  TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYC  1217
             TT YNL GL   DC  LF+KCAF+E+  +  NLV+IG+EIV+KCGG+PLAV+TLGS+LY 
Sbjct  300   TTGYNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGEEIVKKCGGIPLAVRTLGSLLYD  359

Query  1218  KTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREV  1397
              TDE +W ++R+NEIWK+EQK  DILP+L+ SYDQ+P  L+QC AYCC+FPK  E     
Sbjct  360   STDEHDWEYVRDNEIWKLEQKANDILPVLRFSYDQLPPRLKQCVAYCCIFPKDFEFSSYA  419

Query  1398  FINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDG-EILACKIHNLVHD  1574
              +  W+A G +QS + ++ELE++G +Y  ELLSR  FQD+     G E  + K+ +L+HD
Sbjct  420   LVQFWMAHGLLQSHNKNEELEDIGMRYVKELLSRSFFQDLTIGMLGMETFSFKMRDLMHD  479

Query  1575  LAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGT  1754
             LAQ VA  E L V S    IP+SV HL F   N SR +F   L +L              
Sbjct  480   LAQQVAKDEFLVVNSDCQSIPKSVRHLSFATANASRNDFSSLLSDLG-------------  526

Query  1755  VSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKL  1934
                          R LRVL L    ++  P  +G LK +R L+L+ N  IK LP+ I +L
Sbjct  527   -------------RFLRVLDLNGSAIEVCPRKMGNLKHMRRLDLAGNSKIKKLPKSICEL  573

Query  1935  VNLQTLNLINCEQLKELPRNF  1997
              +LQTLNL  C +L+ELP++ 
Sbjct  574   QSLQTLNLEGCLELEELPKDI  594



>ref|XP_008241001.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=830

 Score =   489 bits (1258),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 340/841 (40%), Positives = 492/841 (59%), Gaps = 57/841 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+A ++I  AW +K +L K+Q T+STIK VL DA+++QA N +++ WL++
Sbjct  8     LATKLIEKLGSIASEQICLAWGVKADLNKIQRTMSTIKDVLLDAEQKQAHNQQIRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+DV  DA+DLLD+F   +L R++  +  G + KVR+ F+R + + +RF++ ++I+EIR 
Sbjct  68    LKDVFLDAEDLLDEFECEALRREVVETFHGTIGKVRRFFSRSNPIAFRFRLGNEIKEIRE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCD  635
             RL+++  ++  F   ++  + P   G        FV  S +IGR+S+KE IV +LM+  D
Sbjct  128   RLDELKSNKAIF---DSLTILPHGYGG-DNHERPFVPASKVIGRESEKEEIVNLLMQQGD  183

Query  636   EEDT----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
              + +      VS +PIVG+GGLGKTTL K VY+D RVV +F+ R+W SV  DF L++   
Sbjct  184   NDQSGNSNNKVSVIPIVGIGGLGKTTLAKWVYDDKRVVGHFELRMWASVPVDFELTRCTR  243

Query  804   KILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-  977
              IL SA        L +DQLQ  L   L   ++LLVLDDVW +D  KW  LR+LL  G  
Sbjct  244   LILGSALDTEISDKLTLDQLQGRLREALKDKKFLLVLDDVWKDDALKWSQLRDLLTKGAK  303

Query  978   DGSRVIVTTRSIKVATITGTTTA-YNLSGLSDHDCFDLFLKCAFR---EQEYRPRNLVEI  1145
              GS+++VTTRS  VA I GT  A  NL  LS  +C  LF++CAF+   E+EY   NL ++
Sbjct  304   SGSKILVTTRSTAVAKIMGTIPANINLEFLSFEECLSLFVECAFKDGHEKEYP--NLFKM  361

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE-TDILPILKLSYDQ  1322
             GK+IV KCGGVPLAVKTLGS LY KTDE+EW  +R++EIW+++Q++   ILP L+LSY +
Sbjct  362   GKDIVGKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWELKQEDDGQILPALRLSYTR  421

Query  1323  MPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSPD--GDQELENLGNQYFNELL  1493
             +P HLRQC AYC    K   E      I  W+A G +      G+ ELE++G  YF +L 
Sbjct  422   LPPHLRQCLAYCSHLQKDMIEFNSFQLIRYWMAHGILDQSHVHGNMELEDIGELYFKDLW  481

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE-IPESVHHLVFHAD  1670
             +R  FQ++V+   G      +H+L+HDL QSVA  EC  VKS + + I E+V HL     
Sbjct  482   ARSFFQNIVDG--GINYKFDMHDLIHDLVQSVAQGECFTVKSANTKGISENVRHLTVLE-  538

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
               + +     L  L  +R  A    +  + ++F+      F+ LRV+ L    L+ LPSS
Sbjct  539   --AGQNVSTTLQKLNKVRTVAAD--IIDIDESFLHTCFSRFKYLRVVELPRCSLQVLPSS  594

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LRYLNL  N  I  LP  I +L +LQTLNL  CE L ELPR+  + L+ L +L 
Sbjct  595   IGSLKHLRYLNLGYNEAITKLPNAICRLQSLQTLNLDECENLDELPRDISK-LIRLTSLC  653

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             LT+++ S  +     L  L++L +                           S+LT LP  
Sbjct  654   LTTKQTSFTENGVGCLKLLRYLSIVN-------------------------SNLTSLPRE  688

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
               +LA L  L + NCE+LDL           LQ L ++ LP++V+LP   +   A  L++
Sbjct  689   TSYLASLRTLILHNCEQLDLGNVNYQGTPLRLQKLWIVQLPRMVALPEWFQGA-ANTLQF  747

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID-CPLLNG*  2567
             L +  C  L ALP+WL + T L++L ++ C ELS LPE +RS ++ +  +ID CP L   
Sbjct  748   LAIYECENLEALPEWLASFTSLKKLVLDSCSELSSLPEGMRSLTSLRELVIDNCPELERR  807

Query  2568  C  2570
             C
Sbjct  808   C  808



>ref|XP_008240304.1| PREDICTED: putative disease resistance protein RGA1 [Prunus mume]
Length=874

 Score =   490 bits (1261),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 348/840 (41%), Positives = 494/840 (59%), Gaps = 27/840 (3%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F+  I ENV++ + S A  EI  AW +  EL KL++T S+IK V+ DA+E+Q K   +  
Sbjct  4     FVYTIAENVMNGLASYAYQEICLAWGVTDELNKLKDTFSSIKLVILDAEEKQRKELRLSQ  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRK---LRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             WL KL+DV YD DD+L+DF    L  +   LR    I  +VR  F+  + +++ FK+ H+
Sbjct  64    WLGKLKDVCYDVDDMLNDFAFKELQMQMLILRGRGSIKGQVRIFFSCWNPVVFNFKMGHR  123

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV--  611
             I+EIR RL+ IA ++  F   E       ++  ++ +THSFV+  D+IGR+ DK+ I+  
Sbjct  124   IKEIRERLDVIANEKSQFPLVERDEDWQSQSVHIKRETHSFVQAYDVIGREDDKKQIIIY  183

Query  612   --GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
                + +K    +  E+VS + I GLGG+GKTTL KLV+ND RVV++FD R+WV VS+ F 
Sbjct  184   LLNLTLKEKSRDVQENVSVISITGLGGIGKTTLAKLVHNDHRVVKHFDMRMWVCVSDHFD  243

Query  786   LSKVIEKILRSATGKSFGHLD-MDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWK  947
               +++ +I+ SAT ++ G  +  D +Q+ L   L   ++LLVLDDVW++ Q      KW 
Sbjct  244   NKRLVHEIVASATNQNCGDQESFDSVQKKLQSALKEKQFLLVLDDVWDKGQIGVTITKWI  303

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEY  1121
             +L+ LL  G +GS+VIVTTRS  VA+I  +   + L GL    C  LF+K AF  + +E 
Sbjct  304   DLKALLNVGANGSKVIVTTRSESVASIMDSVCVHQLRGLPHKSCMSLFIKRAFGRKGEEQ  363

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             R  +L+EI   IV+KC GVPLAV TLGS+LY K ++  W  +REN+IW++ Q   DILP 
Sbjct  364   RYPHLMEIAPGIVEKCEGVPLAVTTLGSLLYLKREKHFWSEVRENDIWRLPQGNDDILPA  423

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             L+LSYD +P +L+ CFA C +FPK         ++LW+AQGFIQS  G+QELE +G  Y 
Sbjct  424   LQLSYDALPTYLKPCFAICSLFPKDYVFRSTDLVSLWMAQGFIQSSKGNQELEEIGLDYI  483

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVK-SGDPEIPESVHHLV  1658
              +L SR  FQ   ++ D   +  K+H LVHDLA SV+  EC +V      +  + V  + 
Sbjct  484   RQLCSRSLFQIDEDSID--FIVFKMHALVHDLALSVSEEECSSVNFRPTSDNCKRVRQVS  541

Query  1659  FHADNL--SREEFPQPLLNLKNLR--YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
                D+L    E  P+ L  LK +R   F     VG  SK+ +K  +L F+ LRVL L   
Sbjct  542   MSEDDLPMKGERVPEFLRQLKKVRTILFPVPGHVGISSKSVLKACILRFKYLRVLDLSGS  601

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
               + LPSSIG L +LRYLNLS N  IK LP  I  L+NLQTL L NCE+L+ELPR+ G  
Sbjct  602   TFEVLPSSIGKLSRLRYLNLSKNPFIKKLPGSICNLLNLQTLLLSNCEKLRELPRDIG-N  660

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECS  2186
             L++L+TL LT+ ++ L       L  L+FL ++ CS  +   +  Q +  LR+L I  C 
Sbjct  661   LINLRTLVLTTSQMVLAG-CIERLTSLRFLQVHNCSYLESWGQGIQCLTNLRMLIISNCE  719

Query  2187  SLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKD  2366
             +L  LP  ++ L  L+ L I  CE+LDL             S+       L +LP  L+D
Sbjct  720   NLKSLPPDMKCLTALKTLGISGCEKLDLMTSGAGIRGLRSVSISKAL--HLEALPHWLQD  777

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID  2546
               A  L+ L V  C +L  LP+WLQN  LLQ+L IE CP+L  LP+ +R     ++  ID
Sbjct  778   -SANTLQSLHVKNCEDLKELPEWLQNFKLLQQLVIEYCPQLLALPQGMRHLGALRLLKID  836



>ref|XP_006604363.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine 
max]
 gb|KHN26314.1| Putative disease resistance protein RGA3 [Glycine soja]
Length=853

 Score =   489 bits (1259),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 327/849 (39%), Positives = 494/849 (58%), Gaps = 57/849 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+ DI E++L K+ S A +E S A+ +  +LK +++TLS +K VL DA+E++   H
Sbjct  1     MAESFVFDIAESLLGKLASYAYEEASRAYGVYEDLKGIKDTLSIVKGVLLDAEEKKEHKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V +DA+D+LD+F      +++   SG +  KV   F+  + L++R ++ 
Sbjct  61    GLREWLRQIQNVCFDAEDVLDEFECQGSQKQVVKASGSVRVKVGHFFSSSNSLVFRLRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+++R RL++IA D   F   E   V+ +   + RE T+S V  SD+IGR++DKE I+
Sbjct  121   HQIKDVRERLDKIAADGNKFGL-EKIEVD-LRLVQRREMTYSHVDASDVIGRETDKEEII  178

Query  612   GMLMKSCDEEDT---ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+   + D     S+  +PIVG+GGLGKTTL KLV+ND R+ + F  ++WV +S++F
Sbjct  179   KLLMQPHPDGDGYGDRSLCVIPIVGIGGLGKTTLAKLVFNDKRMDELFQLKMWVCISDEF  238

Query  783   SLSKVIEKILRSATGKS----------FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED  932
              + ++I KI+ SA+  +             LD++QLQ  L   L   ++LLVLDD+WN+D
Sbjct  239   DIRQIIIKIINSASASAPNIALAYQENINSLDIEQLQTRLRHKLSLQKFLLVLDDIWNDD  298

Query  933   QHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
               KW +L+ L+  G  GS++IVTTRS  +A++ GT  +Y L GLS  +C  LF++ AF+E
Sbjct  299   YTKWIDLKNLIKVGAVGSKIIVTTRSNSIASMMGTIPSYVLEGLSPENCISLFVRWAFKE  358

Query  1113  -QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD  1289
              QE    NL+EIGKEIV+KC GVPLAV++LGS L+  +D  +W  +R++EIW +EQK  D
Sbjct  359   GQEKEYPNLMEIGKEIVKKCKGVPLAVRSLGSSLFSTSDLDKWEFVRDHEIWNLEQKRND  418

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             ILP LKLSYDQMP HLR CFAY  +FPK          NLW + G +QSP+G Q++E + 
Sbjct  419   ILPALKLSYDQMPSHLRHCFAYFALFPKDFRFINTEITNLWASLGLLQSPNGSQKVEKIA  478

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVH  1649
              QY  EL SR   QD+ +   G      +H+LVHDLA  VA  E L V +    IPE V 
Sbjct  479   RQYIEELHSRSFLQDITDF--GPFYFFNVHDLVHDLALYVAKEEYLMVDACTRNIPEHVR  536

Query  1650  HLVFHADNLSREE-FPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN  1823
             H+    + L     FP+     ++LR   +    VG  S+  +K  +  +R LRVL L +
Sbjct  537   HISIVENGLPDHAVFPKS----RSLRTITFPIEGVGLASEIILKTWVSRYRYLRVLDLSD  592

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
                + LP+SI  L  LR L+LSNN  IK LP  I KL NLQ  ++  C +LK LP+  G 
Sbjct  593   SSFETLPNSIAKLGHLRVLDLSNNGKIKRLPNSICKLQNLQVFSVSGCMELKALPKGIG-  651

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQ--HMKKLRVLRIY  2177
              L++L+ L +T+++ SL +    +L  LQ L    C   KF  E  Q   +  L++L + 
Sbjct  652   MLINLRELKITTKQSSLSQDEFANLSNLQTLSFEYCVNLKFLLEKAQLTQLSSLQILVVR  711

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAG  2357
              C SL  LP  I  L KL+ L++ +C  ++L +                           
Sbjct  712   SCGSLMSLPLYI--LPKLDALFVADCGMINLFL-------------------------GD  744

Query  2358  LKDIDAMKLKYLRVAGCPELTALPDWLQNCT-LLQRLYIEDCPELSYLPEQI-RSSSNAK  2531
                I   ++K+L V   P L  LP+W++     LQ L I + P+L +LPE + R +   +
Sbjct  745   ESPIKRWRMKFLHVENFPWLQVLPEWIEGAADTLQTLMIYNLPKLKFLPECLPRMTHLKR  804

Query  2532  VRIIDCPLL  2558
             + + +CP L
Sbjct  805   LHVAECPSL  813



>ref|XP_010694190.1| PREDICTED: putative disease resistance protein RGA3 [Beta vulgaris 
subsp. vulgaris]
Length=866

 Score =   489 bits (1260),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 339/855 (40%), Positives = 490/855 (57%), Gaps = 31/855 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQD--------EISSAWNLKPELKKLQNTLSTIKAVLRDA  230
             M+E  L  +T+  L+ I + A D         I +A  ++ +LKK++N L  I+AVL+DA
Sbjct  1     MSEALLWAVTKTTLAHIATFAGDLTCSYATQGILAAQGVRNDLKKIENKLIAIRAVLQDA  60

Query  231   DEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGL  410
             + +Q  +  VK WL+ L++VVYD DDLLD+  T  LLRK  + S +L ++R   +  + +
Sbjct  61    ESKQYDSEAVKIWLKDLKNVVYDIDDLLDEVHT-DLLRKRINKSHLLRQIRYYLSSSNPI  119

Query  411   IYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQ---THSFVRPSDII  581
             +  F  + KIR++  R + IA +RR+     +   +P+E   +       +S+V+ S+II
Sbjct  120   LSNFYWSDKIRDLVQRFDDIAANRRDLGLDGH---DPIEVYNIERNPLDAYSYVKKSEII  176

Query  582   GRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLW  761
             GRD  +  I+  L  S    D  S+  LPIVG GG+GKT L KLV+ND+ V  NFD +LW
Sbjct  177   GRDEARSEIIRRLTSSTSVGDASSLVVLPIVGFGGIGKTALAKLVFNDEWVASNFDIKLW  236

Query  762   VSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
               VSE F L K IE+IL S + ++  +L+M QL E L  +L   ++ LVLDDVW ED   
Sbjct  237   ACVSEKFDLQKTIEEILNSVSNETTANLNMRQLHEKLREILDGRKHFLVLDDVWIEDIKV  296

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
             W++L  L+     GS ++VTTRS  VA+  G    Y L  L    C+ +F + AFRE +E
Sbjct  297   WRDLENLVAVSEKGSVILVTTRSDMVASTVGNVDPYCLDNLPGDVCWSIFKQLAFREGEE  356

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRE-NEIWKIEQKETDIL  1295
              R  NL  IGK IV+KCGGVPL VK L S+L  + +E+EW  I E N    +  +  DI 
Sbjct  357   TRYPNLATIGKSIVEKCGGVPLVVKVLASLLRSERNEKEWRRISETNNFMNLHLQHNDIK  416

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQ  1475
               L++SY+++P  L+ CF+YC +F K  ++   +   LW A G +Q  + ++ELE++G +
Sbjct  417   QALRVSYNKLPSQLKACFSYCSLFVKDSKLNPPILSCLWSALGILQRGNDNEELESIGYK  476

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
             Y  +LLSR   QD    F   I  C++H+L HDLA  + G E   V S    + +   HL
Sbjct  477   YCEDLLSRCLLQDAFLVFTETISECRMHDLFHDLATDLVGEEIAVVTSNHLNVSDMCRHL  536

Query  1656  VF---HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
             V+     + LS + FP+ LL  K  R F + + +G +SK+F++  + NFR LRVL L   
Sbjct  537   VWGYEGGEGLSDKNFPKELLRAKKARTFRFGYAMGYISKSFIESIIHNFRCLRVLDLHQS  596

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
               +ELP SIG L+ LRYL+LS N  IK LP  + KL+NLQ+L +  CEQL+ELPR+   Q
Sbjct  597   SFEELPMSIGKLEHLRYLDLSYNPIIKFLPSTLCKLLNLQSLYIPGCEQLQELPRDI-DQ  655

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIW-----QHMKKLRVLR  2171
             L+SL+ L +T  +VSL       L  L  L LY C   K    +W     Q    L  L 
Sbjct  656   LVSLRYLSVTMNQVSLASTKFNGLSSLGRLELYSC---KELTTLWNGFSFQFHTTLVELH  712

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLP  2351
             I  C  L CLP   ++L  LE L I +C+ELDL  G+ + GL+SL++L + G+PKL  LP
Sbjct  713   IVNCQKLICLPDSKKYLVALETLIIRDCQELDLEKGDNLCGLQSLRTLEITGVPKLERLP  772

Query  2352  AGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNA  2528
              G++   A  L+YL + GC  LT LP+WLQ+ T L+R+ +  C  +  LPE         
Sbjct  773   DGIQSA-ASSLQYLWIEGCAGLTTLPNWLQHFTSLRRILLFSCINIVALPEGFSQLHCLQ  831

Query  2529  KVRIIDCPLLNG*CG  2573
             K++I +CP L+  C 
Sbjct  832   KLQIKNCPHLSKRCA  846



>ref|XP_010904853.1| PREDICTED: putative disease resistance protein RGA3 isoform X2 
[Elaeis guineensis]
Length=812

 Score =   487 bits (1253),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 317/785 (40%), Positives = 485/785 (62%), Gaps = 16/785 (2%)
 Frame = +3

Query  165   LKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLR  344
             ++ EL KL+++++ +KAVL DA+++Q+    ++ WL+ L++V YDA+D+L+DF    L R
Sbjct  1     MEKELDKLKDSITLVKAVLMDAEKKQSTTQGLRVWLELLKNVFYDAEDILNDFEVEDLRR  60

Query  345   KLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPV  524
             ++ S   IL KV +  +R + LI+R  ++HK++++  RL+ I   + +F   E    N  
Sbjct  61    QVVSRGDILRKVHRFCSRSNPLIFRTNMSHKLKKLNERLDGIVRKKIDFQLVEGPVNNYR  120

Query  525   ENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttl  704
                +  ++ HSFVR S+IIGRD DKE I+ +L+    + +   ++ +PIVG+GGLGKTTL
Sbjct  121   PLFQEEKEKHSFVRASNIIGRDEDKEKIIELLLHPNTDRN---INVIPIVGIGGLGKTTL  177

Query  705   vklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATG--KSFGHLDMDQLQEHLNG  878
              KLVYND+R++++F+ ++WV VS+DF   K++E  +++ATG  + +G+  MDQLQ  L  
Sbjct  178   AKLVYNDERIIRHFELKMWVYVSKDFGERKLMENTVKTATGDGQDYGNFTMDQLQIGLRD  237

Query  879   VLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLS  1058
              +   + LLVLDDVWNED+ KW+ L++LLM G  GS ++VTTRS  VA+I  TT  YNL 
Sbjct  238   AIKDKKILLVLDDVWNEDRKKWEELKDLLMVGASGSMIMVTTRSHLVASIMCTTPTYNLL  297

Query  1059  GLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQE  1235
             GL   +C  LF++ AF E QE +  NLV+IG +IV+KCGGVPLAV TL   L+  T E++
Sbjct  298   GLRHDECLSLFVRYAFMEGQERQYPNLVKIGDDIVRKCGGVPLAVMTLAGQLFLNTRERD  357

Query  1236  WLHIRENEIWKIEQKETD--ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINL  1409
             W  I+++ IW+IE+KET+  ILP L++SY+Q+P  L++CFAYC +FPK  E      +  
Sbjct  358   WNVIKDSGIWEIEEKETESGILPALRVSYEQLPSPLKRCFAYCSIFPKDYEFNDFEVVQF  417

Query  1410  WVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSV  1589
             W+A G I   +  QELE++G +Y  +L   F  QD  + +   ++  ++H+++H+LA SV
Sbjct  418   WMALGLIVPMNERQELEDVGFRYLEKLGHGFFVQDFRDHYG--VVRFRMHDVMHELALSV  475

Query  1590  AGAECLNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAY-SFRVGTVSKT  1766
             +  EC  V +   +I ++V HL F   +   ++ P  L +L  +R   + S + G   K+
Sbjct  476   SKDECSVVTANRQKIAKNVRHLSFPDPDSLPQDLPTILQDLDRVRTVCFQSAKEGPSCKS  535

Query  1767  FVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQ  1946
              ++  L  F+ LRVL L   +  +LP  IG  K LRYL+LS N  I+ LP  I KL NLQ
Sbjct  536   VIETCLSRFQYLRVLNLSRSQFDQLPKGIGNFKHLRYLDLSWNHKIRKLPSSIYKLQNLQ  595

Query  1947  TLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKF  2126
             TL L  C+++++LPRN  + ++SL+ L +T+++ SL K     L  L+ L +Y C   + 
Sbjct  596   TLILAGCDEIEKLPRNL-RYMVSLRFLCITTRQKSLPKGEIGCLKSLRVLWIYSCENVEH  654

Query  2127  PAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVg----egmeg  2294
               E  Q +  LR L I  C SL  LP  I+ L  LE L I  CE L+L+      +    
Sbjct  655   LFEDMQALTNLRTLYICTCQSLVSLPPCIKQLTALEILLISGCESLNLARVGGQDDQNSS  714

Query  2295  leslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIE  2474
               SL+ L++  + ++V LP  L    A  L+YLRV  CP LT LP++L+N   L++L+I 
Sbjct  715   QFSLRKLVISFVTEMVELPQWLLGKSADTLEYLRVEFCPGLTELPEYLKNFKSLEQLWIL  774

Query  2475  DCPEL  2489
              CP L
Sbjct  775   GCPLL  779



>gb|KHN14950.1| Putative disease resistance protein RGA1 [Glycine soja]
Length=869

 Score =   489 bits (1258),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 325/834 (39%), Positives = 485/834 (58%), Gaps = 36/834 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE FL  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAELFLFSIAESLITKLASHAFQEASWVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDAD + + F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYDADVIDE-FECQTLQKQVLKAHGTIKDEVSHFFSSSNPLVFRSKMA  119

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V    +   THS V  SD+IGR+ DKE +
Sbjct  120   QQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDMSRMTHSRVSDSDVIGREHDKEKV  179

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  180   IKLLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAKFVFNDKRINECFSLKMWVCVSDDFDI  239

Query  789   SKVIEKILRSATG-------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ S          ++   +D++QLQ HL   L + ++LLVLDD+WN+D+ KW 
Sbjct  240   NQLIIKIINSTNDANAPLCQQNLNMVDLEQLQTHLRNKLANKKFLLVLDDIWNDDRVKWV  299

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQE-YR  1124
              LR L+  G  GS+++VTTR   +A++ GT T++ L  LS  D   LF+K AF+E E  +
Sbjct  300   ELRNLIQGGVAGSKILVTTRIDSIASMMGTVTSHKLKRLSPEDSLSLFVKWAFKEGEDEK  359

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               +LV IGKEIV KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + QK+ DILP L
Sbjct  360   HPHLVNIGKEIVNKCKGVPLAVRTLGSLLFSKFEANEWEYVRDNEIWNLPQKKDDILPAL  419

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             KLSYD +P +LRQCFA   ++PK  E        LW A G +  P  ++  E++  QY +
Sbjct  420   KLSYDFLPSYLRQCFALFSLYPKDYEFRSVEVARLWEALGVLAPPRKNETPEDVVKQYLD  479

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             ELLSR   QD ++   G I   KIH+LVHDLA  VA  ECL + S    IPE++ HL   
Sbjct  480   ELLSRSFLQDFIDG--GTICQFKIHDLVHDLALFVAEDECLLLNSHIQNIPENIRHLSSA  537

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               N  R  F    + L+ + +   +   G   +  +   +L  + LRVL L++   K LP
Sbjct  538   EYNFLRNSFTSKSVALRTIMFRDGA--EGANVEALLNTCVLKSKFLRVLDLRDSTCKTLP  595

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
              SIG LK LRY ++ NN NIK LP  I KL NLQ  N++ CE+L+ LP+   ++L+SL+ 
Sbjct  596   CSIGKLKHLRYFSIQNNRNIKRLPNSIFKLQNLQLFNVLGCEELEALPKGL-RKLISLRH  654

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRIYEC  2183
             L +++++  L      +L  L  L +             KFPA        L+ L + +C
Sbjct  655   LDISTKQPVLPYSEITNLISLAHLSIGSSHNMESIFGGVKFPA--------LKRLSVSDC  706

Query  2184  SSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg----lPKLVSLP  2351
              SL  LP  + +  +LE L + +C  LDL + +     +S    L       LP+LV+LP
Sbjct  707   HSLKSLPLDVTNFPELEILIVEDCVNLDLELWKDDLEEQSPMLKLKCVGFGCLPQLVALP  766

Query  2352  AGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
               L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I 
Sbjct  767   QWLQET-ANFLQTLGIKNCNNLEMLPEWLSTMTNLKVLIISDCPKLISLPDNIH  819



>ref|XP_007162218.1| hypothetical protein PHAVU_001G134000g [Phaseolus vulgaris]
 gb|ESW34212.1| hypothetical protein PHAVU_001G134000g [Phaseolus vulgaris]
Length=864

 Score =   488 bits (1256),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 336/850 (40%), Positives = 504/850 (59%), Gaps = 38/850 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+FL  I +++++K+ S   +E S    L   L++  +TLS +KAVL DA+++Q  NH
Sbjct  1     MVESFLFSIADSLIAKLASQLYEEASRVMGLYHHLQEFTHTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGIL-TKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V  DA DLLD+F   +L  ++    G   TKV + F+  + L++R+K+ 
Sbjct  61    ELREWLRQLKRVFSDAQDLLDEFECQTLQNQVVKAHGTTKTKVGRFFSSSNPLVFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFK----ENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
              +I++I  RL+++A DRR F  +    +   V+ +E       THS V  SD+IGR+ DK
Sbjct  121   QQIKDITNRLDKVAADRRKFGLQTIDVDTRVVHRIE------MTHSHVNDSDVIGREHDK  174

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
               I+ +LM+    +  +S+S +PIVG+GGLGKTTL K V+NDDR+ + F  ++WV VSE+
Sbjct  175   GKIIHILMQKNGIDIDKSLSVIPIVGMGGLGKTTLAKFVFNDDRINECFPLKMWVCVSEN  234

Query  780   FSLSKVIEKILRSAT-GKSFGH----------LDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
             F + ++I KI+ SA    S  H          LDM+QLQ  L   L   ++LL+LDDVWN
Sbjct  235   FDIKQMIVKIINSANDSASHAHAPDFQQNLNILDMEQLQNQLRNKLAGKKFLLILDDVWN  294

Query  927   EDQHKWKNLRELLMSGCD-GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCA  1103
             ED+ KW  LR L+  G   GS+++VTTRS  +A++ GT +++ L GLS  D   LF+K A
Sbjct  295   EDRVKWVELRNLIQVGAAAGSKILVTTRSHSIASLMGTVSSHILQGLSLEDSTSLFVKWA  354

Query  1104  FRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK  1280
             F+E +E    +L+ IG++IV+KC GVPLAV+T+GS+L+ K +  E  ++R++EIW + QK
Sbjct  355   FKEAEEENYPHLINIGRDIVKKCRGVPLAVRTIGSLLFSKFEANEREYVRDSEIWNLPQK  414

Query  1281  ETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELE  1460
             + DILP LKLSYD MP +LRQCFA   ++PK  E        LW A G + S   +   E
Sbjct  415   KEDILPTLKLSYDLMPSYLRQCFALFSLYPKDYEFVNFEVTTLWGALGLLGSLKKNMTQE  474

Query  1461  NLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPE  1640
             ++ NQYFNELLSR   QD V    G     KIH++VHDLA  VA  ECL V S    IPE
Sbjct  475   DVANQYFNELLSRSFIQDFVSC--GTAYTFKIHDVVHDLALFVAKDECLLVNSHIRCIPE  532

Query  1641  SVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLN-FRRLRVLML  1817
             S+ HL F  ++L  + F    + ++ + +      VG  S+ F   TL++ ++ L +L L
Sbjct  533   SIRHLSFVENDLDGKSFSAKSVGVRTILFPKDG--VGANSEAFF--TLVSRYKYLHILDL  588

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
                 +  LP  IG LK LRYL+L NN  I+ LP+ I +L +LQ L+L  C++L+ LP+  
Sbjct  589   SYSSVGTLPGFIGKLKHLRYLSLYNNKKIRGLPDSICELQSLQVLDLGGCQELEALPKGL  648

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRI  2174
              ++L+SL+   +T+++  L +    +L  LQ+L +  C +     + I   +  L+ L +
Sbjct  649   -RKLISLRDFVITTKQAVLPENDIANLSCLQYLTIECCDNVESLFSGI--ELPHLKALNV  705

Query  2175  YECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVg-egmegleslqslllmglPKLVSLP  2351
               C  L  LP   +H   LE L I  C++L LS G E  + +  L+++L   LP+L +LP
Sbjct  706   SSCKRLQYLPLDSKHFPALEILCIRICDKLGLSKGPEDQKFILKLKTILFTSLPQLGTLP  765

Query  2352  AGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNA  2528
               L+      L  LR+  C  L  LPDWL   T L+ L I DCP+L  LP+ I   ++  
Sbjct  766   HWLQG-SISTLLSLRLEHCHNLEVLPDWLPMLTSLKALDITDCPKLRSLPDGINCLTALE  824

Query  2529  KVRIIDCPLL  2558
             ++ +IDCP L
Sbjct  825   RLEVIDCPEL  834



>ref|XP_007029660.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY10162.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=859

 Score =   487 bits (1253),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 323/846 (38%), Positives = 491/846 (58%), Gaps = 62/846 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETF  +I E ++ K+ ++A  EIS AW ++ + ++L + L+T+K VL D +E  A+N+
Sbjct  26    MAETFAFNIVEKLIEKLATVAYQEISLAWGVQTDFQRLNDILTTVKDVLLDTEENVAQNN  85

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             + ++WLQKL+D  Y A+D+LD+F   +L +++     I  KV   F+  + + +RF++ H
Sbjct  86    QQRNWLQKLKDACYGAEDVLDEFQIEALRKQVLKQRSIGKKVHSFFSSSNPVAFRFRMAH  145

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+++  R  +IA  + NFH    +Y        L  +THSFV+ +DIIGRD DKE I+ 
Sbjct  146   KIKKVTERFGEIAALKANFHLAGRHYDTRYLVTGLDRETHSFVQAADIIGRDEDKEKIIK  205

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              LM+  D  D E +S LPIVG+GGLGKT L KLVYND+ V ++F+ ++WV          
Sbjct  206   TLMQ--DPTDGEGISVLPIVGIGGLGKTALAKLVYNDECVDRHFELKMWV----------  253

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
                                          L   +YLL+LDD+WNED  KW  L++LL+ G
Sbjct  254   -------------------------FRDCLDEKKYLLILDDLWNEDHIKWDELKQLLVQG  288

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEY-RPRNLVEIGK  1151
               GS+++VTTRS +VA I  T + +NL GL + +   LFL+ A ++ E  + +NLV+IG+
Sbjct  289   AKGSQIVVTTRSSQVAEIMSTISTHNLQGLPEKESLCLFLQFASKKGEINQHQNLVKIGE  348

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EIV+KC GVPL +KTLGS+L  KT E +W  +R++E+WK+ Q+E  I P+LKLSYDQ+P 
Sbjct  349   EIVKKCSGVPLVLKTLGSLLLSKTSEDDWEFVRDSEMWKLVQEEKSIFPVLKLSYDQLPP  408

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L+ CFAY  +FPK  E  +   I+ W+A   + S + +++ E++G +Y N+L SR  FQ
Sbjct  409   YLKPCFAYLSVFPKDYEFDQMALIHFWMAHDLLHSSNENEDAEDIGERYLNDLSSRSFFQ  468

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             D  ++   +  + K+H+L+HDLA SVA  EC  V      I   + HL   + +   E+ 
Sbjct  469   DFAQSLSFQ--SFKMHDLLHDLALSVAKNECSTVNCFKQIIAPGIRHLCLDSLDFFEEQS  526

Query  1692  PQPL--LNLKNLRYFAY-SFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
                L    L +LR F   + + G+ S++F+KK L  F+ LRVL LQ    + LP  +G L
Sbjct  527   SGFLDVDTLGHLRTFRLENMKEGSNSESFIKKCLSRFQNLRVLDLQGSSFEVLPKRVGRL  586

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQ  2042
             K LRYL+L++N  IK LP  + KL  LQTL L+ CE ++ELP+N  + +++L+ L ++++
Sbjct  587   KHLRYLDLNDNSKIKKLPNFVCKLPCLQTL-LLYCEGIEELPKNM-RYMINLRMLVISTK  644

Query  2043  EVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             + SL K    +L  L+ L++  C   ++  +  Q++K L  L I  C +L  +P G   L
Sbjct  645   QRSLSKNGFENLKSLRHLMIGNCKNLEYLFDGIQNLKSLHALIISGCKNLISMPQGFEAL  704

Query  2223  AKLEKLWIWNCEELDLSVgegm--------------egleslqslllmglPKLVSLPAGL  2360
               L+ L IW CE+L L++  G                    LQ L++ G+PKL  LP  L
Sbjct  705   IALKVLVIWECEKLHLNMTLGSEGRGKEDDSQDYHIASRLRLQELVIGGVPKLEVLPEWL  764

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRI  2540
                 A  L+ L +  C  LT  P+  QN T L+ L I DCP LS LPE+++     ++ I
Sbjct  765   LVESANTLRVLALGECENLTKFPE-RQNFTSLEGLGITDCPNLSSLPERMQCLK--QLVI  821

Query  2541  IDCPLL  2558
               CP+L
Sbjct  822   ERCPIL  827



>ref|XP_004513775.1| PREDICTED: putative disease resistance protein RGA3-like [Cicer 
arietinum]
Length=854

 Score =   486 bits (1252),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 331/831 (40%), Positives = 495/831 (60%), Gaps = 33/831 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + K+ S   +E S A  +   L++++ T+S IKAVL DA+++Q +NH
Sbjct  1     MAESLLFSLAESFIGKLGSHVIEEASLALGVYDNLREIKTTVSLIKAVLLDAEQKQRQNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+K+WL++++ V  DA+D++DDF   +L + + + SG I  KVR+ F+  + L+YR ++ 
Sbjct  61    ELKEWLRQIKRVFSDAEDIIDDFECEALRKHVVNTSGSIKRKVRRFFSSSNSLVYRLRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+  + R N++A DR NF  + N   N V   + RE T+S V  S++IGR+ DK+ I+
Sbjct  121   HQIKHTQERFNKVAADRHNFGLQINETDNRV--VQTREMTYSHVNDSNVIGRELDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LMK   ++   S+S +PIVG+GGLGKTTL K V+ND  VV++F  ++WV VS+DF+L 
Sbjct  179   DLLMKDASDK---SLSVIPIVGIGGLGKTTLAKCVFNDKSVVESFPLKMWVCVSDDFTLK  235

Query  792   KVIEKILRSATGK--------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
              V+ KIL SAT          SF   D +QLQ H+   L S ++LLVLDDVWNED+ KW+
Sbjct  236   HVLLKILNSATDTDPNPILQDSFKDFDTEQLQIHIRNKL-SQKFLLVLDDVWNEDRAKWE  294

Query  948   NLRELLMS--GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEY  1121
              L++++    G   S++IVTTRS  +A + GT ++Y L GLS  D   +F+K AFRE E 
Sbjct  295   ELKDIIQVDVGAQESKIIVTTRSHTIANMMGTCSSYILQGLSREDSLSVFVKWAFREGEE  354

Query  1122  RPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
             +    L+EIG+EIVQKCGG+PLA++TLGS L+ K+D  +W  +++NEIW + QK+ DILP
Sbjct  355   KNYPELIEIGEEIVQKCGGLPLALRTLGSSLFLKSDIDDWKFVKDNEIWNLPQKKDDILP  414

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              +KLSYDQ+P +L++CFA   +F K  +        LW A GF+ SP  D+ +E +G Q 
Sbjct  415   AIKLSYDQLPSYLKRCFACFSLFRKDIQFYSFNVTALWEALGFLPSPKKDKSVEEIGYQI  474

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
               EL S    QD V+   G   A K+H+LVHDL+  VA  E   +K     + E+V +L 
Sbjct  475   LRELQSISFLQDFVDY--GNSCAFKLHDLVHDLSLYVAVDEFQTLKFRSESVFENVLYLS  532

Query  1659  FHADNLS-REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
             F+ +N     + P P       R  +  F  G  ++ F+   L   + LRVL +     K
Sbjct  533   FNKNNNDLLGQIPIP------TRLRSILFPRGANNEAFLNTLLSRCKFLRVLQINYSTYK  586

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LPSSIG LK LRYLNL +N  +KSLP+ + KL NL TLN   C++L+ LP   G +L+S
Sbjct  587   SLPSSIGKLKHLRYLNLQDNKALKSLPDVVCKLQNLLTLNFQRCKKLRLLPNGIG-KLIS  645

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLT  2195
             L+ L +T+++ ++       L  L+   +  C   +   E  Q +  LR L I  C +L 
Sbjct  646   LRRLQITTKQTNIPNNEIAKLTSLEIFSVVSCRNLEELLEGIQ-LPNLRSLLIASCRNLK  704

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDID  2372
              LP  +  +  L+ LWI+NC+ ++LS+    +     L+SL L  LP+LV+ P  L+   
Sbjct  705   SLPFHV--VPNLKGLWIYNCKNMNLSLDHDNDIPNLRLESLRLEYLPQLVTFPQWLQGC-  761

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSN  2525
             A +LK L +  C  L  LP W      L+   I++CP+L  LP+ +    N
Sbjct  762   ASRLKSLDLKSCENLEVLPKWFSTLIYLKTFLIKNCPKLLLLPDDMHCLKN  812



>ref|NP_001238129.1| NBS-LRR disease resistance protein [Glycine max]
 gb|ACJ37419.1| NBS-LRR disease resistance protein [Glycine max]
Length=909

 Score =   488 bits (1255),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 324/849 (38%), Positives = 490/849 (58%), Gaps = 50/849 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DAD++Q  NH
Sbjct  1     MAESFLFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDADQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             E+++WL++L+ V YDA+D+L++F   +L +++    G +               + ++  
Sbjct  61    ELQEWLRQLKSVFYDAEDVLNEFECQTLRKQVLKAHGTI---------------KDEMAQ  105

Query  435   KIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE I+
Sbjct  106   QIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKII  165

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LM+    +D +S+S +PIVG+GGLGKTTL + V+ND R+ + F  ++WV VS+DF ++
Sbjct  166   ELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAQFVFNDKRIYECFSLKMWVCVSDDFDIN  225

Query  792   KVIEKILRSATG-------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKN  950
             ++I KI+ SA         ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ KW  
Sbjct  226   QLIMKIINSANDANAPFRQQNLNMVDLEQLQNQLRSKLAGKKFLLVLDDVWNDDRVKWVE  285

Query  951   LRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRP  1127
             LR L+  G  GS+++VTTR   +A++ GT T++ L  LS  +   LF+K AF+E +E + 
Sbjct  286   LRNLIQEGVAGSKILVTTRIDSIASMMGTVTSHKLQRLSSENSLSLFVKWAFKEGEEQKH  345

Query  1128  RNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              +LV IGKEIV+KC G+PLAV+TLGS L+ K +  EW  +R+NEIW + QK+ DILP LK
Sbjct  346   PHLVNIGKEIVKKCRGIPLAVRTLGSSLFSKFEANEWECVRDNEIWNLPQKKDDILPALK  405

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSYD +P +LRQCFA   ++PK  E      + LW A G + SP  ++ LE++  QY +E
Sbjct  406   LSYDFLPSYLRQCFALFSLYPKDYEFRSFEVVRLWGALGVLASPRKNETLEDVVKQYLDE  465

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             LLSR   QD ++   G     +IH+LVHDLA  V   ECL V S    IPE++ HL F  
Sbjct  466   LLSRSFLQDFIDC--GTFYQFRIHDLVHDLAVFVTKEECLLVNSHIQNIPENIRHLSFAE  523

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
              +     F    + ++ +  F      G V ++ +   +  F+ LRVL L     K LP 
Sbjct  524   YSCLGNSFTSKSVVVRTI-MFPNGAEGGNV-ESLLNTCVSKFKLLRVLDLSYSTCKTLPR  581

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LK LRY ++ NN NIK LP  I KL NLQ L++  C++LK LP+   ++L+SL+ L
Sbjct  582   SIGKLKHLRYFSIENNRNIKRLPNSICKLQNLQLLSVRGCKKLKALPKAL-RKLISLRHL  640

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRIYECS  2186
              +T+++  L      +L  L  L +             KFPA        L+ L + +C 
Sbjct  641   KITTKQPVLPYSEITNLITLAHLYIASSHNMESILGGVKFPA--------LKTLYVVDCH  692

Query  2187  SLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl----PKLVSLPA  2354
             SL  LP  + +  +LE L++ +C  LDL + +     ++ +  L        P+LV+LP 
Sbjct  693   SLKSLPLDVTNFPELETLFVVDCVNLDLELWKDDHEEQNPKLKLKYVAFWGLPQLVALPQ  752

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAK  2531
              L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I   ++  +
Sbjct  753   WLQET-ANSLQTLFIKNCDNLEMLPEWLSTLTNLKALEISDCPKLISLPDNIHHLTALER  811

Query  2532  VRIIDCPLL  2558
             +RI+ CP L
Sbjct  812   LRIVGCPEL  820



>ref|XP_003553414.1| PREDICTED: disease resistance protein RGA2-like [Glycine max]
Length=880

 Score =   485 bits (1249),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 331/847 (39%), Positives = 499/847 (59%), Gaps = 34/847 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+  I E++L K+ S   +E S A+++  +L+ ++ TLS +K VL DA+E++ + H
Sbjct  1     MAESFVFHIAESLLQKLASYVSEEASRAYDVYEDLQVIKGTLSIVKGVLLDAEEKKEQKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL ++++V +DA+D+LD F   +L +++   SG    KV   F+  + L++R  + 
Sbjct  61    GLREWLMQIQNVCFDAEDVLDGFECQNLRKQVVKASGSTRMKVGHFFSSSNSLVFRLSMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I+ +R RL++IA D   F  +     + +   + RE T+S +  S +IGRD+D+E I+
Sbjct  121   RQIKHVRCRLDKIAADGNKFGLERISVDHRLV--QRREMTYSHIDASGVIGRDNDREEII  178

Query  612   GMLMK---SCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+     D +  +SV  +PIVGLGG+GKTTL KLV+ND R+ + F  ++WV VS+DF
Sbjct  179   KLLMQPHPHGDGDGDKSVCVIPIVGLGGMGKTTLAKLVFNDKRIDELFQLKMWVCVSDDF  238

Query  783   SLSKVIEKILRSATG------------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
              + ++I KI+  A+             +S  +LD++QLQ  L   L    YLLVLDD+WN
Sbjct  239   DIRQIIIKIINCASASTSAPSIALAHHESINNLDIEQLQSQLRHKLSGQTYLLVLDDIWN  298

Query  927   EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
             +++ KW  L +L+  G  GS+++VTTRS  +A++ GT  +Y L GLS  +C  LF+K AF
Sbjct  299   DNRAKWIELNDLIKVGAVGSKILVTTRSNSIASMVGTVPSYVLEGLSVENCLSLFVKWAF  358

Query  1107  RE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE  1283
             +E +E +  NLV+IGKEIV+KC GVPLAV+TLG  L+   D + W  +R++EIW + QK+
Sbjct  359   KEGEEKKYPNLVDIGKEIVKKCQGVPLAVRTLGCSLFLNFDLERWEFVRDHEIWNLNQKK  418

Query  1284  TDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN  1463
              DILP LKLSYDQMP +LRQCF +  ++PK          +LW+A G +QS  G Q++EN
Sbjct  419   DDILPALKLSYDQMPSYLRQCFVFFSLYPKDFCFTSGHIAHLWLALGLLQSGVGSQKIEN  478

Query  1464  LGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES  1643
             +  QY +EL SR   +D ++   G +   KIH+LVHDLA  VA  E L V S    IPE 
Sbjct  479   IARQYIDELHSRSFLEDFMDF--GNLYFFKIHDLVHDLALYVAKGELLVVNSHTHNIPEQ  536

Query  1644  VHHL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLML  1817
             V HL +   D+ S   FP+     + +R   +    VG  S+  +   +  ++ LRVL L
Sbjct  537   VRHLSIVEIDSFSHALFPKS----RRVRTILFPVDGVGVDSEALLDTWIARYKCLRVLDL  592

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              +   + LP SI  L+ LR L+++NNC IK LP  + KL NLQ L+L  C +L+ LP+  
Sbjct  593   SDSTFETLPDSISKLEHLRALHVTNNCKIKRLPHSVCKLQNLQFLSLRGCMELETLPKGL  652

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIY  2177
             G  L+SL+ LY+T+++  L +    SL  LQ+L    C   KF     Q +  L VL I 
Sbjct  653   G-MLISLEQLYITTKQSILSEDEFASLRNLQYLSFEYCDNLKFLFRGVQ-IPSLEVLLIQ  710

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLVSLPA  2354
              C  L  LP  +  L KLE L++  CE L+LS+          L+ L L   P+  +LP 
Sbjct  711   SCGRLESLP--LHFLPKLEVLFVIQCEMLNLSLNNESPIQRLRLKLLYLEHFPRQQALPH  768

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV  2534
              ++   A  L+ L +  C  L  LP+WL   T L+ L+I +CP+L  LP  +   +  +V
Sbjct  769   WIQGA-ADTLQTLSILNCHSLKMLPEWLTTMTRLKTLHIVNCPQLLSLPSDMHHLTALEV  827

Query  2535  RIID-CP  2552
              IID CP
Sbjct  828   LIIDGCP  834



>ref|XP_006576493.1| PREDICTED: disease resistance protein RGA2-like [Glycine max]
Length=847

 Score =   484 bits (1246),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 331/847 (39%), Positives = 492/847 (58%), Gaps = 46/847 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE FL  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAELFLFSIAESLITKLASHAFQEASRVVGLYHHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL +L+ V YDA D+LD+F   +L + +    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLSQLKSVFYDAQDVLDEFECQTLRKHVLKAHGTIKDEVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE I
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +  +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDHDKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDECFSLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSATGKS-------FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ SA   S          +D++QLQ HL   L   ++LLVLDDVWN+D+ KW 
Sbjct  241   NQLIIKIINSANDASAPLRQQNLNMVDLEQLQNHLRSKLAGQKFLLVLDDVWNDDRVKWV  300

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYR  1124
              LR L+  G  GS+++VTTR   +A++ GT T++ L  LS  +   LF+K AF+E +E +
Sbjct  301   ELRNLIQEGVAGSKILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEEEK  360

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               + V IGKEIV KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + QK+ DIL +L
Sbjct  361   HPHFVNIGKEIVNKCKGVPLAVRTLGSLLFSKFEANEWEYVRDNEIWNLPQKKDDILAVL  420

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             KLSYD +P +LRQCFA   ++PK  E        LW A G +  P  ++  E++  QY +
Sbjct  421   KLSYDFLPSYLRQCFALFSLYPKDYEFRSVEVARLWEALGVLAPPRKNETPEDVVKQYLD  480

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             ELLSR   QD ++   G I   KIH+LVHDLA  VA  ECL + S    IPE++ HL F 
Sbjct  481   ELLSRSFLQDFIDG--GTICQFKIHDLVHDLALFVAEDECLLLNSHIQNIPENIWHLSFA  538

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               N     F    + ++ +  F+    V  V +  +   +  F+ LRVL L++   K LP
Sbjct  539   EYNFLENSFTSKSVAVRTI-MFSNGAEVANV-EALLNTCVSKFKFLRVLDLRDSTCKTLP  596

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
              SIG LK LRY ++ NN NIK LP  I KL NLQ LN++ CE+L+ LP+   ++L+SL+ 
Sbjct  597   RSIGKLKHLRYFSIQNNRNIKRLPNSICKLQNLQLLNVLGCEELEALPKGL-RKLISLRH  655

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T+++                  ++  S  KFPA        L+ L + +C SL  LP
Sbjct  656   LDITTKQT-----------------VFPYSPLKFPA--------LKTLYVADCHSLKSLP  690

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg----lPKLVSLPAGLKDID  2372
               + +  +LE L + +C  LDL + +     ++ +  L +     LP+ V+LP  L++  
Sbjct  691   LEVTNFPELETLIVKDCVNLDLDLWKDHHEEQNPKLKLKLVGLWRLPQPVALPQWLQET-  749

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDC  2549
             A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I   ++   ++I DC
Sbjct  750   ANSLQSLFMMNCDNLGMLPEWLSTMTNLKVLIISDCPKLISLPDNIHHLTALEYLQISDC  809

Query  2550  PLLNG*C  2570
             P L   C
Sbjct  810   PELCKKC  816



>ref|XP_008241007.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=833

 Score =   483 bits (1243),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 334/841 (40%), Positives = 493/841 (59%), Gaps = 55/841 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+A ++I  AW +K +LKKLQ T+S IK VL DA+++Q  N +++ W+++
Sbjct  8     LATKLIEKLGSIAYEQICLAWGVKADLKKLQRTMSIIKDVLLDAEQKQEHNQQIRSWVRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+DV  DA+DLLD F   +L R++  +  G   KVR+ F+R + + + F++ ++I+EIR 
Sbjct  68    LKDVFLDAEDLLDKFECEALRREVVETFHGTTGKVRRFFSRSNPIAFHFRVGNEIKEIRE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCD  635
             RL++   ++  F   ++                 FV  S +IGR+S+KE IV +LM+  D
Sbjct  128   RLDEPKSNKAIF---DSLTSIDHHGDGGDHHERPFVPASKVIGRESEKEEIVNLLMQQGD  184

Query  636   EEDT----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
              + +      VS +PIVG+GGLGKTTL K VY+D RVV +F+ R+W SV  DF L++   
Sbjct  185   NDQSGNSNNKVSVIPIVGIGGLGKTTLAKWVYDDKRVVGHFELRMWASVPVDFELTRCTR  244

Query  804   KILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-  977
              IL SA   +  + L +DQLQE L   L   ++LLVLDDVW +D  KW  LR+L++ G  
Sbjct  245   LILGSALDTAMSYKLTLDQLQERLREALKDKKFLLVLDDVWKDDALKWSQLRDLVIEGAK  304

Query  978   DGSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
              GS+++VTTR+  VA+I GT  T  NL  LS  +C  LF+KCAF+E  + +  NL E+GK
Sbjct  305   SGSKILVTTRNTAVASIMGTIPTNINLEFLSFEECLSLFVKCAFKEGHDKQYPNLFEMGK  364

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKE-TDILPILKLSYDQMP  1328
             +IV+KCGGVPLAVKTLGS LY KTDE++W  +R++EIW+++Q++ + ILP L+LSY ++P
Sbjct  365   DIVRKCGGVPLAVKTLGSQLYSKTDERDWKLVRDSEIWELKQEDNSHILPALRLSYTRLP  424

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINL---WVAQGFIQSP--DGDQELENLGNQYFNELL  1493
              HLRQC AYCC   K  ++ +   +NL   W+A G +      G+ ELE++G  YF +L 
Sbjct  425   PHLRQCLAYCCHLRK--DMIKFSSLNLIRHWMAHGILDQSRVHGNMELEDIGELYFKDLW  482

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVK-SGDPEIPESVHHLVFHAD  1670
             +R  FQ+V++   G      +H+L+HDL QSVA  EC  VK +   +I E+V HL F   
Sbjct  483   ARSFFQNVIDY--GTHYVFDMHDLIHDLVQSVAQGECFTVKYTNTKDISENVRHLAFLE-  539

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
               + +     L  L  +R  A +     + ++F+  +   F+ LRV+ L    L+ LP S
Sbjct  540   --AGQNVSTTLQKLNKVRTVAAN--KIDIDESFLHTSFSRFKYLRVVELPRCSLQVLPIS  595

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
              G LK LR L+LS N  I  +P  I +L +LQTLN   CE L+ELP +   +L SL +L+
Sbjct  596   FGSLKHLRLLDLSYNKAITKIPIVICRLQSLQTLNFFGCENLEELPSDIS-KLFSLTSLF  654

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             LT+++ S  +                  C          +K LR+L I  CS+LT LP  
Sbjct  655   LTAKQTSFTENG--------------VGC----------LKSLRLLGISICSNLTSLPRE  690

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
               +LA L  L+I  C++LDL           LQ L +  LP +V+LP   +   A  L+ 
Sbjct  691   TGYLATLRTLFIGGCKQLDLGNVNYHGTPLRLQKLHIKDLPWMVALPEWFQGA-ANTLQI  749

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDCPLLNG*  2567
             L +  C  L ALP WL + T L +L++  C  LS LPE +RS +S  ++RII+CP L   
Sbjct  750   LIIESCENLEALPGWLASFTSLTKLFLYSCSRLSSLPEGMRSLTSLRELRIINCPKLERR  809

Query  2568  C  2570
             C
Sbjct  810   C  810



>ref|XP_004513778.1| PREDICTED: putative disease resistance protein RGA3-like [Cicer 
arietinum]
Length=854

 Score =   484 bits (1245),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 333/842 (40%), Positives = 499/842 (59%), Gaps = 37/842 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + KI S A +E S A  +  ++++++NT++ IKAVL DA++++ +N 
Sbjct  1     MAESLLFGLAESFIGKIASRAVEEASLALGVYDDMQEIKNTVTLIKAVLLDAEQKERQNQ  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E++ WL++++ VV DA+D++DDF   +L + + + SG I  KVR++F+  + L+YR ++ 
Sbjct  61    ELRVWLRQIKRVVSDAEDVVDDFECEALRKHVVNSSGSIRRKVRRIFSSSNPLVYRLRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ +R RL+++A DR  F  + N+  N V   + RE THS V  SD+IGR+ DK+ I+
Sbjct  121   HQIKNVRDRLDKVAADRLKFGLQINHNDNRVV--ETRELTHSNVIDSDVIGREPDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+++   +  +S+S +PIVG+GGLGKTTL K V+ND  VV++F  ++WV VS+DF L 
Sbjct  179   DLLLQN---DGDKSLSVIPIVGIGGLGKTTLAKCVFNDKSVVESFPLKMWVCVSDDFELK  235

Query  792   KVIEKILRSAT--------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
              ++ KIL SA+         ++F   D++QLQ H+   L   ++LLVLDDVWNED+ KW+
Sbjct  236   HLLVKILNSASVSNNNPIHHENFKIFDVEQLQNHIKNALAGHKFLLVLDDVWNEDRVKWE  295

Query  948   NLRELL--MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQ  1115
              L++++  + G  GS+V+VTTRS  VA + GT +++ L GLS  D    F+K AF+  E 
Sbjct  296   ELKDIIQVIVGSQGSKVVVTTRSHIVADVMGTHSSHFLQGLSGDDSLSAFVKWAFKVGEG  355

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E  P  L+EIGKEIVQKCGG+PLA++TLGS L+ K D  +W  +R+NEIW + QK+ DIL
Sbjct  356   ENYPE-LMEIGKEIVQKCGGLPLALRTLGSSLFLKFDIDDWKFVRDNEIWNLSQKKDDIL  414

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQ  1475
             P +KLSYD++P +L++CFA   +F KG ++       +W A GF+ SP   + + ++GNQ
Sbjct  415   PAIKLSYDRLPSYLKRCFACFSLFVKGYQLDSLSVTAIWEALGFLPSPKKGKGVADVGNQ  474

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
               +EL SR   QD V+  +G     K+H+LVHDLA  VAG E   +K     I E V HL
Sbjct  475   ILHELRSRSFLQDFVDYGNG--CEFKLHDLVHDLALYVAGDEFQLLKFRSESIFEDVLHL  532

Query  1656  VFHADNLSREEFPQPLLNLKNL--RYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
                 +N         L  L  +  R  +  F  G  ++TF+   L   + LR+L L N  
Sbjct  533   SLITNN-------DDLFGLTQIPTRLRSIIFPSGANNETFLNTMLSRCKFLRILTLANSR  585

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP SIG LK LRYLNL NN  ++SLP+ + KL NL TL L  C  LK LP   G  L
Sbjct  586   YESLPRSIGKLKHLRYLNLENNIELESLPDALCKLQNLHTLKLNGCINLKRLPNEIG-NL  644

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
             +SL+ L++T+++ +   +    L  L+ L +  C       E  Q +  L+ L I  C +
Sbjct  645   ISLRQLHITTKQSNFPNKEIAKLTSLEILSVRHCDNLDLLFEGIQ-LPNLKFLDIAYCEN  703

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKD  2366
             L  LP  +  +  LE L I  C ++ LS+          L+ L L  LP+LV LP  L+ 
Sbjct  704   LRSLPHHV--VLNLEGLLITECNKMKLSLDHDSYIPNLRLKLLSLEYLPQLVVLPQWLQG  761

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRII  2543
               A  L+ L +  C  L  LP WL     L+ L +E+CP L  +P  +    N   V+I 
Sbjct  762   C-AKTLQTLALENCYNLHELPMWLSTFISLKTLSLENCPRLVLIPNDVHHLKNLDYVKIK  820

Query  2544  DC  2549
              C
Sbjct  821   GC  822



>ref|XP_008361183.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=873

 Score =   484 bits (1247),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 340/836 (41%), Positives = 498/836 (60%), Gaps = 37/836 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F++ I E+V++ + S A  E+  AW ++ ELK+L+NT S IK ++ DA+E+Q K  
Sbjct  1     MAE-FVSTIAESVMAGLASFAYQEVCLAWGVEEELKRLRNTFSHIKLLIVDAEERQRKEP  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +  WL +L+D  YD DD+LD+F    +  K+    G I  KV   F+R + +++ F + 
Sbjct  60    LLTQWLGRLKDACYDIDDVLDEFAFQEMQMKMLVPGGSIKGKVCIFFSRWNPIMFNFIMG  119

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR RL+ + +++  FH  E   V   +   ++ +THSFV+P D+IGR+ DK+ ++
Sbjct  120   HKIKEIRERLDDMGDEKSRFHLVER--VGDWQVVHIKRETHSFVQPYDVIGREDDKKQVI  177

Query  612   GMLM----KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
               L+    K       E VS + I+GLGG+GKTTL KLVYND RVV+NFD R+WV VS+ 
Sbjct  178   IHLLNLNLKEASGGAPEHVSVISIIGLGGIGKTTLAKLVYNDHRVVRNFDMRMWVCVSDH  237

Query  780   FSLSKVIEKILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HK  941
             F   +++  IL SAT  + G H  +DQ+Q+ L   L   ++LLVLDDVW++        K
Sbjct  238   FDHKRLVHDILTSATNXNCGDHESLDQMQKKLQDALRDKQFLLVLDDVWDKAHVGVTSAK  297

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQ  1115
             W +++ LL  G +GS+VIVTTRS  VA++  +   + L GL    C  L ++ AF  + +
Sbjct  298   WFDMKALLNVGAEGSKVIVTTRSESVASVMSSARVHQLKGLPLKVCKSLLIRRAFGQKGE  357

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E R ++L+EI + I  KCGGVPLAV TLGS+L+ K ++Q W  +R+++IW ++Q   DIL
Sbjct  358   EQRYQHLMEIAESIADKCGGVPLAVTTLGSLLHSKREKQVWSKVRDSDIWTLDQGNEDIL  417

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPD-----GDQELE  1460
             P LKLSYD +P +L+ CFA C +FPK         ++LW+AQGF+QS +     GDQELE
Sbjct  418   PALKLSYDALPPYLKPCFAICSLFPKDYVFQSTDLVSLWMAQGFLQSSNPTRSKGDQELE  477

Query  1461  NLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVK-SGDPEIP  1637
              +G  Y  +L SRF F+  +E    + +  K+HNLVHDLA SV+  EC ++    +P+  
Sbjct  478   EIGLDYIRQLGSRFLFE--IEEDSIDFIVFKMHNLVHDLAISVSKLECSSINFRPNPDTC  535

Query  1638  ESVHHLVFHADNLSR---EEFPQPLLNLKNLR--YFAYSFRVGTVSKTFVKKTLLNFRRL  1802
             + V H+    D+L     E  P+  L L+ +    F      G  +K+ +K  +L F+ L
Sbjct  536   KRVRHVSMSXDDLPTKKGERVPEFFLQLQKVWTILFPIPGHEGFSNKSVLKSCILKFKYL  595

Query  1803  RVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKE  1982
             RVL L+    +ELP S+G L  LRYLNLS N +++ LP  I +L+NLQTL L NCE+LK+
Sbjct  596   RVLDLRGSTFEELPGSVGNLSGLRYLNLSKNPSMQKLPGSICRLLNLQTLLLTNCEKLKK  655

Query  1983  LPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLR  2162
             LPR+ G  L++L+TL LT+ + ++       L  L+FL +  CS      E+ Q +  LR
Sbjct  656   LPRDIG-NLINLRTLVLTTNQ-TVMPEGIERLASLRFLQVDSCSHLVSFGEMMQCLTNLR  713

Query  2163  VLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLV  2342
             VL I  C SL  LP    +L  L+ L I +C  LDL     M   E ++ L  + +  L 
Sbjct  714   VLVISNCQSLETLPGDXENLTALKALAISDCVNLDL-----MRSGEGIRDLRSVSVSHLE  768

Query  2343  SLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI  2510
             +LP  LK+     L+ L +  C  L  LP+WLQ   LL+ L IE CP+LS LPE +
Sbjct  769   ALPPWLKE-STDTLQSLSIKNCEGLKELPEWLQTFKLLEHLVIEYCPQLSSLPEGM  823



>ref|XP_006372437.1| hypothetical protein POPTR_0017s01630g [Populus trichocarpa]
 ref|XP_006372438.1| hypothetical protein POPTR_0017s01630g [Populus trichocarpa]
 gb|ERP50234.1| hypothetical protein POPTR_0017s01630g [Populus trichocarpa]
 gb|ERP50235.1| hypothetical protein POPTR_0017s01630g [Populus trichocarpa]
Length=834

 Score =   483 bits (1243),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 329/820 (40%), Positives = 474/820 (58%), Gaps = 23/820 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F A+I +++L K+ S A  E   AW L+ +L +L+  L  I  VL DA++QQ+KN 
Sbjct  1     MAEAFAAEIAKSLLGKLGSFAVQEFRLAWGLEDDLARLEERLKAINVVLSDAEKQQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR+V+YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLREVLYDAEDVLDEIECETLQRRVVKTKGSTSRKVQHFFTSSNMIPFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RLN I+  + +++  E          +  E   SF   S +IGRD D+E I+
Sbjct  121   HKIKKIIERLNDISALKSDYNLSEQTIDCSHVLHEETEMNRSFESFSGLIGRDKDRERII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+      D   +  LPIVG+GGLGKT+L K V + + V  +FD ++ V VS+DFSL 
Sbjct  181   NLLIAPIKVGDAHPL-VLPIVGMGGLGKTSLAKSVCDAENVKSHFDLKMRVCVSDDFSLK  239

Query  792   KVIEKILRSAT-GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
             +VI+KI++SAT G+    LD  +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL 
Sbjct  240   QVIQKIIKSATTGERCADLDGVELEKKLEEILNGRKYLLLLDDVWNEDAEKWLLLKPLLS  299

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVE  1142
              G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV 
Sbjct  300   KGADGSKIIVTTRSQRVAEIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELHP-NLVG  358

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IGKEIV+KC  VPLAV  LG+ LY KTDE EW  +R++E W  E++   ILP LK+SY +
Sbjct  359   IGKEIVEKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EEEGDGILPALKISYQR  416

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSR  1499
             +P HL++CF YC +FPK  +      +  W+A G I QS + ++ LE++G +Y  EL+SR
Sbjct  417   LPTHLKRCFLYCSVFPKDYDFVDLSLVQFWMAHGLILQSSNPNENLEDVGLRYVRELISR  476

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNL  1676
               FQD  +   G     K+H+L+HDLA S+A  E   + S + +I ++  HL V  +D+ 
Sbjct  477   CFFQDYEDVIVGATF--KMHDLMHDLASSLAQNEISIISSQNHQISKTTRHLTVLDSDSF  534

Query  1677  SREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVL-MLQNLELKELPSS  1850
               +  P+   N   +R   ++   VG    T  +K LL F+ LR L ++ + E +  P  
Sbjct  535   FHKTLPKSPNNFHQVRSIVFADSIVGPTCTTDFEKCLLEFKHLRSLELMDDSEFEAFPER  594

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LRYL   NN  IK LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ L 
Sbjct  595   IGALKHLRYLYFLNNTTIKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RHMISLRFLC  651

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             L++Q+  L +     L  LQ L +  C   +   E  Q +K LR L I  C SL  LP  
Sbjct  652   LSTQQKRLPEGGIGCLECLQTLFIGDCENLENLCEDMQGLKSLRKLVISGCDSLISLPRS  711

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKDID  2372
             I+ L  LE+L+I NC++LDL      +  +             M +P  ++LP  L    
Sbjct  712   IKCLTTLEELFISNCKKLDLMTIGEEKEKKIQPLSFSLRIVLFMAVPATIALPEQLLKGS  771

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             A  L+   + GCP +  +P+ + N   LQ L I DCP LS
Sbjct  772   AESLQTFIIEGCPNIEEMPECISNLKKLQNLEIIDCPRLS  811



>ref|XP_006604350.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Glycine 
max]
Length=875

 Score =   484 bits (1246),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 335/880 (38%), Positives = 504/880 (57%), Gaps = 45/880 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAESFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK-LRSCSGILTKVRKLFTRPDGLIYRFKIT  431
              +++WL++L+ V YDA ++LD+F   +L ++ L+    I  +V   F+  + L++R K+ 
Sbjct  61    VLREWLRQLKSVFYDAQNVLDEFECQTLRKQVLKDHGTIKDQVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              KI+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE I
Sbjct  121   QKIKDVSKRLDKVAADRHKFGLRTIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+   F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDGCFPLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ SA         ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ +W 
Sbjct  241   NQLIIKIINSANVADAPLRQQNLDMVDLEQLQNQLRSRLAGQKFLLVLDDVWNDDRVRWV  300

Query  948   NLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQ  1115
              LR L+  G   GS+++VTTR   +A++ GT  +Y L  LS  +   LF+K AF+   E+
Sbjct  301   ELRNLIKVGVAAGSKILVTTRIDSIASMMGTVASYKLQSLSPKNSLSLFVKWAFKNEGEE  360

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E  P +LV IGKEIV KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + Q + DIL
Sbjct  361   EKHP-HLVNIGKEIVNKCKGVPLAVRTLGSLLFSKFEVNEWDYVRDNEIWNLPQNKDDIL  419

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQ  1475
             P LKLSYD +P +LRQCFA   ++PK  E        LW A G + SP  ++  EN+  Q
Sbjct  420   PALKLSYDFLPSYLRQCFALFSLYPKDYEFNSVEVAKLWGALGLLASPRKNETPENVVKQ  479

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
             Y +ELLSR   QD ++   G     KIH+LVHDLA  VA  ECL V S    IPE++ HL
Sbjct  480   YLDELLSRSFLQDFIDG--GTFYEFKIHDLVHDLAVFVAKEECLVVNSHIQNIPENIRHL  537

Query  1656  VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
              F   +     F    + ++ +  F      G+V ++ +   +  F+ LRVL L +   K
Sbjct  538   SFAEYSCLGNSFTSKSVAVRTI-MFPNGAEGGSV-ESLLNTCVSKFKLLRVLDLSDSTCK  595

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LP SIG LK LRY ++ NN NIK LP  I KL NLQ L+++ C++L+ LP+ F ++L+ 
Sbjct  596   TLPRSIGKLKHLRYFSIQNNPNIKRLPNSICKLQNLQFLSVLGCKELEALPKGF-RKLIC  654

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRI  2174
             L+ L +T+++  L      +L  L  L +             KFPA        L+ L +
Sbjct  655   LRHLEITTKQPVLPYTEITNLISLARLCIESSHNMESIFGGVKFPA--------LKTLYV  706

Query  2175  YECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----glPKLV  2342
              +C SL  LP  + +  +LE L++ NC  LDL + +      + +  L       LP+L 
Sbjct  707   ADCHSLKSLPLDVTNFPELETLFVENCVNLDLELWKDHHEEPNPKLKLKCVGFWALPQLG  766

Query  2343  SLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-S  2519
             +LP  L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I   +
Sbjct  767   ALPQWLQET-ANSLRTLIIKYCDNLEMLPEWLSTLTNLKSLLILDCPKLISLPDNIHHLT  825

Query  2520  SNAKVRIIDCPLLNG*C----GDTGTRLSWSS*NIFLYQP  2627
             +   + I  C  L   C    G+  +R+S    ++F+ +P
Sbjct  826   AFEHLHIYGCAELCKKCQPHVGEFWSRISHIK-DVFIEEP  864



>ref|XP_006439154.1| hypothetical protein CICLE_v10010866mg, partial [Citrus clementina]
 gb|ESR52394.1| hypothetical protein CICLE_v10010866mg, partial [Citrus clementina]
Length=647

 Score =   476 bits (1224),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 288/645 (45%), Positives = 418/645 (65%), Gaps = 13/645 (2%)
 Frame = +3

Query  195   TLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT  374
             TL+T+K+V+ DA+E+Q  NH + DWL KL+D  YDA+D+LD+F    L R++     I  
Sbjct  2     TLTTVKSVVLDAEEKQIHNHRLSDWLGKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGR  61

Query  375   KVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTH  554
             K R  F   + + +RF++ H+I++IR R ++IA+ R  F+  E    +     K RE TH
Sbjct  62    KFRNFFGCSNPIAFRFRMGHQIKKIRERFDEIAKLRGEFNLIERLDDHRRVVHKERESTH  121

Query  555   SFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRV  734
             SFV  SDIIGRD D+E I+ +LM++   E +E++S +PIVG+GGLGKT L +LV+ND RV
Sbjct  122   SFVLSSDIIGRDKDREKIIELLMQASSGE-SETLSVIPIVGIGGLGKTALAQLVFNDQRV  180

Query  735   VQNFDTRLWVSVSEDFSLSKVIEKILRSATGKS------FGHLDMDQLQEHLNGVLCSGR  896
              ++F+ ++W+ V EDF   +++ +I+ S   +        G L+  QLQ  L   L S R
Sbjct  181   EEHFELKIWMRVFEDFGGRQIMREIMESIIVQIMRKCVFLGDLNTQQLQRILRDHLNSKR  240

Query  897   YLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLS  1067
             YLLV+DDVWNED   W+ L+ LL+ G +GS+++VTTRS KVA+I GT   TT YNL GL 
Sbjct  241   YLLVMDDVWNEDPEAWRKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGYNLQGLP  300

Query  1068  DHDCFDLFLKCAFREQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHI  1247
               DC  LF+K AF+E+  +  NL++IG+EIV+KCGG+PLAV+ LGS+L  KTD++ W ++
Sbjct  301   FEDCLSLFMKYAFKEERDKHPNLIKIGEEIVKKCGGIPLAVRALGSLLCGKTDKRNWEYV  360

Query  1248  RENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGF  1427
             R+ EIW++EQ +T IL  L+LSYDQ+P HL+QC AYC +FPKG +   +  +  W+A G 
Sbjct  361   RDIEIWQLEQMDTGILRALRLSYDQLPPHLKQCVAYCSIFPKGYQFYGDSLVQFWMAHGL  420

Query  1428  IQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDG-EILACKIHNLVHDLAQSVAGAEC  1604
             +QS +  +EL+++G +Y  ELLSRF FQD+     G E  + K+H+L+HDLA  VA  E 
Sbjct  421   LQSHNKKEELDDIGMRYLKELLSRFFFQDLSFGMLGMETFSFKMHDLMHDLALLVAKDEF  480

Query  1605  LNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKT  1781
             L V S    IP+ V HL F A N SR +F   L +L  +R   +S       S++F++  
Sbjct  481   LVVNSDCQFIPKKVRHLSFVAANASRNDFSSLLSDLGRVRTIFFSTDDDEKTSQSFIESC  540

Query  1782  LLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLI  1961
             +   + LRVL L    ++  P  +G LK  RYL+LS N  IK LP+ I +L +LQTLNL 
Sbjct  541   ISKSQFLRVLDLSGSAIEVCPREMGNLKHTRYLDLSKNYKIKKLPKSICELQSLQTLNLA  600

Query  1962  NCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFL  2096
              C +L+ELP++  + L++L+ L LT+++ SLQ+    SLG L+ L
Sbjct  601   GCLELEELPKDI-RYLVNLRLLALTTKQKSLQESGIRSLGSLRCL  644



>ref|XP_007162196.1| hypothetical protein PHAVU_001G132300g [Phaseolus vulgaris]
 gb|ESW34190.1| hypothetical protein PHAVU_001G132300g [Phaseolus vulgaris]
Length=878

 Score =   483 bits (1244),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 333/852 (39%), Positives = 499/852 (59%), Gaps = 34/852 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+ +I E++L K+ S   +E+S A++L  +++ L++TL  +K VL DA+E++ K H
Sbjct  1     MAEYFVFEIAESLLGKLASNLYEEVSRAFDLYEDVQGLRDTLLIVKGVLLDAEEKKEKKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V  D +D+LD F   SL +++   SG    KV   F+  + L++RF++ 
Sbjct  61    GLREWLRQIQNVCLDTEDVLDGFECQSLRKQVLKASGSTRMKVDHFFSSSNSLVFRFRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I+ +R RL++IA D R F  +       VE+ +L  RE T+S V  S +IGR+ D+E 
Sbjct  121   RQIKNVRRRLDKIAADGRKFGLERI----DVEHSRLQRREMTYSHVDASGVIGREKDREE  176

Query  606   IVGMLMKSCDEEDT---ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE  776
              + +LM+     D    +SV  +PIVG GGLGKTTL KLV+ND R+   F  ++WV +S+
Sbjct  177   TIKLLMQPHPHGDGYGDQSVCVIPIVGFGGLGKTTLAKLVFNDKRMDDLFPLKMWVCISD  236

Query  777   DFSLSKVIEKILRSATG--------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED  932
             DF + +++ KI+ SA+         +S  +LD++QLQ  L   L   +YLLVLDDVWN+D
Sbjct  237   DFDIRQIVVKIINSASDPTISVVPQESIDNLDIEQLQSRLRHKLSCQKYLLVLDDVWNDD  296

Query  933   QHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
             + KW  L++L+  G  GS++IVTTRS  +A++ GT  +Y L GLS  +C  LFLK AF+E
Sbjct  297   RAKWIELKDLIKVGAIGSKIIVTTRSHSIASMMGTVPSYVLEGLSAENCLSLFLKWAFKE  356

Query  1113  QEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD  1289
              E +   NLVEIGKEIV+KCGGVPLA+KT GS L+   D + W  +R++E+W ++Q+E D
Sbjct  357   GEEKEHPNLVEIGKEIVKKCGGVPLALKTSGSSLFSVFDLERWEVMRDHELWNLKQQEDD  416

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             ILP LKLSYDQMP +LR CFA+  ++PK          N WV  G ++SP G Q++EN+G
Sbjct  417   ILPSLKLSYDQMPSYLRHCFAFFSLYPKDFGFTSAEMANFWVTLGLLRSPFGSQKIENVG  476

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVH  1649
               Y  EL SR   +D  E F G +   K+H+LVHDL+  VA  E L V S   +IPE V 
Sbjct  477   KLYIYELYSRSFLED-FEDF-GTVYYFKLHDLVHDLSLYVAKEEFLMVNSHTRKIPEQVR  534

Query  1650  HL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN  1823
             H+ V   D+LS   FP+     + +R   +    VG  S+  ++  +  ++ LR L L +
Sbjct  535   HISVVENDSLSHTLFPK----FRGVRTIIFPVDGVGVGSEYLLETWIKRYKYLRHLDLSD  590

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
                + LP+SI  L+ LR L+L NNC+IK LP    KL NLQ L+L  C  L+ LP+  G 
Sbjct  591   SFFETLPNSIAKLEHLRALSLDNNCSIKRLPNSFCKLQNLQMLSLRRCLGLETLPKRLG-  649

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQ-HMKKLRVLRIYE  2180
              L+ L+ LY+T+++  L +    SL  L  L+       KF  +  Q  +  L+VL I  
Sbjct  650   MLIRLRKLYITTKQSILLEDEFASLNSLHTLIFEYSDNLKFLFQGAQAQLPSLKVLIIQS  709

Query  2181  CSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl-PKLVSLPAG  2357
             C +L  LP  +  L KLE L +  C  L+LS          +   L +    +  +LP  
Sbjct  710   CGNLESLPLHL--LPKLEVLIVTRCVMLNLSFNSERPIQRLMMKYLHIEQCARQQTLPQW  767

Query  2358  LKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVR  2537
             ++   +  L+ L ++    L  LP+WL   T L+ L+I +CP+L +LP ++      +  
Sbjct  768   IQGA-SNTLRTLLISNFHCLEKLPEWLNTMTDLKMLHIVNCPQLLHLPSEMHRLRALEDL  826

Query  2538  IID-CPLLNG*C  2570
             IID CP L   C
Sbjct  827   IIDGCPELGRKC  838



>ref|XP_007029663.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY10165.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=900

 Score =   484 bits (1245),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 320/828 (39%), Positives = 494/828 (60%), Gaps = 45/828 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETF  +I ENV+ K+ ++A  EIS AW ++ + ++L + L+T+K VL DA+E QA  +
Sbjct  1     MAETFAFNILENVVQKLATVAHQEISLAWGVQSDFQRLNDILTTVKDVLLDAEENQAHTN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++++WLQKL D  YDA+D+LD+F   +L +++     I  KV   F+  + L +R+++  
Sbjct  61    QLRNWLQKLTDACYDAEDVLDEFEIEALRKQVLKQRNIGKKVSHFFSSSNPLAFRYRMAQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYY-VNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             KI+++  R  +IA  + NFH  E +Y    V  G  RE THSFV+ +DIIGRD D+E I+
Sbjct  121   KIKKVTLRFGEIAALKANFHLAERHYDTRHVVMGPDRE-THSFVQAADIIGRDEDREKII  179

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               LM+  D  D E++S LP+VG+GGLGKT L KL+ ND+ +   F  ++WV VS+DF L 
Sbjct  180   KALMQ--DPPDGENISVLPVVGIGGLGKTALAKLLLNDEIIDGEFQLKIWVCVSDDFHLK  237

Query  792   KVIEKILRSA--TGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             ++I KI+++A    + + ++D+DQLQ+ L   L   +YLL+LDD+WNED  KW  L++ L
Sbjct  238   RLIMKIIKAAKKVNEDWSNMDLDQLQKVLRDCLDGKKYLLILDDLWNEDDLKWNELKQFL  297

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVE  1142
             + G  GS+++VTTRS +VA I GT   +NL GL + +   LFL+ AF+++E     NLV+
Sbjct  298   VGGGRGSKIVVTTRSSRVAEIMGTIPTHNLEGLPEKEALSLFLQFAFKKRETNQYSNLVK  357

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IGKEIV+ C G+PL +KTLGS+L  KT E +W  +R++E+W + QKE ++ P+LKLSYDQ
Sbjct  358   IGKEIVKSCTGIPLVLKTLGSLLLGKTSEYDWKLVRDSEMWTVMQKENNVFPVLKLSYDQ  417

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P +L+ CFA+  +FPK  E      I+ W+A   +QS + + +  ++G +Y N+L SR 
Sbjct  418   LPPYLKLCFAHLSVFPKDYEFNYMELIHFWMAHDLLQSSNENDDPIDIGRRYLNDLSSRS  477

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLS  1679
              FQD  ++   +    K+H+L+HDLA  VA   C  + S    I   + HL   ++D L 
Sbjct  478   FFQDFDKSLSRQYF-FKMHDLLHDLAVLVAKNRCSTINSFKQIITPGIRHLCLENSDFLE  536

Query  1680  REEFP----QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             +          L +L   R+   + +    S++F++K L  F++LRVL LQ   L+ +P 
Sbjct  537   KNSCDFFDIDKLCHLHTFRF--ENMKADANSESFIEKCLSRFQKLRVLTLQGSSLEIVPK  594

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              I  LK LRYL+LS N NIK LP  I KL+ LQTL LI    ++ELP N  + ++SL+ L
Sbjct  595   RISGLKHLRYLDLSGNSNIKKLPNFICKLLCLQTLLLIQA-GIEELPSNM-RYMISLRML  652

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
              +++++  L K     L  L++L +  C   ++  +  +++  L  L I +C +L  LP 
Sbjct  653   SISTKQKVLSKNGLEFLKSLRYLSIAHCENLEYLFDGIRNLTSLHTLIICDCKNLIALPQ  712

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDI------  2369
             GI+ L +L+ L I  CE+LDL++                    L S   G +D       
Sbjct  713   GIKALTELKVLVISECEKLDLNMT-------------------LASEARGKEDDSQDHHI  753

Query  2370  -DAMKLKYLRVAGCPELTALPDWL--QNCTLLQRLYIEDCPELSYLPE  2504
                ++L+ L +   P+L ALP+WL  ++   LQ L IE+C  L+   E
Sbjct  754   GSGLRLQTLIIGWLPKLEALPNWLLGESANTLQILVIEECKNLTTSAE  801



>gb|KEH32274.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=858

 Score =   482 bits (1241),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 338/844 (40%), Positives = 500/844 (59%), Gaps = 35/844 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + K+ S+A  E S + ++  +L++++ T+S +KAVL DA+++Q +N+
Sbjct  1     MAESLLFGVAESFIGKLASVAVQEASLSLSVYKDLQEIKKTVSLVKAVLLDAEQKQWQNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++++ V YDA+D++DDF   +L + + + SG I  KV+  F+  + L+YRF++ 
Sbjct  61    ELREWLKQIKRVFYDAEDVIDDFECEALRKHVINTSGSIRRKVKCFFSNSNPLVYRFQMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ I+ R +++A DR  F  + N   N V   K RE THS+V  SD+IGR+ DK+ I+
Sbjct  121   HQIKHIKERFDKVAADRLKFGLQINDSDNRVV--KRRELTHSYVIDSDVIGREHDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              ML++  D  D+ S+S +P+VG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  179   DMLLQ--DSGDSNSLSVIPVVGIGGLGKTTLAKAVFNDKSLDETFPLKMWVCVSDDFELK  236

Query  792   KVIEKILRSAT------------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
              ++ KIL +A+             +SF +LD++QLQ  L  V+   ++LLVLDDVWNED+
Sbjct  237   NLLVKILNAASVSGSSADPNPIHQESFTNLDLEQLQNRLRNVIAGKKFLLVLDDVWNEDR  296

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQ  1115
              KW  L+ L+  G + S+V+VTTRS  +A + GT T+Y L GLS  D   +F+K AF+E+
Sbjct  297   VKWVELKYLIQVGAEESKVLVTTRSHSIAKMMGTNTSYILEGLSLEDSLSVFVKWAFKEE  356

Query  1116  EYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDI  1292
             E +    LVEIGKEIVQKCGG+PLA++TLGS L+ K D +EW  IR++EIW + QKE DI
Sbjct  357   EEKKYPELVEIGKEIVQKCGGLPLALRTLGSSLFLKFDVEEWKFIRDSEIWNLPQKEDDI  416

Query  1293  LPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGN  1472
             LP LKLSYDQ+P +L+QCFA   +F K  +        LWVA GF+  P   + LE++  
Sbjct  417   LPGLKLSYDQLPSYLKQCFACFSLFEKNFDFSNFHVSVLWVALGFLPPPSRGKTLEDMNI  476

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             Q+  EL SR   Q+  + F G     K+H+LVHDL+  VA  E   +K  +  I E+V H
Sbjct  477   QFVYELQSRSFLQNFRD-FGGGFCGFKLHDLVHDLSLYVARDEFQLLKFHNENILENVLH  535

Query  1653  LVF-HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
             L F   D L     P  L  L         F  G  ++ F+K  +   + LRVL L +  
Sbjct  536   LSFLKNDLLGLTPVPTGLRTL--------IFPKGANNEAFLKTLVSRCKFLRVLQLPDST  587

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP SIG LK LRYLNL  +  +KSLP+ + KL NL TL L  C +LK+LP   G  L
Sbjct  588   YESLPRSIGKLKHLRYLNLGKSKELKSLPDSLCKLQNLYTLKLNGCIKLKKLPNGIG-NL  646

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
             +SL+ L +T+++ +L ++    L  L+ L +  C   +        +  L+ L I  C +
Sbjct  647   ISLRQLIITTKQYTLPEKEIAKLTCLEILSVNSCDNLETLLLEGIQLSNLKWLGISSCGN  706

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKD  2366
             L  +P  +  +  LE L+I NC +L  S     +     L+ L L  LP+LVS P  LK 
Sbjct  707   LKSMPLHV--IPNLEWLFITNCHKLKFSFHNENQIPKLKLKLLSLESLPQLVSFPEWLKG  764

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID  2546
               A  L  L + GC  L  LP+WL       R  + +CP+L  LP+    S+   + I+D
Sbjct  765   C-ADTLNTLVIDGCENLDELPEWLSTMICFNRFVVINCPKLLSLPDCF--SNLESLLIVD  821

Query  2547  CPLL  2558
             CP L
Sbjct  822   CPEL  825



>ref|XP_007162224.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
 gb|ESW34218.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
Length=858

 Score =   482 bits (1240),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 336/854 (39%), Positives = 489/854 (57%), Gaps = 50/854 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++KI S A  E S    L   L+ L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAESFLFSIAESLIAKIASHAFQEASRLVGLYDNLRDLIETLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             ++  WL +L+ V  DA+DLLD+F   +L +K+    G    KV   F+  + L++R+++ 
Sbjct  61    QLSQWLTQLKTVFSDAEDLLDEFECQTLRKKVVKAHGSTKDKVSHFFSTSNPLLFRYQMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD+IGR  DKE 
Sbjct  121   QQIKDISNRLDKVAADRHKFSLQ----IIDVDTRVVHRRDMTHSRVNDSDVIGRKHDKEK  176

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +LM+    +D  S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF 
Sbjct  177   IIELLMQQNSNDDDTSLSVIPIVGIGGLGKTTLAKFVFNDSRIQECFPLKMWVCVSDDFD  236

Query  786   LSKVIEKILRSATGK-------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             + ++I KI+ SA+ +       +   LD++QLQ  L   LC  ++LLVLDDVWNED+ KW
Sbjct  237   IKQLIIKIINSASDQDAPPHQQNLNMLDLEQLQNQLKNKLCGQKFLLVLDDVWNEDRVKW  296

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQE  1118
               LR L+  G  GS+++VTTRS  +A++ G+  ++ L GLS+ D   LF+K AF+  E+E
Sbjct  297   VELRNLIQVGAAGSKILVTTRSHSIASMMGSVPSHILEGLSEEDSLSLFVKWAFKGGEEE  356

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
               P  LV IG+EIV+KC GVPLAV+TL S+L+ K +  EW ++R+NEIW + Q++ DILP
Sbjct  357   KHPY-LVNIGREIVKKCRGVPLAVRTLSSLLFSKFEANEWEYVRDNEIWNLPQRKGDILP  415

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD MP +LRQCFA   ++PK  +       +LW A G I  P  ++ LE++ NQY
Sbjct  416   ALKLSYDLMPSYLRQCFALFSLYPKDYDFTSVEMTSLWGALGLIAVPIKNRTLEDVANQY  475

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
             ++ELLSR   QD      G +   +IH+LVHDLA  VA  ECL+V S    IP+ V H+ 
Sbjct  476   WHELLSRSFLQDFTNF--GTVYCFRIHDLVHDLALFVAKDECLHVSSNIQSIPDKVRHVS  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV---SKTFVKKTLLNFRRLRVLMLQNLE  1829
             F    L        L+N K+       F  G      +  +   L  F+ LRVL L++  
Sbjct  534   FGESRLFGN-----LVNKKSAAVRTVLFPNGAADANGEALLNMCLSKFKCLRVLNLRSAT  588

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP SI  LK LRYL++S N NIK LPE I KL +LQ L L  C +L+ LP+   ++L
Sbjct  589   FETLPRSIAKLKHLRYLDISKNLNIKRLPESICKLQSLQGLMLDGCMELEALPKGL-RKL  647

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVL  2168
             +SL+ L  + ++  L       LG L+ L +  C          KFP         L+VL
Sbjct  648   ISLRYLEFSIKQTVLPLNEIAKLGSLEVLNVESCYNVESIFGEVKFPV--------LKVL  699

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSV-----gegmegleslqslllmglP  2333
              + +C SL  +    ++  +LE L +  C  LDL +      E       L+++L     
Sbjct  700   SVIDCESLKSILLDSKNFPQLESLIVDGCGNLDLELWKGNHLEEQSHKLKLKTVLFSNFS  759

Query  2334  KLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
             +LV+LP  L++  A  L+ L ++ C  +  LPDWL   T L+ L I  CP L  L + I 
Sbjct  760   QLVALPKWLQEA-ANSLQCLLISYCYNIETLPDWLTTLTHLKTLSIMSCPNLVSLSDNIH  818

Query  2514  S-SSNAKVRIIDCP  2552
               ++   +RI  CP
Sbjct  819   HLAALESLRIEGCP  832



>gb|KCW48129.1| hypothetical protein EUGRSUZ_K01864 [Eucalyptus grandis]
Length=859

 Score =   481 bits (1239),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 338/848 (40%), Positives = 495/848 (58%), Gaps = 29/848 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  I + VL KI S A  E  + +N++ ++++L+ TL  IKAVL DA+ Q+AKN 
Sbjct  1     MAESLLFGIAQGVLRKIASPALQEAVAIYNIEHQIRELRETLIAIKAVLSDAEVQKAKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +L+ V YDA+D+LD+    +L +++ S  G +  KV + F+  + L++R KI+
Sbjct  61    RLQVWLDRLQHVFYDAEDVLDEIECEALRKQVISRYGSVKGKVHRFFSISNPLMFRVKIS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR RL++I+ ++  F        N V +   R+ T+SF+   D++GRD+DKE I+
Sbjct  121   HKIKEIRERLSKISTEKNQFDLNMRSADNGVGHMSSRKMTYSFINKLDVVGRDTDKEKII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              MLM    + D +++S LPIVG+GG+GKT L KLVYNDDRV + F+ RLWV V EDF L 
Sbjct  181   EMLM----QPDDKNLSVLPIVGIGGMGKTALAKLVYNDDRVKEQFELRLWVCVPEDFDLK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K IE I++ A+ +   + D+ Q Q  L  ++   ++LLVLDDVW+ D+ +WK LR LL  
Sbjct  237   KTIEGIIKDASRQDLSNFDIQQSQNFLQDIIKDKKFLLVLDDVWSNDRSRWKELRNLLTR  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIG  1148
             G   S++IVTTRS++VA+I GT   YNL GLS  D   LF K AF E E +PR  L+ IG
Sbjct  297   GASESKIIVTTRSVEVASIMGTHPVYNLKGLSHEDSVALFKKWAFDETEKKPRPYLLAIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+K  GVPL VKTLGS+LY K D+  W H+R++E W++ + + DI+P+LKLSYD +P
Sbjct  357   NDIVKKSQGVPLLVKTLGSLLYSKDDDGHWKHVRDSETWELVEAKKDIVPVLKLSYDHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL++CFA   +F +G ++       LW+A G I S      LE++G +Y  E   R   
Sbjct  417   SHLKRCFATFSLFSRGVQMKGPALARLWMALGLISSKREKLALEDVGIEYIKEFWKRSLI  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL---S  1679
             Q+V E   G  L   +H+LVH LA SVA  +   V+    E  + V  + F + +L   S
Sbjct  477   QEVEEC--GAELLFNVHDLVHSLATSVAQNDFSIVRLDTTE--KGVWCISFSSTSLEGIS  532

Query  1680  REEFPQPLL---NLKNLR--YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K LR  YF Y    G ++K F +  +  F  LR L L     +ELP
Sbjct  533   NFDGVPPFLRKTTSKRLRGIYFQYQVNDGVITKEFARICITKFNHLRYLNLSYSSFEELP  592

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
              SI  LKQLR L+L  N  +K LP  I +L +L  L+L+ C +L++LP+N  ++L+SL+ 
Sbjct  593   RSICNLKQLRSLSLYGNKLLKKLPGTICELQSLLELSLVGCLELRDLPKNM-ERLVSLRY  651

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             LY+T+++ SLQ+     L  LQFL L +C+  +   E    + +LR L I +C     LP
Sbjct  652   LYITTKQKSLQESGIQYLENLQFLGLNECANLQILFEGTCRLTRLRGLEIVDCRGPISLP  711

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKL  2384
              G   L  +E L I    +L L+         +L +L++    +++ L   L+   A  L
Sbjct  712   FG--ELKAVESLNI-ASSKLALTSENKSNFSLNLHTLVIYNFEQVMELLQCLEG-SAYTL  767

Query  2385  KYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG  2564
             +   V  C  LT LP WL N T L+ +Y+  CP LS LP+ I+S +N K   I+      
Sbjct  768   ESFLVYDCLSLTYLPTWLPNHTRLRLIYLIRCPNLSSLPQGIQSLTNLKELCIEY-----  822

Query  2565  *CGDTGTR  2588
              CG+   R
Sbjct  823   -CGELSKR  829



>gb|KHN07374.1| Putative disease resistance protein RGA1 [Glycine soja]
Length=861

 Score =   481 bits (1239),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 322/833 (39%), Positives = 477/833 (57%), Gaps = 46/833 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++LSK+ S A +E S    L   LK L++TLS ++AVL DAD++Q KNH
Sbjct  1     MAESFLFSIAESLLSKLASQAYEEASRVLGLYDHLKNLKDTLSLVQAVLLDADQKQEKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V +DA+D+LD+F   +L  ++    G    KV    +  + L++R+K+ 
Sbjct  61    ELREWLRQLKRVFFDAEDVLDEFECQTLQNQVIKAHGTTKDKVSHFLSTSNPLVFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I++I  RL+++A DR  F  K       V + +   +THS V  SD+IGR+ DK  I+
Sbjct  121   QQIKDISMRLDKVAADRDKFGLKAIDVDTRVVHRREMRETHSHVNDSDVIGREQDKGEII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L +    +D +S+S +PIVG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  181   ELLKQQNPNDDHKSLSVIPIVGMGGLGKTTLAKFVFNDKGIDECFPLKMWVCVSDDFDLK  240

Query  792   KVIEKILRSATG-----------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQH  938
             ++I KI+ SA             K+   +D++QLQ+ L   L   ++LLVLDDVWNED+ 
Sbjct  241   QLIIKIINSANDSVFLADAPDRQKNLKEMDLEQLQQQLRNKLADQKFLLVLDDVWNEDRV  300

Query  939   KWKNLRELLMSGCD-GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--  1109
             KW  LR L+  G   GS+++VTTR+   A++ GT +++ L GLS  D   LF++CAF   
Sbjct  301   KWVELRNLIHVGAAAGSKILVTTRNHSTASMMGTASSHMLEGLSPEDSLSLFVRCAFNKG  360

Query  1110  EQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD  1289
             E+E  P+ L+ IG+EIV+KC GVPLAV+TLGS+L+ K +  +W  +R+NEIW + QK+ D
Sbjct  361   EEENYPQ-LINIGREIVKKCRGVPLAVRTLGSLLFSKFEANQWEDVRDNEIWNLPQKKDD  419

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             ILP LKLSYD MP +LRQCFA   ++PK  +      I LW A GF+ SP  ++  E++ 
Sbjct  420   ILPALKLSYDLMPSYLRQCFALFSLYPKDYDFSSYDVIQLWGALGFLASPKKNRAQEDIA  479

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVH  1649
              QY  EL SR   QD V    G   + +IH+LVHDLA  +A  +CL V S    IPE++ 
Sbjct  480   IQYLWELFSRSLLQDFVS--HGSYYSFRIHDLVHDLALFIAKDDCLLVNSHIQSIPENIQ  537

Query  1650  HLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
             HL F   +   +      + ++ + Y          +  +          LR+L L +  
Sbjct  538   HLSFVEKDFHGKSLTTKAVGVRTIFYPGAGAEANFEANKY----------LRILQLTHST  587

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP  IG LK LR+LNL +N  IK LP+ I KL NLQ L L  C +L+ LP    ++L
Sbjct  588   FETLPPFIGKLKHLRFLNLRDNKKIKRLPDSICKLQNLQFLFLNGCTELETLPEGL-RKL  646

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVL  2168
             +SL    +T+++  L +    +L +LQ+L +  C       S  +FP         L+ L
Sbjct  647   ISLYDFEITTKQAVLPENEIANLSYLQYLTIGYCDNVESLFSGIEFPV--------LKAL  698

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVS  2345
              ++ C  L  LP   +H   LE L +  C++L+L    E       L+ +    +P+L  
Sbjct  699   SVWCCKRLKSLPLDSKHFPALETLHVRYCDKLELFKGHEDQNFNLKLKEVSFWEMPQLKI  758

Query  2346  LPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
             LP  ++   A  L  L +A C  L  LPDWL   T L+ L IE CP+L  LP+
Sbjct  759   LPHWVQGC-ANTLLSLHLAQCFNLEVLPDWLPMLTNLRVLDIELCPKLRSLPD  810



>ref|XP_006604341.1| PREDICTED: disease resistance protein RGA2-like [Glycine max]
Length=877

 Score =   481 bits (1238),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 328/850 (39%), Positives = 491/850 (58%), Gaps = 54/850 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAELFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKETLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V Y A+D++D+F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYYAEDVIDEFECQTLRKQVLKAHGTIKDEVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR++DKE+I
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGRENDKENI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDKCFTLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ SA         ++   +D++QLQ  L  +L   ++LLVLDDVW++D+ KW 
Sbjct  241   NQLIIKIINSANVADAPLPQQNLNMVDLEQLQNRLRNILAGQKFLLVLDDVWSDDRVKWV  300

Query  948   NLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQE-Y  1121
              LR L+  G   GS+++ TTR   +A++ GT T+  L  LS  +   LF+K AF+E E  
Sbjct  301   ELRNLIQEGVAAGSKILATTRIDSIASMMGTVTSQKLQSLSPENSLSLFVKWAFKEGEDE  360

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  +LV IGKEIV KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + QK+ DILP 
Sbjct  361   KHPHLVNIGKEIVNKCKGVPLAVRTLGSLLFSKFETNEWEYVRDNEIWNLPQKKDDILPA  420

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             LKLSYD +P +LRQCFA   ++PK           LW A G + SP  ++  E++  QY 
Sbjct  421   LKLSYDFLPSYLRQCFALFSLYPKDYIFHSFEVSRLWGALGVLASPRKNETPEDVVKQYL  480

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
              ELLSR   QD ++   G     KIH+LVHDLA  V   ECL + S    IPE++ HL F
Sbjct  481   VELLSRSFLQDFIDG--GTFYQFKIHDLVHDLALFVTKEECLLINSHIQNIPENIWHLSF  538

Query  1662  HADNLSREEFPQPLLNLKNLRY--FAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
                N     F    + ++ + +   A    V  +  T V K    F+ LRVL L +   K
Sbjct  539   AEYNFIGNSFTSKSVAVRTIMFPNGAEGANVEALLNTCVSK----FKLLRVLDLSDSTCK  594

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              L  SIG LK LRY ++ NN NIK LP  I K+ NLQ LN++ C++L+ LP+   ++L+S
Sbjct  595   TLSRSIGKLKHLRYFSIQNNRNIKRLPNSICKIQNLQFLNVLGCKELEALPKGL-RKLIS  653

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRI  2174
             L++L +++++  L      +L  L  L +             KFPA        L+ L +
Sbjct  654   LRSLDISTKQPVLPYSEITNLISLAHLSIGSSHNMESIFGGVKFPA--------LKTLYV  705

Query  2175  YECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPA  2354
              +C SL  LP  + +  +LE L++ +C  LDL +       +  +   L GLP+LV    
Sbjct  706   ADCHSLKSLPLDVTNFPELETLFVQDCVNLDLEL-----WKDDHEEQNLNGLPQLV----  756

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQ-NCTLLQRLYIEDCPELSYLPEQIRSSSNAK  2531
                     KLKY+   G P+L ALP WLQ +   LQ L I++C  L  LPE + + +N K
Sbjct  757   --------KLKYVAFWGLPQLVALPQWLQESANSLQTLIIKNCNNLEMLPEWLSTMTNQK  808

Query  2532  -VRIIDCPLL  2558
              + I DCP L
Sbjct  809   ALHISDCPKL  818



>ref|XP_008241003.1| PREDICTED: putative disease resistance protein RGA1 [Prunus mume]
Length=803

 Score =   479 bits (1232),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 329/838 (39%), Positives = 476/838 (57%), Gaps = 84/838 (10%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+A ++I  AW +K +LKKLQ T+STIK VL DA+++QA N +++ WL++
Sbjct  8     LATKLIEKLGSIASEQICLAWGVKADLKKLQRTMSTIKDVLLDAEQKQAHNQQIRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+                                  +F   + L+  F++ ++I+EIR R
Sbjct  68    LK---------------------------------DVFLDAEDLLDEFEVGNEIKEIRER  94

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDE  638
             L+++  ++  F   ++  + P  +G        FV  S +IGR+S+KE  + +LM+  D+
Sbjct  95    LDELKSNKAIF---DSLTILPHGDGG-DHHERPFVPASKVIGRESEKEETINLLMQRGDD  150

Query  639   EDT----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEK  806
             + +      V  +PIVG+GGLGKTT  K VY+D RVV +F+ R+W SV  DF L+++   
Sbjct  151   DQSGNSNNKVCVIPIVGIGGLGKTTHAKWVYDDKRVVGHFELRMWASVPVDFELTRLTRL  210

Query  807   ILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-D  980
             IL SA        L  DQLQ  L   L   ++LLVLDDVWN+D   W  LR+L+  G   
Sbjct  211   ILGSALDTEISDKLTPDQLQGRLREALKDKKFLLVLDDVWNDDALMWSQLRDLVTEGAKS  270

Query  981   GSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
             GS+++VTTR+  VA+I GT  T  NL  LS  D   LF++CAF+E  + +  NL E+GK+
Sbjct  271   GSKILVTTRNAAVASIMGTIPTNINLEFLSFEDSLSLFVECAFKEGHDKQYPNLFEMGKD  330

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPY  1331
             IV+KCGGVPLAVKTLGS LY KTDE+EW  +R++EIWK+E+     ILP LKLSY ++P 
Sbjct  331   IVRKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWKLERDGGGHILPALKLSYTRLPP  390

Query  1332  HLRQCFAYCCMFPK-GEEIPREVFINLWVAQGFI-QSPDG-DQELENLGNQYFNELLSRF  1502
             HLRQC AYC    K  +E      I  W+A G + QS D  + ELE++G  YF +L +R 
Sbjct  391   HLRQCLAYCSHLGKDSKEFNSFKLIRYWMAHGILDQSRDHVNMELEDIGELYFKDLCARS  450

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKS-GDPEIPESVHHLVFHADNLS  1679
              FQ+V++     +    +H+L+HDL QSVA  EC  V+S    +I E+V HL F     +
Sbjct  451   FFQNVIDYH--VLYKFDMHDLIHDLVQSVAQGECFTVESVNTKDISENVRHLTFLE---A  505

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              +     L  L  +R  A   +   + ++F+   L  F+ LRVL++  + LK LPSSIG 
Sbjct  506   GQNISTTLQKLNKVRTVA--VQETEIDESFLCTCLSRFKYLRVLVVPKVSLKVLPSSIGA  563

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL+LS N  I  LP  I +L +LQTL L  CE L+ELPR+  + L+SL +L+LT+
Sbjct  564   LKHLRYLDLSCNEVITKLPNVICRLQSLQTLLLCECENLEELPRDISK-LISLTSLFLTT  622

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
              + S  +                  C          +K LR L I+ CS+LT LP    +
Sbjct  623   MQTSFTENG--------------VGC----------LKSLRFLGIFMCSNLTSLPCETNY  658

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             LA L  L + NCE+LDL           LQ   ++ LP++V+LP   +   A  L++L +
Sbjct  659   LASLRTLVLNNCEQLDLGNVNYQGTPLRLQIFNIIYLPRMVALPDWFQGA-AKTLQHLLI  717

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DCPLLNG*C  2570
              GC  L ALP+WL N T L++L +  CP+LS LPE +RS ++ +  +I DCP L   C
Sbjct  718   RGCENLEALPEWLANFTTLRKLILSSCPKLSSLPEGMRSLTSLRELVIDDCPELARRC  775



>ref|XP_007211031.1| hypothetical protein PRUPE_ppa019872mg [Prunus persica]
 gb|EMJ12230.1| hypothetical protein PRUPE_ppa019872mg [Prunus persica]
Length=848

 Score =   478 bits (1231),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 338/823 (41%), Positives = 487/823 (59%), Gaps = 47/823 (6%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F+  I ENV++ + S A  E+  AW +  EL KL++T S+IK V+ DA+E+Q K   +  
Sbjct  4     FVYTIAENVMNGLASYAYQEMCLAWGVTDELNKLKDTFSSIKLVILDAEEKQRKELHLSQ  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRK---LRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             WL KL+DV YD DD+L+DF    L  +   LR    I  +VR  F+  + +++ FK+  +
Sbjct  64    WLGKLKDVCYDVDDMLNDFAFKELQMQMLILRGRGSIKEQVRIFFSGWNPVVFNFKMGPR  123

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV--  611
             I++I+ RL+ IA ++  FH  E       ++  ++ +THSFV+  D+IGR+ DK+ I+  
Sbjct  124   IKDIKERLDVIAIEKSQFHLVERAGDWQSQSVHIKRETHSFVQAYDVIGREDDKKQIIIH  183

Query  612   --GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
                + +K    +  E+VS + I GLGG+GKTTL KLVYND RVV++FD R+WV VS+ F 
Sbjct  184   LFNLTLKEKSRDVQENVSVISITGLGGIGKTTLAKLVYNDHRVVKHFDMRMWVCVSDHFD  243

Query  786   LSKVIEKILRSATGKSFGHLD-MDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWK  947
               +++ +I+ SAT ++ G  +  D++Q+ L   L   ++LLVLDDVW++ Q      KW 
Sbjct  244   NKRLVREIVASATNQNCGDQESFDRVQKKLQSALKDKQFLLVLDDVWDKGQIGVTTAKWI  303

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEY  1121
             +L+ LL  G +GS+VIVTTRS  VA+I  +   + L GL    C  LF+K AF  + +E 
Sbjct  304   DLKALLNVGANGSKVIVTTRSESVASIMDSVCVHQLRGLPHESCMSLFIKRAFGRKGEEQ  363

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             R  +L+EI   I +KC GVPLAV T+GS+L  K ++  W  +R+N+IW++ Q   DILP 
Sbjct  364   RHPHLMEIAHGIAEKCEGVPLAVTTMGSLLCLKREKHFWSEVRDNDIWRLPQGNDDILPA  423

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             LKLSYD +P +L+ CFA C +FPK         ++LW+AQGFIQS  G+QELE +G  Y 
Sbjct  424   LKLSYDALPSYLKPCFAICSLFPKDYVFRSTDLVSLWMAQGFIQSSKGNQELEEIGLDYI  483

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAEC--LNVKSGDPEIPESVHHL  1655
              +L SR  FQ   ++ D   +  K+H LVHDLA SV+  EC  +N +         V  +
Sbjct  484   RQLCSRSLFQIDEDSID--FIVFKMHALVHDLAMSVSEEECSSVNFRPTSDTCKRKVWTI  541

Query  1656  VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
             +          FP P               VGT SK+ +K  +L F+ LRVL L  L  +
Sbjct  542   L----------FPVP-------------GHVGTSSKSVLKACILRFKYLRVLDLSGLTFE  578

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LPSSIG L +LRYL+LS N  IK LP  I  L+NLQTL L NCE+L+ELPR+ G  L++
Sbjct  579   VLPSSIGKLSRLRYLDLSKNPFIKKLPGSICNLLNLQTLLLSNCEKLRELPRDIG-NLIN  637

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLT  2195
             L+TL LT+ +  L       L  L+FL ++ CS  +   +  Q +  LR+L I  C +L 
Sbjct  638   LRTLVLTTNQKVLAGGIE-RLTSLRFLQVHNCSYLESLGQGIQCLTNLRMLVISNCENLK  696

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDA  2375
              LP  ++ L  L+ L I +CE+LDL       G+  L+S+ +    +L +LP  L+D  A
Sbjct  697   SLPPDMKCLTALKTLGISDCEKLDL--MTSGGGIRGLRSVSISKASRLEALPHWLQD-SA  753

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
               L+ LRV  C +L  LP+WLQN  LLQ+L IE CP+L  LP+
Sbjct  754   NTLQSLRVKNCEDLKELPEWLQNFKLLQQLVIEYCPQLLALPQ  796



>ref|XP_008392254.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=786

 Score =   476 bits (1225),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 344/848 (41%), Positives = 487/848 (57%), Gaps = 104/848 (12%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K++S+A +EI  AW +K  ++KL  T+STIK VL DA+E+QA N E++ WLQ+
Sbjct  8     LANRLIEKLISIASEEICLAWGVKANVQKLGXTMSTIKDVLLDAEEKQAHNSELRSWLQQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+DV  DA+DLLD F   +L R++   SG   KVR  F+R + + +R ++ H I++IR R
Sbjct  68    LKDVFLDAEDLLDXFECEALRRQVVHGSGTNRKVRHFFSRSNPVAFRLRVGHGIKKIRER  127

Query  459   LNQIAEDRRNF--HFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSC  632
             L+++ +D +NF  H +EN           R  THSFVR S++IGR+++K  +V +LM   
Sbjct  128   LHELKDD-KNFADHGREN-----------RNTTHSFVRASEVIGRETEKNKVVDLLMVQG  175

Query  633   DE---EDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
             ++   ED  +VS +PIVG GGLGKTTL KLVYND+RVV +F+ R+W SV+ DF ++++  
Sbjct  176   NDHQSEDNGNVSVIPIVGFGGLGKTTLAKLVYNDERVVGSFELRMWQSVTVDFDVTRLTR  235

Query  804   KILRSATGKSFGH-LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD  980
             +IL SA G        +DQLQE L   L   ++LLVLDDVWNED  KW  LR+LL+ G  
Sbjct  236   EILGSALGTKISEGSSLDQLQEQLRDALKDKKFLLVLDDVWNEDCIKWSELRDLLIEGAK  295

Query  981   -GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
              G++++VTTR+I VA+I GT    NL  LS  DC  LF+KCAF+E QE    +L E+GK+
Sbjct  296   VGTKILVTTRNISVASIMGTVGNINLDILSFEDCLSLFVKCAFKEGQERHHPSLYEMGKD  355

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPY  1331
             IV+KCGGVPLAVKTLGS LY KTD ++W  IR++EIW++E+     ILP L++SY Q+P 
Sbjct  356   IVRKCGGVPLAVKTLGSQLYSKTDXRQWRLIRDSEIWELERDGXGHILPALRVSYTQLPS  415

Query  1332  HLRQCFAYCCMFPKG--EEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSRF  1502
             HL+QC A C +  K   E   REV IN W+A G ++S D G+ ELE++G  YF EL  R 
Sbjct  416   HLKQCLASCSILSKNYIEFDSREV-INHWMAHGILESRDHGNMELEDVGELYFXELWERS  474

Query  1503  CFQDVVEA-----FDGEILACKIHNLVHDLAQSVAGAECLNVKSG-DPEIPESVHHLVFH  1664
              FQ+V +      FD       +H+L+HDL Q V   E   V S     IPE+V HL   
Sbjct  475   FFQNVNDHIFFYNFD-------MHDLIHDLVQLVTQGESFTVDSACTKGIPENVRHLTI-  526

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
                                        +G    T ++K  LN  R+ V          LP
Sbjct  527   -------------------------LEIGQNVSTALQK--LNKVRVEV----------LP  549

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             +SIG LK LR L+   +  I  LP    +L +LQ+L+L  C  L+ LPR+  ++L+SL+ 
Sbjct  550   NSIGSLKHLRSLDFYQSEGITELPNSFCELQSLQSLSLGGCVNLEVLPRDM-RKLISLRY  608

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L LT+++ S                        FP      +  LR L I +CS LTCLP
Sbjct  609   LELTTKQSS------------------------FPENGVGCLTSLRYLCIQDCSYLTCLP  644

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKL  2384
                 +LA L  L I NC++LDL +         L+ L ++G P++V+LP   +      L
Sbjct  645   HDTSYLASLCTLTILNCKQLDLVMENYQVIPLRLKKLGIVGFPRMVALPEWFQGA-TNTL  703

Query  2385  KYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPLLN  2561
             + L +  C  L ALP WL + T L+ + ++ C +L  LPE++ R ++   +RI  CP L 
Sbjct  704   QXLVIGDCENLEALPGWLTSFTSLRMVGLKSCXKLLSLPEKMHRLTALTTLRIRKCPDLE  763

Query  2562  G*CG-DTG  2582
               C  DTG
Sbjct  764   RRCQRDTG  771



>gb|KHN11536.1| Putative disease resistance protein RGA4 [Glycine soja]
Length=779

 Score =   476 bits (1224),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 315/809 (39%), Positives = 467/809 (58%), Gaps = 56/809 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DAD++Q  NH
Sbjct  1     MAESFLFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDADQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDA+D+L++F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYDAEDVLNEFECQTLRKQVLKAHGTIKDEVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSF-VRPSDIIGRDSDKES  605
              +I+++  RL+++A DR  F  +  +     V        THS  V  SD+IGR+ DKE 
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSSGVSDSDVIGREHDKEK  180

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +LM+    +D +S+S +PIVG+GGLGKTTL + V+ND R+ + F  ++WV VS+DF 
Sbjct  181   IIELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAQFVFNDKRIYECFSLKMWVCVSDDFD  240

Query  786   LSKVIEKILRSATG-------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             ++++I KI+ SA         ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ KW
Sbjct  241   INQLIMKIINSANDANAPFRQQNLNMVDLEQLQNQLRSKLAGKKFLLVLDDVWNDDRVKW  300

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQ  1115
               LR L+  G  GS+++VTTR   +A++ GT T++ L  LS  +   LF+K AF+   E+
Sbjct  301   VELRNLIQEGVAGSKILVTTRIDSIASMMGTVTSHKLQRLSSENSLSLFVKWAFKNEGEE  360

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E  P +LV IGKEIV+KC G+PLAV+TLGS L+ K +  EW ++R+NEIW + QK+ DIL
Sbjct  361   EKHP-HLVNIGKEIVKKCRGIPLAVRTLGSSLFSKFEANEWEYVRDNEIWNLPQKKDDIL  419

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQ  1475
             P LKLSYD +P +LRQCFA   ++PK  E      + LW A G + SP  ++ LE++  Q
Sbjct  420   PALKLSYDFLPSYLRQCFALFSLYPKDYEFRSFEVVRLWGALGVLASPRKNETLEDVVKQ  479

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
             Y +ELLSR   QD ++   G     +IH+LVHDLA  V   ECL V S    IPE++ HL
Sbjct  480   YLDELLSRSFLQDFIDC--GTFYQFRIHDLVHDLAVFVTKEECLLVNSHIQNIPENIRHL  537

Query  1656  VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
              F   +     F    + ++ +  F      G V ++ +   +  F+ LRVL L     K
Sbjct  538   SFAEYSCLGNSFTSKSVVVRTI-MFPNGAEGGNV-ESLLNTCVSKFKLLRVLDLSYSTCK  595

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LP SIG LK LRY ++ NN NIK LP  I KL NLQ L++  C++LK LP+   ++L+S
Sbjct  596   TLPRSIGKLKHLRYFSIENNRNIKRLPNSICKLQNLQLLSVRGCKKLKALPKAL-RKLIS  654

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRI  2174
             L+ L +T+++  L      +L  L  L +             KFPA        L+ L +
Sbjct  655   LRHLKITTKQPVLPYSEITNLITLAHLYIASSHNMESILGGVKFPA--------LKTLYV  706

Query  2175  YECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPA  2354
              +C SL  LP  + +  +LE L++ +C  LDL +          +       PKL     
Sbjct  707   VDCHSLKSLPLDVTNFPELETLFVVDCVNLDLEL---------WKDDHEEQNPKL-----  752

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQ  2441
                     KLKY+   G P+L ALP WLQ
Sbjct  753   --------KLKYVAFWGLPQLVALPQWLQ  773



>ref|XP_010646027.1| PREDICTED: putative disease resistance protein RGA1 [Vitis vinifera]
Length=624

 Score =   469 bits (1207),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 287/632 (45%), Positives = 401/632 (63%), Gaps = 23/632 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I +NV+ KI SL   EI  AW +K EL KL+ TL+TIK+VL DA+E+Q K+ 
Sbjct  1     MAESFLFSIADNVVGKIGSLTLHEIGLAWGVKTELTKLEATLTTIKSVLLDAEEKQWKDR  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL KL+ V YD +D+LD+F   +L R++ S   + TKV   F+  + L + FK+ H
Sbjct  61    QLRDWLGKLKHVCYDVEDVLDEFQYQALQRQVVSHGSLKTKVLGFFSSSNPLRFSFKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I+E+R RL+ I+ DR  F+ +      P+     RE THSFV  SD+ GR  DKE ++ 
Sbjct  121   RIKEVRERLDGISADRAQFNLQTCMERAPL---VYRETTHSFVLASDVFGRGKDKEKVLE  177

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM S D  D ES+S +PIVGLGGLGKTTL KLVYND  VV +F  R+WV VS+DF + K
Sbjct  178   LLMNSSD--DDESISVIPIVGLGGLGKTTLAKLVYNDPWVVGHFKKRIWVCVSDDFDMKK  235

Query  795   VIEKILRS-----ATGKSFG-----HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             VI  I++S       G   G      L+M+Q Q  L   L +  + LVLDD+WNED+ KW
Sbjct  236   VIIDIIKSIKTTVEGGSGLGLPNHNDLNMEQAQTLLRRTLGNENFFLVLDDMWNEDRQKW  295

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               LR  LM+G  G++++VTTR   VA+I GT  AY L GL   DC  +FLK AF E QE 
Sbjct  296   IELRTFLMNGAKGNKIVVTTRVHPVASIMGTVQAYILEGLPHVDCLSVFLKWAFNEGQEK  355

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  NLV+IG +IV+KC GVPLA +TLGS+L+ K ++++WL++R+N+IWK+EQKE DILP 
Sbjct  356   QHPNLVKIGDDIVKKCNGVPLAARTLGSLLFSKFEQRDWLYVRDNDIWKLEQKEGDILPA  415

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN---LGN  1472
             L+LSY+Q+P +L+ CFAYC +FPKG  +  E  + +W AQG I+     QEL+N   +GN
Sbjct  416   LRLSYEQLPSYLKCCFAYCSIFPKGRVLYNEDLVYMWSAQGLIEPSKKKQELDNIGDIGN  475

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             +Y  ELLSR  FQD  +         K+H+L+HDLA  ++  EC  +   +P + E V H
Sbjct  476   RYIKELLSRSFFQDFEDYH--FYFTFKMHDLMHDLASLISQPECTVIDRVNPTVSEVVRH  533

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV-SKTFVKKTLLNFRRLRVLMLQNLE  1829
             + F  D L+ +E  + +  L N+R   + F + T   + F+K  +  F+ +++L L    
Sbjct  534   VSFSYD-LNEKEILRVVDELNNIRTIYFPFVLETSRGEPFLKACISKFKCIKMLDLGGSN  592

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECI  1925
                LP+SI  LK LR+LNL NN  IK LP  +
Sbjct  593   FDTLPNSISNLKHLRFLNLGNNKRIKKLPNSM  624



>gb|KHN14961.1| Putative disease resistance protein RGA1 [Glycine soja]
Length=868

 Score =   477 bits (1228),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 329/838 (39%), Positives = 484/838 (58%), Gaps = 48/838 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAELFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDA+D+LD+F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYDAEDVLDEFECQTLRKQVLKAHGTIKDQVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE I
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLRTIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDEKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDECFSLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             +++I KI+ SA         ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ KW 
Sbjct  241   NQLIIKIINSANVADAPLRQQNLDMVDLEQLQNQLRSRLAGQKFLLVLDDVWNDDRVKWV  300

Query  948   NLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQ  1115
              LR L+  G   GS+++VTTR   +A++ GT  +Y L  LS  +   LF+K AF+   E+
Sbjct  301   ELRNLIQVGVAAGSKILVTTRIDSIASMMGTVASYKLQNLSPENSLSLFVKWAFKNEGEE  360

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E  P +LV IG+EIV KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + Q + DIL
Sbjct  361   EKHP-HLVNIGEEIVNKCKGVPLAVRTLGSLLFSKFEANEWEYVRDNEIWNLPQNKDDIL  419

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELEN-LGN  1472
             P LKLSYD +P +LRQCFA   ++PK  E   +    LW A G + SP  ++  EN +  
Sbjct  420   PALKLSYDFLPSYLRQCFALFSLYPKDYEFLSDEVAKLWGALGLLASPRKNETPENVVVK  479

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             QY +ELLSR   QD ++   G     KIH+LVHDLA  VA  ECL V S    IPE++ H
Sbjct  480   QYLDELLSRSFLQDFIDC--GTFYQFKIHDLVHDLAVFVAKEECLVVNSHIQNIPENIRH  537

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLEL  1832
             L F   +     F    +        A    V ++  T V K    F+ LRVL L +   
Sbjct  538   LSFAEYSCLGNSFTSKSV------VGAEGGSVESLLNTCVSK----FKLLRVLDLSDSTC  587

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
             K LP SIG LK LRY ++ NN NIK LP  I KL NLQ L+++ C++L+ LP+ F ++L+
Sbjct  588   KTLPRSIGKLKHLRYFSIQNNPNIKRLPNSICKLQNLQFLSVLGCKELEALPKGF-RKLI  646

Query  2013  SLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLR  2171
              L+ L +T+++  L      +L  L  L +             KFPA        L+ L 
Sbjct  647   CLRHLEITTKQPVLPYTEITNLISLARLCIESSHNMESIFGGVKFPA--------LKTLY  698

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----glPKL  2339
             + +C SL  LP  + +  +LE L++ NC  LDL + +      + +  L       LP+L
Sbjct  699   VGDCHSLKSLPLDVTNFPELETLFVENCVNLDLELWKDHHEEPNPKLKLKCVGFWALPQL  758

Query  2340  VSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
              +LP  L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I 
Sbjct  759   GALPQWLQET-ANFLQTLGIKNCDNLEMLPEWLSTLTNLKSLLILDCPKLISLPDNIH  815



>ref|XP_008238997.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=868

 Score =   477 bits (1228),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 344/850 (40%), Positives = 499/850 (59%), Gaps = 39/850 (5%)
 Frame = +3

Query  81    ETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEV  260
             E+F  ++ E VL ++ S A  EI  A +++ +L KLQ TLSTI  V+ DA+E+Q K+  +
Sbjct  2     ESFSFNVVEKVLERLASHAYHEIRLALDVEDDLIKLQETLSTIAKVVLDAEEKQRKDPLL  61

Query  261   KDWLQKLRdvvydaddllddFGTLSL-LRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
              DWL KL+DV YD DD+LD F    L ++ L S S I  KV   F+RP+  +  +KI  +
Sbjct  62    ADWLGKLKDVCYDMDDVLDQFEFRKLRMQLLNSRSNIKGKVCNFFSRPNSFMLSYKIGQR  121

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGM  617
             I++IR RL +IA  +  F+  E       +   +  +THSFV   D+IGRD DKE ++  
Sbjct  122   IKDIRERLGEIAAAKAQFNLYER--AADWQGMHIERETHSFVHAPDVIGRDKDKEEMIMH  179

Query  618   LMKSC-DEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             L+ +       E+VS + I GLGGLGKTTL KLVYND+RVV NF+ R+WV VS+DF   +
Sbjct  180   LLNANRTGHGEENVSVISINGLGGLGKTTLAKLVYNDNRVVGNFELRIWVCVSDDFDNKR  239

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWKNLRE  959
             ++ +I+ +AT +      ++Q+Q  L   L   + LLVLDDVW++        KW +L+ 
Sbjct  240   LLREIVTAATSQKCVDESIEQMQIKLRHALTCKKLLLVLDDVWDKGPMGITVKKWIDLKS  299

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEYRPRN  1133
             LL    +GS++IVTTR+  VA +      + L GL   DC  +F+K AF  REQE  P+ 
Sbjct  300   LLNVVANGSKIIVTTRNESVALLMRHAHMHLLKGLPHSDCMTIFIKMAFTKREQEDYPK-  358

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             L++IG++IV+KCGGVPLA+ TLG +LY   DE+ W H+R+++IWK+EQ   DILP LKLS
Sbjct  359   LIKIGEDIVRKCGGVPLALYTLGGLLYSNKDERYWSHVRDSDIWKLEQGSDDILPALKLS  418

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSP--DGDQELENLGNQYFNE  1487
             YD +P +L+ CFA+C ++PK         I L +A+GFIQS   +G+Q+LE++G  Y  +
Sbjct  419   YDALPIYLKPCFAFCSLYPKDYVFRSAELIPLLMAEGFIQSSKGNGNQDLEDIGLDYIRQ  478

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAE--CLNVKSGDPEIPESVHHLVF  1661
             L SR+ FQ  +E  D   L  ++H+LVHDLA S+A  E   LN +  D    + V H+  
Sbjct  479   LCSRYFFQ--IEEDDFLFLRFRMHDLVHDLAISMARVEYSSLNFRPSDSS--KMVRHVSI  534

Query  1662  HADNLSR--EEFPQPLLNLKNLRYF--------AYSFRVGTVSKTFVKKTLLNFRRLRVL  1811
                +LS+  EE P+ LL L+ LR              +VG  +++F+KK +     LRVL
Sbjct  535   SQKDLSKENEENPKFLLRLEKLRTILIPDLDSEYIPIKVGINNQSFLKKCISRINYLRVL  594

Query  1812  MLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPR  1991
              L NL LK LP SIG L  LRYL++S N +I  LP+ I KL +LQ+L LINC +LKELP+
Sbjct  595   DLSNLTLKVLPCSIGNLSHLRYLDVSYNQHINKLPDSICKLHHLQSLLLINCGKLKELPK  654

Query  1992  NFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLR  2171
             + G  L+SL+ L LT  +  L +     L  L+ L +  C   K   +  + +  LR+L 
Sbjct  655   DMG-NLISLRYLALTINKTHLPEAIG-RLTSLRTLCVSACKNLKSLGKEMRSLTNLRMLV  712

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLP  2351
             I  C +L  L +   ++  LE L I++C +L+L    G E          +    L +LP
Sbjct  713   IVSCQNLESLSSC--NMTTLETLVIYSCPKLNL---MGSEEGIRGLQSFWIVGSNLTALP  767

Query  2352  AGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNA  2528
               L++  A  LK L++  C  L +LP+W QN T LQ+L I  C  L   PE + R ++  
Sbjct  768   HWLQE-SANTLKTLQLGFCTYLQSLPEWFQNFTSLQKLKITHCSHLFAFPEGMDRLTALR  826

Query  2529  KVRIIDCPLL  2558
             ++ I +CPL+
Sbjct  827   ELEISNCPLV  836



>ref|XP_006604349.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Glycine 
max]
Length=873

 Score =   477 bits (1228),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 327/852 (38%), Positives = 484/852 (57%), Gaps = 62/852 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAESFIFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK-LRSCSGILTKVRKLFTRPDGLIYRFKIT  431
              +++WL++L+ V YDA ++LD+F   +L ++ L+    I  +V   F+  + L++R K+ 
Sbjct  61    VLREWLRQLKSVFYDAQNVLDEFECQTLRKQVLKDHGTIKDQVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A D + F  +  +     V        THS V  SD+IGR+ DKE I
Sbjct  121   QQIKDVSKRLDKVATDGQKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKEKI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + + M+    +D +S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF +
Sbjct  181   IELFMQQNPNDDDKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDECFKLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             ++++ KI+ S          ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ KW 
Sbjct  241   NQLVIKIINSVNVNDAPLRQQNLDMVDLEQLQNQLTSKLAGKKFLLVLDDVWNDDRVKWV  300

Query  948   NLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQ  1115
              LR LL  G   GS+++VTTR   +A++ GT  +Y L  LS  +   LF+K AF+   E+
Sbjct  301   ELRNLLKEGVAAGSKILVTTRIDSIASMMGTVASYKLQNLSPENSLSLFVKWAFKNEGEE  360

Query  1116  EYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDIL  1295
             E  P +LV IGKEIV+KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + Q + DIL
Sbjct  361   EKHP-HLVNIGKEIVKKCKGVPLAVRTLGSLLFSKFEANEWEYVRDNEIWNLPQNKDDIL  419

Query  1296  PILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQ  1475
             P LKLSYD +P +LRQCFA   ++PK  E        LW A G +  P  ++  E++  Q
Sbjct  420   PALKLSYDFLPSYLRQCFALFSLYPKDYEFHSVEVARLWEALGVLAPPRKNETPEDVVKQ  479

Query  1476  YFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
             Y +ELLSR   QD ++   G I   KIH+LVHDLA  VA  ECL V S    IPE++ HL
Sbjct  480   YLDELLSRSFLQDFIDG--GTIYQFKIHDLVHDLALFVAKDECLLVNSHVQNIPENIRHL  537

Query  1656  VFHADNLSREEFPQPLLNLKNLRY--FAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
              F   +     F    + ++++     A    V  +  T V K    F+ LRVL L++  
Sbjct  538   SFAEFSSLGNSFTSKSVAVRSIMIPNGAEGANVEALLNTCVSK----FKLLRVLDLRDST  593

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              K LP SIG LK LR  ++ NN NIK LP  I KL NLQ L+++ C++L+ LP+ F ++L
Sbjct  594   CKTLPRSIGKLKHLRSFSIQNNPNIKRLPNSICKLQNLQFLSVLRCKELEALPKGF-RKL  652

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVL  2168
             + L+ L +T+++  L      +L  L+ L +  C          KFPA        L+ L
Sbjct  653   ICLRHLGITTKQPVLPYTEITNLISLELLSIESCHNMESIFGGVKFPA--------LKAL  704

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSL  2348
              +  C SL  LP  + +  +LE L + +C  LDL +          +       PKL   
Sbjct  705   NVAACHSLKSLPLDVINFPELETLTVKDCVNLDLDL---------WKEHHEEQNPKL---  752

Query  2349  PAGLKDIDAMKLKYLRVAGCPELTALPDWLQ-NCTLLQRLYIEDCPELSYLPEQIRSSSN  2525
                       +LKY+   G P+L ALP WLQ     L+ L I DC  L  LPE + + +N
Sbjct  753   ----------RLKYVAFWGLPQLVALPQWLQETANSLRTLIISDCDNLEMLPEWLSTMTN  802

Query  2526  AKVRII-DCPLL  2558
              KV +I  CP L
Sbjct  803   LKVLLIYGCPKL  814



>ref|XP_011016471.1| PREDICTED: putative disease resistance protein RGA4 [Populus 
euphratica]
Length=1214

 Score =   486 bits (1252),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 295/658 (45%), Positives = 422/658 (64%), Gaps = 15/658 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E  L  IT+ +L K+ +LA  EI   W +K EL+KL+NT S IKA+  DA+EQQ K+H
Sbjct  1     MTEAILFSITDRILGKLGNLALQEIGLIWGVKDELEKLRNTASVIKAIFLDAEEQQTKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+DWL+KL+D +YDADDLLDDF T  L ++L        +V   F++     Y F ++ 
Sbjct  61    EVRDWLRKLKDAIYDADDLLDDFSTEMLQQQLMMQDKKAIEVCAFFSKIKKTAYGFSMSS  120

Query  435   KIREIRGRLNQIAEDRRNFHFKEN-YYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             KI+ IR RLN IA DR  FH  ++  ++  V     REQTHSFV   +++GR+ DK +IV
Sbjct  121   KIKAIRERLNDIASDRSKFHLTDHPRHMRSVSAE--REQTHSFVCVEEVVGREDDKLAIV  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+ S  EE+   VS +PIVG+GGLGKTTLV+LVYN +++ ++F+ R+WV VS+ F + 
Sbjct  179   ELLLHSNTEEN---VSVIPIVGIGGLGKTTLVQLVYNSEKIRRHFELRIWVCVSDVFDVK  235

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              +++KI+ SAT      L+MD L   L   +   ++LL+LDDVWN+++ +W  LR+LLM 
Sbjct  236   LIVQKIVESATNTKCDGLEMDSLLTRLGKEIDGKKFLLILDDVWNDNRERWLKLRDLLMG  295

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
             G  GS+V+VTTR+  +ATITGT   Y L  LS+ + + LF K AF++ +E+    LV IG
Sbjct  296   GARGSKVVVTTRTQLIATITGTAKPYFLRSLSEDESWSLFEKLAFKQGKEFENTRLVAIG  355

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KE+V+KC GVPLA++T+GS+LYCK  E EWL  ++ ++  I Q E DILPILKLSY+ +P
Sbjct  356   KEVVKKCAGVPLAIRTMGSLLYCKDTETEWLSFKDRDLSMIPQNENDILPILKLSYELLP  415

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
               L+ CFAYC +FPKG EI ++  I LW+AQGF+Q  DG Q LE +G+Q F +L  R  F
Sbjct  416   PCLKNCFAYCSLFPKGYEINKQTLIKLWMAQGFLQPADGMQHLEEVGHQCFMDLARRSFF  475

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QD+     G++++C++H+L+HDLA  V G+E   V S    I E + H+       S ++
Sbjct  476   QDLEYGEWGDVVSCRMHDLMHDLALLVGGSESSAVDSNAENICEGIRHVSLDFKLDSSQK  535

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKT-----LLNFRRLRVLMLQNLELKELPSSI  1853
              P  L     +R       V  V +  + +      + +FR LR L   N  +  +PSSI
Sbjct  536   IPPSLFKANKIRTLV--LPVQPVYRKILNQAPHDTIISSFRCLRALDFHNTGVDIVPSSI  593

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
               LK LRYL+LS N ++K LP CI+KL NLQTL L +C++L+ LPR+   +++SL+ L
Sbjct  594   SKLKHLRYLDLSKNEDLKRLPRCITKLKNLQTLKLSSCKRLEALPRHIS-KMISLRHL  650


 Score = 85.9 bits (211),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 10/191 (5%)
 Frame = +3

Query  2046  VSLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             VS+ +    +L +L+ L +  C +    P E    ++ LR L I  C SLT L  G+++L
Sbjct  1004  VSMSELGLQNLTYLEHLTIENCPNLSSLPEESLGGLRSLRSLSISGCGSLTSLSPGLQYL  1063

Query  2223  AKLEKLWIWNCEELDLS-----VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
               LE+L I  C  LD+S           GL+SL+ L +  +P+L S+P G+ ++ +  L+
Sbjct  1064  TSLEELEIKECRALDMSDCDEENSLQFRGLKSLRRLKIGYMPQLESIPDGIHEVTS--LQ  1121

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*  2567
              L++ GC  L  LP+W+    LLQRL I +CPEL+ LP+    +    + I +CP L   
Sbjct  1122  DLKIEGCVGLKTLPEWIHELKLLQRLDISECPELTSLPQGCMKALQI-LEIYNCPKLLRV  1180

Query  2568  CGDTGTRLSWS  2600
             C +T T + WS
Sbjct  1181  C-ETRTSMDWS  1190



>ref|NP_001066756.1| Os12g0477100 [Oryza sativa Japonica Group]
 gb|ABA98223.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29775.1| Os12g0477100 [Oryza sativa Japonica Group]
 gb|EAZ20458.1| hypothetical protein OsJ_36065 [Oryza sativa Japonica Group]
Length=802

 Score =   474 bits (1221),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 327/802 (41%), Positives = 476/802 (59%), Gaps = 19/802 (2%)
 Frame = +3

Query  84    TFLADITENVLSKI----VSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             T L+ +  ++LSK+    V  A D+I  AWN+K EL+KL+N+L  I AVL+DA+ +Q+ +
Sbjct  2     TVLSVLASSILSKVTTFAVEYALDDIKFAWNVKSELEKLKNSLGAICAVLKDAERKQSTH  61

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
               +K WL+ L+DVVYD DD+LDD GT  L +K+R    I T   +L       I+ F++ 
Sbjct  62    SSLKHWLENLKDVVYDIDDVLDDVGTRVLQQKVRK-GEICTYFAQL------TIFPFELG  114

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KIR++R RLN+IA  +R+F  KE     P +    RE THS +   +I GRD  K  IV
Sbjct  115   RKIRKVRERLNEIAALKRDFELKEEPIDTPSDQFAQRE-THSLIGEQNIFGRDKAKNDIV  173

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              M+ ++  E ++ ++S LP++G+GG+GKT L KLV+ND      FD  LW SVS  F L 
Sbjct  174   KMISEAA-ESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKMLWASVSNAFDLK  232

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++  I++S +G+S   L ++ L + L+ +L   RYLLVLDD+ N D   W+ L  LL S
Sbjct  233   HIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISN-DNVNWEELINLLPS  291

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGK  1151
             G  G  +++TTR  K+A+   T   Y +  L   +C  +F++ AFR ++ + R L++IG+
Sbjct  292   GRSGCMILITTRLTKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGE  351

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
              IVQKC G+PLA +TLGS+L+ K D   W  ++EN +    + + DIL +LKLSYD +P 
Sbjct  352   SIVQKCDGLPLAARTLGSLLFRK-DISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPS  410

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L+ CF++   FPK  +I RE+ I  W+A G +      +E   +G +YFNEL  R  FQ
Sbjct  411   DLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNPASRTKEAIRVGEKYFNELAGRSLFQ  470

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREE  1688
             D V   DG I  CK+H+LVHDLA SV+  E   V   +    E V +LV+ H D  +  +
Sbjct  471   DYVFNHDGSISHCKMHSLVHDLAISVSQNEHAIVGCENFTATERVKNLVWDHKDFTTELK  530

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             FP  L   +  R FA     GTVSK+F++  L  F  LRVL+   +E +ELPSSIG LK 
Sbjct  531   FPTQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKH  590

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRYL+L  N  IK LP  + KLVNLQTL L  C++L+ELP++  ++L+SL+ L LTS++ 
Sbjct  591   LRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDV-KRLVSLRYLILTSKQQ  649

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
              L K +      + FL +  C       E +  +  LR L ++ C  L  LP+ +  L  
Sbjct  650   YLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVT  709

Query  2229  LEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             L+KL I NC+ELDL    E M GL SL+S+ L GLPK  + P       +  L+YL+V+ 
Sbjct  710   LQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASS-SLQYLKVSD  768

Query  2406  CPELTALPDWLQNCTLLQRLYI  2471
             CP+   LPD+++  + L+++ I
Sbjct  769   CPQFEELPDFIKRFSSLKKIEI  790



>ref|XP_007029665.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007029666.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007029667.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007029668.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007029669.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007029670.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10167.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10168.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10169.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10170.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10171.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10172.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma 
cacao]
Length=881

 Score =   477 bits (1227),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 334/823 (41%), Positives = 497/823 (60%), Gaps = 26/823 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I ENVL  + +L   EIS A  ++ + +KL+  L+T+K  + DA+E+QA+N+
Sbjct  1     MAEPFAFNIAENVLETLTALVVQEISLACGVQSDFRKLREMLATVKPWILDAEEKQARNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DW+QKL+D  YDA+D+LD+F   SL  ++     I  KV   F+  + L++R K+ H
Sbjct  61    QLQDWVQKLKDACYDAEDVLDEFEVESLRGQVLEQKCIGNKVCNFFSSSNPLVFRLKMAH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENY--YVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
             KI++I  R ++IA+ R  FH  E +   ++ V + +   +THSFV+ SD+IGRD DK+ I
Sbjct  121   KIKKITERFSEIADLRDRFHLVEKHDDTMHVVLSDR---ETHSFVQASDVIGRDIDKKKI  177

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             V  L+++    + E++S L IVG+GGLGKT L KLV+ND  V + F  ++WV VS +  L
Sbjct  178   VESLLQAPTGGEEENISVLTIVGIGGLGKTALAKLVFNDVNVAEFFQLKMWVCVSNETDL  237

Query  789   SKVIEKILRSATG--KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              +++EK+++ A G  + +G++ +++LQ+ L G L    YLL+LDDV   D   W  L+ L
Sbjct  238   KRLLEKVIKVANGGDRDYGNMSLEKLQKGLRGCLNGKTYLLILDDVCWVDDKPWSKLKPL  297

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNL  1136
             LM G  GS+++VT RS  VA+  GT   +NL  L + + F LFLK AFR+  +E  P +L
Sbjct  298   LMGGAKGSKILVTARSNLVASNMGTI--HNLKALPEEESFSLFLKVAFRKGGKEQHP-HL  354

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             V+IG+EIV+KCGG PLAVKTL S+LY  T + EW  +R+NE+WK+ Q + D+LP+LKLSY
Sbjct  355   VQIGREIVKKCGGNPLAVKTLASLLYSTTSKHEWEKVRDNEMWKLMQDKNDLLPVLKLSY  414

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             DQ+P++L+ CF YC ++PK         +  W+A G +++ + D++ E  G +Y NEL S
Sbjct  415   DQLPHYLKPCFVYCSVYPKDYRFASFELVQFWMAHGLLKTSNPDEDPEETGRRYLNELSS  474

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
             R+ FQD      G I   K+H+L+HDLA  +A  EC  VKS   ++ E V HL F   ++
Sbjct  475   RYFFQDFETL--GFIQHFKMHDLLHDLALLIAKNECSVVKSQGQDVGEGVRHLYFLDLDI  532

Query  1677  SREEFPQPLLNLKNLRYFAYSF-RVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
               E F + L N  ++R F + + + G+ +  F++  L  F+RLRVL L     + LP  I
Sbjct  533   PAESFSRYLDNCCHVRTFRFLYIKEGSRNDFFIQTFLSRFQRLRVLDLSESTFEVLPRGI  592

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LR+L+L  N NIK LP  I KL NLQTL L +C  ++E P++  Q +M L+ L +
Sbjct  593   GNLKHLRFLDLRGNRNIKKLPNSICKLQNLQTLILASCNGIEEFPKDMSQLIM-LRALSI  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+    L +     L  L+ L +  C   +   E  +++ +LR L I  C +L  LP G+
Sbjct  652   TTNLTVLPENVVNRLKSLRHLAIGHCENLEHLPEGVRNLTQLRTLVIGMCKNLISLPHGL  711

Query  2214  RHLAKLEKLWIWNCEELDL------SVgegmegleslqslllmglPKLVSLPAGL----K  2363
               L  LE L I +CE L+L      S  + +     L+ LLL GLPKL +LP  L     
Sbjct  712   NCLTNLENLAILHCERLELEGKEDNSQEQHIAQGLRLRRLLLGGLPKLKTLPKWLLIQGS  771

Query  2364  DIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
                 + L+ L + GC EL +LP+ +Q  T L  L IE CP LS
Sbjct  772   GSHTLSLEMLEIFGCLELASLPEVMQCLTALVELKIEYCPLLS  814



>ref|XP_006372434.1| hypothetical protein POPTR_0017s01600g [Populus trichocarpa]
 gb|ERP50231.1| hypothetical protein POPTR_0017s01600g [Populus trichocarpa]
Length=844

 Score =   475 bits (1223),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 329/823 (40%), Positives = 476/823 (58%), Gaps = 29/823 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA  F + I +++L K+ S A  E   AW L+ ++ +L+  L  I AVL DA+++Q++N 
Sbjct  1     MAGAFASTIAQSLLGKLGSFAGQEFCLAWGLEADIARLEKRLKAINAVLSDAEQKQSRND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++   +G  + KVR+ F+  + + +R ++ 
Sbjct  61    KIRIWLNDLREVMYDAEDVLDEIECETLRRQVVKTTGSTSRKVRRFFSSSNKIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGK-LREQTH---SFVRPSDIIGRDSDK  599
             HKI+ I  RL +I+  +  F+  E     P++ G  L E+T    S    S +IGRD DK
Sbjct  121   HKIKSIIERLAEISALKSEFNLSEQ----PIDCGHVLHEETEMNRSLESFSGLIGRDKDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L      +D      LPIVG+GGLGKT+L K V + + V  +F+ ++   VS+D
Sbjct  177   ERIINLLAAPSKVDDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEACVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL  VI+ I++SATG+     D  +L++ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKHVIQMIIKSATGEGCVDSDERELKKKLGAILNGRKYLLLLDDVWNEDAQKWMLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRN  1133
             LL  G  GS++IVTTRS +VA I GT TAYNLS L   DC  LF KCAF+E   E  P N
Sbjct  296   LLSKGAAGSKIIVTTRSQRVAEIMGTVTAYNLSLLGQEDCLSLFYKCAFKEGQMELNP-N  354

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             LV IGKEIV KC  VPLAV  LG+ LY KTDE+EW  +R++E W  E++   ILP L++S
Sbjct  355   LVGIGKEIVAKCKQVPLAVINLGTQLYGKTDEKEWKSVRDSEKW--EEEGDAILPALEIS  412

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNEL  1490
             Y ++P HL++CF YC +FPK  +      +  W+A G I QS + ++ LE++G +Y  EL
Sbjct  413   YQRLPTHLKRCFLYCSVFPKDYDFVDLELVQFWMAHGLIHQSSNPNENLEDVGLRYVREL  472

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHA  1667
              SR  FQD V+   G     K+H+L+HDLA S+A  E   + S + +I ++  HL V  +
Sbjct  473   FSRCFFQDYVDVNYGATF--KMHDLMHDLASSLAQNEFSIIGSQNHQISKTTRHLTVLDS  530

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKEL  1841
             D+   +  P+   N   +R   ++   VG   KT  +K LL F+ LR L L N  E +  
Sbjct  531   DSFFHKTLPKFPNNFHQVRSIVFADSIVGPTCKTDFEKCLLEFKYLRSLELMNDSEFEAF  590

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P  IG LK LRYL   +N  IK LP+ I KL NLQ L L   E L+ELP++  + ++SL+
Sbjct  591   PERIGALKHLRYLYSGDNTKIKRLPKSIFKLQNLQALVLTG-EGLEELPKDV-RYMISLR  648

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L L +Q+  L +     L  LQ L + KC   +   E  Q +K LR L I EC SL  L
Sbjct  649   FLALVTQQKRLPEGGIGCLECLQTLFIGKCENLENLCEDMQGLKSLRKLAIAECDSLISL  708

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLK  2363
             P  I+ L  LE+L+I NCE+LDL   E  +  +     L       + +P  ++LP  L 
Sbjct  709   PRSIKCLTTLEELFISNCEKLDLMTIEEEKEKKIQPLSLSLRIVLFVAVPATIALPEQLF  768

Query  2364  DIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             +     L+   +  CP +  +P+ + N   LQ L I +CP LS
Sbjct  769   EGSTESLQTFIIRDCPNIEEMPECISNLKKLQNLEIIECPRLS  811



>ref|XP_007048517.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
 gb|EOX92674.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
Length=840

 Score =   475 bits (1223),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 329/824 (40%), Positives = 480/824 (58%), Gaps = 25/824 (3%)
 Frame = +3

Query  81    ETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN--H  254
             ++F + I  ++L+K+ + A  +I SAW ++ E++KL+NTL  I+AVL DA+E+Q K+   
Sbjct  2     DSFASSIVTSILAKVGTSAYQQIISAWGIEDEMRKLRNTLEEIQAVLNDAEERQVKDEEQ  61

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGI-LTKVRKLFTRPDGLIYRFKIT  431
             E++ WL++ +DV+++ +D+LDDF    L  K+    G  L KVR  F+  + L +RFK +
Sbjct  62    ELRIWLRRFKDVLHNVEDVLDDFEIQDLQTKMLVDRGTTLNKVRNFFSSSNSLAFRFKTS  121

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLR-EQTHSFVRPSDIIGRDSDKESI  608
              KI +I  RL++I   +      +       E G  R  +THS+V    + GRD DKE+I
Sbjct  122   QKIEKIWERLDEIKTSKERLKLSK---APKKETGIQRARETHSYVDAPAVTGRDDDKENI  178

Query  609   VGMLMKSCDEEDT-ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             +  L++  D + +  +VS + IVGLGGLGKTTL KLV ND+RV ++FD  +WV VSE+F 
Sbjct  179   IQSLLQPDDHDRSYNNVSVISIVGLGGLGKTTLAKLVCNDERVRKHFDLNMWVCVSEEFD  238

Query  786   LSKVIEKILRSATGKSFGH--LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             +  + ++IL+S      G+   +  + QE L   L   ++LLVLDDVWN++  KW  L +
Sbjct  239   VITMTKEILKSTKAGLLGYDESNFQKWQEELRHALKDKKFLLVLDDVWNDNPRKWDELNQ  298

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             LL+ G  GS+++VTTRS KV     +   Y L  LS  DC  LFL+ A+ E Q+ R + L
Sbjct  299   LLI-GRRGSKILVTTRSQKVVKAMKSQVKYELGSLSHDDCLSLFLRWAYIEGQKERHQTL  357

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             VEIG EIV+KC G PLA KTLGS+L   T+E++W +IR+NEIW++EQKE DI+P+LKLSY
Sbjct  358   VEIGNEIVKKCKGNPLAAKTLGSLLSLTTNEKDWQNIRDNEIWELEQKEDDIMPVLKLSY  417

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             ++MP +LR CFAYC +FPK  +      I LW+A G I +P  + E+E +G QY  EL  
Sbjct  418   NRMPPYLRSCFAYCAVFPKDFKFNSVDLIQLWLANGLI-TPYKNSEVEYVGMQYLKELFG  476

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
             R  F+DV E     +   K+H+L+HDLA SVA  E L V      IPESV HL     NL
Sbjct  477   RCFFEDVEEYV--FVYTFKMHDLMHDLALSVAQKEFLTVDFRANIIPESVRHLSLFNSNL  534

Query  1677  SREEFPQPLLN--LKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
              +++  +P      K LR       V G++ ++ V   ++  + L VL L +   +ELPS
Sbjct  535   FQQKLKKPSQKKLRKTLRTILCPLAVLGSICESDVGSFIMGCKYLWVLDLSSSSFEELPS  594

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LK LRY +LS N  I+ LP  + KL  LQ L L+ C +L+ LP+   + L+SL+ L
Sbjct  595   SIGRLKHLRYFSLSGNRRIRRLPNSVCKLQKLQALGLVGCRKLERLPKGV-RNLISLRFL  653

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
               T+ E  L       L  +Q L +  C   +F  E  + +  LR   I +C+ L  LP 
Sbjct  654   EFTTNEELLPNEEIGCLDSVQVLSISGCQYLRFLFEDMKQLTALRTSSITDCNWLRRLPC  713

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegle-----slqslllmglPKLVSLPAGLKDID  2372
              +  L  LE L I NC +LDL   E     +     SL+S+ +  +   ++LP  L+   
Sbjct  714   SVNDLTALENLIISNCADLDLKGKEDANPNQDEKVCSLRSITITKMTTFMALPQWLQR-S  772

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
             A  L  + +  CP   +LP+WL N   LQ+L I+ CP+  Y+ E
Sbjct  773   ANTLSCIIIEDCPNFKSLPEWLNNFKSLQKLQIKRCPQFPYVSE  816



>ref|XP_006576824.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine 
max]
Length=862

 Score =   476 bits (1224),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 323/850 (38%), Positives = 485/850 (57%), Gaps = 48/850 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++LSK+ S A +E S    L   LK L++TLS ++AVL DAD++Q KNH
Sbjct  1     MAESFLFSIAESLLSKLASQAYEEASRVLGLYDHLKNLKDTLSLVQAVLLDADQKQEKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V +DA+++LD+F   +L  ++    G    KV    +  + L++R+K+ 
Sbjct  61    ELREWLRQLKRVFFDAENVLDEFECQTLQNQVIKAHGTTKDKVSHFLSTSNPLVFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I++I  RL+++A DR  F  +  +     V   ++RE T+S V  SD+IGR+ DK  I
Sbjct  121   QQIKDISMRLDKVAADRHKFGLQPIDVDTRVVHRREMREMTYSHVNDSDVIGREQDKGEI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L
Sbjct  181   IELLMQQNPNDDHKSLSVIPIVGMGGLGKTTLAKFVFNDKGINKCFPLKMWVCVSDDFDL  240

Query  789   SKVIEKILRSATG-----------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
              ++I KI+ SA             K+   +D++QLQ  L   L   ++LLVLDDVWNED+
Sbjct  241   KQLIIKIINSADDSVFLADAPDRQKNLNKMDLEQLQNQLRNKLADQKFLLVLDDVWNEDR  300

Query  936   HKWKNLRELLMSGCD-GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
              KW  LR L+  G   GS+++VTTRS  +A++ GT +++ L GLS  D + LF++ AF E
Sbjct  301   VKWVGLRNLIHVGAAAGSKILVTTRSHSIASMMGTASSHILQGLSLEDSWSLFVRWAFNE  360

Query  1113  --QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
               +E  P+ L+ IG+EIV+KC GVPLAV+TLGS+L+ K +  +W   R+NEIW + QK+ 
Sbjct  361   GEEENYPQ-LINIGREIVKKCRGVPLAVRTLGSLLFSKFEANQWEDARDNEIWNLPQKKD  419

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
             DILP LKLSYD MP +LRQCFA   ++PK         I+LW A GF+ SP  ++  +++
Sbjct  420   DILPALKLSYDLMPSYLRQCFALFSLYPKDYNFTSYGVIHLWGALGFLASPKKNRAQDDI  479

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
               QY  EL SR   QD V    G      IH+LVHDLA  VA  +CL V S    IPE++
Sbjct  480   AIQYLWELFSRSLLQDFVS--HGTYYTFHIHDLVHDLALFVAKDDCLLVNSHIQSIPENI  537

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
              HL F   +   +      + ++ + Y          +  +          LR+L L + 
Sbjct  538   QHLSFVEKDFHGKSLTTKAVGVRTIIYPGAGAEANFEANKY----------LRILHLTHS  587

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
               + LP  IG LK LR LNL  N  IK LP+ I KL NLQ L L  C +L+ LP+   ++
Sbjct  588   TFETLPPFIGKLKHLRCLNLRKNKKIKRLPDSICKLQNLQFLFLKGCTELETLPKGL-RK  646

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRV  2165
             L+SL    +T+++  L +    +L +LQ+L +  C       S  +FP         L++
Sbjct  647   LISLYHFEITTKQAVLPENEIANLSYLQYLTIAYCDNVESLFSGIEFPV--------LKL  698

Query  2166  LRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLV  2342
             L ++ C  L  LP   +H   LE L +  C++L+L            L+ +  + +P+L 
Sbjct  699   LSVWCCKRLKSLPLDSKHFPALETLHVIKCDKLELFKGHGDQNFNLKLKEVTFVIMPQLE  758

Query  2343  SLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSS  2519
              LP  ++   A  L  L ++ C  L  LPDWL   T L+ L I+ C +L  LP+ + R +
Sbjct  759   ILPHWVQGC-ANTLLSLHLSYCLNLEVLPDWLPMLTNLRELNIDFCLKLRSLPDGMHRLT  817

Query  2520  SNAKVRIIDC  2549
             +   +RI DC
Sbjct  818   ALEHLRIKDC  827



>gb|EEC81232.1| hypothetical protein OsI_24282 [Oryza sativa Indica Group]
Length=835

 Score =   474 bits (1221),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 326/814 (40%), Positives = 481/814 (59%), Gaps = 27/814 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQD----EISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
             MAE  ++    +VL+K  S   D    EI SAWN+K EL KL+ +L +I AVLRDA+ +Q
Sbjct  1     MAEAIISSFAISVLTKAASFGTDWAVNEIKSAWNVKKELGKLERSLRSICAVLRDAECKQ  60

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRF  422
             + ++ +++WL  L+D VYD DD+LDD  T +L +++    G   +   +      L Y F
Sbjct  61    STSYALQEWLNNLKDAVYDIDDVLDDVATEALEQEIYK--GFFNQASHM------LAYPF  112

Query  423   KITHKIREIRGRLNQIAEDRRNFHFKENYY-VNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             K++HKI+ +  +LN+IA++R  F   E    V    N K   +T+  +   DIIGR+  +
Sbjct  113   KLSHKIKRVHDKLNEIADNRARFGLTEQPIDVQAPRNNK--RETYPSISELDIIGRNEAE  170

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             + IV +++++ D   + + S LPIVGLGG+GKT L KLVY +  +   F+  LWV VS+D
Sbjct  171   DEIVKIVLRAAD---SYTFSVLPIVGLGGIGKTALAKLVYTNAEIKSKFEKTLWVCVSDD  227

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             ++  K++E I++  TG+     D+  ++  +  +L   +Y LVLDD+WN+    W+ LR 
Sbjct  228   YNKKKILEDIIKWDTGEICK--DLGLVKRKVYELLKERKYFLVLDDLWNDRVTDWEELRS  285

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLV  1139
             LL  G  GS +IVTTR+  VA +  T   Y++  L    C ++F + AF+    + + L+
Sbjct  286   LLSIGNQGSVIIVTTRNTNVAAVVKTIEPYDVEKLPFDKCMEIFSRYAFKGDCEKDQQLL  345

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
              IG  IVQKC GVPLA +TLGS+L    D +EWL I  + +W I+Q E DILPILKLSY+
Sbjct  346   GIGMSIVQKCCGVPLAARTLGSLLSSCRDVEEWLRIMGDNLWNIKQDEDDILPILKLSYN  405

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
              +P HL+ CF+   +F KG  I  ++ I  W+A G I +P+G  ++ ++G +YF+ELL R
Sbjct  406   ALPSHLQACFSCLSVFRKGHFIYPDIVITFWMALGLIHTPNGKNQV-HVGQRYFSELLGR  464

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNL  1676
               FQ+  +    + +ACK+H+L+HDLA SV+  E   V      + ESV HLV+   D+ 
Sbjct  465   SLFQE-QDILCDDTVACKVHDLIHDLAISVSQREYAIVSWEKAAVSESVRHLVWDREDSS  523

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
             +  +FP+ L      R FA   R+GTVSK+F+     NF+ LR L   +++ +ELP+S+G
Sbjct  524   AVLKFPKQLRKACKARSFAIRDRMGTVSKSFLHDVFSNFKLLRALTFVSVDFEELPNSVG  583

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRYL+++ N  IKSLP  + KLVNLQTL+L+ C QL+ELP N   QL++L  L LT
Sbjct  584   SLKHLRYLHMTFNRKIKSLPNSLCKLVNLQTLHLLCCNQLEELPTNV-HQLVNLVYLNLT  642

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             S+++SL K        L+ L L  CS      E +  +  LR L I+EC  L  LP+ ++
Sbjct  643   SKQISLFKSGFCGWSSLELLKLSYCSELTSLEEGFGSLTALRELEIWECPKLASLPSSMK  702

Query  2217  HL-AKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
             H+ A L KL I +CEELDL    E + GL SL  L L  LPKL+  P   K   A  L+Y
Sbjct  703   HISATLRKLCIHSCEELDLMEPAEALSGLMSLHKLTLTELPKLMGFPESFKSA-ASSLRY  761

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             + +  C  L  LP  +   + L+ + I +CP LS
Sbjct  762   VHIDACEGLEKLPSCIAEFSSLREVRIYNCPALS  795



>gb|EAY83085.1| hypothetical protein OsI_38304 [Oryza sativa Indica Group]
Length=802

 Score =   473 bits (1218),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 327/802 (41%), Positives = 476/802 (59%), Gaps = 19/802 (2%)
 Frame = +3

Query  84    TFLADITENVLSKI----VSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             T L+ +  ++LSK+    V  A D+I  AWN+K EL+KL+N+L  I AVL+DA+ +Q+ +
Sbjct  2     TVLSVLASSILSKVTTFAVEYALDDIKFAWNVKSELEKLKNSLGAICAVLKDAERKQSTH  61

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
               +K WL+ L+DVVYD DD+LDD GT  L +K+R    I T   +L   P      F++ 
Sbjct  62    SSLKHWLENLKDVVYDIDDVLDDVGTRVLQQKVRK-GEICTYFAQLTVFP------FELG  114

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KIR++R RLN+IA  +R+F  KE     P +    RE THS +   +I GRD  K  IV
Sbjct  115   RKIRKVRERLNEIAALKRDFELKEEPIDTPSDQFAQRE-THSLIGEQNIFGRDKAKNDIV  173

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              M+ ++  E ++ ++S LP++G+GG+GKT L KLV+ND      FD  LW SVS  F L 
Sbjct  174   KMISEAA-ESNSNTLSVLPLIGMGGVGKTALAKLVFNDKSTKDKFDKILWASVSNAFDLK  232

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++  I++S +G+S   L ++ L + L+ +L   RYLLVLDD+ N D   W+ L  LL S
Sbjct  233   HIVNIIIQSDSGESNNQLTLEALTKKLHELLRDKRYLLVLDDISN-DNVNWEELINLLPS  291

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGK  1151
             G  G  +++TTR  K+A+   T   Y +  L   +C  +F++ AFR ++ + R L++IG+
Sbjct  292   GRSGCMILITTRLSKIASELKTLEPYEVPKLPHEECRKIFVRYAFRGEKAKDRELLKIGE  351

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
              IVQKC G+PLA +TLGS+L+ K D   W  ++EN +    + + DIL +LKLSYD +P 
Sbjct  352   SIVQKCDGLPLAARTLGSLLFRK-DISMWQEVKENNLLSTGKGKDDILSVLKLSYDALPS  410

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L+ CF++   FPK  +I RE+ I  W+A G +      +E   +G +YFNEL  R  FQ
Sbjct  411   DLKTCFSWLSTFPKDYDIFRELIIMYWMAMGLLNPASRTKEAIRVGEKYFNELAGRSLFQ  470

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREE  1688
             D V   DG I  CK+H+LVHDLA SV+  E   V   +    E V +LV+ H D  +  +
Sbjct  471   DYVFNHDGSISHCKMHSLVHDLAISVSQNEHAVVGCENFSATERVKNLVWDHKDFTTELK  530

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             FP+ L   +  R FA     GTVSK+F++  L  F  LRVL+   +E +ELPSSIG LK 
Sbjct  531   FPKQLRRARKARTFACRHNYGTVSKSFLEDLLATFTLLRVLVFSEVEFEELPSSIGNLKH  590

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEV  2048
             LRYL+L  N  IK LP  + KLVNLQTL L  C++L+ELP++  ++L+SL+ L LTS++ 
Sbjct  591   LRYLDLQWNMKIKFLPNSLCKLVNLQTLQLAWCKELEELPKDV-KRLVSLRYLILTSKQQ  649

Query  2049  SLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK  2228
              L K +      + FL +  C       E +  +  LR L ++ C  L  LP+ +  L  
Sbjct  650   YLPKDALGGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPKLPSLPSSMNRLVT  709

Query  2229  LEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             L+KL I NC+ELDL    E M GL SL+S+ L GLPK  + P       +  L+YL+V+ 
Sbjct  710   LQKLVIHNCDELDLMESEEAMGGLNSLESIELAGLPKFKTFPDSFASASS-SLQYLKVSD  768

Query  2406  CPELTALPDWLQNCTLLQRLYI  2471
             CP+   LPD+++  + L+++ I
Sbjct  769   CPQFEELPDFIKRFSSLKKIEI  790



>ref|XP_011015122.1| PREDICTED: putative disease resistance protein RGA4 [Populus 
euphratica]
Length=1214

 Score =   485 bits (1248),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 294/658 (45%), Positives = 422/658 (64%), Gaps = 15/658 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E  L  IT+ +L K+ +LA  EI   W +K EL+KL+NT S IKA+  DA+EQQ K+H
Sbjct  1     MTEAILFSITDRILGKLGNLALQEIGLIWGVKDELEKLRNTASVIKAIFLDAEEQQTKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+DWL+KL+D +YDADDLLDDF T  L ++L        +V   F++     Y F ++ 
Sbjct  61    EVRDWLRKLKDAIYDADDLLDDFSTEMLQQQLMMQDKKAIEVCAFFSKIKKTAYGFSMSS  120

Query  435   KIREIRGRLNQIAEDRRNFHFKEN-YYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             KI+ IR RLN IA DR  FH  ++  ++  V     REQTHSFV   +++GR+ DK +IV
Sbjct  121   KIKAIRERLNDIASDRSKFHLTDHPRHMRSVSAE--REQTHSFVCVEEVVGREDDKLAIV  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+ S  EE+   VS +PIVG+GGLGKTTLV+LVYN +++ ++F+ R+WV VS+ F + 
Sbjct  179   ELLLHSNAEEN---VSVIPIVGIGGLGKTTLVQLVYNSEKIRRHFELRIWVCVSDVFDVK  235

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              +++KI+ SAT      L+MD L   L   +   ++LL+LDDVWN+++ +W  LR+LLM 
Sbjct  236   LIVQKIVESATNTKCDGLEMDSLLTRLGKEIDGKKFLLILDDVWNDNRERWLKLRDLLMG  295

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
             G  GS+V+VTTR+  +ATITGT   Y L  LS+ + + LF K AF++ +E+    LV IG
Sbjct  296   GARGSKVVVTTRTQLIATITGTAKPYFLRSLSEDESWSLFEKLAFKQGKEFENTRLVAIG  355

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KE+V+KC GVPLA++T+GS+LYCK  E EWL  ++ ++  I Q E DILPILKLSY+ +P
Sbjct  356   KEVVKKCAGVPLAIRTMGSLLYCKDTETEWLSFKDRDLSMIPQNENDILPILKLSYELLP  415

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
               L+ CFAYC +FPKG E+ ++  I LW+AQGF+Q  DG Q LE +G+Q F +L  R  F
Sbjct  416   PCLKNCFAYCSLFPKGYEMNKQTLIKLWMAQGFLQPADGMQHLEEVGHQCFMDLARRSFF  475

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QD+     G++++C++H+L+HDLA  V G+E   V S    I E + H+       S ++
Sbjct  476   QDLEYGEWGDVVSCRMHDLMHDLALLVGGSESSAVDSNAENICEGIRHVSLDFKLDSSQK  535

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKT-----LLNFRRLRVLMLQNLELKELPSSI  1853
              P  L     +R       V  V +  + +      + +FR LR L   N  +  +PSSI
Sbjct  536   IPPSLFKANKIRTLV--LPVQPVYRKILNQAPHDTIISSFRCLRALDFHNTGVDIVPSSI  593

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
               LK LRYL+LS N ++K LP CI+KL NLQTL L +C++L+ LPR+   +++SL+ L
Sbjct  594   SKLKHLRYLDLSKNEDLKRLPRCITKLKNLQTLKLSSCKRLEALPRHIS-KMISLRHL  650


 Score = 86.3 bits (212),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 102/191 (53%), Gaps = 10/191 (5%)
 Frame = +3

Query  2046  VSLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             VS+ +    +  +L+ L +  C +    P E    ++ LR L I  C SLT L  G+++L
Sbjct  1004  VSMSELGLQNFTYLEHLTIENCPNLSSLPEESLGGLRSLRSLSISGCGSLTSLSPGLQYL  1063

Query  2223  AKLEKLWIWNCEELDLS-----VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
               LE+L I  C  LD+S           GL+SL+ L +  +P+L S+P G+ ++ +  L+
Sbjct  1064  TSLEELEIKECRALDMSDCDEENSLQFRGLKSLRRLKIGYMPQLESIPDGIHEVTS--LQ  1121

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*  2567
              L++ GC  L  LP+W+    LLQRL I DCPEL+ LP+    +    + I +CP L   
Sbjct  1122  DLKIEGCVGLKTLPEWIHELKLLQRLDISDCPELTSLPQGCMKALQI-LEIYNCPKLLRV  1180

Query  2568  CGDTGTRLSWS  2600
             C +T T + WS
Sbjct  1181  C-ETRTSMDWS  1190



>gb|KHG18590.1| Putative disease resistance RGA1 [Gossypium arboreum]
Length=869

 Score =   474 bits (1221),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 345/833 (41%), Positives = 489/833 (59%), Gaps = 26/833 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL +I E VL KI  L+ +E   A+N +  L+KL+ TLS IKAVL DA+ QQ +N 
Sbjct  1     MAESFLFNIAERVLEKIAHLSVEEARLAFNFESHLRKLKETLSRIKAVLLDAERQQHQNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++  + KLRD+ YDA+D++DDF   +L +++ +   I  KVR L +    L +  K+ H
Sbjct  61    KLRLSMWKLRDIFYDAEDVIDDFKCEALRKQVVNHPNITFKVRFLASCSLPLSFSLKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI  I  RLN++A +  NF+  +      V N     +THSFV   D+IGRD DKE+IV 
Sbjct  121   KIEVINQRLNELAIEWDNFNLGQGTDNRHVFN----RETHSFVNSKDVIGRDVDKENIVD  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LMK  +  D   V  +PIVG+GGLGKTTL + VYNDDRV   F  ++W+ VSE+F LS+
Sbjct  177   LLMKPSEGLD---VPVIPIVGIGGLGKTTLAQFVYNDDRVTSLFPLKIWICVSEEFDLSR  233

Query  795   VIEKILRSAT-GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +++ I++S   G     L ++ LQ  L  +L   ++LLVLDDVWNE+Q KW  LR LL S
Sbjct  234   LLKLIIQSVNKGVKCDDLTLEALQACLRSLLNDKKFLLVLDDVWNENQAKWVELRNLLRS  293

Query  972   --GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVE  1142
               G   S++IVTTRS+KVA+I      Y L GL   DC  LF K AF +  E    NL+ 
Sbjct  294   TDGFSPSKIIVTTRSLKVASIMSLIPPYILKGLPLEDCLTLFTKWAFNDGHEKHYPNLIR  353

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IG+EIV++C GVPLAV+TLGS+L+ KTDE +W++IRE+EIWK+EQ E DILP+LKLSY+ 
Sbjct  354   IGEEIVKRCKGVPLAVRTLGSLLFQKTDESDWIYIRESEIWKLEQNENDILPVLKLSYNH  413

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P HL++C A+  ++ K E    +  I LW+A G ++ P  +QE  ++G +Y NELLSR 
Sbjct  414   LPSHLQRCLAFLSLYKKDEMYYSDKVIRLWMANGLLEHPKQNQEWGDVGKRYLNELLSRC  473

Query  1503  CFQ---DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN  1673
               Q   D+ E F       KIH+LVHDLA  V+  EC  V S    + E+V HL+     
Sbjct  474   LIQKEEDLEEDFFLN-FTFKIHDLVHDLALDVSQKECKTVNSRTETVDENVRHLLLCDKK  532

Query  1674  LSREEFPQPLLNLKNLR---YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
             L   E P+ L  +KN+R       S    T+ ++ +   + NF+ LR + L+   L  LP
Sbjct  533   LV--EVPRVLEEMKNVRTIIILDVSRESKTIHESVINLCVSNFKYLRAVELRYSPLTVLP  590

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             +SIG LK L+ L+L+    I+ LP    KL +LQ+LNL     L +LP +  Q+L+ L+ 
Sbjct  591   NSIGTLKHLQDLDLAKCEGIRELPRSFYKLRSLQSLNL-RGSGLMQLPDSV-QRLIELRH  648

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T +   L++  +     LQ+L LY C   +   E  Q++K LR L + +C+ L  LP
Sbjct  649   LEITIKGKHLKEIRAGCWTSLQYLKLYYCFELECLPEGMQYLKSLRTLVLIQCNRLVSLP  708

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----glPKLVSLPAGLKDID  2372
               ++ LAKLE + I  C +++L +    E  + LQ  L       L  L  LP  L    
Sbjct  709   RSLKFLAKLEHIVICRCFQMNLKMELEEEEDKDLQLSLKTFSLDSLYALRDLPRLLLQGS  768

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK  2531
             +  L+ L++  C  L+ALP W+ N T L  L I  C  L  LPE I   SN +
Sbjct  769   SSTLQQLQIMYCRNLSALPVWVVNLTSLLELKIVYCRNLLALPEGINRLSNLR  821



>ref|XP_008241006.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=1136

 Score =   482 bits (1241),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 332/834 (40%), Positives = 467/834 (56%), Gaps = 84/834 (10%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+  +A ++I  AW +K +LKKLQ T+STIK VL DA+++QA N +++ WL++
Sbjct  8     LATKLIEKLGPIASEQICLAWGVKADLKKLQRTMSTIKDVLLDAEQKQAHNEQIRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             L+                                  +F   + L+  F++ ++I+EIR R
Sbjct  68    LK---------------------------------DVFLDAEDLLDEFEVGNEIKEIRER  94

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDE  638
             L+++  ++  F   ++  + P   G        FV  S +IGR+S+KE IV +LM+  D+
Sbjct  95    LDELKSNKAIF---DSLTILPHGYGG-DNHERPFVPASKVIGRESEKEEIVNLLMQQGDD  150

Query  639   EDT----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEK  806
             + +      VS +PIVG+GGLGKTTL K VY+D RVV +F+ R+W SV  DF L+++   
Sbjct  151   DQSGNSNNKVSVIPIVGIGGLGKTTLAKWVYDDKRVVGHFEWRIWASVPVDFELTRLTRL  210

Query  807   ILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-D  980
             IL SA        L + QLQ  L   L   ++LLVLDDVWN D  KW  LR+LL  G   
Sbjct  211   ILGSALDTEISDKLALGQLQGRLREALKDKKFLLVLDDVWNHDALKWSQLRDLLTEGAKS  270

Query  981   GSRVIVTTRSIKVATITGTT-TAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIGKE  1154
             GS ++VTTRS  VA+I GT  T  NL  LS  DC  LF++CAF+E   +   NL E+GK+
Sbjct  271   GSNILVTTRSNAVASIMGTIPTNINLEFLSFKDCLSLFVECAFKEGRDKDYPNLFEMGKD  330

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPY  1331
             IV KCGGVPLAVKTLGS LY KTDE+EW  +R++EIW++EQ++   ILP L+LSY ++P 
Sbjct  331   IVGKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWELEQEDAGHILPALRLSYTRLPP  390

Query  1332  HLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSP--DGDQELENLGNQYFNELLSRF  1502
             HLRQC  YC  F K   E      I+ W+A G +      G+ ELE++G  YF +L +R 
Sbjct  391   HLRQCLVYCSHFQKDRIEYGSNALISRWMAHGILDQSHVHGNMELEDIGELYFKDLWARS  450

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESVHHLVFHADNLS  1679
              FQ+V++   G      +H+L+HDL QSVA  EC  VKS +  +I E+V HL F     +
Sbjct  451   FFQNVID--HGIYYQFDMHDLIHDLVQSVAQGECFTVKSANTKDISENVRHLTFLE---A  505

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              +     L  L  +R  A       + ++F+      F+ LRVL LQ   L+ LPSSIG 
Sbjct  506   GQNVSTTLQKLNKVRTVAA--EETKIDESFMCTCFSRFKYLRVLQLQKCSLQVLPSSIGS  563

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYLNLS N  +  LP  I  L +LQTLN I C  L+ELPRN   +L+ L +L LT+
Sbjct  564   LKHLRYLNLSFNEALMKLPNAICGLQSLQTLNHIGCVNLEELPRNIS-KLICLTSLCLTT  622

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++ S  +                  C          +K LR L I ECS+LT LP    +
Sbjct  623   KQTSFTQNG--------------VGC----------LKSLRHLYIIECSNLTSLPRETSY  658

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             LA L  L +  CE+LDL           LQ L +  +P++V+LP   +   A  L++L +
Sbjct  659   LASLRTLVLGECEQLDLGNVNYQGTPLRLQKLWITQVPRMVALPEWFQGA-ANTLQFLLI  717

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DCPLL  2558
               C  L ALP+WL + T L +L I  CP+LS LPE +RS ++ +  +I DCP L
Sbjct  718   GMCENLEALPEWLASFTSLTKLIIRKCPKLSSLPEGMRSLTSLRELVIDDCPEL  771



>gb|KDP26027.1| hypothetical protein JCGZ_21060 [Jatropha curcas]
Length=655

 Score =   466 bits (1200),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 286/681 (42%), Positives = 404/681 (59%), Gaps = 40/681 (6%)
 Frame = +3

Query  549   THSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDD  728
             THSFV  S++IGRD DKE I+  L+K  D E+   VS +PIVG+GGLGKTTL KLVYND+
Sbjct  2     THSFVDASNVIGRDKDKERIIEELLKPADNEN---VSIIPIVGIGGLGKTTLAKLVYNDE  58

Query  729   RVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLV  908
             RV  +F ++ W  VSEDF L K+I KIL   +  +  ++D++QLQ  L   L   RYLLV
Sbjct  59    RVASHFQSKSWACVSEDFDLQKMIIKILNCVSPVNM-NMDIEQLQIALREALYGKRYLLV  117

Query  909   LDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDL  1088
             LDDVWNED+ KW  L+ LLM G  GS+++VTTRS  VA+I  T ++Y L  LS   C  +
Sbjct  118   LDDVWNEDRRKWLELKILLMGGASGSKILVTTRSKHVASIMSTVSSYELDHLSHEYCLAI  177

Query  1089  FLKCAFREQEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIW  1265
             F KCAF E E +   +L++IG+EIV KC G+PLAV TLG++LY    E++W  +R+NEIW
Sbjct  178   FFKCAFEEPEEKQNPDLIKIGEEIVSKCKGIPLAVITLGTLLYSVAGERDWKFVRDNEIW  237

Query  1266  KIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDG  1445
             K+EQKE DILP LKLSY+ MP +L++CFAYC +FPK         +  W++ G IQS + 
Sbjct  238   KLEQKENDILPALKLSYEHMPSYLKRCFAYCSIFPKDHPFVDIELVYFWISHGLIQSSNE  297

Query  1446  DQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGD  1625
              QELE++G + F EL SR  FQD +E ++G +  CK+H+L+HDLA SV   ECL V S +
Sbjct  298   KQELEDVGIRCFQELCSRCFFQDFLE-YNGNV-CCKMHDLIHDLALSVTQNECLIVTSSN  355

Query  1626  PEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFR--VGTVSKTFVKKTLLNFRR  1799
              +IP+S+ HL F    L  E+ P+P+  L  +R  + S    +G  S+ F++  +  F+ 
Sbjct  356   EQIPKSIRHLSFPYPELLPEDLPKPVRKLDRIRTISCSHGRGMGISSEVFLRTCISKFQY  415

Query  1800  LRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLK  1979
             LR L L    +  LP  I  LK L+YL+L  N +IK LPE I KL +LQ L L  C  L+
Sbjct  416   LRALDLSCSRVAALPKGIAKLKHLKYLSLDWNVDIKRLPESICKLQSLQALVLGYCYGLR  475

Query  1980  ELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKL  2159
             ELP++  + L+SL+ L++T+Q+  L       LG L++L +  C   ++     Q +KKL
Sbjct  476   ELPKDI-KYLISLRWLWITTQQRYLPNGGIGCLGSLRYLFITTCENLEYLFGDIQGLKKL  534

Query  2160  RVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKL  2339
             + L I +C SL  LP  ++ LA L+ L +  C+ LDL+                      
Sbjct  535   QTLVIRDCDSLVSLPPSVKFLAALKTLVVAGCKNLDLT----------------------  572

Query  2340  VSLPAGLKDIDA----MKLKYLRVAGCPELTALPDWL--QNCTLLQRLYIEDCPELSYLP  2501
               +  G+   D+      L+ L + G P+L   P WL  ++ T L+ + +  C      P
Sbjct  573   --MEEGIDSQDSTSQLFSLRTLEIVGLPKLVDFPQWLLHRSNTGLKVIKVAYCYNFRNFP  630

Query  2502  EQIRSSSNAKVRIIDCPLLNG  2564
               +    + ++RII CP   G
Sbjct  631   NYLHDIPSLELRIISCPQYQG  651



>ref|XP_006371428.1| hypothetical protein POPTR_0019s10290g, partial [Populus trichocarpa]
 gb|ERP49225.1| hypothetical protein POPTR_0019s10290g, partial [Populus trichocarpa]
Length=1186

 Score =   482 bits (1240),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 293/657 (45%), Positives = 420/657 (64%), Gaps = 13/657 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E  L  IT+ +L K+ +LA  EI   W +K EL+KL+NT S IKA+  DA+EQQ K+H
Sbjct  1     MTEAVLVSITDRILGKLGNLALQEIGLIWGVKDELEKLRNTASVIKAIFLDAEEQQTKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             EV+DWLQKL+D +YDADDLLDDF T  L ++L        +V   F++     Y F ++ 
Sbjct  61    EVRDWLQKLKDAIYDADDLLDDFSTEMLQQQLMMQDQKAIEVCAFFSKIKKTAYGFSMSC  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+ IR RLN IA DR  FH  ++    P    + REQTHSFV   +++GR+ DK +IV 
Sbjct  121   KIKAIRERLNDIASDRSKFHLTDHPRQMPSVIAE-REQTHSFVCVEEVVGREDDKLAIVE  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L+ S  EE+   VS +P+VG+GGLGKTTLV+LVYN +++ ++F+ R+WV VS+ F +  
Sbjct  180   LLLHSNTEEN---VSVIPVVGIGGLGKTTLVQLVYNSEKIRRHFELRIWVCVSDVFDVKL  236

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +++KIL SAT      L+MD L   L   +   ++LL+LDDVWN+++ +W  LR+LLM G
Sbjct  237   IVQKILESATNTKCDGLEMDSLLTRLGKEIDGKKFLLILDDVWNDNRERWLKLRDLLMGG  296

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+V+VTTR+  +ATITGT   Y L  LS+ + + LF K AF++ +++    LV IGK
Sbjct  297   ARGSKVVVTTRTQLIATITGTAKPYFLRSLSEDESWSLFEKLAFKQGKDFENTRLVAIGK  356

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             E+V+KC GVPLA++T+GS+LYCK  E EWL  ++ ++  I Q E DILPILKLSY+ +P 
Sbjct  357   EVVKKCAGVPLAIRTMGSLLYCKDTETEWLSFKDRDLSMIPQNENDILPILKLSYELLPP  416

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L+ CFAYC +FPK  EI ++  I LW+AQGF+Q  DG Q  E +G+Q F +L  R  FQ
Sbjct  417   CLKNCFAYCSLFPKDYEINKQTLIKLWMAQGFLQPADGMQHPEEVGHQCFMDLARRSFFQ  476

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             D+     G++++C +H+L+HDLA  V G+E   V S    I E + H+    +  S ++ 
Sbjct  477   DLEYGEWGDVVSCGMHDLMHDLALLVGGSESSTVDSNAENISERIRHVSLDFELDSSQKI  536

Query  1692  PQPLLNLKNLRYFAYSFRVGTVSKTFVKKT-----LLNFRRLRVLMLQNLELKELPSSIG  1856
             P  L     +R F     V  V +  + +      + +FR LR L   N  +  +PSSI 
Sbjct  537   PPSLFKANKIRTFV--LPVQPVYRKILNQAPHDTIISSFRCLRALDFHNTGVDIVPSSIS  594

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              LK LRYL+LS N ++K LP CI++L NLQTL L +C++L+ LPR+   +++SL+ L
Sbjct  595   KLKHLRYLDLSKNEDLKRLPRCIARLKNLQTLKLSSCKRLEALPRHIS-KMISLRHL  650


 Score = 85.9 bits (211),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (55%), Gaps = 10/190 (5%)
 Frame = +3

Query  2046  VSLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             VS+ +    +L +L+ L +  C +    P E  + ++ LR L I  C SLT L  G+++L
Sbjct  993   VSISELGLQNLTYLEHLTIENCPNLSSLPEESLRGLRSLRFLSIRGCGSLTSLFLGLQYL  1052

Query  2223  AKLEKLWIWNCEELDLS-----VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
               LE+L I  C  LD+S           G++SL+ L +  +P+L S+P G+ ++ +  L+
Sbjct  1053  TSLEELEIEECRALDMSDCDEENSLQFRGMKSLRRLKIGYMPQLESIPDGIHEVTS--LQ  1110

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*  2567
              L++ GC  L  LP+W+ +  LLQRL I DCPEL+ LP+    +    + I +CP L   
Sbjct  1111  DLKIEGCVGLKTLPEWIHDLKLLQRLDISDCPELNSLPQACMKALQI-LEIYNCPKLLRI  1169

Query  2568  CGDTGTRLSW  2597
             C +T T + W
Sbjct  1170  C-ETRTSMDW  1178



>ref|XP_010279527.1| PREDICTED: putative disease resistance protein RGA3 [Nelumbo 
nucifera]
Length=1162

 Score =   481 bits (1238),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 299/652 (46%), Positives = 417/652 (64%), Gaps = 16/652 (2%)
 Frame = +3

Query  69    ASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAK  248
             + MAE  L+ + + +  K VS   +E       K E+KKL++TLSTI+AVL DA ++Q  
Sbjct  37    SDMAEAVLSTLLQAIFEKTVSEVFEEFGLFGGAKKEVKKLRSTLSTIQAVLEDAKDRQVT  96

Query  249   NHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSC-------SGILTKVRKLFTRPDG  407
             +  ++ WL+ L+DV YDADDLLD++   +L +K+ +          I  +VR  F+  + 
Sbjct  97    DKALRIWLRNLKDVAYDADDLLDEYLIEALHKKVETHHIHATIRDHIRKQVRNFFSTSNP  156

Query  408   LIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGR  587
              I+ +++  +++EI  RL+ IA +R  FH K+   ++  +    R QT S +  S+I GR
Sbjct  157   FIFHYRMRRQLKEIGERLDLIAGERFKFHLKDRI-IDRRDGLIGRLQTDSSLVESEIYGR  215

Query  588   DSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVS  767
               DKE I+  L+   +++D   VS +PIVG+GGLG TTL KL YND+RVV++F+ R+WV 
Sbjct  216   GDDKEKIIKFLIHEGNDDD---VSVIPIVGMGGLGMTTLAKLAYNDERVVRHFEQRIWVC  272

Query  768   VSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             VS DF +  ++  I+ SATGK    LDM+ +Q  L  +L   R+LLVLDDVWNED  KW 
Sbjct  273   VSVDFDVRMLVRAIIESATGKRCDCLDMEPMQRRLKEMLTRKRFLLVLDDVWNEDYEKWD  332

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR-EQEYR  1124
              ++ LL  G  GS++IVTTRS KVA ITGT T++ L GL +  C+ LF + AF+ E E  
Sbjct  333   RMKLLLRCGAGGSKIIVTTRSEKVALITGTVTSHGLDGLPEDACWSLFKQRAFQFENEKE  392

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               +LV IGKEIV+KC GVPLA KTLGS++  K ++ EWL +++++IW I   E  ILP L
Sbjct  393   SSSLVSIGKEIVKKCRGVPLAAKTLGSLMCFKREKSEWLSVKDSDIWDIIGGENGILPAL  452

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             +LSYD +P +L+QCFAYC +FPK  ++ RE  I+LWVA+GF+Q+  G++ LE +GN+YFN
Sbjct  453   RLSYDNLPSYLQQCFAYCSIFPKDYKMKREKLIHLWVAEGFVQASGGNKPLEEVGNEYFN  512

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESVHHLVF  1661
             ELL R  FQDV++  DG IL CK+H+LVHDLA+SVAG +C  V +     IP  V H   
Sbjct  513   ELLWRSFFQDVIKESDGIILECKMHDLVHDLARSVAGIDCSIVNANKQVTIPIGVRHSSL  572

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
               + +     P  L N KNLR F   F    +S+   +  +L+FR LRVL L    +K+L
Sbjct  573   VCNEMVL-ALPGVLPNAKNLRSFLLLFGWRKISRV-SRNLILSFRSLRVLDLSYSGIKKL  630

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
               SI  LK LRYL+LS N  IK LP+ IS L NLQTLNLI C QL+ LP++ 
Sbjct  631   SKSIATLKHLRYLDLSGNF-IKMLPKSISSLCNLQTLNLIQCHQLQRLPKDM  681


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 76/160 (48%), Gaps = 29/160 (18%)
 Frame = +3

Query  1800  LRVLMLQN-LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQL  1976
             L+ L L N  EL  LP  +G L  L  L +    ++ SLPE IS L  LQ L+L +CE L
Sbjct  998   LQSLSLSNCYELDHLPEELGSLILLESLVVCGCHSLISLPEGISGLTALQHLSLSDCENL  1057

Query  1977  KELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPA-EIW-QHM  2150
               LP    Q   +L+TL + S                         C K  +   W  H+
Sbjct  1058  SSLPDAM-QHFTNLQTLNIWS-------------------------CGKLASLPNWLGHL  1091

Query  2151  KKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL  2270
             K LR L I+ C ++ CLP G++HL  L+ L IW+C  L++
Sbjct  1092  KSLRELEIWYCDNILCLPEGMQHLTALQFLSIWSCPNLEM  1131



>ref|XP_007162225.1| hypothetical protein PHAVU_001G134500g [Phaseolus vulgaris]
 gb|ESW34219.1| hypothetical protein PHAVU_001G134500g [Phaseolus vulgaris]
Length=853

 Score =   472 bits (1214),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 332/849 (39%), Positives = 484/849 (57%), Gaps = 53/849 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE FL  I E++++K+ S A  E S    L   L+ L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAEYFLFSIAESLIAKLASHAFQEASRLVGLYDNLRDLTKTLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             ++++WL +L+ V  DA+DLLD+F   +L  K+    G    KV   F+  + L++R+++ 
Sbjct  61    QLREWLTQLKIVFSDAEDLLDEFECQTLRNKVVKAHGSTKDKVSHFFSTSNPLLFRYQMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD+IGR  DKE 
Sbjct  121   QQIKDISNRLDKVAADRHKFSLQ----IIDVDTRVVHRRDMTHSRVNDSDVIGRKHDKEK  176

Query  606   IVGMLM-KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
             I+ +LM ++ +++D  S+  +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF
Sbjct  177   IIELLMPQNSNDDDDTSLFVIPIVGIGGLGKTTLAKFVFNDSRIQECFPMKMWVCVSDDF  236

Query  783   SLSKVIEKILRSATGK-------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
              + ++I KI+ SA  +       +   LD++QLQ  L   L S  +LLVLDDVWNED+ K
Sbjct  237   DIKQLIIKIINSANDQDAPPHQQNLNMLDLEQLQNQLKNKLSSQNFLLVLDDVWNEDRVK  296

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
             W  LR L+ S   GS+++VTTRS  +A++ GT T++ L GLS+ D   LF+K AF+E +E
Sbjct  297   WVELRNLIQSAA-GSKILVTTRSHSIASMMGTVTSHILEGLSEEDSLSLFVKWAFKEGEE  355

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
                 +LV IG+EIV+KC GVPLAV+TLGS+L+ K +  EW ++ ENEIW + QK+ DILP
Sbjct  356   ENHPHLVNIGREIVKKCRGVPLAVRTLGSLLFSKFEASEWEYVSENEIWNLPQKKDDILP  415

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD MP +LRQCF    ++PK  EI      +LW A G I  P  ++ LE++ N+Y
Sbjct  416   ALKLSYDLMPSYLRQCFVMLSLYPKDYEINSYEISSLWGALGLIAVPKKNRTLEDVANKY  475

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +ELLSR   QD      G + +  IH+LVHDLA  VA  +CL V S    IP++V HL 
Sbjct  476   LHELLSRSFLQDFTNF--GTVYSFTIHDLVHDLALFVAKDDCLYVSSNIQNIPDNVRHLS  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV---SKTFVKKTLLNFRRLRVLMLQNLE  1829
             F   +L        L + K++      FR G+    S+  +   +  F+ LRVL L    
Sbjct  534   FAESSLFNN-----LYHKKSVAMRTILFRYGSKEINSEALINTCVSKFKYLRVLNLWAST  588

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
             ++ LP +I  LK LR LN+S N NIK LPE I KL +LQ L L  C QL+ +P+   ++L
Sbjct  589   METLPRTIAKLKHLRCLNISQNINIKRLPESICKLQSLQVLRLGRCLQLEAMPKGL-RKL  647

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVL  2168
             +SL+ L  ++++  L      SLG L  L +             +FP         L+ L
Sbjct  648   ISLRELEFSTKQSILPDNDIASLGDLANLCIESSPNLESIFGGVQFPV--------LKGL  699

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSL  2348
              + +C SL           +LE L   + EE              L+++L   L +LV+L
Sbjct  700   TVIDCQSLKSFRLDGNFFPELETLGGNHFEE--------QSHKLKLKTVLFSNLSQLVAL  751

Query  2349  PAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNA  2528
             P  L++  A  L+ L +  C  +  LPDWL   T L+ L I+ CP L  LP+ I   +  
Sbjct  752   PKWLQEA-ANSLQCLIITDCDNIETLPDWLTTMTNLKTLSIKSCPNLISLPDNIHYLTAL  810

Query  2529  KVRIID-CP  2552
             +  +I  CP
Sbjct  811   ETLMIQGCP  819



>ref|XP_011038388.1| PREDICTED: putative disease resistance protein RGA3 isoform X9 
[Populus euphratica]
 ref|XP_011038389.1| PREDICTED: putative disease resistance protein RGA3 isoform X9 
[Populus euphratica]
 ref|XP_011038390.1| PREDICTED: putative disease resistance protein RGA3 isoform X9 
[Populus euphratica]
 ref|XP_011038391.1| PREDICTED: putative disease resistance protein RGA3 isoform X9 
[Populus euphratica]
Length=845

 Score =   471 bits (1212),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 325/821 (40%), Positives = 475/821 (58%), Gaps = 24/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKELPSSI  1853
              +  P+   N  ++R   ++   VG   KT  KK +  F+ LR L L N  E +  P  I
Sbjct  535   HQTVPKFPNNFHHVRSIVFADSVVGPTCKTDFKKCISEFKHLRSLELTNGSEFEAFPEKI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLN   +  +K LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ LYL
Sbjct  595   GALKHLRYLNFGTSAKLKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RYMISLRFLYL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+Q+  L +     L  LQ L +  C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   TTQQKRLPEGGIGCLECLQTLFIAYCENLEDLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              A  L+   +  C ++  +P+ + N   LQ L I DCP LS
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPRLS  812



>gb|KDP43576.1| hypothetical protein JCGZ_16863 [Jatropha curcas]
Length=1087

 Score =   478 bits (1230),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 298/655 (45%), Positives = 423/655 (65%), Gaps = 13/655 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L +I   VL  +V+    EI   W +K EL KL+NT+S I+A+L DADE+QA N 
Sbjct  1     MAEGVLFNIAGGVLRNLVTPVVQEIGLYWGVKDELVKLRNTVSGIQALLIDADEKQALNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +V+DWL KL+DVVYDADDLLDDF T +L +++ + + +  +V + F+  + L Y  K+ +
Sbjct  61    QVRDWLGKLKDVVYDADDLLDDFSTEALQQQVMAGNKVTKEVSRFFSSSNQLTYGLKMGY  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENG---KLREQTHSFVRPSDIIGRDSDKES  605
             KI+ IR RL+ IA+D +N        V   + G   KLRE+T SF  P+ ++GR+ DK +
Sbjct  121   KIKAIRERLDAIAKDSQNLQLG----VRLEDKGFRSKLREETDSFA-PTIVVGREDDKAA  175

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +L+ S DEE+   VS + IVG+GGLGKTTL +L++N++ V  +FD RLWV VS  F 
Sbjct  176   ILKLLLTSNDEEN---VSVISIVGIGGLGKTTLAQLIFNNELVQTHFDLRLWVCVSNPFD  232

Query  786   LSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             +  +++KIL S TG+   +L+++ L++ L  ++   +YLLVLDD+W+ED  KW  L++ L
Sbjct  233   VKVIVKKILESGTGEKPDNLELNTLKDSLGKIINGKKYLLVLDDIWSEDHEKWDRLKKFL  292

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
               G  GS++IVTTRS KVA +  T+  Y L+GLS+ + + L +K  F+ +E +  ++VEI
Sbjct  293   SIGASGSKIIVTTRSTKVAELVSTSQPYVLNGLSNLESWSLLVKIVFKGKEPKNPSVVEI  352

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GKEIV+KC GVPLA+KT+GS+L  K  E EWL   +NE+ KI Q ETDILP LKLSYD +
Sbjct  353   GKEIVEKCVGVPLAIKTIGSVLCFKNPETEWLPFMKNELSKIVQNETDILPTLKLSYDHL  412

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P +L+ CFAYC +FPK   I  E  I+LW+AQGF++S +  Q LE++G +YF +LL R  
Sbjct  413   PSNLKHCFAYCRLFPKDYRICVETLIHLWIAQGFVESSNSSQSLEDIGLEYFMDLLWRSF  472

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQ++     G I  CK+H+L+HDLA  VAG E + V S    I E   ++     + S  
Sbjct  473   FQEIERDAFGRIQTCKMHDLMHDLATLVAGNESIMVDSNVKSIDEKTRNVSIDLGSRSIG  532

Query  1686  EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
             E P   L  K LR F    +   + K+  K  +  FRRLRV  L N  ++E+P SI  LK
Sbjct  533   EVPACFLGAKQLRTFLLRSQ-ERLEKSNHKVIISKFRRLRVCDLHNAGIEEVPYSIKKLK  591

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
              LRYL++S N  I +LP  I++L NLQ L L NC  LKELP+N   +L++L+ LY
Sbjct  592   NLRYLDVSGNKGIVTLPYSITELRNLQVLKLSNCMYLKELPKNM-WKLVNLRHLY  645



>gb|KCW48020.1| hypothetical protein EUGRSUZ_K01752 [Eucalyptus grandis]
Length=860

 Score =   470 bits (1210),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 329/842 (39%), Positives = 492/842 (58%), Gaps = 21/842 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L+ I E VL KI SL   E+ + + L+ +L +L+ T++ IKAVL DA+EQQAKNH
Sbjct  1     MAESLLSGIAEGVLGKIASLVAQEVVAIYGLENQLSELKETVTAIKAVLLDAEEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK-LRSCSGILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +L+DV+YD DD+LD+F   +L ++ +R   GI  KV + F+  + LI+R +++
Sbjct  61    RLQLWLDRLQDVLYDVDDVLDEFECEALRKQVIRRYGGIKEKVCRFFSVSNPLIFRARLS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KI+EIR RL+ I+ ++  F        N   + + RE T+S+V   +++GRD DKE ++
Sbjct  121   DKIKEIRKRLSIISAEKDQFDLNARSANNDAAHTRSREMTYSYVNKLEVVGRDIDKEKMI  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              MLM   D ++   +S  PI+G+GGLGKTTL KLVYNDD V + F  R+WV V +DF+L 
Sbjct  181   KMLMHPVDNKN---ISVFPIIGIGGLGKTTLAKLVYNDDGVKEQFKLRIWVCVPQDFNLR  237

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K+IE I+++ T +SF + D+ QLQ  L   +   +YLLVLDDVW+ D+++W  LR LL  
Sbjct  238   KIIEGIIKNGTRQSFSNFDIQQLQTLLQETIEDKKYLLVLDDVWSNDRNRWNELRNLLSQ  297

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G  GS++IVTTR+++VA + GT   +NL GLS  D   LF K AF E+E  P   LVEIG
Sbjct  298   GASGSKIIVTTRNLEVACMMGTHPTHNLKGLSHEDSMVLFKKFAFDEKEREPCPKLVEIG  357

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
               IV+K  GVPL VKTLG +LY K  E+ W HIR+++ W + + E DI+P+LKLSYD +P
Sbjct  358   SHIVEKSHGVPLLVKTLGCLLYTKRKERYWAHIRDSKTWILVEAEKDIVPVLKLSYDDLP  417

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              +L++CFA   +F K ++         W+A G I S    Q LE++  +Y  EL  R   
Sbjct  418   SNLKRCFAALSLFGKKDDYNSIDVSRWWMALGLISSTREKQALEDVTLEYVKELGKRSLI  477

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA----DNL  1676
             Q+V +   G +L   +H+LV+ LA  VA  +   V     EI + V H+ F +      L
Sbjct  478   QEVEQ--HGSLLTFDMHDLVYYLASIVAKNDYSMVGLDTVEISKGVRHVSFSSILSEGIL  535

Query  1677  SREEFPQPLL--NLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             + +  P  L     K LR   +   V   ++  FV+  L   + LR+L L +   +ELPS
Sbjct  536   NFDGVPLFLRKPTSKRLRAITFCCEVDEIITGEFVRTCLTKCKHLRILQLSDGSFEELPS  595

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LKQLR L+L+++  +K LP+ I +L +LQTL+L  C +L  LP+N   +L+SL+ L
Sbjct  596   SIGNLKQLRSLHLTDSKRLKKLPDSICELQSLQTLSLEGCSKLGNLPKNMN-RLVSLRYL  654

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             ++T+++ SLQ+     L  LQ L    C   +   E    + +L  L I  C     +  
Sbjct  655   WVTTKQKSLQQSGIQYLENLQLLDFNGCENLQVLFEGTSQLTRLEHLLIRNCGR--PISV  712

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
                 L  L  L I +C +L L+         +L+ L +    +++ L   L  + +  L+
Sbjct  713   HFEKLIALHSLVIEDC-KLTLTQENKSNFPLNLKILCITKCEQVMELLQCL--VGSCTLE  769

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLLNG  2564
              L +  CP  TA+P+WL N T L+ + I DC  LS+LP+ +RS +  K + + DC  L+ 
Sbjct  770   CLCIHNCPNFTAVPEWLPNHTHLKCIEIIDCSNLSFLPQGVRSLTALKELYVWDCGELSK  829

Query  2565  *C  2570
              C
Sbjct  830   RC  831



>ref|XP_009339955.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
Length=1068

 Score =   476 bits (1226),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 321/770 (42%), Positives = 446/770 (58%), Gaps = 65/770 (8%)
 Frame = +3

Query  33    PSWIMIS*QSPRASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIK  212
             P  I  S  + +  M E+    I  ++L K+ S    E+   + +  EL KL++TLSTI+
Sbjct  27    PLLIASSQTANKTKMVESVPFGIATHLLVKLGSSTFQELGLIYGVDKELTKLESTLSTIR  86

Query  213   AVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG----ILTKV  380
             AVL DA+E+Q  +H V++W++KL+DVVY AD++ D F T       ++  G    +L +V
Sbjct  87    AVLSDAEEKQETSHLVQEWMRKLKDVVYRADNVFDVFET-------KANDGKDQLLLLQV  139

Query  381   RKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKEN----YYVNPVENGKLREQ  548
             R  F+  + L +R K+  +I+EIR  L++IA D   F+F+      Y    ++NG  +E+
Sbjct  140   RGFFSPSNHLAFRHKMGREIKEIRESLDEIAADISKFNFRAGSVTVYADIGLQNGYEKEE  199

Query  549   THSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDD  728
             THSFV PS +IGRD DKE +V  LM  CD E+   VS   IVG+GGLGKTTL K+VYND+
Sbjct  200   THSFVLPSTVIGRDKDKEEMVRSLMWECDREN---VSIAAIVGIGGLGKTTLAKMVYNDE  256

Query  729   RVVQNFDTRLWVSVSEDFSLSKVIEKILRSATG-----KSFGHL----------DMDQLQ  863
             RVV  F  ++WV    +F +  +  KIL + T        F HL          ++++LQ
Sbjct  257   RVVSYFQLKMWVWAYGNFDVRSIASKILSTGTADELQESEFSHLRNGPQKKMLMELEELQ  316

Query  864   EHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTT  1043
               L   L   RYLLVLDDVWNE+++ W  L +LL  G  GS+++VTTRS KV ++    +
Sbjct  317   ILLRKKLDGKRYLLVLDDVWNENRNSWLQLNDLLSGGAKGSKIVVTTRSTKVTSVMDIDS  376

Query  1044  AYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYC  1217
              Y L GL + +C+ LF K AFR+  +E  P  LV IG+ I  KC GVPLA++TLGS++  
Sbjct  377   PYVLQGLREEECWTLFKKMAFRKGREEENPM-LVPIGRRIADKCQGVPLAIRTLGSLMRY  435

Query  1218  KTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREV  1397
             KT E EWL I+  EIW+  ++E DIL ILKLSYD MP +L+QCF+YC +FPKG EI +++
Sbjct  436   KTSESEWLAIQNKEIWEFPKEENDILAILKLSYDHMPVYLKQCFSYCALFPKGYEIDKKL  495

Query  1398  FINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDL  1577
              I LW+AQG+I  P  D  LE++G+ YF ELL R  FQ+V +  DG +++C +H+L+ DL
Sbjct  496   LIQLWIAQGYIHPPSKDSNLEDIGDTYFKELLWRSLFQEVKKDVDGNVISCNMHDLIQDL  555

Query  1578  AQSVAGAEC--LNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVG  1751
             A++VAG+EC   NV SG+  + E VHH+ F     S  E P  LL  + +R F    +  
Sbjct  556   ARAVAGSECSICNVDSGN--VSERVHHVSFSQYLPSSWEVPTTLLKARKVRTFVLPLQYQ  613

Query  1752  T-VSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECIS  1928
             T    T     + + R LR L L NL  KELP  IG L  LRYL+LS N  +  LP  I 
Sbjct  614   THKISTSHSTIISSLRCLRALDLHNLRTKELPDVIGKLTHLRYLDLSGNVCLVVLPGSIC  673

Query  1929  KLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL------YLTSQEVSLQKRSSVSLGFLQ  2090
              L NLQTL L  C ++K LPRN G +++SL+ L       LT     L K   +SL  L 
Sbjct  674   NLQNLQTLKLNRCYRIKHLPRNLG-KMISLRHLEMNGCCNLTHMPPGLGKL--ISLQTLP  730

Query  2091  FLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
               +L K              K L    + E S L CL  G+ H+  LE +
Sbjct  731   IFVLCK--------------KSLSSSGLDELSGLNCL-RGMLHIVHLEHV  765



>gb|ADB85254.1| putative disease resistance protein [Phyllostachys edulis]
Length=847

 Score =   470 bits (1209),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 335/814 (41%), Positives = 476/814 (58%), Gaps = 36/814 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQD----EISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
             MAE ++A    +VL K+ S   D    +I SAWN+K EL KL+ +L +I AVL DA+ +Q
Sbjct  1     MAEVYIASFAISVLEKVGSFGTDWAVNKIMSAWNVKKELGKLEMSLRSICAVLEDAEGKQ  60

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRF  422
             + +H +++WL  L+D VYD DD+LD   T SL +++    G  T +  L      L Y F
Sbjct  61    STSHALREWLDNLKDAVYDIDDVLDYVATKSLEQEVHK--GFFTCMSHL------LAYPF  112

Query  423   KITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
             K++HKI+E+R +L+++A  R  F   E    +       RE THSF+   DIIGRD  K 
Sbjct  113   KLSHKIKEVREKLDEVAAKRAQFGLTEQPIDSKTSMTSNRE-THSFINEPDIIGRDEAKS  171

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
             +I+  ++ + D  + +++S LPIVGLGG+GKT L KL+YND ++ + F+ +LW  VS+ F
Sbjct  172   AIIERILTAADSRN-QTLSVLPIVGLGGIGKTALAKLIYNDAQITKKFEKKLWACVSDVF  230

Query  783   SLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              L K+++ I++S TG+S   L+++ LQ  L G+L   RY LVLDD+WN+    W  LR L
Sbjct  231   DLKKILDDIIQSGTGESSKQLNLEMLQSRLRGLLQERRYFLVLDDMWNDKVTDWDELRSL  290

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVE  1142
             L SG  GS +IVTTRS  VA++  T   Y+++ LS   C  +F + AFR++  +  +L++
Sbjct  291   LSSGGSGSVIIVTTRSSNVASVVKTMEPYDVAELSFDQCMQVFTRYAFRDEGEKCPHLLK  350

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IG+ IV+KC GVPLA KTLGS+L    D  +W  I E+++W IEQ    ILP LKLSYD 
Sbjct  351   IGESIVEKCCGVPLAAKTLGSLLSNSRDVVKWRRIEEDKLWNIEQSTDGILPALKLSYDA  410

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P HLR C A   +FPK  +I     + LW+A G + +   ++E  N G +YF+ELL R 
Sbjct  411   LPPHLRACLACLSIFPKDYDIFTSPLVMLWMALGLLHTSRENKEALNSGTEYFHELLGRS  470

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
              FQD    ++G I +CK+H+L+HDLA SV+  E   V      + E V H+V+   + S 
Sbjct  471   LFQDQHVVYNGSIDSCKMHDLIHDLANSVSKKEQAVVSCEKVVVSERVRHIVWDRKDFST  530

Query  1683  E-EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
             E +FP+ L   +  R FA ++  GTVSK F+++    F  LRVL+   +E +ELPSS+G 
Sbjct  531   ELKFPKQLKKARKSRTFASTYNRGTVSKAFLEELFSTFALLRVLIFTGVEFEELPSSVGN  590

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             LK LRYL+L  +  IK LP  + +LVNLQTL L  C QL+ELPR+    L+SL  L LTS
Sbjct  591   LKHLRYLDLQWSRKIKFLPNSLCRLVNLQTLYLSRCNQLEELPRDV-HGLVSLTWLSLTS  649

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
             ++  L K        L FL L  C       E +               SL+ + A    
Sbjct  650   KQKYLLKSGFCGWSSLTFLQLGYCPELTLLTEGF--------------GSLSAMSATHVR  695

Query  2220  LAKLEKLWIWNCEE--LDLS-VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
             L+K+   +   C E  LD S +GE + GL SL  L L GLPKL   P   +   A  L+Y
Sbjct  696   LSKVG--FSPPCHEAALDTSGIGEALSGLGSLLKLELGGLPKLAGFPESFRSA-ASSLQY  752

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             +  A C  L  LP ++Q+ T L+R+ I DCPELS
Sbjct  753   VCFADCKGLEKLPGFIQDFTCLKRIVILDCPELS  786



>ref|XP_010094550.1| Disease resistance protein RGA2 [Morus notabilis]
 gb|EXB56304.1| Disease resistance protein RGA2 [Morus notabilis]
Length=941

 Score =   473 bits (1216),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 334/839 (40%), Positives = 485/839 (58%), Gaps = 46/839 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+  +   V+ K+ S++  +I  A  L+ +LK+L+ T++TIK VL DA+E+QA + 
Sbjct  1     MAE-FVYGVAVIVVEKLSSISYHQICLALGLEGDLKRLKETMATIKDVLLDAEEKQAHDK  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK-LRSCSGILTKVRKLFTRPDGLIYRFKIT  431
              +  WL +L+DV  DA+D+LD+F      R+ ++       KVR+ F+R + L++R  + 
Sbjct  60    RITSWLTQLKDVFLDAEDVLDEFDCEEQRRQSVKKHGRTGRKVRRFFSRSNPLVFRASVA  119

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
               I++IR RL+QIA D++NF          + N    ++ HSFV PSD+IGRD D+++I+
Sbjct  120   RAIKDIRERLDQIAADKKNFDLNSRQEERRLTNE--WKEVHSFVDPSDVIGRDIDQKNII  177

Query  612   GMLMKSCDEEDTE---SVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +L  +  ++  E    +S +PI G+ G+GKTTL +LVYN  RV   F+ ++WV VS+DF
Sbjct  178   SLLTDAASDDHDEIHPKLSVIPIHGIPGVGKTTLTRLVYNHKRVRCYFELKMWVHVSKDF  237

Query  783   SLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              + ++I++IL SATGK   +L  DQ+Q  L   L   R+LLVLDDVWN D+ +W  LR L
Sbjct  238   DVPRLIKEILDSATGKKNDNLTFDQVQTQLRDNLEGKRFLLVLDDVWNGDRSRWIELRSL  297

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNL  1136
             L  G  GS++IVTTRS  V    GT + YNL GLSD   ++ FLKCAF+E     + RNL
Sbjct  298   LTGGSKGSKIIVTTRSANVGDCMGTISPYNLEGLSDEHSWNFFLKCAFKEGVGHEQNRNL  357

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKI--EQKETDILPILKL  1310
             ++IG++I+ KC G+PL V+TLGS+LY   D Q W +I E+++W++  E     I   L L
Sbjct  358   LDIGRQILDKCKGIPLVVRTLGSLLYSNQDVQYWRYISESKLWEVVAEPYRKGIFAALLL  417

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQG-FIQSPDGDQELENLGNQYFNE  1487
             SY  +P+HL++CF YC +FPKG+EI     I LW+A G  I   +  + LE++G+QYF E
Sbjct  418   SYSDLPFHLKRCFLYCSLFPKGKEIFSLELIQLWMAHGVLIPKRNEYRSLEDIGHQYFKE  477

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             L SR  FQ V +   G   +  +H L+H+ AQ VA +EC  + S + +I   V HL    
Sbjct  478   LCSRSFFQYVKK--QGWYYSFSMHELIHEFAQLVAQSECWIINSPESDICNRVRHL--SV  533

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
             + LS  E P  L NL ++R   + F +   +S  F KK L  +  LR+L L     +  P
Sbjct  534   NQLSGNEIPSCLDNLNSVRTIIFPFLLTEPLSDFFFKKYLWKYECLRMLDLSYSSFETFP  593

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             S IG +KQLR LNLS+N  + +LP+ I+KL +LQ L L  C  L++LP+N G  L SL  
Sbjct  594   SYIGRMKQLRNLNLSHNRKLVNLPDSITKLQSLQILQLQGCSNLEKLPKNIG-NLSSLMF  652

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T++E+                         FP    + +  LR L I  C+ L+ L 
Sbjct  653   LSITTKEMC------------------------FPENGIECLTSLRTLMIVSCNKLSYLS  688

Query  2205  AGIRH-LAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAM  2378
               I   L  LE L I  CE L L    +      SLQ L+ M LPK+ +LP  L+     
Sbjct  689   DRIMGCLTALETLVISYCENLALFDDQDEKVKRLSLQKLIFMDLPKMRALPRWLEGCQNT  748

Query  2379  KLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCP  2552
              L+YL +  CP LT+LP WL     LQ++ I  CP+L  LPE + R +S  ++RI  CP
Sbjct  749   -LQYLCLGSCPNLTSLPFWLPKTASLQQMEIGACPKLCSLPEGMHRLASLLELRIAKCP  806



>ref|XP_009334476.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=825

 Score =   469 bits (1206),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 341/838 (41%), Positives = 479/838 (57%), Gaps = 47/838 (6%)
 Frame = +3

Query  81    ETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEV  260
             E+F  ++ E VL ++ S A  E+  A+++K EL KL+ TLSTI  VL DA+E+Q K+H +
Sbjct  2     ESFSFNVVERVLERLASHAYQELFLAFDVKYELNKLRETLSTIAKVLLDAEEKQRKDHLL  61

Query  261   KDWLQKLRdvvydaddllddFGTLSLLRKLRS----CSGILTKVRKLFTRPDGLIYRFKI  428
              DWL KL+DV YD DD+LD+F    L  ++ S     + I  KVR  F+  +  +  +K+
Sbjct  62    TDWLGKLKDVCYDIDDVLDEFEFQKLRMQVLSLGTGSNTIKGKVRNFFSHRNSFVSSYKM  121

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              H++++IR RL +IA  +  F+  E           +  +THSFV   D+IGR+S+KE I
Sbjct  122   GHRVKDIRERLGEIAAAKAQFNLAER--SADWHGMHMERETHSFVHAPDVIGRESEKEEI  179

Query  609   VGMLMKSCDEE--DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
             V  L K       D E+VS + I GLGGLGKTTL KLVYND+ VV NF+ R+WV VS+DF
Sbjct  180   VVQLFKDTHTGPGDEENVSVISINGLGGLGKTTLAKLVYNDNTVVTNFELRIWVCVSDDF  239

Query  783   SLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWK  947
                +++ +I+ +AT +  G   ++Q+Q  L   L   + LLVLDDVW++        KW 
Sbjct  240   DSKRLLREIVTAATSQKCGDESIEQMQMKLQRALTGKKLLLVLDDVWDKGPMGITVKKWI  299

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEY  1121
             +L+ LL     GS+VIVTTR+  VA + G    + L  L   DC  +F+K AF  RE++ 
Sbjct  300   DLKSLLNVAACGSKVIVTTRNESVALLMGYAHMHLLKVLPLSDCMTIFIKVAFARREEQN  359

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
              P NL++IG++IV+KCGGVPLA+ TLG +L    DE+ W  +R+++IWK+EQ    ILP 
Sbjct  360   HP-NLMKIGEDIVKKCGGVPLALYTLGGLLCLNKDERYWSRVRDSDIWKLEQGSDGILPA  418

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             L LSYD +P +L+ CFA+C +FPK         I LW+AQGF+QS  G QE E++G  Y 
Sbjct  419   LMLSYDALPVYLKPCFAFCSLFPKDYIFRSSELIPLWMAQGFVQSSRGYQEPEDIGLDYI  478

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAE--CLNVKSGDPEIPESVHHL  1655
              +L SR+ FQ  +E  +   +  +IH+LVHDLA S A  E   LN + G  E    + H+
Sbjct  479   RKLCSRYFFQ--IEEDNVLFVRFRIHDLVHDLAISTAQLEYSSLNFRPG--ESSTMIRHV  534

Query  1656  VFHADNLS--REEFPQPLLNLKNLRYFAY--------SFRVGTVSKTFVKKTLLNFRRLR  1805
                   LS  +EE P+ LL  + LR               VG  +++F+K+ +  F  LR
Sbjct  535   SISQKELSKDKEEDPEFLLPFEKLRTILIPDLNSEYLPTEVGVNNQSFLKRCISMFNCLR  594

Query  1806  VLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKEL  1985
             VL L NL LK LPSSIG L  LRYL+LS N  IK LP+ I KL +LQTL LINCE++KEL
Sbjct  595   VLDLSNLTLKVLPSSIGNLSHLRYLDLSYNQWIKKLPDSICKLQHLQTLLLINCEKIKEL  654

Query  1986  PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFL-LLYKCSCRKFPA--EIWQHMKK  2156
             P N G  L+SL+ L LT  +  L +     +G L  L  LY  +C+   +  E  + +  
Sbjct  655   PENMG-NLISLRYLGLTINQRHLPE----VIGRLTSLRTLYITACKYLISFGEGVRTLPN  709

Query  2157  LRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPK  2336
             LR L I  C ++  L     ++  LE L I+NC  LDL               L +    
Sbjct  710   LRTLIIVNCQNMKSLSC---NMTALENLAIYNCRVLDL---MRSGEGIRGLQSLWIVGSN  763

Query  2337  LVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI  2510
             L+ LP  L++  A  LK L +  C  L  LP W +N T LQ++ I +C  LS  P+ +
Sbjct  764   LLELPHWLQE-SANTLKTLHLGYCTYLELLPGWFENLTFLQQIKIRNCSHLSDFPKGM  820



>gb|ABA98222.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ20457.1| hypothetical protein OsJ_36064 [Oryza sativa Japonica Group]
Length=798

 Score =   468 bits (1204),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 316/798 (40%), Positives = 477/798 (60%), Gaps = 19/798 (2%)
 Frame = +3

Query  84    TFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVK  263
              F + I   V +  V  A D+I  A  ++ E++KL+N+L  I AVL+DA+ +Q+ +  +K
Sbjct  6     VFASSILSKVTTFAVEYALDDIKLACTVRSEIEKLRNSLKAICAVLKDAERKQSTSSSLK  65

Query  264   DWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIR  443
              WL+ L+D+VYD DD+LDD GT +L +K+     I T   +LF      I+ F++  KIR
Sbjct  66    HWLENLKDIVYDIDDVLDDVGTRALQQKVGK-GEIRTYFAQLF------IFPFELGRKIR  118

Query  444   EIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLM  623
              +R RLN+I+  +RNF  KE     P +    RE T+S V    I+GRD  K  IV ++ 
Sbjct  119   RVRERLNEISALKRNFDLKEEPIDTPSDRIVQRE-TYSIVDERKIVGRDKAKNDIVKVIS  177

Query  624   KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIE  803
             ++  E +++++S LP++G+GG+GKT L KLV+ND R  + FD  LW  V+    L  +++
Sbjct  178   EAA-ESNSDTLSVLPLIGMGGVGKTALAKLVFNDKRTKEKFDKMLWACVANVSDLKHIVD  236

Query  804   KILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDG  983
              I++S +G+S   L ++ LQ+ L+ +    RYLLVLDD+ +++ + W+ L  LL SG  G
Sbjct  237   IIIQSDSGESNKQLTLEALQKKLHELSGDKRYLLVLDDISHDNINDWEELMNLLPSGRSG  296

Query  984   SRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKEIVQ  1163
             S +++TTR  K+A++  T   Y +  L   +C  +F + AF+ Q+ +   L++IG+ IVQ
Sbjct  297   SMILITTRLSKIASVLKTIEPYEVPKLPHEECMKVFARYAFKGQKAKDTELLKIGESIVQ  356

Query  1164  KCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQ  1343
             KC G+PLAV+TLGS+L  + D  +W  ++E  I       TDIL +LKLSYD +P  LR 
Sbjct  357   KCDGLPLAVRTLGSLLSME-DISKWQEVKETNI-----PNTDILSVLKLSYDALPSDLRA  410

Query  1344  CFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVE  1523
             CFA    FPK  EI RE+ I  W+A G + +  G +E   +G +YF+EL  R  FQD V 
Sbjct  411   CFASLSTFPKDYEIFRELLIMYWMAMGLLNTASGSKEAIRMGERYFSELAGRSLFQDYVF  470

Query  1524  AFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE-EFPQP  1700
             + DG I  CK+H+ VHDLA SV+  E   +   +    + V HLV+     S++ +FP+ 
Sbjct  471   SHDGTISHCKMHSFVHDLAISVSPNEHATISCENFSASKRVKHLVWDQKEFSKDLKFPKQ  530

Query  1701  LLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYL  1880
             L   +  R FA     GTVSK+F++  L  F RLR+L+   +E +ELPSSIG LK LRYL
Sbjct  531   LRRARKARTFASRHNYGTVSKSFLEDLLATFTRLRILVFSEVEFEELPSSIGNLKHLRYL  590

Query  1881  NLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQK  2060
             +L  N  IK LP  + KLVNLQTL L  C++L+ELPR+  ++L+SL+ L LTS++  L  
Sbjct  591   DLQWNMKIKYLPNSLCKLVNLQTLQLAWCKELEELPRDV-KRLVSLRYLILTSKQQYLPN  649

Query  2061  RSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
              + +    + FL +  C       E +  +  LR L ++ C +L  LP+ +  L  L+KL
Sbjct  650   DALMGWTSMVFLQISACPMLTSLTEGFGSLSALRELFVFNCPNLPSLPSSMNRLVTLQKL  709

Query  2241  WIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPEL  2417
              I NC+EL+L    E M G++SL+S+ L+GLPK  + P       A  L+YL+V+ C E 
Sbjct  710   VIHNCDELNLMEPKEAMGGMKSLKSIELVGLPKFETFPDSFASA-ASTLEYLKVSDCKEF  768

Query  2418  TALPDWLQNCTLLQRLYI  2471
               LPD++Q  + L+++ I
Sbjct  769   KKLPDFIQRFSSLKKIEI  786



>ref|XP_003553415.1| PREDICTED: disease resistance protein RGA2-like [Glycine max]
Length=847

 Score =   469 bits (1208),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 317/824 (38%), Positives = 486/824 (59%), Gaps = 26/824 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E  L  I E++++K+ S A +E S    L   L++   TLS +KAVL DA+E+Q +N+
Sbjct  1     MTELVLFSIAESLIAKLASQAYEETSQVLGLYHHLQEFTQTLSLVKAVLLDAEEKQQQNY  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++++ V  DA+++LD+F   +L +++    G   TKV   F+  + L++R+++ 
Sbjct  61    ELQEWLRQVKHVFSDAENVLDEFECETLRKEVVQAHGSATTKVAHFFSTSNPLVFRYRLA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
               I++I+ RL+++A DR  F  +       V +   R+ T+S+V  SD+IGR+ DKE+I+
Sbjct  121   QHIKKIKKRLDKVAADRHKFGLETTDIDRRVVHR--RDMTYSYVVDSDVIGRNHDKENII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++     + +S+S + IVG+ GLGKTTL K+V+ND R+ + F  ++WV VS DF++ 
Sbjct  179   RLLVQQNPNNNDKSLSVISIVGIPGLGKTTLAKIVFNDRRIHELFQLKMWVCVSNDFNIK  238

Query  792   KVIEKILRS----ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             +V+ KIL S    A  ++   +DM+QLQ  L   L S ++LLVLDDVWNED  KW  LR+
Sbjct  239   QVVIKILNSNKDSAHQQNLDMVDMEQLQSQLRNKLASKKFLLVLDDVWNEDLVKWVELRD  298

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLV  1139
             L+     GS+++VTTRS   A++ GT  +Y L GLS  D   LF+K AF+E+E R   LV
Sbjct  299   LIQVDATGSKILVTTRSHVTASMMGTVPSYILEGLSLEDSLSLFVKWAFKEEEKRNSYLV  358

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
              IGKEIV+KC GVPLAV+TLGS+L+ K + +EW  +R+NEIW   + E+ +   LKLS+D
Sbjct  359   NIGKEIVKKCNGVPLAVRTLGSLLFSKDNREEWEFVRDNEIWNSMKSESGMFAALKLSFD  418

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
             QMP +LR+CFA   ++P G         +LW A GF+ SP+ +Q L++  NQY  EL SR
Sbjct  419   QMPSNLRRCFALFNLYPCGHAFDSFDVTSLWGALGFLPSPNRNQILKHGANQYLCELFSR  478

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES--VHHLVFHADN  1673
                QD V+   G     KIH+LVHD+A+ + G + + V+      PE   V HL F  +N
Sbjct  479   SFLQDFVDYGIG--FGFKIHDLVHDIARYL-GRDSIMVRYPFVFRPEERYVQHLSF-PEN  534

Query  1674  LSREEFP-QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             +  E FP    ++++ + +      VG  S+ F+ K     +RLR L L +   + LP  
Sbjct  535   VEVENFPIHKFVSVRTILFPTSG--VGANSEVFLLKCTSRCKRLRFLDLSDSMYEALPPY  592

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LRYL+L NN N+K LP+ +  L+ L+ L L  C +L  LP    ++L+SL+ L 
Sbjct  593   IGKLKHLRYLSLENNNNLKRLPDSLCNLLKLEVLILSGCSELLTLPNGL-RKLISLQHLE  651

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +T++   L +    +L  L+ L +  C+  +   E  + +  L+VL I  C SL  LP  
Sbjct  652   ITTKLRVLPEDEIANLSSLRILRIEFCNNVESLFEGIK-LPTLKVLCIANCQSLKSLPLD  710

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslll-mglPKLVSLP---AGLKDIDAM  2378
             I H  +LE L + NC+ L+ S     +       ++  + LP+LV+LP    G KD    
Sbjct  711   IEHFPELETLLVDNCDVLEFSKEHNNQNSNLRLKIVNFISLPQLVTLPHWLQGSKD----  766

Query  2379  KLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI  2510
              L+YL ++ C  L  LP+WL   T L+ L +  CP +  LP+ I
Sbjct  767   TLQYLLISSCNNLVGLPEWLSAMTCLKTLCVTSCPNMLSLPDGI  810



>ref|XP_006388824.1| NBS-LRR resistance gene-like protein ARGH30 [Populus trichocarpa]
 gb|ERP47738.1| NBS-LRR resistance gene-like protein ARGH30 [Populus trichocarpa]
Length=842

 Score =   469 bits (1207),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 332/821 (40%), Positives = 483/821 (59%), Gaps = 27/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F ADI +++L K+ S A  E   AW L+ +L +L+  L  I AVL DA+++Q+KN+
Sbjct  1     MAEAFAADIAKSLLGKLGSFAVQEFRLAWGLEDDLARLEEILKAINAVLSDAEQKQSKNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR+V+YDA+D+LD+    +L RK+    G  + KV   FTR     +R  I 
Sbjct  61    GIRLWLHMLREVLYDAEDVLDEIECETLQRKVVKTKGSTSRKVLHFFTRSP---FRLIIG  117

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  + +F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  118   HKIKKIIERLGEISALKSDFNLSEQAIDCSHVLHEETEMNRSFESFSGLIGRDKDKERII  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D   V  LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  178   NLLAAPSKVGDAHPV-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD  +L + L  ++   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  237   QVIQKIIKSATGERCADLDEGELNKKLEEIVNGRKYLLLLDDVWNEDAQKWLLLKPLLSK  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS++IVTTRS +VA I GT  A NLS L   DC  LF KCAF+E  +E  P NLV I
Sbjct  297   GADGSKIIVTTRSQRVAEIMGTVPADNLSLLGQEDCLSLFYKCAFKEGQKELYP-NLVGI  355

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GKEIV+KC  VPLAV  LG+ LY KTDE+EW  +R++E W  E++   ILP LK+SY ++
Sbjct  356   GKEIVEKCKQVPLAVINLGTQLYGKTDEKEWQSVRDSEKW--EEEGDGILPALKISYQRL  413

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + ++ LE++G +Y  EL+SR 
Sbjct  414   PTHLKRCFLYCSVFPKDYQFVDLELVQFWMAHGLIHQSSNPNENLEDVGLRYVRELISRC  473

Query  1503  CFQDVVEAFDGEIL--ACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADN  1673
              FQD    ++ +I+  + K+H+L+HDLA S+A  E   + S + +I ++  HL V  +D+
Sbjct  474   FFQD----YENKIIIASFKMHDLMHDLASSLAQNEFSIISSQNHQISKTTRHLSVLDSDS  529

Query  1674  LSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVL-MLQNLELKELPS  1847
                   P+   N   +R   ++   VG   KT  +K LL F+ LR L ++ + E +  P 
Sbjct  530   FFHRTLPKFPNNFHQVRSIGFADSIVGPTCKTDFEKCLLEFKHLRSLELMDDSEFETFPE  589

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SIG LK LRYL   +N  IK LP+ I KL NLQ L +   E L+ELP++  + ++SL+ L
Sbjct  590   SIGALKHLRYLYFGSNTKIKRLPKSIFKLQNLQALAVTGEEGLEELPKDV-RYMISLRFL  648

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             +L +++  L +     L  LQ L + +C   +   E  Q +K LR L I+EC SL  LP 
Sbjct  649   FLFTKQKRLPEGGIGCLECLQTLFIAQCENLENLCEDMQGLKSLRKLVIFECDSLISLPR  708

Query  2208  GIRHLAKLEKLWIWNCEELDL------SVgegmegleslqslllmglPKLVSLPAGLKDI  2369
              I+ L  LE+L+I NC++LDL         +      SL+ +L + +P  ++LP  L + 
Sbjct  709   SIKCLTTLEELFISNCQKLDLMKIKEVKEKKIQPLSLSLRIVLFVAVPATIALPEQLLEG  768

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
                 L+   +  CP +  +P+ + N   LQ L I +CP LS
Sbjct  769   STESLQTFIIRDCPNIEEMPECISNLKKLQNLQIINCPRLS  809



>ref|XP_006421379.1| hypothetical protein CICLE_v10006930mg [Citrus clementina]
 gb|ESR34619.1| hypothetical protein CICLE_v10006930mg [Citrus clementina]
Length=832

 Score =   469 bits (1206),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 325/851 (38%), Positives = 484/851 (57%), Gaps = 67/851 (8%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E++     E +L K+ S A +E+     +K +L+KL+ TL+T+K+V+ DA+E+Q  NH
Sbjct  1     MVESYFP--IEKLLEKLGSFAYEELLLFCGVKNDLQKLKETLTTVKSVVLDAEEKQIHNH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              + DWL KL+D  YDA+D+LD+F    L R++     I  K R  F   + + +RF++ H
Sbjct  59    RLSDWLGKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKFRNFFGCSNPIAFRFRMGH  118

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR R ++IA+ R  F+  E    +     K RE THSFV  SDIIGRD D+E I+ 
Sbjct  119   QIKKIRERFDEIAKLRGEFNLIERLDDHRRVVHKERESTHSFVLSSDIIGRDKDREKIIE  178

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM++   E +E++S +PIVG+GGLGKT L +LV+ND RV ++F+ ++W+ V EDF   +
Sbjct  179   LLMQASSGE-SETLSVIPIVGIGGLGKTALAQLVFNDQRVEEHFELKIWMRVFEDFGGRQ  237

Query  795   VIEKILRSATGK------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             ++ +I+ S   +        G L+  QLQ              +L D  N          
Sbjct  238   IMREIMESIIVQIMRKCVFLGDLNTQQLQR-------------ILRDHLNM---------  275

Query  957   ELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNL  1136
                     G+R              G T  YNL GL   DC  LF+KCAF+E+  +  NL
Sbjct  276   --------GTR--------------GGTIGYNLQGLPFEDCLSLFMKCAFKEERDKHPNL  313

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             ++IG+EIV+KCGG+PLAV+ LGS+L  KTD++ W ++R+ EIW++EQ +T IL  L+LSY
Sbjct  314   IKIGEEIVKKCGGIPLAVRALGSLLCGKTDKRNWEYVRDIEIWQLEQMDTGILRALRLSY  373

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             DQ+P HL+QC AYC +FPKG +   +  +  W+A G +QS +  +EL+++G +Y  ELLS
Sbjct  374   DQLPPHLKQCVAYCSIFPKGYQFYGDSLVQFWMAHGLLQSHNKKEELDDIGMRYLKELLS  433

Query  1497  RFCFQDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN  1673
             RF FQD+     G E  + K+H+L+HDL+  VA  E L V S    IP+ V HL F A N
Sbjct  434   RFFFQDLSFGMLGMETFSFKMHDLMHDLSLLVAKDEFLVVNSDCQFIPKKVRHLSFVAAN  493

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
              SR +F   L +L  +R   +S       S++F++  +   + LRVL L    ++  P  
Sbjct  494   ASRNDFSSLLSDLGRVRTIFFSTDDDEKTSQSFIESCISKSQFLRVLDLSGSAIEVCPRE  553

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             +G LK  RYL+LS N  IK LP+ I +L +LQTLNL  C +L+ELP++  + L++L+ L 
Sbjct  554   MGNLKHTRYLDLSKNYKIKKLPKSICELQSLQTLNLAGCLELEELPKDI-RYLVNLRLLA  612

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             LT+++ SLQ+    SLG L+ L +  C   +   E    +  LR L I  C  L  LP  
Sbjct  613   LTTKQKSLQESGIRSLGSLRCLSISSCWNLEHLFEEIDQLSVLRTLSIESCPRLISLPPA  672

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm----------glPKLVSLPAGL  2360
             I++L+ LE L++ +CE LDL++   MEG  S                  + +L+ LP  L
Sbjct  673   IKYLSSLENLYLASCESLDLNLNMEMEGEGSHHDRKNTRPHIRRVFIKEITQLLELPQWL  732

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VR  2537
                    L+ L + GCP   AL + L+N   L+ L I +CP+LS LPE +   +  K + 
Sbjct  733   LQGSTDTLQNLLILGCPNFMALLESLRNFEALEVLVIGNCPKLSSLPEDMHHLTTLKSLA  792

Query  2538  IIDCPLLNG*C  2570
             I  CP L+  C
Sbjct  793   IAGCPALSERC  803



>ref|XP_011038383.1| PREDICTED: putative disease resistance protein RGA3 isoform X5 
[Populus euphratica]
Length=880

 Score =   470 bits (1210),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 338/873 (39%), Positives = 493/873 (56%), Gaps = 26/873 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKELPSSI  1853
              +  P+   N  ++R   ++   VG   KT  KK +  F+ LR L L N  E +  P  I
Sbjct  535   HQTVPKFPNNFHHVRSIVFADSVVGPTCKTDFKKCISEFKHLRSLELTNGSEFEAFPEKI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLN   +  +K LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ LYL
Sbjct  595   GALKHLRYLNFGTSAKLKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RYMISLRFLYL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+Q+  L +     L  LQ L +  C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   TTQQKRLPEGGIGCLECLQTLFIAYCENLEDLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDC  2549
              A  L+   +  C ++  +P+ + N   LQ L I DCP L+    +       KV  I  
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPSLNKRCRKETGEDWPKVAHI--  829

Query  2550  PLLNG*CGDTGTRLSWSS*NIFLYQPREDCLSL  2648
             P +N    D+G   S S  +       ED LSL
Sbjct  830   PKINVDGDDSGEETSHSGSSGTPSAREEDKLSL  862



>gb|KHN14949.1| Putative disease resistance protein RGA4 [Glycine soja]
Length=865

 Score =   470 bits (1209),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 325/852 (38%), Positives = 484/852 (57%), Gaps = 38/852 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++K+ S A  E S    L   L+ L+ TLS +KAVL DA+++Q  NH
Sbjct  1     MAESFLFSIAESLITKLASHAFQEASRVVGLYDHLRDLKKTLSLVKAVLLDAEQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++L+ V YDA D+LD+F   +L +++    G I  +V   F+  + L++R K+ 
Sbjct  61    ELQEWLRQLKSVFYDAQDVLDEFECQTLRKQVVKAHGTIKDEVSHFFSSSNPLVFRSKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHF-KENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I+++  RL+++A DR  F     +  +  +        THS V  S +IGR+ DKE I
Sbjct  121   QQIKDVSKRLDKVAADRHKFGLLIIDVDIRVIHRRDTSRMTHSGVSDSYVIGREHDKEKI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND R+   F  ++WV VS+DF +
Sbjct  181   IELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAKFVFNDKRIDGCFTLKMWVCVSDDFDI  240

Query  789   SKVIEKILRSATGKS--------FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             +++I KI+ SA   +           +D++Q    L   L   ++LLVLDDVWN D+ KW
Sbjct  241   NQLIIKIINSANVVADAPPRQLNLNMVDLEQSLIQLRNKLAHKKFLLVLDDVWNNDRVKW  300

Query  945   KNLRELLMSG-CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
               LR LL  G   GS+++VTTR   +A++ GT T++ L  LS  +   LF+K AF+E +E
Sbjct  301   VELRNLLQEGVAAGSKILVTTRIDSIASMMGTVTSHKLQSLSPENSLSLFVKWAFKEGEE  360

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
              +  +LV IGKEIV+KC GVPLAV+TLGS+L+ K +  EW ++R+NEIW + QK+ DILP
Sbjct  361   EKHPHLVNIGKEIVKKCRGVPLAVRTLGSLLFSKFEANEWEYVRDNEIWNLPQKKDDILP  420

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD  P +LRQCFA   ++PK      +    LW A G + SP  ++  E++  QY
Sbjct  421   ALKLSYDFFPSYLRQCFALFSLYPKDYSFLSDEVAKLWGALGVLASPRKNETPEDVVKQY  480

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +ELLSR   QD ++   G     KIH+LVHDLA  V   ECL V S    IPE++ HL 
Sbjct  481   LDELLSRSFLQDFIDG--GTFYEFKIHDLVHDLAVFVTKEECLLVNSHIQNIPENIRHLS  538

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
             F   N     F    + ++ +  F      G++ ++ +   +  F+  RVL L     + 
Sbjct  539   FAEYNFIGNSFTSKSVAVRTI-MFPNGAEGGSI-ESLLNTCVSKFKLWRVLDLSYSTCET  596

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP SIG LK LRY ++ NN  IK LP  I KL NLQ L++  C++LK LP+   ++L+SL
Sbjct  597   LPHSIGMLKHLRYFSIENNRIIKRLPNSICKLQNLQLLSVRGCKKLKALPKGL-RKLISL  655

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRIY  2177
             + L +T+++  L      +L  L  L +             KFPA        L+ L + 
Sbjct  656   RHLKITTKQPVLPYSEITNLITLAHLSIESSHNMESILGGVKFPA--------LKTLNVS  707

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg----lPKLVS  2345
             +C SL  LP    +  +LE L++ +C  LDL +       +S    L       LP+LV+
Sbjct  708   DCHSLKSLPLDATNFPELETLFVQDCVNLDLDLWMDHHEEQSPMLKLKCVGFWGLPQLVA  767

Query  2346  LPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SS  2522
             LP  L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L    + I   ++
Sbjct  768   LPQWLQET-ANSLQTLFIKNCDNLEMLPEWLSTLTNLKTLAISDCPKLISRLDNIHHLTA  826

Query  2523  NAKVRIIDCPLL  2558
               ++RI  CP L
Sbjct  827   LERLRISGCPEL  838



>ref|XP_006661639.1| PREDICTED: putative disease resistance protein RGA1-like [Oryza 
brachyantha]
Length=827

 Score =   468 bits (1205),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 318/820 (39%), Positives = 503/820 (61%), Gaps = 23/820 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQD----EISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
             MAE  L+    ++L KIVS   +    E  S  ++  EL+KLQ +L +I  VL DA+ +Q
Sbjct  1     MAEVLLSSFAVSILGKIVSFVSEHSLNENKSDISVHKELRKLQKSLQSINGVLLDAERKQ  60

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFT----RPDGL  410
             + +  +K+WL+ L+DVVYD DD+LDD  T +L R++    G++T+ + L          L
Sbjct  61    STSDALKEWLRNLKDVVYDIDDILDDVSTEALKRRVDK--GMVTQTKCLHIYRFKLRRKL  118

Query  411   IYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRD  590
             + +  ++ +IRE+  +LN++A  R++F   +            RE ++SFV  +DIIGRD
Sbjct  119   LRKKILSSRIREVCEKLNEVAIYRKDFGLTDWAMAGQCSEEPQRE-SYSFVYQADIIGRD  177

Query  591   SDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSV  770
               ++ I+  ++++ +  D   +  LP++GLGG+GKT L K+VY++ ++ + F   LW  V
Sbjct  178   DARDEIIREILRASECHD---LFVLPLLGLGGIGKTALAKMVYHNQQIRERFCKILWACV  234

Query  771   SEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKN  950
             S  F+L ++++ I+ SATG+S  HL+++Q+Q+ L G+L +G Y LVLDD+W  + ++W+ 
Sbjct  235   SNKFNLKRILQDIIESATGESCKHLNLEQIQKKLRGILQNGNYFLVLDDMWTHNINEWRE  294

Query  951   LRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRP  1127
             LR LL SG   S +IVTTR   VA++ GT+  Y +  L  H+C  +F + AF++ +E + 
Sbjct  295   LRNLLSSGARASVIIVTTRKYVVASMVGTSNPYKVGALPFHECMQIFTRVAFKQGEENKY  354

Query  1128  RNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              +L++IG+ IV+KC GVPLA+K+LGS+L+   DE +WL ++E+ + KI Q + DI+P+LK
Sbjct  355   PSLLKIGESIVKKCAGVPLAIKSLGSLLFTMRDESQWLRVKEDHLCKIIQGDGDIMPVLK  414

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSY+ +P  L+ C +Y  +FPK  E  R   I LW+A G ++S +   E++ +GNQY  E
Sbjct  415   LSYNALPPALKPCLSYLSIFPKDFEYYRRCIIMLWMAHGLLRSNNLSDEID-VGNQYIVE  473

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             L+    FQD +  FDG +  CK+H++VHDL + V   +   V     E+ E+V HLV+  
Sbjct  474   LIGSSFFQDALITFDGSMPHCKMHDIVHDLGRYVLDTDLAIVNCDGQEVSETVRHLVWDY  533

Query  1668  DNLSRE-EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
              + S E EFP  L+  +  R F  S   G++SK F++  L  F  LRVL++    + ELP
Sbjct  534   KDFSHEQEFPGHLIKARKARTFVSSCNPGSLSKKFLQVLLSKFLLLRVLIISGAWIDELP  593

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
              SIG LK LRY++L+ N +IK LP  I KL+NLQTL+L  C+ L ELPR+   +L+SL+ 
Sbjct  594   DSIGNLKHLRYVDLTWNKSIKFLPNSICKLINLQTLDLYRCDHLIELPRDVN-KLISLRY  652

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L LT ++    +        L +L L+ CS      E    +  L++L I +C  L  LP
Sbjct  653   LSLTCKQKHFPEGGLCGWASLTYLQLHSCSELTSLTEQIGCLTALQMLWISDCPKLPSLP  712

Query  2205  AGIRHLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             A ++HL+ L++L+I NC ELDL +  E M+GL SL++L ++GLPKL  LP  L    +  
Sbjct  713   ASMKHLSALQELFIENCPELDLMNTEEAMDGLWSLRTLQIIGLPKLERLPVTLCSA-SRS  771

Query  2382  LKYLRVAGCPELTALPDWLQNC---TLLQRLYIEDCPELS  2492
             L+YL +  CP+L  + +++Q+    T  +R++I+DCP +S
Sbjct  772   LQYLLIEKCPKLREILNYMQDLAKDTNHRRVFIKDCPGIS  811



>ref|XP_011038387.1| PREDICTED: putative disease resistance protein RGA3 isoform X8 
[Populus euphratica]
Length=871

 Score =   469 bits (1208),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 324/821 (39%), Positives = 475/821 (58%), Gaps = 24/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKELPSSI  1853
              +  P+   N  ++R   ++   VG   KT  KK +  F+ LR L L N  E +  P  I
Sbjct  535   HQTVPKFPNNFHHVRSIVFADSVVGPTCKTDFKKCISEFKHLRSLELTNGSEFEAFPEKI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLN   +  +K LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ LYL
Sbjct  595   GALKHLRYLNFGTSAKLKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RYMISLRFLYL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+Q+  L +     L  LQ L +  C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   TTQQKRLPEGGIGCLECLQTLFIAYCENLEDLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              A  L+   +  C ++  +P+ + N   LQ L I DCP L+
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPSLN  812



>gb|KDO38042.1| hypothetical protein CISIN_1g042863mg, partial [Citrus sinensis]
Length=680

 Score =   463 bits (1192),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 285/673 (42%), Positives = 409/673 (61%), Gaps = 30/673 (4%)
 Frame = +3

Query  576   IIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTR  755
             IIGRD D+E I+  LM++   E +E+VS +PIVG+GGLGKT L +LV+ND RV ++F+ +
Sbjct  1     IIGRDKDREKIIEALMQTSSGE-SETVSVIPIVGIGGLGKTALAQLVFNDQRVEEHFELK  59

Query  756   LWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
             +W+ +SEDF   +++ KI++S TG++ G LD++QLQ  L   L   RYLLV+DDVWNED 
Sbjct  60    IWICISEDFGERQIMTKIIKSITGQNQGDLDIEQLQRILRVCLNGKRYLLVMDDVWNEDP  119

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAF  1106
               W  L+ LL  G  GS+++VTTRS KVA++ GT   TT YNL GL   DC  LF+KCAF
Sbjct  120   KVWDKLKSLLSGGAKGSKILVTTRSNKVASVMGTRGGTTGYNLQGLPLEDCLSLFMKCAF  179

Query  1107  REQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
             +E+  +  NLV+IG+EIV+KCGG+PLAV+TLGS+LYC TDE +W ++R+NEIWK+EQK  
Sbjct  180   KEERDKHPNLVKIGEEIVKKCGGIPLAVRTLGSLLYCSTDEHDWEYVRDNEIWKLEQKAN  239

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
             DILP+L+ SYDQ+P  L+QC AYCC+FPK  +      +  W+AQG +   + + EL+++
Sbjct  240   DILPVLRFSYDQLPPRLKQCVAYCCIFPKDYQFSSVYLVQFWMAQGLLHPLNENDELDDI  299

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
             G +   +L SR  F D+V  F  E+   K+H+L+HDLAQ VA  E L   S    IP+ V
Sbjct  300   GMRSLKQLCSRSFFHDLVRGF--EMFTFKMHDLIHDLAQLVAKGEFLIGNSDSQSIPKRV  357

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
              HL F   N SR++F + L +L  +R   +S     VS++FV+  +   + LRVL L   
Sbjct  358   RHLSFVGANASRKDFSRFLSDLGRVRTIFFSINDEKVSQSFVRSCISKSQFLRVLNLSGS  417

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
              ++ LP  IG LK +RYL+LS N  IK LP  I +L +LQTLNL  C +L+ELP++  + 
Sbjct  418   AIEALPKEIGNLKHMRYLDLSRNYKIKKLPNAICELQSLQTLNLEECLELEELPKDI-RY  476

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECS  2186
             L+SL+   +T+++ SLQ      L  L+ L++  C   ++  +    ++ LR L I  C 
Sbjct  477   LVSLRVFEVTTKQKSLQDSGIGCLVSLRCLIISHCRNLEYLFDDIDQLRVLRSLLIAGCP  536

Query  2187  SLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKD  2366
              L  LP  +R+L+ LE L    CE L L++   +EG  S Q+                 +
Sbjct  537   CLISLPPAMRYLSSLETLMFVECESLSLNLSMQLEGEGSHQA----------------SN  580

Query  2367  IDAMKLKYLRVAGCPELTALPDW-----LQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK  2531
                  L+ L +     L  LP W     L+N   L+ L I +CP+L  LPE +      +
Sbjct  581   TTRPHLRKLLIGQVTPLLELPQWLLQESLRNFQALEGLVIGNCPKLLSLPEDMLHLKTLR  640

Query  2532  VRIIDCPLLNG*C  2570
             +R   CP L+  C
Sbjct  641   IR--GCPALSDRC  651



>ref|XP_011038386.1| PREDICTED: putative disease resistance protein RGA3 isoform X7 
[Populus euphratica]
Length=873

 Score =   469 bits (1208),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 324/821 (39%), Positives = 475/821 (58%), Gaps = 24/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKELPSSI  1853
              +  P+   N  ++R   ++   VG   KT  KK +  F+ LR L L N  E +  P  I
Sbjct  535   HQTVPKFPNNFHHVRSIVFADSVVGPTCKTDFKKCISEFKHLRSLELTNGSEFEAFPEKI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLN   +  +K LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ LYL
Sbjct  595   GALKHLRYLNFGTSAKLKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RYMISLRFLYL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+Q+  L +     L  LQ L +  C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   TTQQKRLPEGGIGCLECLQTLFIAYCENLEDLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              A  L+   +  C ++  +P+ + N   LQ L I DCP L+
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPSLN  812



>ref|XP_011038379.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Populus euphratica]
 ref|XP_011038380.1| PREDICTED: putative disease resistance protein RGA3 isoform X2 
[Populus euphratica]
 ref|XP_011038381.1| PREDICTED: putative disease resistance protein RGA3 isoform X3 
[Populus euphratica]
Length=882

 Score =   469 bits (1207),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 324/821 (39%), Positives = 475/821 (58%), Gaps = 24/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN-LELKELPSSI  1853
              +  P+   N  ++R   ++   VG   KT  KK +  F+ LR L L N  E +  P  I
Sbjct  535   HQTVPKFPNNFHHVRSIVFADSVVGPTCKTDFKKCISEFKHLRSLELTNGSEFEAFPEKI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLN   +  +K LP+ I KL NLQ   L+  E L+ELP++  + ++SL+ LYL
Sbjct  595   GALKHLRYLNFGTSAKLKRLPKSIFKLQNLQA--LVTGEGLEELPKDV-RYMISLRFLYL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+Q+  L +     L  LQ L +  C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   TTQQKRLPEGGIGCLECLQTLFIAYCENLEDLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              A  L+   +  C ++  +P+ + N   LQ L I DCP L+
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPSLN  812



>gb|KCW75022.1| hypothetical protein EUGRSUZ_E03801, partial [Eucalyptus grandis]
Length=807

 Score =   467 bits (1201),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 319/846 (38%), Positives = 485/846 (57%), Gaps = 51/846 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  + + VL KI S A  E  + ++++ ++  L+NTL+ I AVL DA+EQQAKNH
Sbjct  1     MAESFLFSVAQGVLGKIASSAFQEAVAIYSIEDQIHDLKNTLAAITAVLLDAEEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS-CSGILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +LRDV+YDA+D+LD+    +L +++ S   G+  KV +  +  + +I R KI+
Sbjct  61    SLQLWLGRLRDVLYDAEDVLDELECEALRKRVISQYGGVKEKVHRFCSLSNPVILRAKIS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR  L++I+ ++  F        N + + + RE T+SF+   D++GRD +K+ I+
Sbjct  121   HKIKEIRETLSKISIEKNQFDLNVQSVDNGMGHSRSREMTYSFINKLDVVGRDVNKQKII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LM+S    D +++S +PIVG+GGLGKT L KLVYNDD V   F++RLWV V EDF L 
Sbjct  181   EILMQS----DNKNLSVIPIVGIGGLGKTALAKLVYNDDSVKAQFESRLWVCVPEDFDLK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             + I+ I++  TG +  +LD+ Q Q  L   +   ++LLVLDDVW+ ++ +W+ L+ LL  
Sbjct  237   RTIDGIIKDVTGGNLSNLDIQQSQTFLRDTIKDKKFLLVLDDVWSNNRSRWEELKALLTE  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G  GS++IVTTRS++VA++ GT   +NL GL   D   LF K AF ++E +P  +L++IG
Sbjct  297   GAHGSKIIVTTRSLEVASMMGTHPTHNLEGLCHEDSMALFKKWAFDQKEKQPCPDLLDIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+KC GVPL VKTLGS+LY K ++  W HIR++EIWK+ +++ D+LP+LKLSYD +P
Sbjct  357   NDIVKKCQGVPLLVKTLGSLLYTKDEKWHWAHIRDSEIWKLVEQKKDVLPVLKLSYDHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL++CFA   +F KG EI       LW+A G +     +  LE++  +Y NEL  R   
Sbjct  417   SHLKRCFATLSLFGKGSEIYSFKTAWLWMALGLVSLTGEEVALEDIVVEYINELWKRSLI  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL---S  1679
             Q   E FD  + + K+H+LVH LA  VA  +C +V     EI E V  + F   +L   S
Sbjct  477   QLEDEWFDFTLSSFKVHDLVHSLATIVAQNDCSSVDLDTAEIFEGVRKVSFSGTSLPGIS  536

Query  1680  REEFPQPLL---NLKNLRYFAYSFRV--GTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K LR   +S  +    V++ F +  +     LR L L+    ++LP
Sbjct  537   NFDGVPPFLRKPTSKRLRAIMFSSEIYGQYVTREFARTCISKCNNLRHLDLKYGIFEKLP  596

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             SSI  LK LR L +S+N  +K LP+ I  L +L+ L +  C +L +LPRN   +L+SL+ 
Sbjct  597   SSICNLKHLRTLIISSNNRLKKLPDTICDLQSLEVLEVTGCLELGDLPRNM-NRLVSLRF  655

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L++T+++ +LQ      L  LQ L L +C   +   +    +  LR L I +C     LP
Sbjct  656   LHITTKQKNLQDTGIQYLENLQILALLRCPNLEVLFQGTCRLTHLRRLAIMDCEKPIFLP  715

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKL  2384
                  L  L  L I  C+ +                   +      + P+ L+       
Sbjct  716   --FVELIDLHTLQISKCKLM-------------------LTKENKSNFPSNLQ-------  747

Query  2385  KYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLLN  2561
                    CP L A+P+WL N T L+ +Y+ +CP L  +P+ I S +  K + I +C  L+
Sbjct  748   -------CPSLVAIPEWLLNHTRLKVIYLAECPNLLSMPQGISSLTALKELGITNCGELS  800

Query  2562  G*CGDT  2579
               C  T
Sbjct  801   KRCRPT  806



>ref|XP_007210348.1| hypothetical protein PRUPE_ppa001712mg [Prunus persica]
 gb|EMJ11547.1| hypothetical protein PRUPE_ppa001712mg [Prunus persica]
Length=775

 Score =   465 bits (1196),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 320/748 (43%), Positives = 453/748 (61%), Gaps = 32/748 (4%)
 Frame = +3

Query  81    ETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEV  260
             E+F  ++ E VL ++ S A  EI  A ++K +L KLQ TLSTI  V+ DA+E+Q K+  +
Sbjct  2     ESFSFNVVEKVLERLASHAYHEIRLALDVKDDLIKLQETLSTIAKVVLDAEEKQRKDPLL  61

Query  261   KDWLQKLRdvvydaddllddFGTLSL-LRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
              DWL KL+DV YD DD+LD F    L ++ L S S +  KVR  F+RP+  +  +KI  +
Sbjct  62    ADWLGKLKDVCYDMDDVLDQFEFRKLRMQVLNSRSNVKGKVRNFFSRPNSFMLSYKIGQR  121

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKES-IVG  614
             I++IR RL +IA  +  F+  E       +   +  +THSFV   D+IGRD DKE  I+ 
Sbjct  122   IKDIRERLGEIAAAKAQFNLYER--AADWQGMHIERETHSFVHAPDVIGRDKDKEEMIMH  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L  +      E+VS + I GLGGLGKTTL KLVYND+RVV NF+ R+WV VS+DF   +
Sbjct  180   LLNDNRTGHGEENVSVISINGLGGLGKTTLAKLVYNDNRVVGNFELRIWVCVSDDFDNKR  239

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED-----QHKWKNLRE  959
             ++ +I+ +AT +      ++Q+Q  L   L   + LLVLDDVW++        KW +L+ 
Sbjct  240   LLREIVTAATSQKCVDESIEQMQIKLRHALTCKKLLLVLDDVWDKGPMGITMKKWIDLKS  299

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEYRPRN  1133
             LL    +GS++IVTTR+  VA + G    + L GL   DC  +F+K AF  REQ   P+ 
Sbjct  300   LLNVVANGSKIIVTTRNESVALLMGHAHMHLLKGLPHSDCMTIFIKVAFTKREQGDYPK-  358

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             L++IG++IV+KCGGVPLA+ TLG +LY   DE+ W H+R+++IWK+EQ   DILP LKLS
Sbjct  359   LIKIGEDIVRKCGGVPLALYTLGGLLYSNKDERYWSHVRDSDIWKLEQGSDDILPALKLS  418

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSP--DGDQELENLGNQYFNE  1487
             YD +P +L+ CFA+C ++PK         I L +A+GFIQS   +G+QELE++G  Y  +
Sbjct  419   YDALPIYLKPCFAFCSLYPKDYVFRSAELIPLLMAEGFIQSSKGNGNQELEDIGLDYIRQ  478

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAE--CLNVKSGDPEIPESVHHLVF  1661
             L SR+ FQ  +E  D   L  ++H+LVHDLA S+A  E   LN +  D    + V H+  
Sbjct  479   LCSRYFFQ--IEEDDFLFLRFRMHDLVHDLAISMARVEYSSLNFRPSDSS--KMVRHVSI  534

Query  1662  HADNLSR--EEFPQPLLNLKNLRYF--------AYSFRVGTVSKTFVKKTLLNFRRLRVL  1811
                +LS+  EE P+ LL L+ LR              +VG  S++F+KK +     LRVL
Sbjct  535   SQKDLSKENEENPKFLLRLEKLRTILIPDLDSEYVPIKVGINSQSFLKKCISRINYLRVL  594

Query  1812  MLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPR  1991
              L NL LK LP SIG L  LRYL++S N +I  LP+ I KL +LQ+L LINC +LKELP+
Sbjct  595   DLSNLTLKVLPCSIGNLSHLRYLDVSYNQHINKLPDSICKLHHLQSLLLINCGKLKELPK  654

Query  1992  NFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLR  2171
             + G  L+SL+ L LT ++  L + +  S   L+ L L  C+  +   E +Q+   L+ L+
Sbjct  655   DMG-NLISLRYLALTIKKTHLPE-AIESANTLKTLQLGFCTYLQSLPEWFQNFPSLQKLK  712

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNC  2255
             I  CS L  LP G+  L  L +L I NC
Sbjct  713   ITNCSHLFALPEGMDRLTALRELEISNC  740



>gb|AGT75398.1| CC-NBS-LRR disease resistance protein [Cicer arietinum]
Length=872

 Score =   468 bits (1203),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 326/855 (38%), Positives = 487/855 (57%), Gaps = 46/855 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE    D  E +L K+ S A  E+S A+ +  +L+ +++TL+ ++ +L DA+E++ + H
Sbjct  1     MAEAIAFDAAELLLRKLTSYAYQEVSRAYGVYKDLRVIKDTLTIVRCLLLDAEEKKNQQH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLS----LLRKLRSCSGILTKVRKLFTRPDGLIYRF  422
              +++WL++ +++  DA+D+L+ F        +++  RS S    KVR  F+  + L +R 
Sbjct  61    ALREWLRQTQNICSDAEDVLEGFDLQDKRKQVIKDSRSTS---MKVRHFFSSSNPLAFRI  117

Query  423   KITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
             K+  +I++IR RL+++A D   F       V P      RE T+  V  S +IGR+SD+E
Sbjct  118   KMARQIKDIRNRLDKVAYDGTRFGL-ATINVEPGLVVHRREMTYPDVDASSVIGRESDRE  176

Query  603   SIVGMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS  773
              I+ +LM+     D++  +S+  +PIVG+GGLGKTTL KLV+ND RV Q F  ++W  VS
Sbjct  177   EIIKLLMQPHPHGDDDGDKSMCVIPIVGIGGLGKTTLAKLVFNDKRVDQLFQLKMWACVS  236

Query  774   EDFSLSKVIEKILRSATGKSFG----------------HLDMDQLQEHLNGVLCSGRYLL  905
              DF + ++I KI+ SA+   F                 +LD+ QL   L   +   ++LL
Sbjct  237   NDFDIRQIIIKIVNSASTSKFASTSASSVTFPHQENINNLDIVQLVSCLRSKISGQKFLL  296

Query  906   VLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFD  1085
             VLDD+WN+D+ KW  L++L+  G  GS+++VTTRS  ++++ GT  +Y L GLS  +C  
Sbjct  297   VLDDIWNDDRAKWTELKDLIKVGTVGSKMMVTTRSKSISSMMGTVPSYVLHGLSVENCLF  356

Query  1086  LFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEI  1262
             LF+K AF+E +E +  NLV IGKEIV+KC GVPLAVKTLGS L+ K D  +W  +R++EI
Sbjct  357   LFVKSAFKEGEEEKFPNLVAIGKEIVKKCHGVPLAVKTLGSSLFSKFDLNKWKFVRDSEI  416

Query  1263  WKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPD  1442
             W +EQK+ DILP LKLSYDQMP +LR CFAY  ++PK          +LWVA G +Q  +
Sbjct  417   WNLEQKKDDILPALKLSYDQMPSYLRHCFAYFSLYPKDFTFLAGDITSLWVALGLVQPRN  476

Query  1443  GDQELENLGNQYFNELLSRFCFQDVVEAFD--GEILACKIHNLVHDLAQSVAGAECLNVK  1616
             G++ LEN+  +Y +EL SR    D    FD  G     K+H+LVHDLA  VA  EC+ V+
Sbjct  477   GNENLENVAREYIDELHSRSFLLD----FDDIGHFFNFKVHDLVHDLALYVAKEECVLVQ  532

Query  1617  SGDPEIPESVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYSF-RVGTVSKTFVKKTLLN  1790
             S    IPE   HL +F  D+L    F    L  K +R   +   RVG    + +   +  
Sbjct  533   SNTRNIPEQARHLSIFENDSLGHALF----LKSKQVRTILFPIDRVGLDRDSLLDTWVSR  588

Query  1791  FRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCE  1970
             ++ LR+L L +  +  LP SI  L+ LR LNL+NNC IK LP  I KL+NLQ L L  C 
Sbjct  589   YKYLRILDLSDSSMVTLPISIAKLEHLRVLNLTNNCKIKRLPHSICKLLNLQVLLLTGCM  648

Query  1971  QLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHM  2150
             +L+ LP   G +L+SL+ L++T+++  L +    S   L  L  Y+C   KF     + +
Sbjct  649   ELETLPNGLG-KLISLRQLFITTKQFVLPQNEFASFKHLHTLDFYRCDNLKFLFNGTRQL  707

Query  2151  KKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmg  2327
               +  L +  C SL  L   +    KL+ L++ +C+ L +S+          ++ L L  
Sbjct  708   TFVETLSVQSCGSLESL--SLYSFPKLQTLYLADCKMLTMSLNNESPIQRMPMRHLYLEE  765

Query  2328  lPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQ  2507
              P L++LP  +  I A  L+ L +   P L  LP      T L+RL I  CP+LS LP  
Sbjct  766   FPGLLTLPRWIVGI-ADTLETLVITKFPNLKMLPKCFTALTHLKRLDIRHCPQLSTLPND  824

Query  2508  I-RSSSNAKVRIIDC  2549
             I R ++   +RI  C
Sbjct  825   IQRLTALEDLRIYRC  839



>ref|XP_003616167.1| Disease resistance protein RGA2 [Medicago truncatula]
 gb|AES99125.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=856

 Score =   466 bits (1198),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 330/849 (39%), Positives = 493/849 (58%), Gaps = 40/849 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + K+ S+A ++ S    +   L++++NT+S IKAVL DA++ Q +NH
Sbjct  1     MAESLLFGVAESFIEKLASVAVEKASLTLGVYDNLQEIKNTVSLIKAVLLDAEQTQWQNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++++ V YDA+D++DDF   +L + + + SG I  KV++ F+  + L+YR K+ 
Sbjct  61    ELREWLKQIKRVFYDAEDVIDDFECEALRKHIINTSGSIRRKVKRFFSNSNPLVYRLKMV  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ I+ R +++A DR  F  + N   N V   K RE THS+V  SD+IGR  DK+ I+
Sbjct  121   HQIKHIKERFDKVAADRLKFGLQINDSDNRVV--KRRELTHSYVNDSDVIGRKHDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+   D  D+ S+S +PIVG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  179   NQLL--LDSGDSNSLSVIPIVGIGGLGKTTLSKAVFNDKSLDETFSLKMWVCVSDDFGLK  236

Query  792   KV------IEKILRSATG------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
              +         +  SATG       ++ + D++QLQ HL   +   ++LLVLDDVWN+D+
Sbjct  237   NLLLKILNAASVSGSATGPNPIHQANYTNHDLNQLQNHLRNEIAGKKFLLVLDDVWNQDR  296

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAY--NLSGLSDHDCFDLFLKCAFR  1109
              KW  L+ L+  G +GS+V+VTTRS  +A + GT T+Y   L GLS  D   +F+K AF+
Sbjct  297   VKWVELKNLIQVGAEGSKVLVTTRSHSIAKMMGTNTSYILELKGLSPEDSLSVFIKWAFK  356

Query  1110  EQEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
             E E +    L++IGKEIVQKCGG+PLA++T GS L+ K D +EW  IR++EIW + QKE 
Sbjct  357   EGEEKNYPELMKIGKEIVQKCGGLPLALRTSGSSLFLKVDVEEWKFIRDSEIWNLPQKED  416

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
             DILP +KLSYDQ+P +L++CF    +F K           LW   G +  P+  + LE  
Sbjct  417   DILPAIKLSYDQLPSYLKRCFTCFSLFQKDFTFTNMDVRMLWEVLGVLLPPNRGKTLEGT  476

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
               Q   EL SR   QD V+ F G I   K+H+LVHDLA  VA  E   ++  +  I E+V
Sbjct  477   SIQLLQELWSRSFLQDFVD-FGGGICTFKLHDLVHDLAVYVARDEFQLIEFHNENILENV  535

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
              HL F  ++L     P P      LR   +        K F+K      + LR+L L + 
Sbjct  536   LHLSFIKNDLLGVT-PVP----TGLRTMLFPEEAN--DKAFLKTLASRCKFLRLLQLADS  588

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
             + + LP SIG LK LRYLNL N+  +KSLP  + KL NL TL+L  C +L+ LP   G  
Sbjct  589   KYESLPRSIGKLKHLRYLNLKNSKELKSLPNSLCKLQNLHTLDLDGCIELQTLPNGIG-N  647

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQ-FLLLYKCSCRKFPAEIWQ--HMKKLRVLRIY  2177
             L+SL+ L +T+++ +L ++    L  L+ F + Y   C      +++   +  L+ L I+
Sbjct  648   LISLRQLVITTKQYTLPEKEIAKLTSLERFDVTY---CDNLETLLFEGIQLSNLKSLYIH  704

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPA  2354
              C +L  +P  +  +  LE L+I NC +L LS     +     L+ L L  LP+LVS+P 
Sbjct  705   SCGNLKSMPLHV--IPNLEWLFITNCHKLKLSFHNDNQIPKFKLKLLTLRSLPQLVSIPK  762

Query  2355  GLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-  2531
              L++  A  L+ L +  C  +  LP+WL     L +L I +CP+L  LP+ I      + 
Sbjct  763   WLQEC-ADTLQTLAIVDCENIDELPEWLSTLICLNKLVIVNCPKLLSLPDDIDCLPKLED  821

Query  2532  VRIIDCPLL  2558
             + I DCP L
Sbjct  822   LSIYDCPEL  830



>ref|XP_004306372.1| PREDICTED: disease resistance protein RGA2-like [Fragaria vesca 
subsp. vesca]
Length=939

 Score =   468 bits (1204),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 332/855 (39%), Positives = 483/855 (56%), Gaps = 28/855 (3%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F   I ENVL ++ S A  E+S AW  + EL KL  TLSTI  VL+DA+++Q KN  +  
Sbjct  3     FATSIAENVLERLASYASQEVSLAWGAQLELTKLTKTLSTINLVLQDAEKKQVKNLLITH  62

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSG--ILTKVRKLFTRPDGLIYRFKITHKI  440
             WL KL+DV YD DD+LD+     L +K+ + +   +  +VR  F+R +  ++ FK+ HK+
Sbjct  63    WLGKLKDVCYDVDDVLDELEFRKLRKKVLANNHGRVKGQVRHFFSRWNPTVFNFKMGHKV  122

Query  441   REIRGRLNQIAEDRRNFHFKENYYV---NPVENGKLREQ--THSFVRPSDIIGRDSDKES  605
             +EIR RL +I  ++R F   E   +   + V  G    Q  T S V  S++IGRD DKE 
Sbjct  123   KEIRERLVEIDNEKRQFALVEVPKIAEDHSVPQGMQYNQRETDSLVEASEVIGRDDDKEL  182

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I   L+   D  + E+VS + I+G+GGLGKTTL KLVYND  V +NF+ ++WV VSE+F 
Sbjct  183   IFSHLLHDTDISNEENVSVISILGMGGLGKTTLAKLVYNDSVVEENFEVKMWVCVSENFE  242

Query  786   LSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWKN  950
             +  +I KI+ +AT +      +D+++  L   L   ++LLVLDDVW+ +       KW  
Sbjct  243   VKSLILKIINAATDQKCEDESLDRMKRRLQDTLRGRKFLLVLDDVWDTESIGVTPEKWLG  302

Query  951   LRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRP  1127
             L+ LL  G +GSR++VTTR+  VA +      ++L GL    C  LF+K AF++ +E R 
Sbjct  303   LKSLLCVGANGSRILVTTRNRSVALLVNPLYMHSLKGLPHKKCMFLFIKRAFKKGEEQRY  362

Query  1128  RNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              +L+ IG++IV KCGGVPLAV TLGSMLY   +   WL +R++++W I     +ILP LK
Sbjct  363   PHLIGIGEDIVNKCGGVPLAVATLGSMLYLNREPDRWLSVRDDDMWSI--GNDNILPALK  420

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSYD +P HL+ CFA+C +FPK  E   E  ++LWVAQG++++   +++L  +G  Y  +
Sbjct  421   LSYDALPQHLKPCFAFCSLFPKDFEYYSESLVDLWVAQGYLKTCKKNEDLGKMGMDYIRQ  480

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
               SR  FQ  VE     I+  K+H+LVHD+A SVA  E   V        E V H+    
Sbjct  481   FCSRSLFQ--VEGDFKTIMIFKMHDLVHDIAISVAQTEYSTVNFRPSSAFEMVRHVSISD  538

Query  1668  DNLSREE--FPQPLLNLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
              +L  +E   P  +     LR F    R G  +++ FVK  +  F+ +RVL L    L++
Sbjct  539   KDLLGQEAQVPDFIFKSTKLRSFLIPSRAGKMMNQRFVKTCISRFKYMRVLDLSGWPLEK  598

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LPSSIG L  LR+L+L +N  IK LP  I  L+NL++LN+  C  L+E+P++ G  L++L
Sbjct  599   LPSSIGSLFHLRFLDLRSNDKIKRLPNSICNLLNLESLNIGMCTALEEIPKDIG-NLINL  657

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTC  2198
             ++L +T+Q+  L K  S  L  +Q L    C       E  + +  LR L I +C +L  
Sbjct  658   RSLVITTQQKYLPKGIS-RLTSIQLLYFVGCDNLMTLGEEIRFLTNLRKLMITKCENLES  716

Query  2199  LPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAM  2378
             LP  ++ L  L  L+I  C++LDL              L       L  LP  L+D  A 
Sbjct  717   LPPNMKLLTALHVLYIDECKKLDL---MKTRESPQGLRLFAFFTSDLEVLPPWLED-SAK  772

Query  2379  KLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RSSSNAKVRIIDCPL  2555
              L+ + V  C  LT LP+ LQ  T L++L IE C  LS LP+ + R +   +++I DCP 
Sbjct  773   VLQSIVVKECHNLTELPE-LQKFTFLEQLVIERCSNLSALPQGLHRLTELRELKIQDCPK  831

Query  2556  LNG*CGDTGTRLSWS  2600
             L+  C        WS
Sbjct  832   LSKSCKRQLKGEDWS  846



>gb|KEH23636.1| NBS-LRR disease resistance protein [Medicago truncatula]
Length=1335

 Score =   478 bits (1230),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 325/869 (37%), Positives = 493/869 (57%), Gaps = 54/869 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+F+ D+  ++L K+ S A +E S A+ +  +L+++++TLS ++ +L DA+E++ + H
Sbjct  3     MVESFVFDVANSLLGKLASYAYEEASRAYGVYEDLQRIKDTLSIVRGLLLDAEEKKNRQH  62

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              + +WL++++++ YDA+D+LD F      ++    SG    KV   F+  + L +RF+++
Sbjct  63    ALCEWLRQIQNICYDAEDVLDGFELQDRRKQFVEASGSTRLKVCHFFSSSNPLAFRFRMS  122

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I+EIR RL+++A D   F      +V P  +   RE T+S +  S +IGR++DKE+I+
Sbjct  123   RQIKEIRDRLDKVAADGTKFGLVR-IHVEPGLSVHNREITYSHIDVSSVIGRENDKEAII  181

Query  612   GMLMKSCDE---EDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM S  +       S+  +PIVG+GGLGKTTL KLVYND R+ + F  ++W  VS DF
Sbjct  182   ELLMDSDPQGYGNGHRSLCVIPIVGIGGLGKTTLAKLVYNDKRIDEVFQLKMWACVSVDF  241

Query  783   SLSKVIEKILRS-----------ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNE  929
              + +++ KI+ S           A  +   H D++QLQ HL   L   +++LVLDDVWN+
Sbjct  242   DIRQIVIKIINSVFASAAPSVPIAPQEDSNHCDIEQLQIHLRRKLSGQKFILVLDDVWND  301

Query  930   DQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR  1109
             D+ KW  L +L+  G  GS++IVTTRS  VA++ GT  +Y L GLS  DC  LF+K AF+
Sbjct  302   DRAKWIELEDLIKVGAVGSKIIVTTRSNSVASMMGTVPSYVLEGLSLEDCLSLFVKWAFK  361

Query  1110  E-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
             + +E +  NLVEIGKEIV+KC GVPLAV+T+GS L+ K D  +WL +R++EIW +EQK+ 
Sbjct  362   DGEEEKYPNLVEIGKEIVKKCAGVPLAVRTVGSSLFSKFDLDKWLFVRDHEIWNLEQKKD  421

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
             DILP LKLSYDQMP +LRQCFA   ++PK           LW+  G +Q  +G ++LE++
Sbjct  422   DILPALKLSYDQMPSYLRQCFACFSLYPKDYTFNIVEMTILWIPLGLVQPINGSEKLEHI  481

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
               +Y +EL SR   QD  +   G I   ++H+L+HDLA  VA  E + V S    I E  
Sbjct  482   AREYVHELHSRSLLQDFKDF--GYICEFRVHDLIHDLAMYVAKEEFVMVVSRTRNISEQA  539

Query  1647  HHL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQ  1820
              HL +   D+L +  FP+     K++R   +    VG  ++T V   +  ++ LR +   
Sbjct  540   KHLSIVEKDSLDKVLFPKS----KSVRTILFPVEGVGLDNETLVHTWVSKYKYLRYVDFN  595

Query  1821  NLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG  2000
             +   + LP SI  ++ LR L L NN  IK LP  I KL NLQ L L  C +L+ LPR  G
Sbjct  596   DSLFETLPKSIAKVEHLRVLGLKNNSKIKKLPHSIFKLYNLQVLILSGCTELETLPRGLG  655

Query  2001  QQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYE  2180
              +++SL+ L++T+++  L     ++L  LQ L    C   KF       +  L  L +Y+
Sbjct  656   -KMVSLQHLFITTKQSVLSLTEFINLKHLQVLAFNHCKNMKFLFSRAHQLISLETLSLYK  714

Query  2181  CSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLVSLPA-  2354
             C SL  LP  I     L+ L I +C+ LDLS+          L+ L +   P L++LP  
Sbjct  715   CGSLETLPLYI--FPNLQTLIIIDCKMLDLSLNNESPIQKLRLKHLFIRDFPGLLTLPGW  772

Query  2355  -----------------GLKDIDA-----MKLKYLRVAGCPELTALPDWLQNCTLLQRLY  2468
                               LK +         LK L + GCP+L +LP  + + T L+ L 
Sbjct  773   IEGAAETLETLLIYELPNLKTLSQRLTTLTHLKRLHIVGCPQLISLPSDMYHLTALEDLV  832

Query  2469  IEDCPEL--SYLPEQIRSSSNAKVRIIDC  2549
             IEDCPEL   + P+      N  + + DC
Sbjct  833   IEDCPELCRKFKPQSESRKRNEDIDLEDC  861


 Score =   285 bits (729),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 248/395 (63%), Gaps = 18/395 (5%)
 Frame = +3

Query  348   LRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVE  527
             +++      KV  LF+  + L +RF+++HKI+EIR RLN++A D   F       V P  
Sbjct  928   VKASGSTRMKVCHLFSSSNPLAFRFRMSHKIKEIRDRLNKVAADGTRFGLVR-IDVAPDP  986

Query  528   NGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKS---CDEEDTESVSFLPIvglgglgkt  698
               + RE THS+V  S +IGR++D+E I+ +LM+     D +  +++  +PIVG+GGLGKT
Sbjct  987   VVQRREFTHSYVDASSVIGRENDREEIIKLLMQPHPHGDGDGDKNLCVIPIVGIGGLGKT  1046

Query  699   tlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKS-------------FG  839
             TL +LV+ND R+   F  ++WV VS DF + ++I KI+ SA   +               
Sbjct  1047  TLARLVFNDKRIDDIFQLKIWVCVSNDFDIRRIIIKIINSAFASASTPPSVAMANQEDIN  1106

Query  840   HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKV  1019
             H D++QLQ  L   L   +++L+LDD+WN+D+ KW  L  L+  G + S+VIVTT S  +
Sbjct  1107  HFDIEQLQIRLRHKLSGQKFILILDDIWNDDRAKWIELLNLIKVGGEESKVIVTTCSNSI  1166

Query  1020  ATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKT  1196
             A++  T  +Y L GLS   C  LF+K AF++ +E +  NLVEIGKEIV+KC GVPLAVKT
Sbjct  1167  ASMMSTVPSYILEGLSQESCLYLFVKWAFKDGEEEKYSNLVEIGKEIVKKCAGVPLAVKT  1226

Query  1197  LGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKG  1376
             LGS L  K D  +W+ +R++EIW +EQK+ DILP LKLSYD+MP +LR CFAY  ++PK 
Sbjct  1227  LGSSLLSKFDLNKWIFVRDHEIWNLEQKKGDILPALKLSYDEMPSYLRHCFAYFSLYPKD  1286

Query  1377  EEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
                       LW+A G +QS +G ++LEN+  +Y 
Sbjct  1287  YSFSIVEITCLWIALGLVQSLNGSEKLENIAIEYI  1321



>ref|XP_011038385.1| PREDICTED: putative disease resistance protein RGA3 isoform X6 
[Populus euphratica]
Length=880

 Score =   466 bits (1198),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 321/819 (39%), Positives = 475/819 (58%), Gaps = 22/819 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E +   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EDEGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK  +      +  W+A G I QS + +++LE++G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDIKFADLELVQFWMAHGLILQSSNPNEKLEDIGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD +  + G   + K+H+L+HDLA S+A  E L + S + +I ++  HL V  +D+  
Sbjct  477   FFQDYLHGWFGA--SFKMHDLMHDLASSLAQNEFLIISSRNHQISKTTRHLTVLDSDSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVL-MLQNLELKELPSSI  1853
              +  P+   N   +R   ++   VG   KT  +K LL F+ LR L +L + E +  P  I
Sbjct  535   HQTLPKFPNNFHQVRSIVFADSIVGPPCKTDFEKCLLEFKHLRSLELLYDSEFEAFPQRI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRY++  NN  +K LP+ I KL NLQ   L   + L+ELP++  + ++SL+ L+L
Sbjct  595   GALKHLRYIHFGNNTKMKRLPKSIFKLQNLQA--LFTGDGLEELPKDV-RYMISLRFLFL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
              +++  L +     L  LQ L + +C   +   E  + +K LR L I  C SL  LP  I
Sbjct  652   VTKQKRLPEGGIGCLECLQTLFIVRCENLENLCEDMKGLKSLRKLAIGRCDSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKDIDA  2375
             + L  L++L+I  CE+LDL   E  +  +     L         LP  ++LP       A
Sbjct  712   KCLTTLKELYIKECEKLDLMTIEEEKKEKIQSLSLSLRIIIFEKLPATLALPKQFLQGSA  771

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               L+   +  CP +  +PD +     LQ L I DCP L+
Sbjct  772   ESLQTFIIRYCPNIEEMPDCIGKLKKLQNLEISDCPSLN  810



>ref|XP_011001928.1| PREDICTED: disease resistance protein RGA2-like [Populus euphratica]
Length=837

 Score =   464 bits (1195),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 326/817 (40%), Positives = 478/817 (59%), Gaps = 29/817 (4%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F  +I ENV+ K+ SL  +E S A   + ELKKL++++  IK VL DA+E+++ + E + 
Sbjct  4     FSLNIAENVVEKLCSLESEETSLACCNEDELKKLKHSMLVIKDVLIDAEEKRSNSPEPRL  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKITHKIR  443
             WL++L  V YDA+D+LD+    +L R++       T KV + F+  + LI+R  I  K++
Sbjct  64    WLKQLNHVFYDAEDVLDELEVENLRRQVIDRGNFYTRKVLRCFSSANPLIFRSTIGRKLK  123

Query  444   EIRGRLNQIA----EDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              I  R + IA    E R     +E   +N  E G     THS+V  +DIIGRD DKE I+
Sbjct  124   RINERFDAIAAGNVESRLTERAEERRPLNR-ERG-----THSYVHSADIIGRDEDKEKII  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+   DEE+   +S LPIVG+GG+GKTTL K+ YND+RVV++F  ++WV VS DF   
Sbjct  178   QLLLHPSDEEN---ISVLPIVGVGGMGKTTLAKMAYNDERVVKHFQFKMWVYVSRDFDKK  234

Query  792   KVIEKILRSATG-----KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVW-NEDQHKWKNL  953
             +++EK++ SATG     +  G++++++LQ  L   +   +Y LVLDDVW N++  +W+ L
Sbjct  235   RLVEKLIISATGGVGFGEDNGNMEVEELQTILRESIRDKKYFLVLDDVWINDNLAQWEEL  294

Query  954   RELLMSGCDGSRVIVTTRSIKVATITGTTTAY--NLSGLSDHDCFDLFLKCAFRE-QEYR  1124
             ++LL  G  GS ++VTTRS +VA++ GT   Y  NL G+   +C  LF+K AF+E  + +
Sbjct  295   KDLLQVGARGSMIMVTTRSNQVASMIGTAPKYVHNLQGVRYDECLSLFVKYAFKEGHDKK  354

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               NL+ IGKEIV+KCG VPLAV+TL   L+  TDE++W  IR++ +WK+EQKE DILP L
Sbjct  355   YPNLLRIGKEIVKKCGEVPLAVRTLAGQLFLNTDERDWNLIRDSRLWKVEQKEDDILPAL  414

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             ++SY+ +P  L++CFAYC +FPK  E      I  W+A G +QS DG+ ELE++G+ Y  
Sbjct  415   RVSYEHLPSCLKRCFAYCSLFPKNYEYNDYELIQFWMAHGLLQSSDGESELEDIGSIYLK  474

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             E L   CF        G  L   + +++HDLA SVA  EC  V +    I +SV H+   
Sbjct  475   E-LEYGCFLQGFRDLYGS-LQFGMLDVMHDLALSVAQDECFVVTANSKRIEKSVQHISIP  532

Query  1665  ADNLSREEFPQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
               +  R++FP    +L  +R  F +S +    S + +   L  F+ LR L L   + KEL
Sbjct  533   DPDSVRQDFPMLSQDLDQVRTVFIHSDKDVLASNSILATCLSRFKYLRALNLSRSQFKEL  592

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P  IG LK LRYL+LS N  IK LP  + KL NLQTL L  C++++ELPR   + + SL+
Sbjct  593   PKKIGKLKHLRYLDLSWNHRIKRLPNSLCKLQNLQTLFLGGCDEIEELPRGM-RYMESLR  651

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L+L +++ SL +     L  L+FL +  C   +   E  +++  LR L I  C SL  L
Sbjct  652   FLWLATRQTSLPRDEIGCLKSLRFLWIATCEKLERLFEDMENLSALRSLYIVTCPSLNSL  711

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             P  I++L  L+ L I  C  + L+          L+ L+L  L  +  LP  L    A  
Sbjct  712   PPSIKYLTALQDLHISGC--VALNFPNQEACEFKLKKLVLCFLEAIEELPEWLIKGSAGT  769

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             LK L++  CP L  LP  L+  + LQ L I  CP L+
Sbjct  770   LKNLKLEFCPALLELPACLKTFSALQELRILGCPRLA  806



>gb|KHN07375.1| Putative disease resistance protein RGA1 [Glycine soja]
Length=864

 Score =   465 bits (1196),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 322/852 (38%), Positives = 482/852 (57%), Gaps = 50/852 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++LSK+ S A +E S    L   LK L++TLS ++AVL DAD++Q KNH
Sbjct  1     MAESFLFSIAESLLSKLASQAYEEASRVLGLYDHLKNLKDTLSLVQAVLLDADQKQEKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             E++ WL++L+ V +DA+++LD+F   +L  ++    G    KV    +  + L++R+K+ 
Sbjct  61    ELRVWLRQLKRVFFDAENVLDEFECQTLQNQVVKAHGTTKDKVSHFLSTSNPLVFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              +I++I  RL+++A DR  F  +  +     V   +    THS V  SD+IGR+ DK  I
Sbjct  121   QQIKDISMRLDKVAVDRHKFGLQPIDVDTRVVHVREWEYSTHSHVDDSDVIGREQDKAEI  180

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             + +LM+    +D +S+S +PIVG+GGLGKTTL K V+ND ++ + F  ++WVS S+DF L
Sbjct  181   IELLMQQNPNDDHKSLSVIPIVGMGGLGKTTLAKFVFNDKKIDECFPLKMWVSDSDDFDL  240

Query  789   SKVIEKILRSATG-------------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNE  929
              ++I KI+ SA               K+   + ++ LQ  L   L   ++LLVLD VW E
Sbjct  241   KQLIIKIINSANANDSVFLADAPDGQKNLSKMGLETLQNQLRHKLADQKFLLVLDGVWKE  300

Query  930   DQHKWKNLRELLMSGCD-GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
             D+ KW  LR L+  G   GS+++VTTRS  +A++ GT +++ L GLS  D   LF++ AF
Sbjct  301   DRVKWVELRNLIHVGAAAGSKILVTTRSHSIASMMGTVSSHILEGLSLEDSLSLFVRWAF  360

Query  1107  REQEYR--PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK  1280
              E E +  PR L++IG+EIV+KC GVPLA++TLGS+L+ K D  +W  +R+NEIW + QK
Sbjct  361   NEGEEKKYPR-LIKIGREIVKKCRGVPLALRTLGSLLFPKYDTIQWEDVRDNEIWYLPQK  419

Query  1281  ETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELE  1460
             + DILP LK+SYD MP +LRQCFA   ++PK  +      I LW A GF+ SP  ++  +
Sbjct  420   KDDILPALKVSYDLMPSYLRQCFALFSLYPKDYKFYSYDVIQLWGALGFLASPKNNRAQD  479

Query  1461  NLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPE  1640
             ++  QY  EL SR   QD V    G   +  +H+LVHDLA  VA  +CL V S    IPE
Sbjct  480   DIAIQYLWELFSRSLLQDFVS--HGTYYSFCLHDLVHDLALFVAKDDCLLVNSHIQSIPE  537

Query  1641  SVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQ  1820
             S+ HL F   +   +      + ++ + Y               +     ++ LR+L L 
Sbjct  538   SIQHLSFVEKDFHGKSLTTKAVGVRTIFY----------PDAGAEANFKAYKYLRILHLT  587

Query  1821  NLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG  2000
             N   + LP  IG LK LR LNL NN  IK LP+ I KL NLQ L L  C +L+ LP++  
Sbjct  588   NSTFETLPPFIGKLKHLRCLNLRNNKKIKRLPDSICKLQNLQFLFLDGCTELETLPKSL-  646

Query  2001  QQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKL  2159
             ++L+SL    +T+++  L +    +L +LQ+L +  C       S  +FP         L
Sbjct  647   RKLISLYNFEITTKQAVLPENEIANLSYLQYLTIGYCDNVESLFSGIEFPV--------L  698

Query  2160  RVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPK  2336
             + L ++ C  L  LP   +H   LE L +  C++L+L    E       L+ +    +P+
Sbjct  699   KALSVWCCKRLKSLPLDSKHFPALETLHVRYCDKLELFKGHEDQNFYSKLKEVGFWEMPQ  758

Query  2337  LVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS  2516
             L  LP  ++   A  L  L ++ C  L  LPDWL   T L+ L IE CP+L  LP+ +  
Sbjct  759   LEILPHWVQGC-ANTLLSLHLSYCFNLEVLPDWLPMLTNLRVLDIELCPKLRSLPDGMHC  817

Query  2517  -SSNAKVRIIDC  2549
              ++   +RI DC
Sbjct  818   LTALEHLRIKDC  829



>ref|XP_007030149.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY10651.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=820

 Score =   463 bits (1191),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 317/810 (39%), Positives = 480/810 (59%), Gaps = 29/810 (4%)
 Frame = +3

Query  198   LSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK  377
             ++ IKAVL DA+ QQ +N  +   + KLRD+ YDA+D++D+    +  +++ +      K
Sbjct  1     MTLIKAVLLDAERQQEQNKALSHSIWKLRDLFYDAEDVIDEIECEAPRKEVVNYPSTSVK  60

Query  378   VRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGK-LREQTH  554
             VR L +    L +  K+ HKI+EI  R+++IA +   F+  +      V+N + +  +TH
Sbjct  61    VRCLPSCFVPLAFSSKMGHKIKEINKRIDKIATEWDRFNLGQQ-----VDNRRVIHRETH  115

Query  555   SFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRV  734
             SFV  SD+IGRD D+E+I+ +L +  DE  + ++  +PIVG+GGLGKTTL + VYND+RV
Sbjct  116   SFVNASDVIGRDEDRENIINLLKEPSDE--SGNIPVIPIVGIGGLGKTTLAQFVYNDERV  173

Query  735   VQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLD  914
             ++ F  R+WV VSE+F L +++++++ S + K      +D LQ  L  ++    +LLVLD
Sbjct  174   IKLFSLRIWVCVSEEFDLRRLLQEMIYSISKKKCDDTKIDILQTQLRSLVNDENFLLVLD  233

Query  915   DVWNEDQHKWKNLRELLMSGCDGSR--VIVTTRSIKVATITGTTTAYNLSGLSDHDCFDL  1088
             DVWNED+ KW   + LLMS  + SR  +IVTTR++KVA+I  +   Y L GLS  DC  L
Sbjct  234   DVWNEDRVKWIEFKNLLMSMGNLSRNKMIVTTRTLKVASIMSSCDPYVLKGLSHEDCLIL  293

Query  1089  FLKCAFREQEYR--PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEI  1262
             F K AF +++ R  P+ L+ IG++IV+KC GVPLAV+TLGS+L+ KTDE EW+ +R+NEI
Sbjct  294   FTKWAFNDEDERQYPK-LMRIGEKIVEKCKGVPLAVRTLGSLLFSKTDEYEWILLRDNEI  352

Query  1263  WKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPD  1442
             W++EQ+E DILP+LKLSY  +P HL++C  Y  +FPK      +  I  W+A G + S +
Sbjct  353   WRLEQRENDILPVLKLSYHYLPSHLQRCLTYLSLFPKDYLYDTDYIIQFWMANGLLASSN  412

Query  1443  GDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSG  1622
              ++E E++G  YF EL  R   QDV +   G     K+H+L+HDLA +++  ECL V   
Sbjct  413   QNEEWEDIGITYFKELWLRCFVQDVTDR--GSFYLFKMHDLIHDLALNLSQRECLTVNRQ  470

Query  1623  DPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRY-----FAYSFRVGTVSKTFVKKTLL  1787
               ++ E V HL F  D+  R   PQ L  LK +R        +S    ++ ++FV   +L
Sbjct  471   PLKVVEKVRHLSFSLDSPLR--VPQSLKKLKLVRTIMVPSLPFSKENRSIDESFVNACIL  528

Query  1788  NFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINC  1967
             NF+ LR+L L    L+ELP SIG LK LRYL+L+    ++ +P  I KL +L TL L   
Sbjct  529   NFKYLRLLDLSYTLLEELPESIGTLKHLRYLDLTLCHRMRKIPSSICKLQSLLTLRLFGV  588

Query  1968  EQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQH  2147
               L E+P +  Q L+SL+ + +T+    L+         LQFL LY+C       +  QH
Sbjct  589   -PLIEVPESL-QSLISLRFIEITTCGPLLRDIQPGCWSSLQFLYLYQCDMLVSIFDGMQH  646

Query  2148  MKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegle----slqsl  2315
             +  LR L I EC  L  LP  ++ L KLE++ I  C++++L +       +    SL++ 
Sbjct  647   LTSLRTLTIIECVRLISLPRSLKFLTKLEEIDIRRCQKINLCMEVEEAEDQDLHLSLKTF  706

Query  2316  llmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSY  2495
              +  L  L  LP  L +  A  L+ +++  C     L +WLQN T +Q+L I  CP+LS 
Sbjct  707   SIFELGALTDLPRLLLEGSASTLQSIKIESCENFEVLQEWLQNLTSIQKLEISYCPKLSS  766

Query  2496  LPEQI-RSSSNAKVRIIDCPLLNG*CGDTG  2582
             LPE + R ++  +++I  CP L+  C   G
Sbjct  767   LPEGMDRLTALTQLKIKGCPTLSERCRRDG  796



>gb|KCW90386.1| hypothetical protein EUGRSUZ_A02528 [Eucalyptus grandis]
Length=833

 Score =   463 bits (1191),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 325/844 (39%), Positives = 500/844 (59%), Gaps = 30/844 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E  L+ I   +L K+ S A  +    W++K E +KL++TL  I+ VL DA+++QAK  
Sbjct  1     MTEVVLS-ILGPLLQKLASPAVGDFQLVWSVKDEREKLKSTLEMIQKVLADAEQKQAKEE  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V+ WL KL+D  YDA+D+LD+F + +L  + RS      KV  L +      ++FK+  
Sbjct  60    AVRLWLLKLKDFCYDAEDVLDEFESRALWWRARST--FKRKVCYLSSWLSNFSFQFKMAD  117

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++E+  RL++I E++  F+   + +  P+     + +THSFV  S +IGR+ +K+ I+ 
Sbjct  118   KMKELGRRLDRINEEKIKFNLLSDVHEMPIVP---QRETHSFVPTSKVIGRNVEKKKIIE  174

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM S D+     +  +PI+G+GG GKTTL KLVYNDD V ++FD  +W+S+  +F +++
Sbjct  175   LLMGS-DDGSVGKIGVIPIIGMGGSGKTTLAKLVYNDDEVKKHFDYLVWLSMPVEFKVTE  233

Query  795   VIEKILRSATGKSFGHLD----MDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
             +I  I+     KS GH +    +D LQ  L  ++ + R L V+DDVW   +  W+ L + 
Sbjct  234   IIIDII-----KSLGHKEEYDKLDMLQNCLRSMVENKRCLFVMDDVWEVKEDAWRELTKS  288

Query  963   LMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLV  1139
             L    +GS+VIVT+R+  VA+I GT     L+ LS  D   LF+KCAF + QE    +L+
Sbjct  289   LEGVSEGSKVIVTSRNNSVASIMGTVPPLKLANLSKEDSLTLFVKCAFDQGQEKNHPDLM  348

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
              IG+EIV KC G PLAV TLG  L+ + + +EW ++R++++W+++   T+ILP L++SYD
Sbjct  349   VIGEEIVGKCKGNPLAVTTLGCSLHSRNNRKEWEYVRDSKMWRLK---TNILPSLRISYD  405

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
              MP +L+QCFAYC +FPK         I LW++ GFIQS   +QEL+ +G QY  EL SR
Sbjct  406   LMPSYLKQCFAYCSIFPKKYNFINNELIQLWISNGFIQSSGNNQELQEIGRQYLEELRSR  465

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNL  1676
               F    EA+   +L  ++H+L+++LA SVA  E  N+++   +I     ++ F +   +
Sbjct  466   SFFNVNEEAY--PLLFIRMHDLIYELAISVAQPESSNIRAWTQDISWRTRYISFPNPSGV  523

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLN-FRRLRVLMLQNLELKELPSSI  1853
              ++     L  L  +R         + S+ F  +T ++ F+ LRVL L +     LP SI
Sbjct  524   PKDVVSGCLNKLSRVRTIVCEELGSSDSEEFFLETCISQFKHLRVLWLDDSSFHLLPRSI  583

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
               LK LRYL+L  N NIK LP+ + +L NLQTL L  C +L+ELP +  + ++SL+ L++
Sbjct  584   CRLKHLRYLSLCGNSNIKKLPKSVCELYNLQTLILGGCNELEELPTSI-KHMISLRFLWV  642

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+++    K     L  L +L + +C   +   +  Q +  LR L I +C  LT LP GI
Sbjct  643   TTKQQHFLKSGIGCLTSLWWLGIAECKNLEALFDDIQSLTSLRTLSIVDCPKLTSLPQGI  702

Query  2214  RHLAKLEKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
             ++L  LE L I +CE L L  S   G   +  LQ+    GLP L+SLP  L+   A  L+
Sbjct  703   KNLKALEDLLILDCESLRLAESESNGPRSMSRLQTFRFQGLPGLISLPGWLEG-SASTLE  761

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR-SSSNAKVRIIDCPLLNG  2564
              +R+A CP+L+ALP+WLQNC+ L+ L IE CPELS LP+ IR   +  K+RI +C  ++ 
Sbjct  762   MIRIAYCPKLSALPEWLQNCSSLRTLEIESCPELSSLPDGIRLIPTLTKLRISNCEKVSS  821

Query  2565  *CGD  2576
              CG+
Sbjct  822   -CGE  824



>ref|XP_010058597.1| PREDICTED: putative disease resistance protein RGA1 [Eucalyptus 
grandis]
Length=832

 Score =   462 bits (1190),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 318/838 (38%), Positives = 498/838 (59%), Gaps = 28/838 (3%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   +L K+ S A  +    W++K + +KL++TL  I+ VL DA+++Q K   V+ W
Sbjct  5     VSSILGPLLQKLASPAVGDFQLVWSVKDDREKLKSTLEMIQKVLADAEQKQTKEEAVRLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREI  449
             L KL+D  Y A+D+LD+F + +L  + RS      KV  L +      ++FK+  K++E+
Sbjct  65    LLKLKDFCYGAEDVLDEFESRALWWRARST--FKRKVCYLSSWLSNFSFQFKMADKMKEL  122

Query  450   RGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKS  629
               RL++I  ++  F+   + +  P+     + +THSFV  S +IGR+ +K+ I+ +LM S
Sbjct  123   GKRLDRINGEKIKFNLLSDVHEMPIVP---QRETHSFVPTSKVIGRNVEKKKIIELLMGS  179

Query  630   CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKI  809
              D+ +   +  +PI+G+GG GKTTL KLVYNDD V ++FD  +W+S+  +F ++++I  I
Sbjct  180   -DDGNVGKIGVIPIIGMGGSGKTTLAKLVYNDDEVKKHFDCLVWLSMPVEFQVTEIIIDI  238

Query  810   LRSATGKSFGHLD----MDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             +     KS GH +    +D L+  L  ++ + R L V+DDVW+  +  W+ L E L    
Sbjct  239   I-----KSLGHKEEYDKLDMLRNCLRSMVENKRCLFVMDDVWDVTEDAWRELTESLEGVS  293

Query  978   DGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
             +GS+VIVT+R+  VA+I GT     L+ LS  D   LF+KCAF + QE    +L+ IG+E
Sbjct  294   EGSKVIVTSRNKSVASIMGTVPLLKLANLSKEDSLTLFVKCAFDQGQEKNHPDLMVIGEE  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV KC G PLAV TLG  L+ + + +EW ++R++ +W+++   T+IL  L++SYD MP +
Sbjct  354   IVNKCKGNPLAVTTLGCSLHSRNNRKEWEYVRDSNMWRLK---TNILSSLRISYDLMPSY  410

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFAYC +FP+  E      I+LW++ GFIQS   +QEL+  G QY  EL SR  F  
Sbjct  411   LKQCFAYCSIFPRKYEFANIELIHLWISNGFIQSSGNNQELQEKGRQYLEELRSRSFFNV  470

Query  1515  VVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREEF  1691
             V EA+   +L   +H+L+++LA SVA  E  N+++   +I     ++ F +   + ++E 
Sbjct  471   VWEAY--PLLCIGMHDLIYELAISVAQPESSNIRAWTRDISWRTRYISFPNPSGVPKDEV  528

Query  1692  PQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
                L  +  +R         + S+ F++  +  F+ LRVL LQ+     LP SIG LK L
Sbjct  529   SGCLSKVSRVRTIVCWGLGSSDSEFFLETCISQFKHLRVLWLQDSSFHLLPRSIGRLKHL  588

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             RYL+L+ N  IK LP+ + +L NLQTL L  C +L+ELP +  + ++SL+ L++T+++  
Sbjct  589   RYLSLNGNSYIKKLPKSVCELYNLQTLILGGCNELEELPTSI-KHMISLRFLWVTTKQQH  647

Query  2052  LQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
               K     L  L +L + +C   +   +  Q +  LR L I +C  LT LP GI++L  L
Sbjct  648   FLKSGIGCLTSLWWLGIAECKNLEALFDDIQSLTSLRTLLIVDCPKLTSLPQGIKNLKAL  707

Query  2232  EKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             E L I +CE L L  S   G   +  LQ+    GLP L+SLP  L+   A  L+ +R+A 
Sbjct  708   EDLLILDCESLRLPESESNGPRSMSRLQTFRFQGLPGLISLPGWLEG-SASTLQRIRIAY  766

Query  2406  CPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR-SSSNAKVRIIDCPLLNG*CGD  2576
             CP+L+ALP+WLQNC+ L+ L IE CPELS LP+ IR   +  K+RI +C  ++  CG+
Sbjct  767   CPKLSALPEWLQNCSSLRTLEIESCPELSSLPDGIRLIPTLTKLRISNCEKVSS-CGE  823



>ref|XP_004301268.1| PREDICTED: disease resistance protein RGA2-like [Fragaria vesca 
subsp. vesca]
Length=868

 Score =   464 bits (1193),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 334/848 (39%), Positives = 490/848 (58%), Gaps = 32/848 (4%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F+  I E  +  + S    E+  A  +  EL KL+ T S +K V+ DA+E+Q  +  + +
Sbjct  4     FVTSIAETAMIGLASYTYKEVCLARGVTDELAKLKETFSDVKKVVLDAEEKQRNDPRLTE  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILT-KVRKLFTRPDGLIYRFKITHKI  440
             WL KL+DV YD DD+LD+F    L  ++ +  G +LT KVR  F+R + L++  K+ H+I
Sbjct  64    WLGKLKDVCYDIDDVLDEFAFTELQMQVMNNRGSVLTLKVRTFFSRWNPLVFNIKMAHRI  123

Query  441   REIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGML  620
             + IR  L+++A ++  F  +E       +   ++ +THSFV+  D+IGRD DK+ I+  L
Sbjct  124   KGIREELDRVAAEKALFPLEER--AGDWQGVHVKRETHSFVQVYDVIGRDDDKKQIIIHL  181

Query  621   M--KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +  +  D    ++VS + I+GLGG+GKTTL KLVYND RVV+NF+ R+WV VS+ F + +
Sbjct  182   LNLRLKDPGVRDTVSVISILGLGGMGKTTLAKLVYNDKRVVKNFELRMWVYVSDHFDIKR  241

Query  795   VIEKILRSATGKSFGHLD-MDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWKNLR  956
             ++  I+ SAT ++ G  + ++QLQ+ L  VL    +LLVLDDVW++ +      KW  L+
Sbjct  242   LVRDIITSATNQNCGDDESLEQLQKKLQNVLTDKHFLLVLDDVWDKSEIGVTISKWLELK  301

Query  957   ELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--REQEYRPR  1130
              LL  G + S++IVTTR+  V  +  +   + L GL   DC  LFL+ AF  R +E R  
Sbjct  302   ALLNVGANESKIIVTTRNESVTKVMESVYVHPLKGLRHEDCKSLFLQRAFARRGEEERYP  361

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
              LVEIG +I +KCGGVPLAV TLGSML  K ++  W  +R+++IWK++Q+  DI P LKL
Sbjct  362   QLVEIGDDIAEKCGGVPLAVTTLGSMLCLKREQHAWSEVRDSDIWKLKQEHNDISPALKL  421

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYD +P +L+ CFA+C +FPK         + LW+AQGF+QS  G QE E +G  Y  ++
Sbjct  422   SYDALPPYLKPCFAFCSIFPKDYIFRSTDLVPLWMAQGFLQSSTGSQEPEEMGLDYIRQI  481

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES---VHHLVF  1661
              SR  FQ   ++     +  ++H+LVHDLA SVA  EC +     P    S   V H+  
Sbjct  482   CSRSLFQMHEDSIHS--IVFEMHHLVHDLAISVAQVECSSENFRPPSTSISHKKVRHVSI  539

Query  1662  HADNLSREE--FPQPLLNLKNLRYFAYSFRVGTV--SKTFVKKTLLNFRRLRVLMLQNLE  1829
               D+L  +E   P  LL LK +    +     TV  +K  +K     F+ LRVL L    
Sbjct  540   SRDDLCMKEVRVPDYLLQLKKVWTILFPNPGDTVITNKPLLKTCFKRFKYLRVLDLSGWS  599

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
             L++LPSSIG L  LRYL+LS N +++ LP+ I +L NLQTL L  CE LK LP++ G  L
Sbjct  600   LEKLPSSIGNLSHLRYLDLSRNPSLQKLPDSICELQNLQTLLLSGCENLKGLPKDIG-SL  658

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
             ++L+ L  T+  + L +    SL  L+   ++ CS  +   E+ Q +  LR+L I  C +
Sbjct  659   INLRKLVFTTSRMDLPEEIK-SLTSLRHFEVHSCSNLESLGEVVQSLTNLRILVISNCGN  717

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDI  2369
             L  LP   +    L+ L I +CE+LDL      EG+E L S  +  +  L +LP  L+D 
Sbjct  718   LESLP---QLSPSLKALVISDCEKLDL--MSLGEGIEGLLSFSISKMSNLEALPHWLQD-  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIID  2546
                 L+ +R+  C  L  LP+WLQ+   LQ+L IE CPEL  LPE +      K ++I D
Sbjct  772   SKPSLQSIRIENCVHLKVLPEWLQSLMKLQQLVIEGCPELLALPEGMHHLFALKELKIND  831

Query  2547  CPLLNG*C  2570
             C  L   C
Sbjct  832   CSKLGESC  839



>ref|XP_002318368.1| NBS-LRR resistance gene-like protein ARGH30 [Populus trichocarpa]
 gb|EEE96588.1| NBS-LRR resistance gene-like protein ARGH30 [Populus trichocarpa]
Length=836

 Score =   462 bits (1188),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 323/813 (40%), Positives = 476/813 (59%), Gaps = 22/813 (3%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F  +I ENV+ K+ SL  +E S A   + ELKKL++++  IK VL DA+E+++ + E++ 
Sbjct  4     FSLNIAENVVEKLGSLEYEETSLACCNEDELKKLKHSMLVIKDVLIDAEEKRSNSPELRL  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKITHKIR  443
             WL++L  V YDA+D+LD+    +L R++       T KV + F+  + LI+R  I  K++
Sbjct  64    WLKQLNHVFYDAEDVLDELEVENLRRQVIDRGNFYTRKVLRCFSSSNPLIFRSTIGRKLK  123

Query  444   EIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQ-THSFVRPSDIIGRDSDKESIVGML  620
              I   L+ IA         E        N   RE+ THSFV  + IIGRD DKE I+ +L
Sbjct  124   RINEGLDAIAAGNVKCRLTERAEERRPLN---RERGTHSFVHSAGIIGRDEDKEKIIQLL  180

Query  621   MKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
             +   DEE+   +S LPIVG+GG+GKTTL K+ YND+RVV++F  ++WV VS D    +++
Sbjct  181   LHPSDEEN---ISVLPIVGIGGMGKTTLAKMAYNDERVVKHFQFKMWVYVSRDSDKKRLM  237

Query  801   EKILRSATG-----KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             EK++ SATG     +  G +++++LQ  L   +   +Y LVLDD+WN++  +W+ L++LL
Sbjct  238   EKLIISATGGVGIGEDNGSMEVEELQTLLRESIRDKKYFLVLDDLWNDNLARWEELKDLL  297

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAY--NLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
               G  GS ++VTTRS +VA++ GT   Y  NL G+   +C  LF+K AF+E Q+ +  NL
Sbjct  298   RVGARGSMIMVTTRSNQVASMIGTAPKYVHNLQGVRYDECLSLFVKYAFKEGQDKQYPNL  357

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IG+EIV+KCG VPLAV+TL   L+  TDE++W  IR++ +WK+EQKE DILP L++SY
Sbjct  358   LRIGEEIVKKCGEVPLAVRTLAGQLFLNTDERDWNLIRDSRLWKVEQKEDDILPALRVSY  417

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             +Q+P  L++CFAYC +FPK  E      I  W+A G +QS DG+ ELE++G+ Y  EL  
Sbjct  418   EQLPSCLKRCFAYCSLFPKNYEYNDYELIQFWMAHGLLQSSDGESELEDIGSIYLKELEY  477

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
                 QD  + +    L   + +++HDLA SVA  EC  V +    I +SV H+     + 
Sbjct  478   GCFLQDFRDLYGS--LQFGMLDVMHDLALSVAQDECFVVTANSKRIEKSVQHISIPDPDS  535

Query  1677  SREEFPQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
              R++FP     L  +R  F +S +    S + ++  L  F+ LR L L   + KELP  I
Sbjct  536   VRQDFPMLSKELDQVRTVFIHSDKDVLASNSILETCLSRFKYLRALNLSRSQFKELPKKI  595

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYL+LS N  IK LP  I KL NLQTL L  C++++ELPR   + + SL+ L+L
Sbjct  596   GKLKHLRYLDLSWNHRIKRLPNSICKLQNLQTLFLGGCDEIEELPRGM-RYMESLRFLWL  654

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
              +++ SL +     L  L+FL +  C   +   E  +++  LR L I  C SL  LP  I
Sbjct  655   ATRQTSLPRDEIGCLKSLRFLWIATCENLERLFEDMENLSALRSLYIVTCPSLNSLPPSI  714

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYL  2393
             ++L  L+ L I  C  + L+          L+ L+L  L  +  LP  L    A  LK L
Sbjct  715   KYLTSLQDLHISGC--VALNFPNQEACEFKLKKLVLCFLEAVEELPEWLIRGSADTLKNL  772

Query  2394  RVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             ++  CP L  LP  L+  + LQ L I  CP L+
Sbjct  773   KLEFCPALLELPACLKTFSALQELRILGCPRLA  805



>ref|XP_007162212.1| hypothetical protein PHAVU_001G133400g [Phaseolus vulgaris]
 gb|ESW34206.1| hypothetical protein PHAVU_001G133400g [Phaseolus vulgaris]
Length=875

 Score =   463 bits (1191),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 330/840 (39%), Positives = 474/840 (56%), Gaps = 50/840 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++KI S A  E S    L   L+ L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAESFLFSIAESLIAKIASHAFQEASRLVGLYDNLRDLTKTLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             ++++WL +L+ +  DA+DLLD+F   +L +K+    G    KV   F+  + L++R+K+ 
Sbjct  61    QLREWLTQLKTIFSDAEDLLDEFECQTLRKKVVKAHGSTKDKVSHFFSTSNPLLFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD++GR  DKE 
Sbjct  121   QQIKDISKRLDKVAADRHKFSLQ----IIDVDTRVVHRRDMTHSRVSDSDVVGRKHDKEK  176

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +LM   +  D  S+S +PIVG+GGLGKTTL K V+ND R+ + F   +WV VS+DF 
Sbjct  177   IIELLMPQ-NPNDDASLSVIPIVGIGGLGKTTLAKFVFNDSRIQEYFPLMMWVCVSDDFD  235

Query  786   LSKVIEKILRSAT-------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             + ++I KI+ SA         ++   LD++QLQ  L   L S ++LLVLDDVWNED+ KW
Sbjct  236   IKQLIIKIINSANEQDAPPHQQNLNMLDLEQLQNQLKNKLSSQKFLLVLDDVWNEDRVKW  295

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QE  1118
               LR L+     GS+++VTTRS  +A++ G+  ++ L GLS+ D   LF+K AF+E  +E
Sbjct  296   VELRNLIQVSAAGSKILVTTRSHSIASMMGSVPSHILEGLSNEDSLSLFVKWAFKEGEEE  355

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
               P  L+ I +EIV+KC GVPLAV+TLGS+L+ K +  EW ++ +NEIW + QK+ DILP
Sbjct  356   NHPHLLI-IAREIVKKCRGVPLAVRTLGSLLFSKFEVSEWEYVCDNEIWNLPQKKDDILP  414

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD MP +LRQCFA   ++PK  E+      ++W A G I  P  ++ LE++ NQY
Sbjct  415   ALKLSYDLMPSYLRQCFAIFSLYPKDYELNSYEITSVWGALGLIALPKKNRTLEDVANQY  474

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +ELLSR   QD      G +    IH+LVHDLA  VA  E L V S    IP++V HL 
Sbjct  475   LHELLSRSFLQDFTSF--GSVYRFTIHDLVHDLALFVAKDESLYVSSRIQNIPDNVRHLS  532

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVG---TVSKTFVKKTLLNFRRLRVLMLQNLE  1829
             F   +L        L N K++      F  G   T  +  +   L  F+ LRVL L +  
Sbjct  533   FAESSLFSN-----LYNKKSVAVKTILFPNGTEETSDEALINTCLSKFKYLRVLDLWSST  587

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
             ++ LP +I  LK LRYL++  N NIK LPE I KL +LQ L L  C +L+ LP    ++L
Sbjct  588   IETLPHTIAKLKHLRYLDIGKNRNIKRLPESICKLQSLQVLRLDGCIELEALPIGL-RKL  646

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVL  2168
             +SL+ L  ++++  L      SL  L  L +  C          KFP         L+ L
Sbjct  647   ISLRHLEFSTKQSILPDNEIASLDLLANLSIESCHNLGSIFGDVKFPV--------LKAL  698

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSV-----gegmegleslqslllmglP  2333
              I  C SL       +   +LE L + +C  LDL +      EG      L+++LL  L 
Sbjct  699   YIGNCESLKSFQLDGKKFPELETLGVNSCSNLDLELWKGNHLEGQSHKLKLKTILLSNLS  758

Query  2334  KLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
             +LV+LP  L +  A  L+ L +  C  +  LPDW    T L+ L I  C  L  LP+ I 
Sbjct  759   QLVTLPKWLHEA-ANSLQCLIIENCDNIETLPDWFTTMTDLKTLSITSCLSLVSLPDNIH  817



>ref|XP_009369141.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
Length=1219

 Score =   472 bits (1215),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 316/755 (42%), Positives = 440/755 (58%), Gaps = 57/755 (8%)
 Frame = +3

Query  66    RASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA  245
             +  M E     I  ++L K+ S    E+   + +  EL KL++TLSTI+AVL DA+E+Q 
Sbjct  189   KTKMVEAVPFGIATHLLVKLGSSTFQELGLIYGVDKELTKLESTLSTIRAVLSDAEEKQE  248

Query  246   KNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFK  425
             K+H V++W++KL+DVVY AD++ D F T +   K +    +L +VR  F+  + L +R K
Sbjct  249   KSHLVQEWMRKLKDVVYRADNVFDVFETKANDGKDQQ---LLLQVRGFFSPSNHLAFRHK  305

Query  426   ITHKIREIRGRLNQIAEDRRNFHFKEN----YYVNPVENGKLREQTHSFVRPSDIIGRDS  593
             +  +I+EIR  L++IA D   F+F+      Y    ++NG  +E+THSFV PS +IGRD 
Sbjct  306   MGREIKEIRESLDEIAADISKFNFRAGSVTVYADIGLQNGYEKEETHSFVLPSTVIGRDK  365

Query  594   DKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS  773
             DKE +V  LM  CD ++   VS   IVG+GGLGKTTL K++YND+RVV  F  ++WV   
Sbjct  366   DKEEMVRSLMSECDRDN---VSIAAIVGIGGLGKTTLAKMLYNDERVVSYFQLKMWVWAY  422

Query  774   EDFSLSKVIEKILRSATG-----KSFGHL----------DMDQLQEHLNGVLCSGRYLLV  908
              +F +  +  KIL + T        F HL          ++++LQ  L   L   RYLLV
Sbjct  423   GNFDVRSIASKILSTGTADELQESEFSHLRNGPQKNMVMELEELQILLRKKLDGKRYLLV  482

Query  909   LDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDL  1088
             LDDVWNE+++ W  L +LL  G  GS+++VTTRS KV ++    + Y L GL + +C+ L
Sbjct  483   LDDVWNENRNSWLQLNDLLSGGAKGSKIVVTTRSTKVTSVMDIDSPYVLQGLREEECWTL  542

Query  1089  FLKCAFRE--QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEI  1262
             F K AFR+  +E  P  LV IG+ I  KC GVPLA++TLGS++  KT E EWL I+  EI
Sbjct  543   FKKMAFRKGREEENPM-LVPIGRRIADKCQGVPLAIRTLGSLMRYKTSESEWLAIQNKEI  601

Query  1263  WKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPD  1442
             W+  ++E DIL ILKLSYD MP +L+QCF+YC +FPKG EI +++ I LW+AQG+I  P 
Sbjct  602   WEFPKEENDILAILKLSYDHMPVYLKQCFSYCALFPKGYEIDKKLLIQLWIAQGYIHPPS  661

Query  1443  GDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAEC--LNVK  1616
              D  LE++ + YF ELL R   Q+V +  DG +++C +H+L+ DLA++VAG+EC   NV 
Sbjct  662   KDSNLEDISDTYFKELLWRSLLQEVKKDVDGNVISCNMHDLIQDLARAVAGSECSICNVD  721

Query  1617  SGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGT-VSKTFVKKTLLNF  1793
             SG+  + E VHH+ F     S  E P  LL  + +R F    +  T    T     + + 
Sbjct  722   SGN--VSERVHHVSFSQYLPSSWEVPTTLLKARKVRTFVLPLQYQTHKISTSHSTIISSL  779

Query  1794  RRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQ  1973
             R LR L L NL  KELP  IG L  LRYL+LS N  +  LP  I  L NLQTL L  C +
Sbjct  780   RCLRALDLHNLRTKELPDVIGKLIHLRYLDLSGNVWLVVLPGSICNLQNLQTLKLNRCYR  839

Query  1974  LKELPRNFGQQLMSLKTL------YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAE  2135
             LK LPRN G +++SL+ L       LT     L K   +SL  L   +L K         
Sbjct  840   LKHLPRNLG-KMISLRHLEINGCCNLTHMPPGLGKL--ISLQTLPIFVLCK---------  887

Query  2136  IWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
                  K L    + E S L CL  G+ H+  LE +
Sbjct  888   -----KSLSSSGLDELSGLNCL-RGMLHIVHLEHV  916



>gb|KCW90193.1| hypothetical protein EUGRSUZ_A02366 [Eucalyptus grandis]
Length=808

 Score =   460 bits (1184),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 309/806 (38%), Positives = 463/806 (57%), Gaps = 63/806 (8%)
 Frame = +3

Query  117   SKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvy  296
              K+ S   +EI   W++K +  KL+N L  I+ V+ DA+++Q  +  VK WL KL+D  Y
Sbjct  14    GKLGSAVFEEIQLLWSVKGDQDKLKNLLEMIEKVITDAEQKQTTDQAVKHWLSKLKDFCY  73

Query  297   daddllddFGTLSLLRKLRSCSGIL--TKVRKLFTRPDGLIYRFKITHKIREIRGRLNQI  470
             DA+D+LD+F   +L  + R    +    KVR  F+     I++FK+ HK++E+R RL++I
Sbjct  74    DAEDVLDEFAAKALRGRARPTEHLTLKRKVRYWFSWLSNFIFQFKMAHKMKELRERLHEI  133

Query  471   AEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTE  650
              E++   H   N    P ++   R++THSFV  S++IGR+ DK+ I+ +LM++ D++   
Sbjct  134   NEEKNVLHLSSNV---PDKSIVQRKETHSFVLVSNVIGRNKDKQRIIELLMRT-DDDGAG  189

Query  651   SVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGK  830
              +  +PI+G+GG+GKTTL K VY DDRV ++FD ++W+S+S DF + K+I  ++ S + +
Sbjct  190   KIGVIPIIGIGGIGKTTLAKWVYMDDRVSKHFDIKVWLSMSVDFEVKKIIRDVIESLSHE  249

Query  831   S-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTR  1007
             +      +++LQ HL  ++ + R L ++DDVW   Q  WK L +LL    +GS+VIVT++
Sbjct  250   AKCDSWSLEKLQNHLRSIVENKRCLFIMDDVWEVSQEDWKGLIDLLEGVSEGSKVIVTSQ  309

Query  1008  SIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPL  1184
             + K+A+I GT   +NL+     D   LF+KCAF + QE    +L+ IGKEIV KC G P+
Sbjct  310   NKKIASIMGTVPPHNLA----EDSLTLFMKCAFDQGQEKNHPDLMAIGKEIVSKCAGNPM  365

Query  1185  AVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCM  1364
             AVKTLGS+                EIW+++   T+ILP L++SYD MP +L++CFAYC +
Sbjct  366   AVKTLGSLF---------------EIWQLQ---TNILPSLRISYDLMPSYLKKCFAYCSI  407

Query  1365  FPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEIL  1544
             FPK  E      I LW+A G IQS +  QELE +G +Y+ EL SR  F DVVE  D   L
Sbjct  408   FPKNYEFNNLELIQLWIANGLIQSSENTQELEEIGQRYWEELWSRSFFDDVVE--DYLFL  465

Query  1545  ACKIHNLVHDLAQSVAGAECLNVKSG--DPEIPESVHHLVFHADNLSRE-EFPQPLLNLK  1715
               K+H+L+H LA SVA  E  NV       ++  +  H+ F   +L +E E P  L  L 
Sbjct  466   TFKMHDLIHQLAISVAQTESSNVNMNMRTQDVSSTTRHISFSDPSLLQEGELPSYLSKLS  525

Query  1716  NLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNN  1895
                        G+  ++F++  +  F++LRVL L +    +LPSSIG LK LR+L+L  N
Sbjct  526   G---------EGSTRESFLEMCISRFKQLRVLYLHDTSFDQLPSSIGGLKHLRFLHLCGN  576

Query  1896  CNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVS  2075
              NIK LP  I +L NLQ+L L  CE+L+E+P +  + +++L+ L +T+++    ++    
Sbjct  577   RNIKKLPNSICELHNLQSLGLAGCEELEEVPADI-KSMINLRFLDITTKQQQFPEKGIGC  635

Query  2076  LGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNC  2255
             L  L+ L +  C   +      + +  L  L I  C  L  LP GI++L  LE LWI NC
Sbjct  636   LTSLRCLFIGDCKNLEVLFNDMESLTLLHKLFIGGCPKLASLPQGIKNLKALENLWICNC  695

Query  2256  EELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDW  2435
             E L L                    P+ + L        A  L+ + V  CP L  LP+W
Sbjct  696   ENLKLP-------------EGESDEPRSMWLKGS-----ARTLQKIDVVHCPNLGTLPEW  737

Query  2436  LQNCTLLQRLYIEDCPELSYLPEQIR  2513
             LQNC  L++L IEDCP LS LP+ IR
Sbjct  738   LQNCFSLRKLKIEDCPSLSSLPDGIR  763



>gb|KCW90387.1| hypothetical protein EUGRSUZ_A02530, partial [Eucalyptus grandis]
Length=781

 Score =   459 bits (1180),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 309/804 (38%), Positives = 476/804 (59%), Gaps = 34/804 (4%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   +L K+ SLA +EI   W +K +L+ +Q        VL DA+++Q K   V+ W
Sbjct  5     VSSILGPLLQKLASLAVEEIQLVWGVKDDLEMIQK-------VLADAEQKQTKQEAVRLW  57

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREI  449
             L KL+D  YDA+D+LD+F T +L  ++R    +  KVR          Y FKI HK++E+
Sbjct  58    LSKLKDFCYDAEDVLDEFETNALCGRVRRTEHLTLKVR--------YSYSFKIAHKMKEL  109

Query  450   RGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKS  629
               RL++I E++  F+   + +   +     R +T+SFVR S+IIGRD +KE I+ +L +S
Sbjct  110   GKRLDRINEEKIKFNLSSDIHEKAIVP---RRKTYSFVRTSNIIGRDEEKERIIELLKRS  166

Query  630   CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKI  809
              D      ++ LPI+G+GG GKTTL KL+YND+RV ++F+ ++W+S+  +F + K +  I
Sbjct  167   -DYGGAGIIAVLPIIGMGGTGKTTLAKLIYNDERVKEHFEHKVWLSMPLEFEIEKTMRDI  225

Query  810   LRSATGKS-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGS  986
             ++    ++ F +  ++ LQ  L   + + R L V+DDVW   + +W+ L  LL     GS
Sbjct  226   IKCLNNEAKFDNRTLEMLQNDLRSRVENKRCLFVMDDVWQVRREEWEQLTYLLGGVSKGS  285

Query  987   RVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIGKEIVQ  1163
             ++IVT+R+  + +I GT   ++L+ LS  D   LF+ CAF + + R   +L+ IGKEIV+
Sbjct  286   KIIVTSRNKFITSIMGTRYPFDLANLSREDSLTLFVNCAFDQGKERNHPDLMVIGKEIVR  345

Query  1164  KCGGVPLAVKTLGSMLYCKTDEQ-EWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLR  1340
             KCGG PLA+KTLGS+LY K +++ +W  +R++EIW+++   T ILP L++SYD MP +L+
Sbjct  346   KCGGNPLAMKTLGSLLYSKHNQKSDWEFVRDSEIWQLD---TGILPSLRISYDLMPSYLK  402

Query  1341  QCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVV  1520
             QCFAYC +FPK  E      I  W++ GFIQ    +QELE +G QY  EL SR  F  V 
Sbjct  403   QCFAYCSIFPKNHEFSNFDLIQFWISNGFIQPRRKNQELEEIGRQYLKELFSRSFFDVVA  462

Query  1521  EAFDGEILACKIHNLVHDLAQSVAGAECLNV-KSGDPEIPESVHHL-VFHADNLSREEFP  1694
             E +   ++  K+H+L+H+LA SVA  E  N+ K    +I  S  H+ +F+  ++ ++E P
Sbjct  463   ERYP--VVIFKMHDLIHELAISVAQTESCNMTKERTQDISPSTRHISIFNTFDVPKDELP  520

Query  1695  QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLR  1874
               L  L  +R    S ++G+  + F++  +  F+ +RVL+L       LPSSIG LK LR
Sbjct  521   GCLSKLSRVRT-VMSEKLGSSEEFFLETCIERFKHMRVLVLHESTFDLLPSSIGTLKHLR  579

Query  1875  YLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSL  2054
              L+L  + N+K LP+ + KL NLQ L L  C +L+ELP N  + +++L+ L +T+++   
Sbjct  580   NLHLCYSPNLKKLPKSVCKLRNLQCLVLSGCTELEELPANI-KNMINLRFLSVTTKQQRF  638

Query  2055  QKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLE  2234
              +     L  L++L +  C   +   +  Q +  LRVL I  C  L  LP GI++L  LE
Sbjct  639   SESGIGCLTSLRWLFIADCMNLETLFDDIQSLTSLRVLAIANCPKLASLPQGIKNLQALE  698

Query  2235  KLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
              LWI   E L L             LQS    GLP+LVSLP  L+   A  L+ +++AGC
Sbjct  699   HLWIGYSERLRLPEGERNEPRSTSRLQSFRFEGLPELVSLPRWLEG-SASTLQKIKIAGC  757

Query  2409  PELTALPDWLQNCTLLQRLYIEDC  2480
             P L  LP+WLQNC+ L++L I +C
Sbjct  758   PNLRVLPEWLQNCSSLKKLKIRNC  781



>gb|KCW90191.1| hypothetical protein EUGRSUZ_A02363 [Eucalyptus grandis]
Length=788

 Score =   459 bits (1180),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 311/834 (37%), Positives = 468/834 (56%), Gaps = 82/834 (10%)
 Frame = +3

Query  111   VLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdv  290
             ++ ++VS A +EI     +K +  KL+N L  IK  L DA+++Q  N  V+ WL K++D 
Sbjct  7     LVGRLVSAALEEIQKLLGVKGDQDKLKNLLEMIKKTLADAEQKQTTNQAVRIWLSKVKDF  66

Query  291   vydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQI  470
              YDA+D+LD+F   +L R+ R       KV   F+     I++F++ +K++E+R RL +I
Sbjct  67    CYDAEDVLDEFEAKALWRRARP----KRKVHYWFSWLSNFIFQFEMANKMKELRKRLLEI  122

Query  471   AEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTE  650
              E++   H   N     +   K   +THSFV  S++IGR+ DK+ I+ +LM++ D++   
Sbjct  123   NEEKNELHLSSNVCDKSIVQWK---ETHSFVTISNVIGRNKDKQRIIELLMRT-DDDGVG  178

Query  651   SVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGK  830
              V  + IVG+GG+GKTTL K VY DDR+ + FD ++W+S+S DF + K+I  I+ S + +
Sbjct  179   KVGVISIVGMGGIGKTTLAKWVYMDDRISKYFDLKVWLSMSVDFEVKKIIRDIIESLSHE  238

Query  831   S-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTR  1007
             +      +++LQ HL  ++ + R LLV+DDVW   +  W+ LR+LL    +GS+VIVT+ 
Sbjct  239   AKCDSWSLEKLQNHLRSIVENKRCLLVMDDVWEVSRENWEGLRDLLEGVSEGSKVIVTSW  298

Query  1008  SIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPL  1184
             +  + +  GT   +NL+ LS  D   LF+KCAF + QE    +L+ IGKEIV KC G P+
Sbjct  299   NKSIVSTMGTVPPHNLANLSQEDSLTLFMKCAFDQGQEKNHPDLMAIGKEIVSKCAGNPM  358

Query  1185  AVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCM  1364
             AVKTLGS+LY KT    W  IR++EI +++   T ILP L++SYD MP+HL+QCFAYC +
Sbjct  359   AVKTLGSLLYSKTKLSNWECIRDSEILQLQ---TGILPSLRISYDLMPFHLKQCFAYCSI  415

Query  1365  FPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEIL  1544
             FPK  +      I LW+A G IQS    QELE +G QY+ EL SR  F DVVE  D   L
Sbjct  416   FPKNYKFNNLELIQLWIANGLIQSSGNTQELEEIGQQYWEELWSRSFFDDVVE--DYLFL  473

Query  1545  ACKIHNLVHDLAQSVAGAECLNVKSG--DPEIPESVHHLVFHADNL-SREEFPQPLLNLK  1715
               K+H+L+H LA SVA  E  NV       ++  +  H+ F   +L   +E P  L  L 
Sbjct  474   TFKMHDLIHQLAISVAQTESSNVNMNMRTQDVSPTTQHISFSDPSLLPEDELPSYLSKLS  533

Query  1716  NLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSN  1892
              +R   +  +  G+  ++F++  +  F++LRVL L +    +LPSSI  LKQLRYL+L  
Sbjct  534   RVRTIMFPIKKEGSTGESFLEMCISRFKQLRVLYLHDSSFDQLPSSISGLKQLRYLHLCG  593

Query  1893  NCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSV  2072
             N +IK LP  I +L NLQ+L L  CE+L+ELP +  + +++L+ L +T+++         
Sbjct  594   NRSIKKLPNSICELHNLQSLGLAGCEELEELPVHI-KSMINLRFLDITTKQ---------  643

Query  2073  SLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWN  2252
                            ++FP +    +  LR L I +C +L  L   +  L  L KL+I  
Sbjct  644   ---------------QRFPEKGIGCLTSLRCLIIGDCKNLEVLFNDMESLMLLRKLFIGG  688

Query  2253  CEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPD  2432
             C                         PK +       +     L+ + V  CP L  LP+
Sbjct  689   C-------------------------PKWL-------EGSTRTLQKIDVVHCPNLGTLPE  716

Query  2433  WLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*CGDTGTRLS  2594
             WLQNC  L++L IEDCP+LS LP+ IR  +  +   ID       CG+  +R++
Sbjct  717   WLQNCFSLRKLKIEDCPKLSSLPDGIRHIATLRELWIDD------CGEISSRIA  764



>ref|XP_010097657.1| Putative disease resistance protein RGA4 [Morus notabilis]
 gb|EXB70612.1| Putative disease resistance protein RGA4 [Morus notabilis]
Length=1080

 Score =   468 bits (1203),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 298/668 (45%), Positives = 420/668 (63%), Gaps = 25/668 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVS-LAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             MAE  L ++ E+++ K+ S     E+   + +  EL+KL+ T+S IKAVL DA+++QA+N
Sbjct  1     MAEAILFNVAESIIEKLGSETLGKEMGLLFGVNTELQKLKRTVSAIKAVLLDAEQKQAEN  60

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
             H+VKDWLQKL+D VY ADDL+D+F T +L R++   SG   KVR  F+  + L +  KI 
Sbjct  61    HQVKDWLQKLQDAVYYADDLVDEFYTEALQRRVMIGSGKAKKVRIFFSSSNQLAFMLKIG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+E+R  LN+I +D ++F+  E      V +  +  +THS+VR  ++IGRD+DK +I+
Sbjct  121   HKIKEVRETLNEI-KDNKDFYLMERLEDTRVSS--MARETHSYVREEEVIGRDADKLAIM  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+   D E  E VS +PIVG+GGLGKTTL + ++ND+ + ++F+ R WV VS+ F L 
Sbjct  178   KLLL---DLESKEDVSVIPIVGIGGLGKTTLAQHIFNDENIQKHFELRSWVCVSDFFDLK  234

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++EKI++S T KS G+L+++QLQ HL   +   RYLLVLDDVWNED  KW+ L  LLM 
Sbjct  235   LIVEKIIKSVTLKSSGNLELEQLQFHLRKEIDGKRYLLVLDDVWNEDGEKWRRLERLLMG  294

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF-REQEYRPRNLVEIG  1148
             G  GSRV+VTTRS  VA IT T   Y LSGL + D + LF + AF + QE     ++ +G
Sbjct  295   GAKGSRVLVTTRSYMVAKITHTIQPYKLSGLDNVDSWSLFKRIAFDKGQEPENSTVLAMG  354

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              EIV+KC GVPLA+KT+GS+LY K  E EW    E E+ KI Q E DILP LKLSY+ +P
Sbjct  355   MEIVEKCRGVPLAIKTIGSILYFKRREIEWSSFMETELSKIPQGEDDILPALKLSYNHLP  414

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+ CFAYC +FPK  EI  +  I LW+AQGFI+  D  Q LE++G +YF  LL R  F
Sbjct  415   SHLKHCFAYCRLFPKDHEIDVQKLIRLWIAQGFIKPSDRSQCLEDVGYEYFMALLWRSFF  474

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QD      G +   +IH+L+HDLA  VAG   +++        E++ H+ F +      +
Sbjct  475   QDPKIDDWGNVKRFRIHDLMHDLAVLVAGTSSISIDRSMENSNENIRHVSFDSKFNQSWK  534

Query  1689  FPQPLLNLKNL-------RYFAYSFRVGTVSKTFVKK--------TLLNFRRLRVLMLQN  1823
              P  LL   N+       +Y A+         T  KK         L +F  LR L L+ 
Sbjct  535   LPPSLLKKNNIVRTFISPKYNAWHGYQHNFLGTSRKKLRWLTRDAILFSFTSLRTLDLKA  594

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
             L +K+LP+S+G LK LRYL++S N NI+ LP  I++L NLQTL L +C +L  LP +  +
Sbjct  595   LNIKKLPNSLGRLKHLRYLDVSRN-NIQMLPNSITRLQNLQTLILSHCRELIRLPEDM-K  652

Query  2004  QLMSLKTL  2027
             +L++L+ L
Sbjct  653   KLVNLRHL  660



>ref|XP_010694939.1| PREDICTED: putative disease resistance protein RGA4 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=785

 Score =   458 bits (1179),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 284/657 (43%), Positives = 419/657 (64%), Gaps = 10/657 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L +I + ++  + S A +E++SAW  K  L KL+N+++TIK VL DA+E+Q  +H
Sbjct  1     MAEAVLYNIAQELIINMSSAAIEEVASAWGYKTHLAKLKNSINTIKDVLLDAEERQPNSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL++LR  VYDADDL D+  +L+   ++        +VR  F++ + L     ++ 
Sbjct  61    AIRGWLERLRVAVYDADDLFDEITSLTDQNEVIYGGKCTKEVRFFFSKINQLHVGSTMSR  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI EIR  L+ IA+D  NF F+      PV  G++R+Q++SFVR  DI+GR SDK +I+G
Sbjct  121   KINEIRENLDDIAKDGGNFGFRLQVNEEPV-IGRIRDQSYSFVREEDIVGRGSDKVAILG  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             ML  S  EE   +VS +PIVG+GGLGKTTL +LVYND++V  +F+ RLWV VS+ F +  
Sbjct  180   MLFGSDIEE---TVSVIPIVGIGGLGKTTLAQLVYNDEKVDDHFELRLWVCVSDMFDIKV  236

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++EKIL  AT      L+M+QLQ  L   +   RYLLVLDDVWNED+ +W  L+ LL SG
Sbjct  237   IVEKILTCATCVKPSDLEMEQLQRQLRDAIGGKRYLLVLDDVWNEDREEWLKLKALLFSG  296

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+++VTTR  +VA+I  T   Y+L  L++ + + LF K AF   QE +   LVE+GK
Sbjct  297   GPGSKILVTTRLRQVASIMTTGLCYDLRHLTEAESWSLFGKMAFEPGQESKDLELVEVGK  356

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EI++KC  VPLA++T+G +LY + D + WL  ++NE+ K+ +    I+PILKLSY+ +  
Sbjct  357   EILKKCANVPLAIRTVGGLLYAR-DRKRWLAFKDNELAKLPETGNSIMPILKLSYNHLSS  415

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L+ CFAYC +FPK  E+ +E  I+LW+A+GF+      Q LE+ G ++F +L+ R  FQ
Sbjct  416   SLKHCFAYCALFPKDYELEKERLISLWIAEGFVVPSCERQSLEDAGEEHFMDLVQRCFFQ  475

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             ++ +   G I +C+IH+L+HDLA   AG E + +      + +  HH+    +  S  E 
Sbjct  476   NLTKDALGTIKSCRIHDLMHDLALKEAGGESIILTCDMRNLNKYTHHISSGFNLTSSWEI  535

Query  1692  PQPLLNLKNLRYFAY--SFRVGT-VSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
             P  LL L  LR F      ++GT + K+   + + NFRRLRVL L  L ++ L +SIG L
Sbjct  536   PNCLLELNRLRTFLLPEQAKLGTRIRKSVSDQLVTNFRRLRVLDLHGLGVEILSNSIGDL  595

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
               LRYL+LS N +IK+LP  IS+L NLQ L L  C +L++LP +F ++L++L+ L L
Sbjct  596   IHLRYLDLSFNSHIKTLPNSISRLQNLQVLRLSKCYRLRKLPSDF-KRLINLRCLEL  651



>ref|XP_010694946.1| PREDICTED: putative disease resistance protein RGA4 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=770

 Score =   457 bits (1177),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 284/657 (43%), Positives = 419/657 (64%), Gaps = 10/657 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L +I + ++  + S A +E++SAW  K  L KL+N+++TIK VL DA+E+Q  +H
Sbjct  1     MAEAVLYNIAQELIINMSSAAIEEVASAWGYKTHLAKLKNSINTIKDVLLDAEERQPNSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL++LR  VYDADDL D+  +L+   ++        +VR  F++ + L     ++ 
Sbjct  61    AIRGWLERLRVAVYDADDLFDEITSLTDQNEVIYGGKCTKEVRFFFSKINQLHVGSTMSR  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI EIR  L+ IA+D  NF F+      PV  G++R+Q++SFVR  DI+GR SDK +I+G
Sbjct  121   KINEIRENLDDIAKDGGNFGFRLQVNEEPV-IGRIRDQSYSFVREEDIVGRGSDKVAILG  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             ML  S  EE   +VS +PIVG+GGLGKTTL +LVYND++V  +F+ RLWV VS+ F +  
Sbjct  180   MLFGSDIEE---TVSVIPIVGIGGLGKTTLAQLVYNDEKVDDHFELRLWVCVSDMFDIKV  236

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++EKIL  AT      L+M+QLQ  L   +   RYLLVLDDVWNED+ +W  L+ LL SG
Sbjct  237   IVEKILTCATCVKPSDLEMEQLQRQLRDAIGGKRYLLVLDDVWNEDREEWLKLKALLFSG  296

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+++VTTR  +VA+I  T   Y+L  L++ + + LF K AF   QE +   LVE+GK
Sbjct  297   GPGSKILVTTRLRQVASIMTTGLCYDLRHLTEAESWSLFGKMAFEPGQESKDLELVEVGK  356

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EI++KC  VPLA++T+G +LY + D + WL  ++NE+ K+ +    I+PILKLSY+ +  
Sbjct  357   EILKKCANVPLAIRTVGGLLYAR-DRKRWLAFKDNELAKLPETGNSIMPILKLSYNHLSS  415

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
              L+ CFAYC +FPK  E+ +E  I+LW+A+GF+      Q LE+ G ++F +L+ R  FQ
Sbjct  416   SLKHCFAYCALFPKDYELEKERLISLWIAEGFVVPSCERQSLEDAGEEHFMDLVQRCFFQ  475

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             ++ +   G I +C+IH+L+HDLA   AG E + +      + +  HH+    +  S  E 
Sbjct  476   NLTKDALGTIKSCRIHDLMHDLALKEAGGESIILTCDMRNLNKYTHHISSGFNLTSSWEI  535

Query  1692  PQPLLNLKNLRYFAY--SFRVGT-VSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
             P  LL L  LR F      ++GT + K+   + + NFRRLRVL L  L ++ L +SIG L
Sbjct  536   PNCLLELNRLRTFLLPEQAKLGTRIRKSVSDQLVTNFRRLRVLDLHGLGVEILSNSIGDL  595

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
               LRYL+LS N +IK+LP  IS+L NLQ L L  C +L++LP +F ++L++L+ L L
Sbjct  596   IHLRYLDLSFNSHIKTLPNSISRLQNLQVLRLSKCYRLRKLPSDF-KRLINLRCLEL  651



>gb|KCW90390.1| hypothetical protein EUGRSUZ_A02533 [Eucalyptus grandis]
Length=804

 Score =   459 bits (1180),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 309/812 (38%), Positives = 478/812 (59%), Gaps = 21/812 (3%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   +L K+ S A +EI     +K + +KL+  L  I+ VL DA+++Q K   V+ W
Sbjct  5     VSSILGPLLEKLASPAIEEIQLLCGIKDDQEKLKRKLEMIQNVLADAEQKQTKEAAVRLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRK---LFTRPDGLIYRFKITHKI  440
             L KL++  YD +D LD+F T +L R++R  +  LT  RK   L +     I++FK+ HK+
Sbjct  65    LLKLKNFCYDIEDALDEFETRALWRRVR-LNEHLTLKRKVCYLSSWLSNFIFQFKMAHKM  123

Query  441   REIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGML  620
             +E+R RL+ I +++  F+   + +   +   +   +THSF   S +IGR+ +KE I+ +L
Sbjct  124   KELRKRLDGINKEQTKFNLSSDVHEKAIVPWR---ETHSFALASKVIGRNKEKEEIIELL  180

Query  621   MKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
             + S D    + ++ +PI+G+GG GKTTL KLVYNDDRV ++FD ++W+S+   F ++K++
Sbjct  181   IGSNDRR-PKMIAVIPILGMGGSGKTTLAKLVYNDDRVKKHFDCKIWLSMPVQFDITKIV  239

Query  801   EKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD  980
               I+ S  G    +   D LQ  L  ++ + R L ++DDV    Q  W  L +LL    +
Sbjct  240   RDIIES-LGDKEKYDKFDMLQNRLRSMVENKRCLFIMDDVREVTQEAWDKLTKLLEGVFE  298

Query  981   GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEI  1157
             GS+VIVT+++  +A+I GT   +NL+ LS  D   LF++ AF + QE    +L+ IGKEI
Sbjct  299   GSKVIVTSQNKSIASIMGTVPPHNLANLSQEDSLTLFVEYAFVQGQEKNHLDLMVIGKEI  358

Query  1158  VQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHL  1337
             V KC G P+AVK LGS+LY   +  +W ++R++E+W+++    +IL  L++SYD MP HL
Sbjct  359   VTKCRGNPMAVKALGSLLYSTKNRSDWEYVRDSEMWQLQ---IEILASLRISYDLMPSHL  415

Query  1338  RQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDV  1517
             ++CFAYC +FPK  +      I LW++ G IQS   +QELE +G QY  EL+SR  F DV
Sbjct  416   KRCFAYCSIFPKNHKFDSINLIQLWISNGLIQSNGNNQELEEIGQQYLEELMSR-SFFDV  474

Query  1518  VEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREEFP  1694
             VE  D  +L  ++H+L+++LA SVA  E  N+K    +I  +  H+ F     + ++E  
Sbjct  475   VEDID-LLLTFEMHDLIYELAISVAQTESSNIKVWTQDISSTTQHISFPDPSGVPKDELS  533

Query  1695  QPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
               L  L  +R            +K F++ ++  F+ LR L L+      LP+SIG LK L
Sbjct  534   SCLSKLSRVRTIMCEELGSSASAKFFLETSISRFKHLRALWLRGSSFDLLPTSIGNLKHL  593

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             R+L+L  N NIK LP+ + +L NLQTL+L  C+ L+ELP N  + +++L+ L +T+ +  
Sbjct  594   RFLSLKGNGNIKKLPKSVCELRNLQTLDLGGCKDLEELPANI-KNMINLRVLIITTNQRR  652

Query  2052  LQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
               +     L  L++L + +C   +   +  Q +  L +L I EC  L  LP GI++L  L
Sbjct  653   FPESGIGCLTSLRWLAIVRCENLEALFDDIQLLTSLHMLIIGECPKLASLPQGIKNLKAL  712

Query  2232  EKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             E+L I+ C+ L L        E +  LQS  L  LP+LVSLP  LK      L+ + + G
Sbjct  713   ERLCIYYCKSLRLPEGESNEPESMSRLQSFTLAELPELVSLPGWLKG-STSTLESVTIVG  771

Query  2406  CPELTALPDWLQNCTLLQRLYIEDCPELSYLP  2501
             CP L ALP+WLQNC+ L+ L I+DCPEL  LP
Sbjct  772   CPNLRALPEWLQNCSSLRTLEIQDCPELVNLP  803



>ref|XP_010269783.1| PREDICTED: disease resistance protein RGA2-like [Nelumbo nucifera]
Length=965

 Score =   463 bits (1191),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 298/663 (45%), Positives = 407/663 (61%), Gaps = 29/663 (4%)
 Frame = +3

Query  78    AETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             A   ++ I EN+L  + SL   EI+  + +  ELK L   LSTI+AVL+DA+EQQ     
Sbjct  3     AGAVISAIVENLLGSLSSLIGREIALIYGVNSELKILSRRLSTIQAVLQDAEEQQINKPA  62

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             VK WLQ L+D  YDA+D+LD+F T +L RK+ + +  +TKV  +F R        ++ HK
Sbjct  63    VKIWLQSLKDAAYDAEDVLDEFLTEALRRKMDNRA--MTKVSNIFLRS-------RMGHK  113

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGM  617
             I+ +  ++++IA +R  F+ +E+     VEN + RE T SFV  S++ GRD DKE IV M
Sbjct  114   IKRVMEKIDRIAAERSQFNLRESEVNRRVENIEGRE-TDSFVIESEVYGRDEDKEKIVKM  172

Query  618   LMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKV  797
             L+ S DE D  S+  +PIVG+GG GKTT+ +LVYNDDRV   F+ R+W+ VS+DF + K+
Sbjct  173   LISSGDEADDVSIIVIPIVGMGGQGKTTIAQLVYNDDRVKGYFNLRMWICVSDDFDVKKL  232

Query  798   IEKILRSAT-GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +  I+ SAT G      DMD LQ  L  VL    +LLVLDDVWN+D  KW  LR+ LM G
Sbjct  233   VRSIIESATAGAKCDISDMDPLQHRLQEVLWGKLFLLVLDDVWNDDHEKWDRLRKYLMCG  292

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQEYRPRNLVEI  1145
               GS+++VT+RS  VA I GT   Y L  LS  DC+ LF K AFR   E+E  P NLV I
Sbjct  293   ARGSKIMVTSRSYGVAEIMGTVEPYTLGVLSVEDCWSLFRKRAFRDRGEEEANP-NLVTI  351

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GKEIV KCGG+PLAVK L  +L CK +E+EWL +R +    IE   + ILP LKLSY+ +
Sbjct  352   GKEIVSKCGGLPLAVKALAGLLRCKKEEKEWLSVRNHRSSLIEDG-SGILPALKLSYNSL  410

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQS--PDGDQELENLGNQYFNELLSR  1499
             P  +++CFA+C +FPK  +IP+   I LW+A GFI +      +E+E++GN YFN+ L R
Sbjct  411   PSPMKRCFAFCALFPKDYKIPKNTLIQLWMAHGFIPAELSSAGKEVEDVGNDYFNDFLRR  470

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHAD---  1670
               FQDVV+   G I  CK+H+LVHDLA S+ G EC+ +  G+    ES+H  ++HA    
Sbjct  471   CFFQDVVKDESGNIKECKMHDLVHDLAGSIGGKECMTMDVGNDNWMESIHKRIYHASIYC  530

Query  1671  --NLSRE--EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
               N +RE  E    L   +NLR        G   +       L F+ LRVL L    +K 
Sbjct  531   RYNNNREPVEVFTALHKTQNLRTLLLLHHYGEFLRPL--GCSLRFKGLRVLDLHYTNIKR  588

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP SI  LK LRYLNLS+   I+ LP   + L NLQTL L+   +L E+PR+  +++++L
Sbjct  589   LPISITHLKHLRYLNLSHT-PIRKLPTTFTSLQNLQTLKLLYAYRLAEMPRDL-RKMVNL  646

Query  2019  KTL  2027
             + L
Sbjct  647   RHL  649



>ref|XP_003625117.1| hypothetical protein MTR_7g091140, partial [Medicago truncatula]
Length=999

 Score =   464 bits (1193),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 329/855 (38%), Positives = 501/855 (59%), Gaps = 42/855 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F  DI  ++L K+ S A +E S A+ +  +L++ ++TLS +  VL DA+ ++ + H
Sbjct  1     MAESFAFDIARSLLGKLASYAYEEASRAYGVYKDLQEFKDTLSIVSGVLLDAECKKDQKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL++++++ YDA+D+LD F      +++   SG    KVR LF+  + L +RFK+ 
Sbjct  61    GLREWLRQIQNICYDAEDVLDGFDLQDKRKQVVEASGSTRVKVRHLFSSSNSLAFRFKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+EIR RL+++A D   F       V+P    + RE T+  +  S +IGR +D++ I+
Sbjct  121   HQIKEIRDRLDKVAADGVMFGLTN---VDPGLVVQQREMTYPDIDTSSVIGRKNDQDQII  177

Query  612   GMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+     D +   S+  +PIVG+GGLGKTTL K V+ND R+ Q F  ++WV +S+DF
Sbjct  178   NLLMQPHPRGDGDGDNSLCVIPIVGIGGLGKTTLAKSVFNDKRMDQLFQLKMWVCISDDF  237

Query  783   SLSKVIEKILRS----------------ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLD  914
              + K+I KI+ S                A  ++  +LD+ QL   L   L   ++L+VLD
Sbjct  238   DIRKIIIKIINSATSSTLTSSSVPSSGLAQLENINNLDIVQLVSRLKQKLSGQKFLVVLD  297

Query  915   DVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFL  1094
             DVWN+D+ KW  L EL+  G  GS++IVTTRS  +A++ G    Y L GLS  DC  LF+
Sbjct  298   DVWNDDRAKWLELIELIKVGAPGSKIIVTTRSNSIASMMGDVFPYVLKGLSPKDCISLFV  357

Query  1095  KCAFREQEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKI  1271
             K AF+E E +   N VEIGKEIV+KC GVPLAV+TL S L+   D  +W  +R++E+W +
Sbjct  358   KWAFKEGEEKNYPNQVEIGKEIVKKCQGVPLAVRTLASSLFSNFDISKWEFVRDSEMWNL  417

Query  1272  EQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQ  1451
             EQK  DILP LKLSYDQMP +LRQCFAY  ++PK          NLWVA G +QS +G +
Sbjct  418   EQKINDILPALKLSYDQMPSYLRQCFAYFSLYPKDYIFNSYDIGNLWVALGLVQSLNGSE  477

Query  1452  ELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE  1631
             +LE++  +Y +E+ SR   QDV E   G I   K+H+L+HDLA  V+  + + V S    
Sbjct  478   KLESIARKYIDEMHSRSFIQDVKEI--GSICEFKVHDLIHDLALYVSREDFVAVDSHTRN  535

Query  1632  IPESVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYS-FRVGTVSKTFVKKTLLNFRRLR  1805
             IP+ V HL V   D+L  + FP+     +++R   +  F VG  S++ + K +  ++ LR
Sbjct  536   IPQQVRHLSVVKDDSLDLDLFPKS----RSVRSILFPIFGVGLESESLLNKLMSRYKYLR  591

Query  1806  VLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKEL  1985
              L L +   K +P+SI  L+ LR L+LS N  I++LP  I KL++LQ L+L  C + + L
Sbjct  592   YLGLSDSSYKTMPNSIAKLEHLRVLDLSRNGKIRTLPNSICKLLHLQVLDLGGCTEFENL  651

Query  1986  PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRV  2165
             P+  G +L+SL++L +T+++  L      +L  L+FL  + C      +     +  +  
Sbjct  652   PKGLG-KLISLRSLTVTTKQSVLPHDEFATLIHLEFLCFHYCG--NIMSLFRHQLPSVEE  708

Query  2166  LRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLV  2342
             L I  CS L  LP  I    +L  L I  CE+L+L +          ++ L LMGLP LV
Sbjct  709   LLIVSCSRLESLPLYI--FPELHTLTIDKCEKLNLLLNNESPIQTLKMKHLYLMGLPTLV  766

Query  2343  SLPAGLKDIDAMK-LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RS  2516
             +LP  +  + AM+ L+ L +   P L  LP  L   T L+RL+I +CP+L  LP  + R 
Sbjct  767   TLPEWI--VCAMETLETLAIKRLPNLKRLPVCLSTMTRLKRLFIVNCPQLLSLPSNMHRL  824

Query  2517  SSNAKVRIIDCPLLN  2561
             ++  ++ I  CP L+
Sbjct  825   TALERLHIFGCPKLS  839



>ref|XP_011038382.1| PREDICTED: putative disease resistance protein RGA4 isoform X4 
[Populus euphratica]
Length=882

 Score =   460 bits (1184),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 321/821 (39%), Positives = 470/821 (57%), Gaps = 24/821 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M+  F + I +++L K+ + A  E   AW L+ ++ +L+  LS I AVL DA+++Q+KN 
Sbjct  1     MSGPFASTIAQSLLVKLGTFAGQEFCLAWGLEADIARLEKRLSAIAAVLSDAEQKQSKND  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-VRKLFTRPDGLIYRFKIT  431
             +++ WL  LR+V+YDA+D+LD+    +L R++    G  ++ VR+ F+  + + +R K+ 
Sbjct  61    KIRFWLNDLREVLYDAEDVLDEIECETLRRQVVKTKGSTSRNVRRFFSSSNMIKFRSKMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI++I  RL +I+  +  F+  E          +  E   SF   S +IGRD DKE I+
Sbjct  121   HKIKKIIERLAEISSLKSEFNLSEQAIDRSHVLHEETEMNRSFESFSGLIGRDKDKELII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L       D      LPIVG+GGLGKT+L K V + + V  +F+ ++ V VS+DFSL 
Sbjct  181   NLLAAPSKVGDAHPF-VLPIVGMGGLGKTSLAKSVCDAENVKSHFELKMEVCVSDDFSLK  239

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +VI+KI++SATG+    LD+ +L++ L  +L   +YLL+LDDVWNED  KW  L+ LL  
Sbjct  240   QVIQKIIKSATGERCADLDVGELEKKLEEILNGRKYLLLLDDVWNEDAQKWLLLKSLLSK  299

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE--QEYRPRNLVEI  1145
             G DGS+VIVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E   E  P NLV I
Sbjct  300   GADGSKVIVTTRSQRVADIMGTVAAYNLSLLGQEDCLSLFYKCAFKEGQMELYP-NLVGI  358

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GK+IV KC  VPLAV  LG+ LY KTDE EW  +R++E W  E+K   ILP LK+SY ++
Sbjct  359   GKQIVAKCKQVPLAVINLGTQLYGKTDETEWKSVRDSEKW--EEKGDGILPALKISYQRL  416

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELLSRF  1502
             P HL++CF YC +FPK         +  W+A G I QS + + +LE +G +Y  EL+SR 
Sbjct  417   PTHLKRCFLYCSVFPKDYLFVDLQLVQFWMAHGLILQSSNRNDKLEEVGLRYVRELISRC  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLS  1679
              FQD  +     I    +H+L+HDLA S+A  E   + S + ++ +   HL V H+ +  
Sbjct  477   FFQDYEDLNYAAIFT--MHDLMHDLASSLAQNEFSIISSQNHQMSKMTRHLTVLHSYSFF  534

Query  1680  REEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVL-MLQNLELKELPSSI  1853
              E  P+   N   +R   ++   VG   KT  +K LL F+ LR L ++   E +  P  I
Sbjct  535   HETLPKFPNNFHQVRSIVFADSIVGPTCKTDFEKCLLEFKHLRFLELMYGSEFEAFPERI  594

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYL   NN +IK LP+ + KL NLQ   L+  E L+ELP++  + ++SL+ L+L
Sbjct  595   GALKHLRYLVFFNNRDIKILPKSLFKLQNLQA--LVTGEGLEELPKDV-RYMISLRYLFL  651

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
              +++  L +     L FLQ L + +C   +   E  Q +K LR L IY C+SL  LP  I
Sbjct  652   VTKQKRLPEGGIGCLQFLQTLFIVRCENLENLCEDMQGLKSLRKLVIYRCNSLISLPRSI  711

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmegleslqslllmg--------lPKLVSLPAGLKDI  2369
             + L  LE+  I  C +LDL   +  +  +     L +         LP  ++LP      
Sbjct  712   KCLTTLEEFGISECRKLDLMTIQEEKKGKIQPLSLSLSLRIVIFDDLPSTIALPEQFLQG  771

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
              A  L+   +  C ++  +P+ + N   LQ L I DCP L+
Sbjct  772   SAESLQTFIINKCQKIREMPECIGNLKKLQNLEISDCPSLN  812



>ref|XP_002519373.1| leucine-rich repeat containing protein, putative [Ricinus communis]
 gb|EEF42990.1| leucine-rich repeat containing protein, putative [Ricinus communis]
Length=1208

 Score =   469 bits (1207),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 294/661 (44%), Positives = 420/661 (64%), Gaps = 14/661 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     I  N+L  + S    EI + + +K +L+KL+NTLSTIKA L DA+E+Q K+H
Sbjct  1     MAEAVPFGIATNILMNLGSSTFQEIGATYGVKKDLRKLENTLSTIKAALLDAEERQEKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-----RSCSGILTK--VRKLFTRPDGLI  413
              V+DW++KL+DVVYDADD+LD F T +L R+L      + +GI  K  V + F+  + L 
Sbjct  61    LVQDWIRKLKDVVYDADDVLDSFATKALSRQLDTTTAAAAAGIRIKEQVSEFFSMSNQLA  120

Query  414   YRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDS  593
             +R+K+   I++IR R++ IA D   F+FK   +   V + K R QTHSFV  S+IIGRD 
Sbjct  121   FRYKMAQNIKDIRERVDDIAADMWKFNFKGRVFELGVHD-KGRGQTHSFVPTSEIIGRDR  179

Query  594   DKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS  773
             +KE IV +L  S    +   +S +PIVG+GG GKTTL +LVY D RVV +F+ R+WV V 
Sbjct  180   NKEEIVNLLTCSSSRSN---LSIVPIVGIGGSGKTTLAQLVYQDKRVVSSFEERMWVCVY  236

Query  774   EDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNL  953
             ++F +  +   I++S T    G+L++DQLQ  L   L   RYLLVLDDVW+E   +W  L
Sbjct  237   KNFDVRMIASSIVKSITKIDPGNLELDQLQSCLRENLDGKRYLLVLDDVWDESYERWVCL  296

Query  954   RELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR-EQEYRPR  1130
               LL  G  GS+++VTTRS KVA++ G +  Y L GL + DC+ LF   AF  ++E    
Sbjct  297   ESLLRIGAQGSKILVTTRSRKVASVMGISCPYVLEGLREDDCWALFEHMAFEGDKERVNP  356

Query  1131  NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKL  1310
             +L+ IGK++V++C GVPLAVK+LG+++  KT+E EWL ++ +EIW+I   + +I+P LKL
Sbjct  357   SLITIGKQMVRRCKGVPLAVKSLGNVMRTKTEETEWLTVQNDEIWRISFDDDEIMPALKL  416

Query  1311  SYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNEL  1490
             SYD +P  LRQCFA+C +FPK   I +++ I LW+A G+I S +G+Q LE+LG+QYF +L
Sbjct  417   SYDHLPIPLRQCFAFCSIFPKEYIIQKDLLIQLWIAHGYIHSTNGNQHLEDLGDQYFKDL  476

Query  1491  LSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHAD  1670
             L+R  FQ+V     G I   K+H+L+H LAQ VAG +C    +    I E VHH+     
Sbjct  477   LARSFFQEVETDEYGHIKTFKMHDLMHGLAQVVAGTDCAIAGTDVENISERVHHVSVLQP  536

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
             + S  E  + LL  K++R        G   ++     +  F+ LR L L +  +++LP +
Sbjct  537   SYS-PEVAKHLLEAKSMRTLFLPDDYGFTEESAWATLISKFKCLRALDLHHSCIRQLPYT  595

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LK LRYL+LS+N + KSLP  I  L NLQTL L NC  L+ LPR+ G +L+SL+ L 
Sbjct  596   IGKLKHLRYLDLSDNGDFKSLPCFICNLYNLQTLLLSNCTSLQCLPRDLG-KLISLRHLM  654

Query  2031  L  2033
             +
Sbjct  655   I  655


 Score = 80.5 bits (197),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 107/217 (49%), Gaps = 26/217 (12%)
 Frame = +3

Query  1926  SKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLY  2105
             S L  L++L L+  + LK LP                  E+ L   +S+ L  ++     
Sbjct  988   SPLSKLKSLQLVRIDDLKSLP------------------EIWLPNLTSLELIKIEECPRL  1029

Query  2106  KCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgeg  2285
             +C     P E ++ +  LR LRIY C +L  L  GI++L  LE+L I +CE+L LS    
Sbjct  1030  QC----LPGEGFRALTSLRTLRIYRCENLKTLSQGIQYLTALEELRIKSCEKLHLSDDGM  1085

Query  2286  megleslqs-lllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQR  2462
                       L L  +P++ SLP  ++DI    L  L +  C  L+ LP+W+ + + LQR
Sbjct  1086  QLQDLKNLHCLELNDIPRMTSLPNWIQDIPC--LLELHIEECHSLSTLPEWIGSLSSLQR  1143

Query  2463  LYIEDCPELSYLPEQIRS-SSNAKVRIIDCPLLNG*C  2570
             L I     L+ LP+ IR+ ++  ++RI +CP L+  C
Sbjct  1144  LKISYISRLTSLPDSIRALAALQQLRICNCPKLSKRC  1180



>ref|XP_010269784.1| PREDICTED: disease resistance protein RGA2-like [Nelumbo nucifera]
Length=1121

 Score =   466 bits (1199),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 295/662 (45%), Positives = 412/662 (62%), Gaps = 27/662 (4%)
 Frame = +3

Query  78    AETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHE  257
             A   ++ I EN+L  + SL   EI+  + +  EL+ L   LSTI+AVL+DA+EQQ  N  
Sbjct  3     AGAVVSAIVENLLWSLSSLIGREIALIYGVNSELEILSRRLSTIQAVLQDAEEQQINNPA  62

Query  258   VKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHK  437
             VK WLQ L+D  Y A+D+LD+F T +L RK+ + +  +TKV K+F R        ++ HK
Sbjct  63    VKIWLQSLKDAAYGAEDVLDEFLTEALRRKMGNRA--ITKVSKIFLRS-------RMGHK  113

Query  438   IREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGM  617
             I+ +  ++++IA +R  F+ +E+      EN + RE T SFV  S++ GRD DKE IV M
Sbjct  114   IKRVLEKIDRIAAERSQFNLRESEVNRRDENTEGRE-TDSFVIESEVYGRDEDKEKIVKM  172

Query  618   LMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKV  797
             L+ S DE +  S+  +PIVG+GGLGKTT+ +LVYNDDRV   F+ R+W+ VS+DF + K+
Sbjct  173   LISSGDEANDFSIIVIPIVGMGGLGKTTIAQLVYNDDRVKGYFNLRMWICVSDDFDVKKL  232

Query  798   IEKILRSAT-GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +  I+ SAT G      DMD LQ  L  VL    +LLVLDDVWNED  KW  LR+ LM G
Sbjct  233   VRSIIESATAGAKCDISDMDPLQHRLQEVLRGKLFLLVLDDVWNEDHEKWDRLRKYLMCG  292

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR---EQEYRPRNLVEI  1145
               GS++IVT+RS  VA I GT   Y+L  LS+  C+ LF + AFR   E+E  P N V I
Sbjct  293   ARGSKIIVTSRSYGVAEIMGTVEPYSLGVLSEEGCWSLFRERAFRDRGEEEANP-NXVAI  351

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GKEIV K GGVPLAVK LG +L  K +E+EWL +R++    IE+ E+ ILP LKLSY+ +
Sbjct  352   GKEIVNKYGGVPLAVKALGGLLRSKKEEKEWLSVRDHRSSLIEEDESGILPALKLSYNSL  411

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQS--PDGDQELENLGNQYFNELLSR  1499
             P  ++QCFA+C +FPK  +IP+   I LW+A GFI +      +E+E++GN+YFN+ + R
Sbjct  412   PSPMKQCFAFCALFPKDYKIPKNTLIQLWIAHGFIPAEFSSVGKEVEDVGNEYFNDFIRR  471

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA----  1667
               FQDVV+   G I  CK+H+LVHDLA S+ G EC+ +  G+    ES+H  ++HA    
Sbjct  472   CLFQDVVKDEYGNIKECKMHDLVHDLAGSIGGKECMTMDVGNDNWRESIHKRIYHASIYF  531

Query  1668  --DNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
               DN  + E    L   +NLR      +      T  +   L F+ LRVL L +  +K L
Sbjct  532   PYDNERKVEVFTALHKAQNLRTLLLMHQCW--EPTLPRGCSLRFKGLRVLDLHDTTIKTL  589

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P SI  LK LRYL+LS   +I+ LP   + L NLQTL L++  +  ELPR+  +++++L+
Sbjct  590   PISISQLKHLRYLDLSTT-SIRKLPTTFTSLQNLQTLKLLDAHRFAELPRDL-RKMVNLR  647

Query  2022  TL  2027
              L
Sbjct  648   HL  649



>ref|XP_007162214.1| hypothetical protein PHAVU_001G133600g [Phaseolus vulgaris]
 gb|ESW34208.1| hypothetical protein PHAVU_001G133600g [Phaseolus vulgaris]
Length=815

 Score =   457 bits (1175),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 315/821 (38%), Positives = 471/821 (57%), Gaps = 50/821 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++K+ S A  E S    L   L  L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAESFLFSIAESLIAKLASHAFQEASQLVGLYDNLGDLTKTLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             ++++WL +L+ V  DA+DLLD+F   +LL+K+    G    KV   F+  + L++R+K+ 
Sbjct  61    QLREWLTQLKTVFSDAEDLLDEFECQTLLKKVVKAHGSTKDKVSHFFSTSNPLLFRYKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD++GR  DKE+
Sbjct  121   QQIKDISNRLDKVAADRHKFSLQ----IIDVDTRVVHRRDMTHSRVSDSDVVGRKHDKEN  176

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +LM     +D  S+S +P+VG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF 
Sbjct  177   IIELLMPQNSNDDDTSLSVIPVVGIGGLGKTTLAKFVFNDSRIQECFPLKMWVCVSDDFD  236

Query  786   LSKVIEKILRSATGK-------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             + ++I KI+ S   +       +   LD++QLQ  L   L   ++LLVLDDVWNED+ KW
Sbjct  237   IKQLIIKIINSVNDQGAPPNQQNLNMLDLEQLQNQLTNKLSGQKFLLVLDDVWNEDRVKW  296

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               LR L+     GS+++VTTRS  +A++ GT  ++ L GLS+ D   LF+K AF+E +E 
Sbjct  297   VELRNLIQVSVSGSKILVTTRSHSIASMMGTVPSHTLEGLSEEDSLSLFVKWAFKEGEEE  356

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  +LV IG+EIV++C GVPLAV+TLGS+L+ K +  EW ++ +NEIW + QK+ DILP 
Sbjct  357   KHPHLVNIGREIVKRCKGVPLAVRTLGSLLFSKFEANEWEYVSDNEIWNLPQKKDDILPA  416

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             LKLSYD MP +LR  FA+        EI       LW A G I  P  ++ LE++ NQY 
Sbjct  417   LKLSYDLMPSYLRHDFAF-----DNYEITA-----LWGALGLIAPPKKNRTLEDVANQYL  466

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
             +ELLSR   QD      G +   +IH+LVHDLA  VA  E ++V S    IP++V H+ F
Sbjct  467   HELLSRSFLQDFSNF--GAVYNFRIHDLVHDLALFVAKDEYVHVSSSIQNIPDNVRHVSF  524

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
                NL    + + L+ ++ + +   +  V    +T +   L  F+ LRVL L +   + L
Sbjct  525   AESNLFTNLYNKKLVAVRTILFLNDAAEVNV--ETLLNMCLSKFKCLRVLKLCSATFETL  582

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
               +I  LK LRYL +  N NIK LPE I KL NL  L L NC +L+ LP    ++L+SL+
Sbjct  583   SRTIAKLKHLRYLEIGQNLNIKKLPESICKLQNLLILKLENCTELEALPIGL-RKLISLR  641

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L  ++++  L   + ++               +FPA        L+VL + +C SL   
Sbjct  642   HLEFSTKQFILPD-NEIATNLESIF-----GDVEFPA--------LKVLSVVDCQSLKSF  687

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSV-----gegmegleslqslllmglPKLVSLPAGLKD  2366
                 +   +LE L I +C  LDL +      E       L+++L   L +LV+LP  L++
Sbjct  688   RLDGKKFPELETLAIHSCGNLDLELWKVNHLEEQSHKLKLKTVLFSNLSQLVTLPKWLQE  747

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPEL  2489
               A  L+ L + GC  +  LPDWL   + L+ L I+ C +L
Sbjct  748   A-ANSLQGLLIIGCDNIQTLPDWLTTMSDLKTLMIDGCHDL  787



>ref|XP_010024364.1| PREDICTED: disease resistance protein RGA2-like [Eucalyptus grandis]
 gb|KCW90373.1| hypothetical protein EUGRSUZ_A02513 [Eucalyptus grandis]
Length=821

 Score =   457 bits (1175),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 313/818 (38%), Positives = 484/818 (59%), Gaps = 24/818 (3%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F++ I   ++ K+ S A +EI     +K + +KL+NTL  I+ VL DA+++Q K   V+ 
Sbjct  4     FVSSILGTLVEKLTSSAVEEIQLVCGVKDDREKLKNTLEMIQKVLIDAEQKQKKEEAVRL  63

Query  267   WLQKLRdvvydaddllddFGTLSLLRKLRSCSGIL--TKVRKLFTRPDGLIYRFKITHKI  440
             WL +L++  YD +D LD+F   +L R++RS   +    KV  L++    +I +FK+ H +
Sbjct  64    WLLRLKNWCYDTEDALDEFEARALWRRVRSTEHLTLKRKVCYLYSWISEMILQFKMAHNM  123

Query  441   REIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGML  620
             +E+R  L+ I +D+  F+   +     +     R +THSFV  S++IGR+ +KESI+  L
Sbjct  124   KELRKSLDGIDKDKTQFNLSADILERTIVP---RRKTHSFVPTSNVIGRNKEKESIIEWL  180

Query  621   MKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNF-DTRLWVSVSEDFSLSKV  797
                    D E++    I+G+GG GKTTL KLVYND+ V ++F + ++W+S+  +F +  +
Sbjct  181   -----RSDAEAIEVFSIIGMGGAGKTTLTKLVYNDEWVNEHFKNNQVWLSMPLEFKIENI  235

Query  798   IEKILRSATGKS-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             I  I++S +G++   + ++D LQE L  ++ + R L V+DDVW   ++ W  L +LL   
Sbjct  236   IRGIIKSLSGEANVDNYNLDMLQERLRNLVKNRRCLFVMDDVWAMSRNDWLELTDLLGGL  295

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+VI+T+R   +A   GT    +L  LS  D   LF+K AF + QE    +L++IGK
Sbjct  296   SKGSKVILTSRDQAIAKNMGTVRLLHLVNLSSEDSLTLFVKYAFDQGQEKNHLDLMKIGK  355

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EIV+KCGG P+A++ LG +LY K ++++W HIR++E W++   E  ILP L++SYD MP 
Sbjct  356   EIVKKCGGNPMALRALGCLLYSKNNQRDWAHIRDSETWQLPSLE--ILPSLRISYDLMPS  413

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L++CFAYC +FPK  E      I LW++ GFIQS   +QELE +G QY  ELLSR  F 
Sbjct  414   YLKRCFAYCSIFPKNHEFDNIELIELWISNGFIQSSRNNQELEEIGRQYLEELLSRSFFN  473

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA-DNLSREE  1688
              V + +   IL  ++H+L+++LA SVA  E  N+K    +I  ++ H+ F A   + ++E
Sbjct  474   VVRDNY--PILYFEMHDLIYELAISVAQTESSNMKVWTQDISPTIRHVSFPALSGVPKDE  531

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKTFVKKT-LLNFRRLRVLMLQNLELKELPSSIGFLK  1865
                       +R         + S+ F  +T +L F+ LRVL L++     LPSSIG LK
Sbjct  532   LSGCFNKPSRIRTIKCQKLGSSDSEEFFLETCILRFKHLRVLWLEDSSFDLLPSSIGDLK  591

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQE  2045
              LRYLNLS    IK LP+ + +L NLQ L+L  CE L EL  +  + +++L++LY+T+++
Sbjct  592   HLRYLNLSFG-TIKKLPKSVYELRNLQILDLARCENLAELSADI-KNMINLRSLYITTKQ  649

Query  2046  VSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLA  2225
                 +     +  L+ L +  C   +      Q +  LR+LRI EC  L  LP GI++L 
Sbjct  650   KHFPESGIGRVTSLRRLFIVGCENLEALFNDIQSLTSLRMLRIMECPKLASLPQGIKNLK  709

Query  2226  KLEKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
              LE L+I  CE L L          + SLQSL+L  LP+LVSLP  L+   A  L+ + +
Sbjct  710   ALEDLYICYCESLRLPEGDSNEPGSMSSLQSLVLWRLPELVSLPGWLEG-SASTLRTIAI  768

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
               CP+L+ALP+WLQNC+ L +L +   PELS LP+ +R
Sbjct  769   FDCPQLSALPEWLQNCSSLTKLELRWLPELSSLPDGVR  806



>gb|KEH32275.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=797

 Score =   455 bits (1171),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 321/821 (39%), Positives = 480/821 (58%), Gaps = 61/821 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+ + K+ S+A  E S + ++  +L++++ T+S +KAVL DA+++Q +N+
Sbjct  1     MAESLLFGVAESFIGKLASVAVQEASLSLSVYKDLQEIKKTVSLVKAVLLDAEQKQWQNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WL++++ V YDA+D++DDF   +L + + + SG I  KV+  F+  + L+YRF++ 
Sbjct  61    ELREWLKQIKRVFYDAEDVIDDFECEALRKHVINTSGSIRRKVKCFFSNSNPLVYRFQMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ I+ R +++A DR  F  + N   N V   K RE THS+V  SD+IGR+ DK+ I+
Sbjct  121   HQIKHIKERFDKVAADRLKFGLQINDSDNRVV--KRRELTHSYVIDSDVIGREHDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              ML++  D  D+ S+S +P+VG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  179   DMLLQ--DSGDSNSLSVIPVVGIGGLGKTTLAKAVFNDKSLDETFPLKMWVCVSDDFELK  236

Query  792   KVIEKILRSAT------------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
              ++ KIL +A+             +SF +LD++QLQ  L  V+   ++LLVLDDVWNED+
Sbjct  237   NLLVKILNAASVSGSSADPNPIHQESFTNLDLEQLQNRLRNVIAGKKFLLVLDDVWNEDR  296

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQ  1115
              KW  L+ L+  G + S+V+VTTRS  +A + GT T+Y L GLS  D   +F+K AF+E+
Sbjct  297   VKWVELKYLIQVGAEESKVLVTTRSHSIAKMMGTNTSYILEGLSLEDSLSVFVKWAFKEE  356

Query  1116  EYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDI  1292
             E +    LVEIGKEIVQKCGG+PLA++TLGS L+ K D +EW  IR++EIW + QKE DI
Sbjct  357   EEKKYPELVEIGKEIVQKCGGLPLALRTLGSSLFLKFDVEEWKFIRDSEIWNLPQKEDDI  416

Query  1293  LPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGN  1472
             LP LKLSYDQ+P +L+QCFA   +F K  +        LWVA GF+  P   + LE++  
Sbjct  417   LPGLKLSYDQLPSYLKQCFACFSLFEKNFDFSNFHVSVLWVALGFLPPPSRGKTLEDMNI  476

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             Q+  EL SR   Q+  + F G     K+H+LVHDL+  VA  E   +K  +  I E+V H
Sbjct  477   QFVYELQSRSFLQNFRD-FGGGFCGFKLHDLVHDLSLYVARDEFQLLKFHNENILENVLH  535

Query  1653  LVF-HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
             L F   D L     P  L  L         F  G  ++ F+K  +   + LRVL L +  
Sbjct  536   LSFLKNDLLGLTPVPTGLRTL--------IFPKGANNEAFLKTLVSRCKFLRVLQLPDST  587

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP SIG LK LRYLNL  +  +KSLP+ + KL NL TL L  C +LK+LP   G  L
Sbjct  588   YESLPRSIGKLKHLRYLNLGKSKELKSLPDSLCKLQNLYTLKLNGCIKLKKLPNGIG-NL  646

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
             +SL+ L +T+++ +L ++    L  L+ L +  C   +        +  L+ L I  C +
Sbjct  647   ISLRQLIITTKQYTLPEKEIAKLTCLEILSVNSCDNLETLLLEGIQLSNLKWLGISSCGN  706

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDI  2369
             L  +P  +  +  LE L+I NC +L  S                               I
Sbjct  707   LKSMPLHV--IPNLEWLFITNCHKLKFSFHNE-------------------------NQI  739

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNC-----TLLQRLYIED  2477
               +KLK L +   P+L + P+WL+ C     TL+ + Y+ED
Sbjct  740   PKLKLKLLSLESLPQLVSFPEWLKGCADTLNTLIVQNYVED  780



>ref|XP_007162223.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
 gb|ESW34217.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
Length=701

 Score =   452 bits (1162),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 290/694 (42%), Positives = 418/694 (60%), Gaps = 28/694 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  I E++++KI S A  E S    L   L+ L  TLS +KAVL DA ++Q  NH
Sbjct  1     MAESFLFSIAESLIAKIASHAFQEASRLVGLYDNLRDLIETLSLVKAVLLDAQQKQEHNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             ++  WL +L+ V  DA+DLLD+F   +L +K+    G    KV   F+  + L++R+++ 
Sbjct  61    QLSQWLTQLKTVFSDAEDLLDEFECQTLRKKVVKAHGSTKDKVSHFFSTSNPLLFRYQMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I++I  RL+++A DR  F  +    +  V+   +  R+ THS V  SD+IGR  DKE 
Sbjct  121   QQIKDISNRLDKVAADRHKFSLQ----IIDVDTRVVHRRDMTHSRVNDSDVIGRKHDKEK  176

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             I+ +LM+    +D  S+S +PIVG+GGLGKTTL K V+ND R+ + F  ++WV VS+DF 
Sbjct  177   IIELLMQQNSNDDDTSLSVIPIVGIGGLGKTTLAKFVFNDSRIQECFPLKMWVCVSDDFD  236

Query  786   LSKVIEKILRSATGK-------SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             + ++I KI+ SA+ +       +   LD++QLQ  L   LC  ++LLVLDDVWNED+ KW
Sbjct  237   IKQLIIKIINSASDQDAPPHQQNLNMLDLEQLQNQLKNKLCGQKFLLVLDDVWNEDRVKW  296

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQE  1118
               LR L+  G  GS+++VTTRS  +A++ G+  ++ L GLS+ D   LF+K AF+  E+E
Sbjct  297   VELRNLIQVGAAGSKILVTTRSHSIASMMGSVPSHILEGLSEEDSLSLFVKWAFKGGEEE  356

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
               P  LV IG+EIV+KC GVPLAV+TL S+L+ K +  EW ++R+NEIW + Q++ DILP
Sbjct  357   KHPY-LVNIGREIVKKCRGVPLAVRTLSSLLFSKFEANEWEYVRDNEIWNLPQRKGDILP  415

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD MP +LRQCFA   ++PK  +       +LW A G I  P  ++ LE++ NQY
Sbjct  416   ALKLSYDLMPSYLRQCFALFSLYPKDYDFTSVEMTSLWGALGLIAVPIKNRTLEDVANQY  475

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
             ++ELLSR   QD      G +   +IH+LVHDLA  VA  ECL+V S    IP+ V H+ 
Sbjct  476   WHELLSRSFLQDFTNF--GTVYCFRIHDLVHDLALFVAKDECLHVSSNIQSIPDKVRHVS  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV---SKTFVKKTLLNFRRLRVLMLQNLE  1829
             F    L        L+N K+       F  G      +  +   L  F+ LRVL L++  
Sbjct  534   FGESRLFGN-----LVNKKSAAVRTVLFPNGAADANGEALLNMCLSKFKCLRVLNLRSAT  588

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
              + LP SI  LK LRYL++S N NIK LPE I KL +LQ L L  C +L+ LP+   ++L
Sbjct  589   FETLPRSIAKLKHLRYLDISKNLNIKRLPESICKLQSLQGLMLDGCMELEALPKGL-RKL  647

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC  2111
             +SL+ L  + ++  L       LG L+ L +  C
Sbjct  648   ISLRYLEFSIKQTVLPLNEIAKLGSLEVLNVESC  681



>ref|XP_006490004.1| PREDICTED: putative disease resistance protein RGA4-like [Citrus 
sinensis]
Length=660

 Score =   450 bits (1158),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 256/602 (43%), Positives = 365/602 (61%), Gaps = 16/602 (3%)
 Frame = +3

Query  798   IEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             + KI+ S  G + G+LD D+LQ+ L   L   RYLLV+DDVWNED   W  L+ LL+ G 
Sbjct  1     MTKIINSVIGGNHGNLDPDRLQKVLRDSLNGKRYLLVMDDVWNEDPRAWGELKSLLLGGA  60

Query  978   DGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIG  1148
             +GS+++VTTRS KVA I GT   TT YNL  L   DC  LF+KCAF+E + +  NLV+IG
Sbjct  61    EGSKILVTTRSNKVALIMGTMRGTTGYNLQELPYKDCLSLFMKCAFKEGKEKHPNLVKIG  120

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             ++I++KC G+PLAV+T+GS+LY  TDE +W H+R+N+IWK+ Q   DILP L+LSYDQ+P
Sbjct  121   EKIMEKCRGIPLAVRTVGSLLYGSTDEHDWEHVRDNDIWKLRQAPDDILPALRLSYDQLP  180

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCFAYC +FPK  +      +  W+AQG +QSP+ ++ELE +G +YF EL SR  F
Sbjct  181   PHLKQCFAYCSIFPKDYKFASVHLVQFWMAQGLLQSPNENEELEKIGMRYFKELCSRSFF  240

Query  1509  QDVVEAFDG-EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             QD+ +   G E+  C+IH+L+HDLA  VA  ECL V S    IP+SV HL F + N  R 
Sbjct  241   QDLGDLLPGLEVFNCQIHDLMHDLALLVAKGECLMVNSAGQSIPKSVRHLSFVSANALRN  300

Query  1686  EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
             +F   L +L  +R           S++FV   +   + LRVL+L N  ++ LP  +G L+
Sbjct  301   DFASFLPDLGRVRTIMLPIDDERTSQSFVTSCISKSKSLRVLVLMNSAIEVLPRKMGNLR  360

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQE  2045
             QLR+L+LS N  IK LP  I +L +LQTLNL +C +L+ELP++  + L+SL+   +T+++
Sbjct  361   QLRHLDLSGNRKIKKLPNSICELQSLQTLNLGDCLELEELPKDI-RYLVSLRMFVVTTKQ  419

Query  2046  VSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLA  2225
              SL +     L  L+FL++  C   ++  E    +  LR L I  C  L  LP  +++L+
Sbjct  420   KSLLESGIGCLSSLRFLMISDCGNLEYLFEDIDQLSVLRSLVINSCPRLISLPPAMKYLS  479

Query  2226  KLEKLWIWNCEELDLSVgegme----------gleslqslllmglPKLVSLPAGLKDIDA  2375
              LE L +  CE LDL++   ME              L++L +  L +L+ LP  L    +
Sbjct  480   SLETLILLKCESLDLNLNMEMEEEGSHHDCNNVRSHLRTLCVAELTQLLELPQWLLQGSS  539

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRII-DCP  2552
               L+ L +  CP   ALP  L++   L+ L I  CP+LS LPE +   +  K   I +CP
Sbjct  540   KTLQMLTIGDCPNFMALPRSLKDLEALENLLITSCPKLSSLPEGMHHLTTLKTLAIEECP  599

Query  2553  LL  2558
              L
Sbjct  600   AL  601



>ref|XP_010024476.1| PREDICTED: putative disease resistance protein RGA3 [Eucalyptus 
grandis]
Length=844

 Score =   456 bits (1173),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 308/809 (38%), Positives = 477/809 (59%), Gaps = 21/809 (3%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   +L K+ S A +EI     +K + +KL+  L  I+ VL DA+++Q K   V+ W
Sbjct  5     VSSILGPLLEKLASPAIEEIQLLCGIKDDQEKLKRKLEMIQNVLADAEQKQTKEAAVRLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRK---LFTRPDGLIYRFKITHKI  440
             L KL++  YD +D LD+F T +L R++R  +  LT  RK   L +     I++FK+ HK+
Sbjct  65    LLKLKNFCYDIEDALDEFETRALWRRVR-LNEHLTLKRKVCYLSSWLSNFIFQFKMAHKM  123

Query  441   REIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGML  620
             +E+R RL+ I +++  F+   + +   +   +   +THSF   S +IGR+ +KE I+ +L
Sbjct  124   KELRKRLDGINKEQTKFNLSSDVHEKAIVPWR---ETHSFALASKVIGRNKEKEEIIELL  180

Query  621   MKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVI  800
             + S D    + ++ +PI+G+GG GKTTL KLVYNDDRV ++FD ++W+S+   F ++K++
Sbjct  181   IGSNDRR-PKMIAVIPILGMGGSGKTTLAKLVYNDDRVKKHFDCKIWLSMPVQFDITKIV  239

Query  801   EKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCD  980
               I+ S  G    +   D LQ  L  ++ + R L ++DDV    Q  W  L +LL    +
Sbjct  240   RDIIES-LGDKEKYDKFDMLQNRLRSMVENKRCLFIMDDVREVTQEAWDKLTKLLEGVFE  298

Query  981   GSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEI  1157
             GS+VIVT+++  +A+I GT   +NL+ LS  D   LF++ AF + QE    +L+ IGKEI
Sbjct  299   GSKVIVTSQNKSIASIMGTVPPHNLANLSQEDSLTLFVEYAFVQGQEKNHLDLMVIGKEI  358

Query  1158  VQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHL  1337
             V KC G P+AVK LGS+LY   +  +W ++R++E+W+++    +IL  L++SYD MP HL
Sbjct  359   VTKCRGNPMAVKALGSLLYSTKNRSDWEYVRDSEMWQLQ---IEILASLRISYDLMPSHL  415

Query  1338  RQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQDV  1517
             ++CFAYC +FPK  +      I LW++ G IQS   +QELE +G QY  EL+SR  F DV
Sbjct  416   KRCFAYCSIFPKNHKFDSINLIQLWISNGLIQSNGNNQELEEIGQQYLEELMSR-SFFDV  474

Query  1518  VEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREEFP  1694
             VE  D  +L  ++H+L+++LA SVA  E  N+K    +I  +  H+ F     + ++E  
Sbjct  475   VEDID-LLLTFEMHDLIYELAISVAQTESSNIKVWTQDISSTTQHISFPDPSGVPKDELS  533

Query  1695  QPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
               L  L  +R            +K F++ ++  F+ LR L L+      LP+SIG LK L
Sbjct  534   SCLSKLSRVRTIMCEELGSSASAKFFLETSISRFKHLRALWLRGSSFDLLPTSIGNLKHL  593

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             R+L+L  N NIK LP+ + +L NLQTL+L  C+ L+ELP N  + +++L+ L +T+ +  
Sbjct  594   RFLSLKGNGNIKKLPKSVCELRNLQTLDLGGCKDLEELPANI-KNMINLRVLIITTNQRR  652

Query  2052  LQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
               +     L  L++L + +C   +   +  Q +  L +L I EC  L  LP GI++L  L
Sbjct  653   FPESGIGCLTSLRWLAIVRCENLEALFDDIQLLTSLHMLIIGECPKLASLPQGIKNLKAL  712

Query  2232  EKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAG  2405
             E+L I+ C+ L L        E +  LQS  L  LP+LVSLP  LK      L+ + + G
Sbjct  713   ERLCIYYCKSLRLPEGESNEPESMSRLQSFTLAELPELVSLPGWLKG-STSTLESVTIVG  771

Query  2406  CPELTALPDWLQNCTLLQRLYIEDCPELS  2492
             CP L ALP+WLQNC+ L+ L I+DCPELS
Sbjct  772   CPNLRALPEWLQNCSSLRTLEIQDCPELS  800



>ref|XP_006371429.1| hypothetical protein POPTR_0019s10300g, partial [Populus trichocarpa]
 gb|ERP49226.1| hypothetical protein POPTR_0019s10300g, partial [Populus trichocarpa]
Length=1163

 Score =   464 bits (1195),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 282/624 (45%), Positives = 403/624 (65%), Gaps = 13/624 (2%)
 Frame = +3

Query  174   ELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLR  353
             EL+KL+NT S IKA+  DA+EQQ K+HEV+DWLQKL+D +YDADDLLDDF T  L ++L 
Sbjct  22    ELEKLRNTASVIKAIFLDAEEQQTKSHEVRDWLQKLKDAIYDADDLLDDFSTEMLQQQLM  81

Query  354   SCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENG  533
                    +V   F++     Y F ++ KI+ IR RLN IA DR  FH  ++    P    
Sbjct  82    MQDKKAIEVCAFFSKIKKTAYGFSMSCKIKAIRERLNDIASDRSKFHLTDHPRQMPSVIA  141

Query  534   KLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvkl  713
             + REQTHSFV   +++GR+ DK +IV +L+ S  EE+   VS +P+VG+GGLGKTTLV+L
Sbjct  142   E-REQTHSFVCVEEVVGREDDKLAIVELLLHSNTEEN---VSVIPVVGIGGLGKTTLVQL  197

Query  714   vYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSG  893
             VYN +++ ++F+ R+WV VS+ F +  +++KIL SAT      L+MD L   L   +   
Sbjct  198   VYNSEKIRRHFELRIWVCVSDVFDVKLIVQKILESATNTKCDGLEMDSLLTRLGKEIDGK  257

Query  894   RYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDH  1073
             ++LL+LDDVWN+++ +W  LR+LLM G  GS+V+VTTR+  +ATITGT   Y L  LS+ 
Sbjct  258   KFLLILDDVWNDNRERWLKLRDLLMGGARGSKVVVTTRTQLIATITGTAKPYFLRSLSED  317

Query  1074  DCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIR  1250
             + + LF K AF++ +E+    LV IGKE+V+KC GVPLA++T+GS+LYCK  E EWL  +
Sbjct  318   ESWSLFEKLAFKQGKEFENTRLVAIGKEVVKKCAGVPLAIRTMGSLLYCKDTETEWLSFK  377

Query  1251  ENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI  1430
             + ++  I Q E DILPILKLSY+ +P  L+ CFAYC +FPK  EI ++  I LW+AQGF+
Sbjct  378   DRDLSMIPQNENDILPILKLSYELLPPCLKNCFAYCSLFPKDYEINKQTLIKLWMAQGFL  437

Query  1431  QSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLN  1610
             Q  DG Q LE  G+Q F +L  R  FQD+     G++++C++H+L+HDLA  V G+E   
Sbjct  438   QPADGMQHLEEAGHQCFMDLARRSFFQDLEYGEWGDVVSCRMHDLMHDLALLVGGSESSA  497

Query  1611  VKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKT---  1781
             V S    I E + H+    +  S ++ P  L     +R F     V  V +  + +    
Sbjct  498   VDSNAENICERIRHVSLDFELDSSQKIPPSLFKANKIRTFV--LPVQPVYRKILNQAPHD  555

Query  1782  --LLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLN  1955
               + +FR LR L   N  +  +PSSI  LK LRYL+LS N ++K LP CI++L NLQTL 
Sbjct  556   TIISSFRCLRALDFHNTGVDIVPSSISKLKHLRYLDLSKNEDLKRLPRCITRLKNLQTLK  615

Query  1956  LINCEQLKELPRNFGQQLMSLKTL  2027
             L +C++L+ LPR+   +++SL+ L
Sbjct  616   LSSCKRLEALPRHIS-KMISLRHL  638


 Score = 84.7 bits (208),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 103/190 (54%), Gaps = 10/190 (5%)
 Frame = +3

Query  2046  VSLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHL  2222
             VS+ +    +L +L+ L +  C +    P E  + ++ LR L I  C SLT L  G+++L
Sbjct  970   VSMSEVGLQNLTYLEHLTIENCPNLSSLPEESLRGLRSLRSLSIRGCGSLTSLFLGLQYL  1029

Query  2223  AKLEKLWIWNCEELDLS-----VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLK  2387
               LE+L I  C  LD+S           GL+SL+ L +  +P+L S+P G+ ++ +  L+
Sbjct  1030  TSLEELEIKECRALDMSDCDEENSLQFRGLKSLRRLKIGYMPQLESIPDGIHEVTS--LQ  1087

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIIDCPLLNG*  2567
              L++ GC  L  LP+W+    LLQRL I DCPEL+ LP+    +    + I +CP L   
Sbjct  1088  DLKIEGCVGLKTLPEWIHELKLLQRLDISDCPELNSLPQGCMKALQI-LEIYNCPKLLRI  1146

Query  2568  CGDTGTRLSW  2597
             C +T T + W
Sbjct  1147  C-ETRTSMDW  1155



>ref|XP_004292330.1| PREDICTED: disease resistance protein RGA2-like [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   456 bits (1174),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 324/856 (38%), Positives = 477/856 (56%), Gaps = 30/856 (4%)
 Frame = +3

Query  87    FLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKD  266
             F   I ENVL ++ S A  E+S AW  + EL KL  TLSTI  VL+DA+++Q KN  +  
Sbjct  3     FAISIAENVLGRLASYASLEVSLAWGTQLELTKLTKTLSTINLVLQDAEKKQVKNLLIAH  62

Query  267   WLQKLRdvvydaddllddFGTLSLLRKL--RSCSGILTKVRKLFTRPDGLIYRFKITHKI  440
             WL KL+DV YD DD+LD+     L +K+   +   +  +VR  F+R +  ++ FK+ +K+
Sbjct  63    WLGKLKDVCYDVDDVLDELEFQKLRKKVLANNHGHVKGQVRHFFSRWNPTVFNFKMGYKV  122

Query  441   REIRGRLNQIAEDRRNFHF------KENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
             +EIR RL +I  ++R F         E++ V P      + +T S V  S+IIGRD DKE
Sbjct  123   KEIRKRLVEIDNEKRQFSLVEVPKIAEDHSV-PQRMQYNQRETDSLVEASEIIGRDDDKE  181

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              I   L+ + D  + E+VS + I+GLGGLGKTTL KLVYND  V +NF+ ++WV VSE+F
Sbjct  182   LIFSHLLHNTDISNEENVSVISILGLGGLGKTTLAKLVYNDSMVEENFEVKMWVCVSENF  241

Query  783   SLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ-----HKWK  947
              +  +I KI+ +A  +      +D+++  L+  L   ++LLVLDDVW+         KW 
Sbjct  242   EVKSLILKIINAAIDQKCEDESLDRMKRRLHDTLRGRKFLLVLDDVWDTKSIGVTPEKWL  301

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYR  1124
              L+ LL  G +GSR++VTTR+  VA +   +  ++L GL   DC  LF+K AF++ +E R
Sbjct  302   GLKSLLCVGANGSRILVTTRNRSVALLMNPSYMHSLKGLPHKDCMSLFIKRAFKKGEEQR  361

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
               +L+EIG++IV KCG VPLAV TLGSMLY   +   WL +R++++W I      ILP L
Sbjct  362   YPHLIEIGEDIVNKCGRVPLAVATLGSMLYLNKEPDRWLSVRDDDMWSIGNDH--ILPAL  419

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             KLSYD +P HL+ CFA+C +FPK  E   +  + LWVAQG++++   +++L+ +G  Y  
Sbjct  420   KLSYDALPQHLKPCFAFCSLFPKDFEFDSDSLVELWVAQGYLKTCKKNEDLDKMGMDYIR  479

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             +  SR  FQ  VE      +  K+H+LVHD+A SVA  E   +        E V H+   
Sbjct  480   QFCSRSLFQ--VEGDYKTKMKFKLHDLVHDIAISVAQTEYSTINFRPSSAFEMVRHVSIS  537

Query  1665  ADNLSREEFPQPLLNLKNLRYFAYSFRVG---TVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
               +L REE   P    K+ +   +    G    +++ FVK  +  F+ +RVL L    L 
Sbjct  538   EKDLLREEAKVPNFIYKSTKLRTFLIPSGDGKMMNQHFVKTCISRFKYMRVLDLSGSPLD  597

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
             +LPSS+G L  LR+L+LS+N  IK LP  I  L+NL++L L  C  L+E+P++ G  L++
Sbjct  598   KLPSSVGRLFHLRFLDLSSNDKIKRLPNSICNLLNLESLILNQCTALEEIPKDIG-NLIN  656

Query  2016  LKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLT  2195
             L++L +T+Q+  L K  S  L  LQ L   +C       E  + +  LR L I  C +L 
Sbjct  657   LRSLVITTQQKYLPKGIS-RLTSLQLLYFVECVNLMTLGEEIRFLTNLRSLVISHCENLE  715

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDA  2375
              LP  I+    L  L I  C++LD                  +    L +LP  L+D  A
Sbjct  716   SLPPNIKLWTALNSLHIHECKKLDF---MKTREGPQGLRSFGILTSDLEALPPWLED-SA  771

Query  2376  MKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCP  2552
               L+ + V  C  LT LP  LQ  T L++L+I  C  L  LP+ +   +  + ++I DCP
Sbjct  772   KVLQSIVVVRCDNLTELPK-LQKFTFLEQLFIVSCSNLLALPQGLHCLTELRELKIKDCP  830

Query  2553  LLNG*CGDTGTRLSWS  2600
              L+  C        WS
Sbjct  831   KLSKSCKRQLKGEDWS  846



>emb|CBI23411.3| unnamed protein product [Vitis vinifera]
Length=795

 Score =   453 bits (1165),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 287/746 (38%), Positives = 434/746 (58%), Gaps = 44/746 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+FL  I +NV+ KI S+   EI  AW +K EL+KL+ TL+ IK+VL DA+E+Q K+ 
Sbjct  1     MTESFLFSIADNVVGKIGSVTLQEIGLAWGVKTELQKLEATLTAIKSVLLDAEEKQWKDR  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++DWL KL+ V YD +D+LD+    +L R++ S   + TKV   F+  + L + FK+ H
Sbjct  61    QLRDWLGKLKHVCYDVEDVLDESEYQALQRQVVSHGSLKTKVLGFFSSSNPLPFSFKMGH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I+E+R RL+ IA DR  F+ +      P+     RE TH FV  SD+IGRD DKE ++ 
Sbjct  121   RIKEVRERLDGIAADRAQFNLQTCMERAPL---VYRETTH-FVLASDVIGRDKDKEKVLE  176

Query  615   MLMKS---------CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVS  767
             +LM S          +E + E    +    LG      ++  ++N+DR       + W+ 
Sbjct  177   LLMNSRGSGTGLLKYNELNLEQSQTVLRTTLGNENFFLVLDDMWNEDR-------QKWIE  229

Query  768   VSEDFSLSKVIEKILRSATG-KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKW  944
             +            ++  A G K +  L+++Q Q  L   L +  + LVLDD+WNED  KW
Sbjct  230   LKT---------LLMNGAKGNKIYNELNLEQSQTVLRTTLGNENFFLVLDDMWNEDCQKW  280

Query  945   KNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEY  1121
               L+ LLM+G  G++++VTTR   VA+I GT  AY L GL   DC  +FLK AF E QE 
Sbjct  281   IELKTLLMNGAKGNKIVVTTRGHPVASIMGTVQAYILEGLPHVDCLSVFLKWAFNEGQEK  340

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPI  1301
             +  NLV+IG +IV+KC GVPLA +TLGS+L+ K + ++WL +R+N+IWK+EQKE DILP 
Sbjct  341   QHPNLVKIGDDIVKKCNGVPLAARTLGSLLFSKFEPRDWLDVRDNDIWKLEQKEGDILPA  400

Query  1302  LKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYF  1481
             L+LSY+Q+P +L+ CFAYC +FPK   +  E  + +W A+G I+     QEL+++GN+Y 
Sbjct  401   LRLSYEQLPSYLKCCFAYCSIFPKDYVLDNESLVCIWSAKGLIEPSKKKQELDDIGNRYI  460

Query  1482  NELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
              E+LSR  FQD  +         K+H+L+HDLA  ++  EC  +    P +   V H+ F
Sbjct  461   KEMLSRSFFQDFEDHH--YYFTFKMHDLMHDLASFISQTECTLIDCVSPTVSRMVRHVSF  518

Query  1662  HADNLSREEFPQPLLNLKNLRYFAYSFRVGTV-SKTFVKKTLLNFRRLRVLMLQNLELKE  1838
               D L  +E  + +  L ++R   + F + T   + F+K  +  F+ +++L L       
Sbjct  519   SYD-LDEKEILRVVGELNDIRTIYFPFVLETSRGEPFLKACISRFKCIKMLDLTGSNFDT  577

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP+SI  LK LR+LNLS N  IK LP  + KL +LQT +L  CE  + LP++FG  L++L
Sbjct  578   LPNSINNLKHLRFLNLSLNKRIKKLPNSVCKLFHLQTFSLQGCEGFENLPKDFG-NLINL  636

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQ---FLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
             + L +T     +++R+   +G L+    L ++ C   +F  +  Q +  LR L+I  C S
Sbjct  637   RQLVIT-----MKQRALTGIGRLESLRILRIFGCENLEFLLQGTQSLTALRSLQIGSCRS  691

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELD  2267
             L  L   ++ L  LE L I +CE L+
Sbjct  692   LETLAPSMKQLPLLEHLVIIDCERLN  717



>ref|NP_001064207.1| Os10g0161400 [Oryza sativa Japonica Group]
 gb|AAL77135.1|AC097447_1 Putative NBS-LRR type resistance protein [Oryza sativa Japonica 
Group]
 gb|AAN04216.1| Putative NBS-LRR type resistance protein [Oryza sativa Japonica 
Group]
 gb|AAP52240.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26121.1| Os10g0161400 [Oryza sativa Japonica Group]
 gb|EAY77780.1| hypothetical protein OsI_32818 [Oryza sativa Indica Group]
 gb|EAZ15382.1| hypothetical protein OsJ_30794 [Oryza sativa Japonica Group]
Length=804

 Score =   452 bits (1162),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 316/808 (39%), Positives = 485/808 (60%), Gaps = 21/808 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDE----ISSAWNLKPELKKLQNTLSTIKAVLRDADEQQ  242
             MAE  L+    +++ KI+    +     I S  ++  EL KLQN+L  I  VL DA+ +Q
Sbjct  1     MAEVLLSSFAVSIIGKIILFVSEHGLMGIKSDRSVHQELGKLQNSLQAISGVLLDAERKQ  60

Query  243   AKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTK-----VRKLFTRPDG  407
             + +  +K+WL+KL+DV+YD DD+LDD  T +L R  R    ++T+     + +L  R   
Sbjct  61    STSSALKEWLRKLKDVMYDIDDILDDASTETLKR--RVSKDVVTQTNCVHISRLKLRRKL  118

Query  408   LIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGR  587
             L  + K + +IRE+  +LN+IA  +++F   + + V    + +   +++SFV   DIIGR
Sbjct  119   LKRKKKWSSRIREVHEKLNEIAASKKDFGLTD-WTVGGQCSEEPERESYSFVYQPDIIGR  177

Query  588   DSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVS  767
             D  ++ IV  ++++ +  D   +  LP++GLGG+GKT L  +VY+D ++ + F   +W  
Sbjct  178   DDARDEIVSKILRAAEHHD---IFVLPLLGLGGIGKTELANMVYHDQQIRERFSKMMWAC  234

Query  768   VSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWK  947
             VS  F+L  +++ I+ SA+G+S  HL+++ LQ  L G+L +G Y LVLDD+W  D ++W+
Sbjct  235   VSNKFNLKNILQDIIESASGESCKHLNLEHLQNKLRGILQNGNYFLVLDDLWTRDVNEWR  294

Query  948   NLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYR  1124
              LR LL SG  GS +IVTTR   VA++ GT+  Y +  L  H+C  +F + AFR+ +E +
Sbjct  295   ELRNLLSSGARGSVIIVTTRENVVASMVGTSDPYKVGALPFHECMQIFTRVAFRQGEENK  354

Query  1125  PRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPIL  1304
                L++IG+ IV+KC GVPLA+K+LGS+L+   DE +WL ++E+ + KI Q + DI+P+L
Sbjct  355   YPWLLKIGESIVKKCAGVPLAIKSLGSLLFTMRDETQWLRVKEDHLCKIVQGDRDIMPVL  414

Query  1305  KLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFN  1484
             KLSY+ +P  L+ C +Y  +FPK  E  R   I  W+A G + S    +E++ +GNQY  
Sbjct  415   KLSYNALPAALKPCLSYLSIFPKDFEYYRRCIIMFWMAHGLLNSNKLSEEID-VGNQYII  473

Query  1485  ELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH  1664
             EL+    FQD +  FDG +  CK+H++VHDL + V   +   V     ++ E+V HLV+ 
Sbjct  474   ELIGSSLFQDSLITFDGSMPHCKLHDIVHDLGRYVLDTDLAVVNCEGQQVSETVRHLVWD  533

Query  1665  ADNLSRE-EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKEL  1841
               + + E EFP+ L+  +  R F  S   G++SK F++  L     LRVL++  + + EL
Sbjct  534   LKDFTHEQEFPRHLIKARKARTFISSCNHGSLSKKFLEVLLSKLLLLRVLIISGVRIDEL  593

Query  1842  PSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             P SIG LK LRYL+L+ N  IK LP  + KL+NLQTL+L   +QL ELPR+   +L+SL+
Sbjct  594   PDSIGNLKHLRYLDLTWNKTIKYLPNSLCKLINLQTLDLYRSDQLIELPRDV-NKLISLR  652

Query  2022  TLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCL  2201
              L LTS++  L +        L  L L+ CS     +E    +  L++L I +C  L  L
Sbjct  653   YLSLTSKQKQLPEAGLRGWASLTSLQLHSCSELTSLSEGIGSLTALQMLWISDCPKLPSL  712

Query  2202  PAGIRHLAKLEKLWIWNCEELDL-SVgegmegleslqslllmglPKLVSLPAGLKDIDAM  2378
             PA + HL+ L +L+I NC ELDL    E M+GL SL+SL ++GLPKL  LP  L      
Sbjct  713   PASMTHLSSLRELFIDNCPELDLMHPEEAMDGLWSLRSLQIIGLPKLERLPDTLCSASG-  771

Query  2379  KLKYLRVAGCPELTALPDWLQNCTLLQR  2462
              L+YL +  CP L  LP ++Q+ T  QR
Sbjct  772   SLRYLLIEQCPNLRELPSFMQDLTNHQR  799



>ref|XP_010908948.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
Length=1108

 Score =   461 bits (1185),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 300/755 (40%), Positives = 424/755 (56%), Gaps = 41/755 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE   + +   V  K+ +    E   +  +  ELKKL++TLSTI  VL DA+ +Q K  
Sbjct  1     MAEVVASSLLRLVFDKLGNKILKEFGMSRGVDKELKKLESTLSTIHDVLEDAEARQVKEK  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL+KL+DV YD DD+LD+    ++ R+  + S I  KVR+L + PD  ++  KI H
Sbjct  61    ALRGWLRKLKDVAYDVDDVLDEVAAKAMKRRSENKSHITEKVRQLSSIPDSFVFPSKIAH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI++IR RL +IA +R  FH +E    N      +RE+T S +  S++ GR  DKE I+ 
Sbjct  121   KIKKIRERLEEIAGERTKFHLQERVAENIRAETTVREETGSLIDESEVYGRQEDKEKIID  180

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              L+   DE D   +    IVGLGGLGKTT+ +LVYND RV ++F   +WV VS+DF + +
Sbjct  181   FLINMSDERD---LGVTAIVGLGGLGKTTVAQLVYNDPRVCEHFGKMIWVYVSDDFDIKR  237

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +   I+ + +G       MD +Q  L  ++   R+LLVLDDVWNE+  KW  LR +L+  
Sbjct  238   LTRSIIETMSGSECSLTGMDLMQHKLKELIGDKRFLLVLDDVWNENYEKWDRLRTVLIGS  297

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQ--EYRPRNLVEIG  1148
               GS+VIVTTRS +VA+I GT   + LS LS+ DC+ LF K AF     E  P  LV IG
Sbjct  298   ARGSKVIVTTRSARVASIMGTVAPHFLSDLSEEDCWLLFEKRAFGLGGCEKTPY-LVAIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEIV+KCGGVPLA K LGS++  +  E +WL I+E+EIW +   E +ILP L LSY+ +P
Sbjct  357   KEIVKKCGGVPLAAKALGSLMRFRRGESQWLAIKESEIWNLPDDENEILPALMLSYNHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCFAYC +FPKGEEI  E  + LW+A+GF+QS +G   LE++G  Y +ELLSR  F
Sbjct  417   SHLKQCFAYCSIFPKGEEIRSEQLVQLWIAEGFVQSSNGGTYLEDVGLLYVDELLSRSLF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q   E  DG +   K+H+LVHDLA+S+AG EC    +GD  +         +A  + R  
Sbjct  477   QRGQEDLDGVVRQVKMHDLVHDLARSIAGDECSIADAGDETV---TSQNCRYASLICRGP  533

Query  1689  FPQPLLNLKNLRYFAYSFRVGTVSKT--------FVKKTLLNFRRLRVLMLQNLELKELP  1844
                 L  LK+ +     + + +  +T         ++      + LR L L    +K LP
Sbjct  534   ITTILEPLKDAQRLRTLYFIASRGRTEEEDKGDDVLQAIFSKMKLLRALHLSKCPMKALP  593

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG--QQLM--  2012
              S+  LK LRYL+LS   +I++LP CI  L NLQ  +L  C QL+ +P   G  Q L+  
Sbjct  594   VSVAKLKHLRYLSLSYT-DIETLPPCIGALQNLQIFDLSCCRQLRAMPETIGDLQNLLCL  652

Query  2013  -------------------SLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAE  2135
                                +L+ L L+  ++     S   L  LQ L L  C       E
Sbjct  653   NLSDCKNIFSLPNSIGYARNLQNLDLSFSQIQTLPESLSFLSNLQSLSLRYCYFLNRLPE  712

Query  2136  IWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
               ++++ L+ L IY+C  L C+P G+  L  L  L
Sbjct  713   NMKNVRSLKHLDIYQCCELACMPPGMGQLTHLRTL  747



>ref|XP_010646017.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=694

 Score =   447 bits (1151),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 287/704 (41%), Positives = 414/704 (59%), Gaps = 53/704 (8%)
 Frame = +3

Query  426   ITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKES  605
             + H+I+E+R RL+ IA DR  F+ +      P+     RE TH FV  SD+IGRD DKE 
Sbjct  1     MGHRIKEVRERLDGIAADRAQFNLQTCMERAPL---VYRETTH-FVLASDVIGRDKDKEK  56

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             ++ +LM S D  D ES+S +PIVGLGGLGKTTL KLVYND  VV +F  R+WV VS DF 
Sbjct  57    VLELLMNSSD--DAESISVIPIVGLGGLGKTTLAKLVYNDPWVVGHFKKRIWVCVSNDFD  114

Query  786   LSKVIEKILRS---------ATGK-SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
             +  VI  I+ S          TG   +  L+++Q Q  L   L +  + LVLDD+WNED 
Sbjct  115   MKMVIIDIINSIKTTVEGGSGTGLLKYNELNLEQSQTVLRTTLGNENFFLVLDDMWNEDC  174

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-  1112
              KW  L+ LLM+G  G++++VTTR   VA+I GT  AY L GL   DC  +FLK AF E 
Sbjct  175   QKWIELKTLLMNGAKGNKIVVTTRGHPVASIMGTVQAYILEGLPHVDCLSVFLKWAFNEG  234

Query  1113  QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDI  1292
             QE +  NLV+IG +IV+KC GVPLA +TLGS+L+ K + ++WL +R+N+IWK+EQKE DI
Sbjct  235   QEKQHPNLVKIGDDIVKKCNGVPLAARTLGSLLFSKFEPRDWLDVRDNDIWKLEQKEGDI  294

Query  1293  LPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGN  1472
             LP L+LSY+Q+P +L+ CFAYC +FPK   +  E  + +W A+G I+     QEL+++GN
Sbjct  295   LPALRLSYEQLPSYLKCCFAYCSIFPKDYVLDNESLVCIWSAKGLIEPSKKKQELDDIGN  354

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             +Y  E+LSR  FQD  +         K+H+L+HDLA  ++  EC  +    P +   V H
Sbjct  355   RYIKEMLSRSFFQDFEDHH--YYFTFKMHDLMHDLASFISQTECTLIDCVSPTVSRMVRH  412

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV-SKTFVKKTLLNFRRLRVLMLQNLE  1829
             + F  D L  +E  + +  L ++R   + F + T   + F+K  +  F+ +++L L    
Sbjct  413   VSFSYD-LDEKEILRVVGELNDIRTIYFPFVLETSRGEPFLKACISRFKCIKMLDLTGSN  471

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
                LP+SI  LK LR+LNLS N  IK LP  + KL +LQT +L  CE  + LP++FG  L
Sbjct  472   FDTLPNSINNLKHLRFLNLSLNKRIKKLPNSVCKLFHLQTFSLQGCEGFENLPKDFGN-L  530

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQ---FLLLYKCSCRKFPAEIWQHMKKLRVLRIYE  2180
             ++L+ L +T     +++R+   +G L+    L ++ C   +F  +  Q +  LR L+I  
Sbjct  531   INLRQLVIT-----MKQRALTGIGRLESLRILRIFGCENLEFLLQGTQSLTALRSLQIGS  585

Query  2181  CSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGL  2360
             C SL  L   ++ L  LE L I +CE L+           SL       +P+L +L    
Sbjct  586   CRSLETLAPSMKQLPLLEHLVIIDCERLN-----------SLDGNGEDHVPRLGNL----  630

Query  2361  KDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
                     ++L +   P+L ALP+W++N T L RL IE+CP+L+
Sbjct  631   --------RFLFLGNLPKLEALPEWMRNLTSLDRLVIEECPQLT  666



>gb|KCW90383.1| hypothetical protein EUGRSUZ_A02522 [Eucalyptus grandis]
Length=803

 Score =   451 bits (1159),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 307/836 (37%), Positives = 485/836 (58%), Gaps = 53/836 (6%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I   +L K+ S A  +    W++K + +KL++TL  I+ VL DA+++Q K   V+ W
Sbjct  5     VSSILGPLLQKLASPAVGDFQLVWSVKDDREKLKSTLEMIQKVLADAEQKQTKEEAVRLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREI  449
             L KL+D  Y A+D+LD+F + +L  + RS      KV  L +      ++FK+  K++E+
Sbjct  65    LLKLKDFCYGAEDVLDEFESRALWWRARST--FKRKVCYLSSWLSNFSFQFKMADKMKEL  122

Query  450   RGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKS  629
               RL++I  ++  F+   + +  P+     + +THSFV  S +IGR+ +K+ I+ +LM S
Sbjct  123   GKRLDRINGEKIKFNLLSDVHEMPIVP---QRETHSFVPTSKVIGRNVEKKKIIELLMGS  179

Query  630   CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKI  809
              D+ +   +  +PI+G+GG GKTTL KLVYNDD V ++FD  +W+S+  +F ++++I  I
Sbjct  180   -DDGNVGKIGVIPIIGMGGSGKTTLAKLVYNDDEVKKHFDCLVWLSMPVEFQVTEIIIDI  238

Query  810   LRSATGKSFGHLD----MDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
             +     KS GH +    +D L+  L  ++ + R L V+DDVW+  +  W+ L E L    
Sbjct  239   I-----KSLGHKEEYDKLDMLRNCLRSMVENKRCLFVMDDVWDVTEDAWRELTESLEGVS  293

Query  978   DGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
             +GS+VIVT+R+  VA+I GT     L+ LS  D   LF+KCAF + QE    +L+ IG+E
Sbjct  294   EGSKVIVTSRNKSVASIMGTVPLLKLANLSKEDSLTLFVKCAFDQGQEKNHPDLMVIGEE  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV KC G PLAV TLG  L+ + + +EW ++R++ +W+++   T+IL  L++SYD MP +
Sbjct  354   IVNKCKGNPLAVTTLGCSLHSRNNRKEWEYVRDSNMWRLK---TNILSSLRISYDLMPSY  410

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFAYC +FP+  E      I+LW++ GFIQS   +QEL+  G QY  EL SR  F  
Sbjct  411   LKQCFAYCSIFPRKYEFANIELIHLWISNGFIQSSGNNQELQEKGRQYLEELRSRSFFNV  470

Query  1515  VVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLSREEF  1691
             V EA+   +L   +H+L+++LA SVA  E  N+++   +I     ++ F +   + ++E 
Sbjct  471   VWEAY--PLLCIGMHDLIYELAISVAQPESSNIRAWTRDISWRTRYISFPNPSGVPKDEV  528

Query  1692  PQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
                L  +  +R         + S+ F++  +  F+ LRVL LQ+     LP SIG LK L
Sbjct  529   SGCLSKVSRVRTIVCWGLGSSDSEFFLETCISQFKHLRVLWLQDSSFHLLPRSIGRLKHL  588

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVS  2051
             RYL+L+ N  IK LP+ + +L NLQTL L  C +L+ELP +  + ++SL+ L++T+++  
Sbjct  589   RYLSLNGNSYIKKLPKSVCELYNLQTLILGGCNELEELPTSI-KHMISLRFLWVTTKQQH  647

Query  2052  LQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
               K     L  L +L + +C   +   +  Q +  LR L I +C  LT LP GI++L  L
Sbjct  648   FLKSGIGCLTSLWWLGIAECKNLEALFDDIQSLTSLRTLLIVDCPKLTSLPQGIKNLKAL  707

Query  2232  EKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCP  2411
             E L I +CE L L                    P+         +  A  L+ +R+A CP
Sbjct  708   EDLLILDCESLRL--------------------PE--------SESSASTLQRIRIAYCP  739

Query  2412  ELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR-SSSNAKVRIIDCPLLNG*CGD  2576
             +L+ALP+WLQNC+ L+ L IE CPELS LP+ IR   +  K+RI +C  ++  CG+
Sbjct  740   KLSALPEWLQNCSSLRTLEIESCPELSSLPDGIRLIPTLTKLRISNCEKVSS-CGE  794



>ref|XP_010654316.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=792

 Score =   450 bits (1157),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 329/845 (39%), Positives = 456/845 (54%), Gaps = 96/845 (11%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA +F  DI   V+ K+ SLA  E++ AW ++ +L+ L+NT+STI+AV+ DA+EQQ+K  
Sbjct  1     MAVSFAFDIANQVVGKLGSLALQEVALAWGVQADLEDLKNTISTIQAVISDAEEQQSKIR  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             ++ DWL+KL                      L     +L          D   YR     
Sbjct  61    QLSDWLRKLN-------------------NALYEAKDVL----------DEFEYRGFTAE  91

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENG--KLREQTHSFVRPSDIIGRDSDKESI  608
               +    R      D+  F+  E   V    +   + RE  HS+V  S+IIGRD DKE+I
Sbjct  92    SCKRWEHRK---TADKSKFNLTERVVVVDGAHVVHRKREMAHSYVDASNIIGRDQDKENI  148

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVS-EDFS  785
             V +LM+S  +E  E+VS +PI+G+GGLGKTTL KLVYND+RVV +FD R+W  VS E+F 
Sbjct  149   VSILMQSSSDEQ-ENVSVIPIIGIGGLGKTTLAKLVYNDERVVAHFDKRMWACVSDENFE  207

Query  786   LSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             + K+ +KIL SAT  S                  +  YLLVLDDVWN D+ KW  L+ELL
Sbjct  208   IEKLTKKILMSATRGS-----------------AAESYLLVLDDVWNNDREKWLELKELL  250

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
             M G  GS+++VTTR   VA+I        + G   H                 P NLV++
Sbjct  251   MGGAGGSKIVVTTRKNSVASI--------MDGQIKH----------------YP-NLVKL  285

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G EIV++CGGVPLAV+ LG  L+ K DE  W+ +R+NEIWK   KE  ILP+LK SYD++
Sbjct  286   GDEIVKRCGGVPLAVRALGGFLFRKVDEHVWVSVRDNEIWK--SKEDRILPVLKFSYDEL  343

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P +L+QCFA+C +FPK  E      I  W+A G IQ    +Q+LE++GN+Y  EL S   
Sbjct  344   PSYLKQCFAFCSLFPKDFEFNNRELIQFWLAHGLIQPSSQNQDLEDIGNEYITELCSISF  403

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQDV +      +  K+H+LVHDLA+SVA  E   + + +      V H++   D+   E
Sbjct  404   FQDVQDC--KFCVYFKMHDLVHDLAKSVAQFEQHTLDAIEKINSNEVQHVLLSGDD--PE  459

Query  1686  EFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
             E    L  +  LR   +    G  S +FV      F+ +R L L +   + LPSSIG +K
Sbjct  460   EVLTLLQKITKLRTILFR-NGGATSLSFVTTCASKFKYMRYLDLSDSSFEVLPSSIGNMK  518

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQE  2045
              LRYL+L  N  IK LP  I KL +LQTL L  C +L+ELPR+ G  L++L  L +T+++
Sbjct  519   HLRYLSLLRNKRIKKLPASICKLYHLQTLILAECSELEELPRDMG-NLINLMFLSITTKQ  577

Query  2046  VSLQKRSSV--SLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
              +L    +    L  L+ LL+Y C+  +F  E  Q++  LR L I  C SL  LP  ++H
Sbjct  578   RALSGTENGLECLISLRSLLIYACNNLEFIFEGMQNLTALRTLVIVGCPSLVSLPTSVKH  637

Query  2220  LAKLEKLWIWNCEELDL------SVgegmegleslqslllmglPKLVSLPAGL-KDIDAM  2378
             L  LE L   +CE L+L      S  +       L + ++  LP+L +LP  L +     
Sbjct  638   LPALENLVFGDCERLNLMDGDGDSEDDIQGSSSRLCTFIIGALPQLEALPQWLVQGPTTS  697

Query  2379  KLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKV-RIIDCPL  2555
              L  L + GC     LP+ L+N T LQ L I DCP+LS L E +   +  KV  I DCP 
Sbjct  698   NLHCLGINGCHNFKGLPESLENLTSLQELRIGDCPQLSTLTEGMHRLTTLKVLSIDDCPE  757

Query  2556  LNG*C  2570
             L+  C
Sbjct  758   LSKRC  762



>ref|XP_004493472.1| PREDICTED: putative disease resistance protein RGA3-like [Cicer 
arietinum]
Length=856

 Score =   451 bits (1161),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 321/851 (38%), Positives = 477/851 (56%), Gaps = 54/851 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE    D  E +L K+ S A  E+S A+ +  +L+ +++TL+ ++ +L DA+E++ + H
Sbjct  1     MAEAIAFDAAELLLRKLTSYAYQEVSRAYGVYKDLRVIKDTLTIVRCLLLDAEEKKNQQH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              +++WL++ +++  DA+D+L+ F               L   RK   + D      K+  
Sbjct  61    ALREWLRQTQNICSDAEDVLEGFD--------------LQDKRKQVIK-DSRSTSMKMAR  105

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR RL+++A D   F       V P      RE T+  V  S +IGR+SD+E I+ 
Sbjct  106   QIKDIRNRLDKVAYDGTRFGL-ATINVEPGLVVHRREMTYPDVDASSVIGRESDREEIIK  164

Query  615   MLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             +LM+     D++  +S+  +PIVG+GGLGKTTL KLV+ND RV Q F  ++W  VS DF 
Sbjct  165   LLMQPHPHGDDDGDKSMCVIPIVGIGGLGKTTLAKLVFNDKRVDQLFQLKMWACVSNDFD  224

Query  786   LSKVIEKILRSATGKSFG----------------HLDMDQLQEHLNGVLCSGRYLLVLDD  917
             + ++I KI+ SA+   F                 +LD+ QL   L   +   ++LLVLDD
Sbjct  225   IRQIIIKIVNSASTSKFASTSASSVTFPHQENINNLDIVQLVSCLRSKISGQKFLLVLDD  284

Query  918   VWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLK  1097
             +WN+D+ KW  L++L+  G  GS+++VTTRS  ++++ GT  +Y L GLS  +C  LF+K
Sbjct  285   IWNDDRAKWTELKDLIKVGTVGSKMMVTTRSKSISSMMGTVPSYVLHGLSVENCLFLFVK  344

Query  1098  CAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIE  1274
              AF+E +E +  NLV IGKEIV+KC GVPLAVKTLGS L+ K D  +W  +R++EIW +E
Sbjct  345   SAFKEGEEEKFPNLVAIGKEIVKKCHGVPLAVKTLGSSLFSKFDLNKWKFVRDSEIWNLE  404

Query  1275  QKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQE  1454
             QK+ DILP LKLSYDQMP +LR CFAY  ++PK          +LWVA G +Q  +G++ 
Sbjct  405   QKKDDILPALKLSYDQMPSYLRHCFAYFSLYPKDFTFLAGDITSLWVALGLVQPRNGNEN  464

Query  1455  LENLGNQYFNELLSRFCFQDVVEAFD--GEILACKIHNLVHDLAQSVAGAECLNVKSGDP  1628
             LEN+  +Y +EL SR    D    FD  G     K+H+LVHDLA  VA  EC+ V+S   
Sbjct  465   LENVAREYIDELHSRSFLLD----FDDIGHFFNFKVHDLVHDLALYVAKEECVLVQSNTR  520

Query  1629  EIPESVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYSF-RVGTVSKTFVKKTLLNFRRL  1802
              IPE   HL +F  D+L    F    L  K +R   +   RVG    + +   +  ++ L
Sbjct  521   NIPEQARHLSIFENDSLGHALF----LKSKQVRTILFPIDRVGLDRDSLLDTWVSRYKYL  576

Query  1803  RVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKE  1982
             R+L L +  +  LP SI  L+ LR LNL+NNC IK LP  I KL+NLQ L L  C +L+ 
Sbjct  577   RILDLSDSSMVTLPISIAKLEHLRVLNLTNNCKIKRLPHSICKLLNLQVLLLTGCMELET  636

Query  1983  LPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLR  2162
             LP   G +L+SL+ L++T+++  L +    S   L  L  Y+C   KF     + +  + 
Sbjct  637   LPNGLG-KLISLRQLFITTKQFVLPQNEFASFKHLHTLDFYRCDNLKFLFNGTRQLTFVE  695

Query  2163  VLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKL  2339
              L +  C SL  L   +    KL+ L++ +C+ L +S+          ++ L L   P L
Sbjct  696   TLSVQSCGSLESL--SLYSFPKLQTLYLADCKMLTMSLNNESPIQRMPMRHLYLEEFPGL  753

Query  2340  VSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RS  2516
             ++LP  +  I A  L+ L +   P L  LP      T L+RL I  CP+LS LP  I R 
Sbjct  754   LTLPRWIVGI-ADTLETLVITKFPNLKMLPKCFTALTHLKRLDIRHCPQLSTLPNDIQRL  812

Query  2517  SSNAKVRIIDC  2549
             ++   +RI  C
Sbjct  813   TALEDLRIYRC  823



>ref|XP_010058559.1| PREDICTED: disease resistance protein RGA2-like [Eucalyptus grandis]
 gb|KCW90375.1| hypothetical protein EUGRSUZ_A02516 [Eucalyptus grandis]
Length=825

 Score =   450 bits (1157),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 312/821 (38%), Positives = 484/821 (59%), Gaps = 28/821 (3%)
 Frame = +3

Query  90    LADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDW  269
             ++ I  +++ K+ SLA +EI     +K + +KL+NTL  I+ VL DA+++Q K + V+ W
Sbjct  5     VSSILGSLVEKLTSLATEEIQLVCGVKDDREKLKNTLEMIQMVLADAEQRQTKENVVRLW  64

Query  270   LQKLRdvvydaddllddFGTLSLLRKLRSCSGIL--TKVRKLFTRPDGLIYRFKITHKIR  443
             L +L++  YDA+D LD+F   +L R++RS   +    KVR L++    +I++FK+ H ++
Sbjct  65    LSRLKNWCYDAEDALDEFEARALWRRVRSIEHLTLKRKVRYLYSWISEMIFQFKMAHNMK  124

Query  444   EIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLM  623
             E+R  L+ I +D   F    N +   +     R +THSFV  S++IGR+ +KESI+  L 
Sbjct  125   ELRKSLDGIDKDETRFTLSTNVHERTIVP---RRETHSFVPASNVIGRNEEKESIIEWL-  180

Query  624   KSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNF-DTRLWVSVSEDFSLSKVI  800
                   D E++    I+G+GG GKTTLV+LVYND RV ++F + ++W+S+ ++F +  +I
Sbjct  181   ----RSDAEAIKVYSIIGMGGAGKTTLVRLVYNDKRVEEHFKNNQVWLSMPQEFKIQNII  236

Query  801   EKILRSATGKS-FGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC  977
               I++S +G +   + +++ LQ HL  ++ + R L V+DDVW    + W  L  LL    
Sbjct  237   RDIIKSLSGVAEVDNYNLEALQNHLRNLVKNRRCLFVMDDVWAMSMNDWLELTILLEGLS  296

Query  978   DGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKE  1154
              GS+VI+T+R+  +A   GT     L+ LS  D   LF+K AF + QE    +L+EIGKE
Sbjct  297   KGSKVILTSRNQAIAKNMGTDCLLYLANLSLEDSLTLFVKYAFDQGQEKNHPDLMEIGKE  356

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK--ETDILPILKLSYDQMP  1328
             IV+KCGG P+A++ LG +LY K +  +W HIR++E W++       +ILP L++SYD MP
Sbjct  357   IVKKCGGNPMALRALGCLLYSKNNRSDWEHIRDSETWQLTNTLPSLEILPSLRISYDLMP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR--F  1502
              +L+QCFAYC +FPK  E      I LW++ GFIQS   +QELE +G QY  ELLSR  F
Sbjct  417   SYLKQCFAYCSIFPKNHEFNNFELIELWISNGFIQSSGNNQELEEIGRQYLEELLSRSFF  476

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HADNLS  1679
              F   +  F    L  ++H+L+++LA SVA  E  N+K    +I  ++ H+ F     + 
Sbjct  477   IFLKDIYPF----LYFEMHDLIYELAISVAQTESSNMKVWTQDISPTIRHVSFPDLSGVP  532

Query  1680  REEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKT-LLNFRRLRVLMLQNLELKELPSSIG  1856
             ++E          +R         + S+ F  +T +L F+ LRVL L+      LPSSIG
Sbjct  533   KDELSGCFNKPSRIRTIMCQKLGSSDSEEFFLETCILRFKHLRVLWLEESSFNLLPSSIG  592

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LRYL LS+   I  LP+ + +L NLQ L+L  C+ L+EL  +  + +++L+ LY+T
Sbjct  593   DLKLLRYLKLSDG-TINKLPKSVYELCNLQILDLAVCQNLEELSADI-KNMINLRALYIT  650

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIR  2216
             +++    +     +  L+ L ++ C   +   +  Q +  LR+LRI  C  L  LP GI+
Sbjct  651   TKQKHFPESGIGRVTSLRRLCIWDCRNLEALFDDIQSLTSLRMLRIGMCRKLASLPQGIK  710

Query  2217  HLAKLEKLWIWNCEELDL--SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
             +L  LE L+I  C  L L    G     + SLQSL+L  LP+LVSLP  L+   A  L+ 
Sbjct  711   NLKALEDLYICACGSLRLPEGDGNEPGSMSSLQSLVLSYLPELVSLPGWLEG-SASTLRT  769

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR  2513
             + ++ CP+L+ALP+WLQNC+ L +L +   PELS LP+ +R
Sbjct  770   IEISYCPKLSALPEWLQNCSSLTKLQLTMLPELSSLPDGVR  810



>ref|XP_010097660.1| Putative disease resistance protein RGA4 [Morus notabilis]
 gb|EXB70615.1| Putative disease resistance protein RGA4 [Morus notabilis]
Length=1079

 Score =   457 bits (1176),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 296/668 (44%), Positives = 418/668 (63%), Gaps = 25/668 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKI-VSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             MA+  L ++  +++ K+     + EI   + +  EL+KL+ T+S IKAVL DA++ QA N
Sbjct  1     MADAILFNVAASIVEKLGPETLRKEIGLLFGVNTELEKLKRTVSAIKAVLLDAEQNQADN  60

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
             H+V+DWLQKL+D VY ADDL+D+F T +L R++   S    KVR  F+  + L +   I 
Sbjct  61    HQVRDWLQKLQDAVYYADDLVDEFYTEALQRRVIFGSKRAKKVRIFFSSSNQLSFMLNIG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+E+R  LN+I +D R+F+  E +    V +  +RE THSFV   ++IGRD DK +IV
Sbjct  121   HKIKEVREALNEI-KDSRDFYLMECFEDTRV-SSNVRE-THSFVGKEEVIGRDGDKMAIV  177

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L+ S  EED   VS +PIVG+GGLGKT L + ++ND+ V  +F+ R WV VS+ F L 
Sbjct  178   KLLLDSETEED---VSVIPIVGIGGLGKTALAQHIFNDENVQNHFELRSWVCVSDCFDLK  234

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              V++KI++S T KS   L+++QLQ HL   +   RYLLVLDDVWNED  KW+ L  LLM 
Sbjct  235   LVVQKIIKSVTLKSPEDLELEQLQFHLRKEIGGKRYLLVLDDVWNEDAEKWRGLERLLMG  294

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIG  1148
             G  GS+V+VTTRS +VA IT T   Y LSGL + + + LF + AF + QE     ++ +G
Sbjct  295   GAKGSKVLVTTRSDRVAEITHTIRPYKLSGLDNVNSWSLFKRIAFHKGQEPENSTVLALG  354

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEIV KC GVPLA+KT+GS+LY K  E EW   +ENE+ KI Q E  ILP LKLSY+ +P
Sbjct  355   KEIVDKCSGVPLAIKTVGSILYFKRREIEWSSFKENELAKIPQGEDGILPTLKLSYNHLP  414

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+ CFAYC +FPK  EI  +  I LW+AQGFI+  DG + LE++G +YF +LL R  F
Sbjct  415   SHLKHCFAYCRLFPKDREIDVQKLIRLWIAQGFIKPSDGGRCLEDVGYEYFMDLLCRSFF  474

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QD      G +   +IH+L+HDLA  VAG   +++        E++ H+ F +      +
Sbjct  475   QDPKRDDQGNVKRFRIHDLMHDLAVLVAGTSSISIDRSMENSNENIRHVSFDSKFSPSWK  534

Query  1689  FPQPLLNLKNL-------RYFAYSFR----VGTVSKTFVKKT----LLNFRRLRVLMLQN  1823
              P  LL   ++       +Y A+       +GT  K     T    L +F  LR L L+ 
Sbjct  535   LPPSLLKKNSIVRTFISPKYNAWHGYQHDFLGTSRKKLRWLTRDAILFSFTSLRTLDLKA  594

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
             L +K+LP+S+G LK LRYL++S N NI+ LP  I++L NLQTL L +C +L  LP +  +
Sbjct  595   LNIKKLPNSLGRLKHLRYLDVSRN-NIQMLPNSITRLQNLQTLILSHCRELIRLPEDM-K  652

Query  2004  QLMSLKTL  2027
             +L++L+ L
Sbjct  653   KLVNLRHL  660



>ref|XP_010918019.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
Length=1124

 Score =   458 bits (1178),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 312/734 (43%), Positives = 432/734 (59%), Gaps = 24/734 (3%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             I + V+ K+ S    E+  A ++K +++KLQ+ L TI  VL DA+ +   +  +  WL+K
Sbjct  13    ILKIVIQKLGSGLLKEMGLASSVKKDVEKLQSVLETINDVLDDAESRTISDKPLHGWLRK  72

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             LRD  +DADD++D+F T +L RK+   + I  KVR  F+  + +I+  KI  K++EIR R
Sbjct  73    LRDAAFDADDVVDEFQTEALRRKIEENNCITRKVRDFFSLNNSIIFHHKIARKVKEIRKR  132

Query  459   LNQIAEDRRNFHFKENYYVN-PVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCD  635
             L+QI+E+R  FH  E      P+E G     T+SFV  S+  GR  DKE ++  L     
Sbjct  133   LDQISEERLKFHLSERSIPERPLERG-----TYSFVIESETYGRHDDKEEVINFLGHVDT  187

Query  636   EEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILR  815
             ++D   VS LPIVGLGG+GKTTL +LVYND RV + F+ R+WV +SE+F + ++I  I+ 
Sbjct  188   DKD---VSVLPIVGLGGVGKTTLAQLVYNDRRVEEQFELRMWVCISENFDIPRIIRAIIE  244

Query  816   SATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVI  995
               TGK+    D++ +Q  L   L   R+LLVLDDVWNE++ +W+ L+ LL  G  GS++I
Sbjct  245   QVTGKNCELSDIEMMQSLLREKLREWRFLLVLDDVWNEEEAEWERLKPLLRGGKKGSKII  304

Query  996   VTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEIGKEIVQKC  1169
             VTTRS +VA+I G+     L  LS  DC+ LF + AF     E  PR LVEIGKEIVQKC
Sbjct  305   VTTRSERVASIMGSFAPLRLQVLSTDDCWTLFRQRAFGLGRTEETPR-LVEIGKEIVQKC  363

Query  1170  GGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCF  1349
             GG+PLA K LGS++  K  E EWL ++ +EIWK+  KET ILP L+LSYD +P HL+QCF
Sbjct  364   GGLPLAAKALGSLMSSKRGEVEWLAVKNSEIWKLPTKETGILPALRLSYDHLPSHLKQCF  423

Query  1350  AYCCMFPKGEEIPREVFINLWVAQGFIQSP-DGDQELENLGNQYFNELLSRFCFQDVVEA  1526
             AYC +FPK     RE  I LW+A+GFI  P D +  LEN+GNQ+FN LL R  FQD  + 
Sbjct  424   AYCSLFPKDFRFHRERLIQLWIAEGFINQPSDNNMNLENIGNQFFNNLLWRSFFQDAEKD  483

Query  1527  FDGEILACKIHNLVHDLAQSVAGAECLNVKSG-DPEIPESVHHLVFHADNLSREEFPQPL  1703
              DG +  CK+H+LVHDLA  V G E + +++G D  I     +      N    E  Q  
Sbjct  484   SDGNVTVCKMHDLVHDLACCVIGDEAVIMEAGKDTSISHRCRYSSVDISNHKSSECLQLA  543

Query  1704  LNLKNLRYF----AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQL  1871
                K LR       + FRV  + + FV   + N   LRVL LQ   L +L S I  LK L
Sbjct  544   YKTKKLRSLIFLPCFRFRVVNI-REFVFYVVSNLTYLRVLDLQGTALSKLSSKISRLKHL  602

Query  1872  RYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT-SQEV  2048
             R+L+LS    IK+LP+ I+ L NLQ L+L  C  L+ LP +    L +L+ L L+    +
Sbjct  603   RFLDLSRTL-IKALPDSIASLYNLQVLDLSTCHLLEALPDSIA-SLCNLQVLDLSYCHHL  660

Query  2049  SLQKRSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLA  2225
                  S  SL  L+ L L  C   ++ P ++ + M+ LR L I  C  LT +P  +  L+
Sbjct  661   EALPESIASLDNLRVLDLTCCYHLKELPKDM-RKMRNLRHLCIVGCYRLTRMPPKMSELS  719

Query  2226  KLEKLWIWNCEELD  2267
              L  L ++   E D
Sbjct  720   NLRTLSMFAVGEED  733



>gb|AES81335.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1401

 Score =   464 bits (1193),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 329/855 (38%), Positives = 501/855 (59%), Gaps = 42/855 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F  DI  ++L K+ S A +E S A+ +  +L++ ++TLS +  VL DA+ ++ + H
Sbjct  1     MAESFAFDIARSLLGKLASYAYEEASRAYGVYKDLQEFKDTLSIVSGVLLDAECKKDQKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL++++++ YDA+D+LD F      +++   SG    KVR LF+  + L +RFK+ 
Sbjct  61    GLREWLRQIQNICYDAEDVLDGFDLQDKRKQVVEASGSTRVKVRHLFSSSNSLAFRFKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+EIR RL+++A D   F       V+P    + RE T+  +  S +IGR +D++ I+
Sbjct  121   HQIKEIRDRLDKVAADGVMFGLTN---VDPGLVVQQREMTYPDIDTSSVIGRKNDQDQII  177

Query  612   GMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+     D +   S+  +PIVG+GGLGKTTL K V+ND R+ Q F  ++WV +S+DF
Sbjct  178   NLLMQPHPRGDGDGDNSLCVIPIVGIGGLGKTTLAKSVFNDKRMDQLFQLKMWVCISDDF  237

Query  783   SLSKVIEKILRS----------------ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLD  914
              + K+I KI+ S                A  ++  +LD+ QL   L   L   ++L+VLD
Sbjct  238   DIRKIIIKIINSATSSTLTSSSVPSSGLAQLENINNLDIVQLVSRLKQKLSGQKFLVVLD  297

Query  915   DVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFL  1094
             DVWN+D+ KW  L EL+  G  GS++IVTTRS  +A++ G    Y L GLS  DC  LF+
Sbjct  298   DVWNDDRAKWLELIELIKVGAPGSKIIVTTRSNSIASMMGDVFPYVLKGLSPKDCISLFV  357

Query  1095  KCAFREQEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKI  1271
             K AF+E E +   N VEIGKEIV+KC GVPLAV+TL S L+   D  +W  +R++E+W +
Sbjct  358   KWAFKEGEEKNYPNQVEIGKEIVKKCQGVPLAVRTLASSLFSNFDISKWEFVRDSEMWNL  417

Query  1272  EQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQ  1451
             EQK  DILP LKLSYDQMP +LRQCFAY  ++PK          NLWVA G +QS +G +
Sbjct  418   EQKINDILPALKLSYDQMPSYLRQCFAYFSLYPKDYIFNSYDIGNLWVALGLVQSLNGSE  477

Query  1452  ELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE  1631
             +LE++  +Y +E+ SR   QDV E   G I   K+H+L+HDLA  V+  + + V S    
Sbjct  478   KLESIARKYIDEMHSRSFIQDVKEI--GSICEFKVHDLIHDLALYVSREDFVAVDSHTRN  535

Query  1632  IPESVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYS-FRVGTVSKTFVKKTLLNFRRLR  1805
             IP+ V HL V   D+L  + FP+     +++R   +  F VG  S++ + K +  ++ LR
Sbjct  536   IPQQVRHLSVVKDDSLDLDLFPKS----RSVRSILFPIFGVGLESESLLNKLMSRYKYLR  591

Query  1806  VLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKEL  1985
              L L +   K +P+SI  L+ LR L+LS N  I++LP  I KL++LQ L+L  C + + L
Sbjct  592   YLGLSDSSYKTMPNSIAKLEHLRVLDLSRNGKIRTLPNSICKLLHLQVLDLGGCTEFENL  651

Query  1986  PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRV  2165
             P+  G +L+SL++L +T+++  L      +L  L+FL  + C      +     +  +  
Sbjct  652   PKGLG-KLISLRSLTVTTKQSVLPHDEFATLIHLEFLCFHYCG--NIMSLFRHQLPSVEE  708

Query  2166  LRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLV  2342
             L I  CS L  LP  I    +L  L I  CE+L+L +          ++ L LMGLP LV
Sbjct  709   LLIVSCSRLESLPLYI--FPELHTLTIDKCEKLNLLLNNESPIQTLKMKHLYLMGLPTLV  766

Query  2343  SLPAGLKDIDAMK-LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-RS  2516
             +LP  +  + AM+ L+ L +   P L  LP  L   T L+RL+I +CP+L  LP  + R 
Sbjct  767   TLPEWI--VCAMETLETLAIKRLPNLKRLPVCLSTMTRLKRLFIVNCPQLLSLPSNMHRL  824

Query  2517  SSNAKVRIIDCPLLN  2561
             ++  ++ I  CP L+
Sbjct  825   TALERLHIFGCPKLS  839


 Score =   121 bits (303),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 149/541 (28%), Positives = 240/541 (44%), Gaps = 88/541 (16%)
 Frame = +3

Query  717   YNDDRVVQNFDTRLWVSVSEDFSLSKV-----IEKILRSATGKSFG--------HLDMDQ  857
             +ND+RV Q F  ++WV VS +F + ++           SA+  S G        +LD+ Q
Sbjct  910   FNDERVDQIFKLKMWVFVSNNFDIRQIIIKIITASFYTSASTPSSGLAHQENIKNLDILQ  969

Query  858   LQEHLNGVLCSGRYLLVLDDVWN---EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATI  1028
                 L  +L    +LLVLDDVWN   ED+ KW  L+ LL  G   S+++VTTRS  +A +
Sbjct  970   PVCRLRQILSGQNFLLVLDDVWNDNREDRAKWIELKYLLEVGAPESKIMVTTRSSSIAWM  1029

Query  1029  TGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSM  1208
              G   +Y L GLS  +C  LF       +E +  NLVEIGK+ V+KC GVPLAVK+LGS 
Sbjct  1030  MGNVPSYVLKGLSPKNCLSLFKD----GEEKKYPNLVEIGKDTVKKCQGVPLAVKSLGSS  1085

Query  1209  LYCKTD-----EQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFP-  1370
             L+   D      ++++ IR   I            +  +S D++ +   +      +FP 
Sbjct  1086  LFSNFDLMYVGREDFVEIRYLSI------------VENVSLDRVLFPNSRG-VRSILFPI  1132

Query  1371  KGEEIPREVFINLWVAQ-GFIQSPD-GDQELENLGNQYFNELLSRFCFQDVVEAFDGEIL  1544
              G  +     ++ WV++  +++  D  D   E L N      L    F D+        L
Sbjct  1133  DGVGLKSVSVLDTWVSRYKYLRYLDLSDSSFETLPNSITK--LEHLRFLDLSRNDKLRTL  1190

Query  1545  ACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLR  1724
                I  LVH     + G   L                         E  P+ L  L +LR
Sbjct  1191  PKSICKLVHLQVLLLGGCTEL-------------------------ENLPKGLGKLISLR  1225

Query  1725  YFAYSFRVGTVSKT-FVKKTLLNFRRLRVLMLQNLEL---KELPSSIGFLKQLRYLNLSN  1892
              F  + +   + +  FV+  L+N + L      N++    ++LPS    +++L +     
Sbjct  1226  RFTVTTKQSVLPQDEFVR--LINLQSLSFDCCYNIKFLFTQKLPS----VEELYF----E  1275

Query  1893  NCN-IKSLPECISKLVNLQTLNLINCEQLKELPRN-FGQQLMSLKTLYLTS--QEVSLQK  2060
             +C+ ++SLP  I     L+TL + +C +L  L  N    + + +K LYL      V+L  
Sbjct  1276  SCDSLESLPLHI--FPKLKTLFIRDCNKLDLLLNNEIPIETLRMKHLYLMGFPTLVTLPD  1333

Query  2061  RSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
               + ++  L+ L++      K        M +L+ L I +C  L   P+ +  L  LE +
Sbjct  1334  WIACAMDTLESLVIIGFPNLKMLPVFLTSMTRLKKLYIIDCPQLLSFPSEMHRLTALETM  1393

Query  2241  W  2243
             +
Sbjct  1394  F  1394


 Score =   105 bits (263),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 96/283 (34%), Positives = 149/283 (53%), Gaps = 14/283 (5%)
 Frame = +3

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             +L R  FP    N + +R   +    VG  S + +   +  ++ LR L L +   + LP+
Sbjct  1113  SLDRVLFP----NSRGVRSILFPIDGVGLKSVSVLDTWVSRYKYLRYLDLSDSSFETLPN  1168

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             SI  L+ LR+L+LS N  +++LP+ I KLV+LQ L L  C +L+ LP+  G +L+SL+  
Sbjct  1169  SITKLEHLRFLDLSRNDKLRTLPKSICKLVHLQVLLLGGCTELENLPKGLG-KLISLRRF  1227

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
              +T+++  L +   V L  LQ L    C   KF     Q +  +  L    C SL  LP 
Sbjct  1228  TVTTKQSVLPQDEFVRLINLQSLSFDCCYNIKF--LFTQKLPSVEELYFESCDSLESLPL  1285

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegm-egleslqslllmglPKLVSLPAGLK-DIDAMK  2381
              I    KL+ L+I +C +LDL +   +      ++ L LMG P LV+LP  +   +D   
Sbjct  1286  HI--FPKLKTLFIRDCNKLDLLLNNEIPIETLRMKHLYLMGFPTLVTLPDWIACAMDT--  1341

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI  2510
             L+ L + G P L  LP +L + T L++LYI DCP+L   P ++
Sbjct  1342  LESLVIIGFPNLKMLPVFLTSMTRLKKLYIIDCPQLLSFPSEM  1384



>ref|XP_009775464.1| PREDICTED: putative disease resistance protein RGA4 [Nicotiana 
sylvestris]
Length=840

 Score =   449 bits (1156),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 307/814 (38%), Positives = 468/814 (57%), Gaps = 39/814 (5%)
 Frame = +3

Query  183   KLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCS  362
             K+ + L  ++  +R  +     +H+V    + L+   Y+A+ +++++   SL  +L S S
Sbjct  39    KMHSQLKKLELFVRGTESDDHFDHQVA---EMLKPAFYEAEHVIEEYEICSLQNQLLSNS  95

Query  363   GILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLR  542
                      F+R + L YR ++   +R++   L++I+ +R    FK   Y       + R
Sbjct  96    TSAKVCAFFFSRSNPLAYRIRMCLVMRKLIKILDKISRNR--VFFKRMAYGGFPSPHRAR  153

Query  543   EQTHS--FVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklv  716
                H+  +V  S ++GRD D++ +V  L+KS +E    ++   P+VG GG+GKTTL KLV
Sbjct  154   GLMHTRAYVHDSGVVGRDFDRDIVVETLLKSGNEA---ALFVFPVVGFGGIGKTTLAKLV  210

Query  717   YNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGR  896
             YND R+V +F  R+WV VS  F + K++E+I+ S       + DM++LQ  +   L   +
Sbjct  211   YNDPRIVSHFQLRVWVRVSRVFQVQKLLEQIVNSVREDLCENDDMNELQTLIRETLYEKK  270

Query  897   YLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHD  1076
             YL+VLDDVWNED  KW  L++LLM G  GS+++VTTR+  VA+I G   AY L GLS  D
Sbjct  271   YLIVLDDVWNEDPVKWDELKKLLMVGACGSKILVTTRNEAVASIMGMVPAYCLKGLSSED  330

Query  1077  CFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRE  1253
             C  LFL  AF E QE    NLV I  +IVQKC G PL +  +GS L+ +T E +W  ++ 
Sbjct  331   CLTLFLSKAFEEGQEVLYPNLVGIASDIVQKCEGNPLLLMLVGSSLHMETKEWKWHEVK-  389

Query  1254  NEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQ  1433
               +W + Q + +I P L +SY+++P +L+ C AYC + PK   I  +  I LWVA+G + 
Sbjct  390   -NMWNLNQND-NISPALIISYERLPSNLKVCLAYCSILPKNCVIEIDKLIQLWVAEGLVS  447

Query  1434  SPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNV  1613
               +  ++LE++G QYF ELLSR  FQ+V E        C++H+LVHDLA S AG E   V
Sbjct  448   KSNESEDLEHIGIQYFQELLSRSFFQEVEEYRSVFTSLCRLHDLVHDLALSAAGVEFCTV  507

Query  1614  KSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLN  1790
              S    I + V H+VF   +L+ +E P  LLN + LR  ++S   VG +S  FV+  +  
Sbjct  508   ASHTQSISDEVRHVVFSDYDLTGKELPASLLNNQTLRTISFSVDGVGPMSTMFVENCIAR  567

Query  1791  FRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCE  1970
             F +LRVL + +    ELP S+G LK LRYL++S+N +I+ LP+ I+KL++LQTL + +C 
Sbjct  568   FAQLRVLDISDSCFDELPRSVGELKYLRYLDISSNGSIRELPDSINKLLSLQTLRVSHCA  627

Query  1971  QLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHM  2150
             Q + LP++ G  L+SL+ +++T+++ S   ++   L  L+ L  Y C+     +E  Q++
Sbjct  628   QFEGLPKDIG-NLISLRHVHITTKQSSFPDKAIGCLSSLRSLYFYSCTNLVSLSEGLQYL  686

Query  2151  KKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL--------------------  2270
               LR L I  C  LT  P+ ++HL  LE L I +C+EL L                    
Sbjct  687   TSLRTLAIIGCPRLTFFPSAMKHLTALENLLIVDCKELTLLEWQDIEGLRMIRSLVIGGL  746

Query  2271  --SVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQN  2444
                  + ++ L +++ L+L GLP+LV+LP  L+   A  L+YLRV  CP   ALP WL+N
Sbjct  747   PGLESKDVQCLGNIKMLVLAGLPQLVTLPRWLEGSSA-TLQYLRVERCPNFAALPKWLEN  805

Query  2445  CTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID  2546
              T L++L I  C +LS LPE +   +N KV  ID
Sbjct  806   LTTLEKLEISKCGKLSSLPEGMSCLTNLKVLRID  839



>ref|XP_010057749.1| PREDICTED: putative disease resistance protein RGA4 [Eucalyptus 
grandis]
 ref|XP_010057750.1| PREDICTED: putative disease resistance protein RGA4 [Eucalyptus 
grandis]
 ref|XP_010057751.1| PREDICTED: putative disease resistance protein RGA4 [Eucalyptus 
grandis]
Length=753

 Score =   446 bits (1148),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 294/738 (40%), Positives = 443/738 (60%), Gaps = 17/738 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  + + VL KI S A  E  + ++++ ++  L+NTL+ I AVL DA+EQQAKNH
Sbjct  1     MAESFLFSVAQGVLGKIASSAFQEAVAIYSIEDQIHDLKNTLAAITAVLLDAEEQQAKNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS-CSGILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +LRDV+YDA+D+LD+    +L +++ S   G+  KV +  +  + +I R KI+
Sbjct  61    SLQLWLGRLRDVLYDAEDVLDELECEALRKRVISQYGGVKEKVHRFCSLSNPVILRAKIS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR  L++I+ ++  F        N + + + RE T+SF+   D++GRD +K+ I+
Sbjct  121   HKIKEIRETLSKISIEKNQFDLNVQSVDNGMGHSRSREMTYSFINKLDVVGRDVNKQKII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LM+S    D +++S +PIVG+GGLGKT L KLVYNDD V   F++RLWV V EDF L 
Sbjct  181   EILMQS----DNKNLSVIPIVGIGGLGKTALAKLVYNDDSVKAQFESRLWVCVPEDFDLK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             + I+ I++  TG +  +LD+ Q Q  L   +   ++LLVLDDVW+ ++ +W+ L+ LL  
Sbjct  237   RTIDGIIKDVTGGNLSNLDIQQSQTFLRDTIKDKKFLLVLDDVWSNNRSRWEELKALLTE  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G  GS++IVTTRS++VA++ GT   +NL GL   D   LF K AF ++E +P  +L++IG
Sbjct  297   GAHGSKIIVTTRSLEVASMMGTHPTHNLEGLCHEDSMALFKKWAFDQKEKQPCPDLLDIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+KC GVPL VKTLGS+LY K ++  W HIR++EIWK+ +++ D+LP+LKLSYD +P
Sbjct  357   NDIVKKCQGVPLLVKTLGSLLYTKDEKWHWAHIRDSEIWKLVEQKKDVLPVLKLSYDHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL++CFA   +F KG EI       LW+A G +     +  LE++  +Y NEL  R   
Sbjct  417   SHLKRCFATLSLFGKGSEIYSFKTAWLWMALGLVSLTGEEVALEDIVVEYINELWKRSLI  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL---S  1679
             Q   E FD  + + K+H+LVH LA  VA  +C +V     EI E V  + F   +L   S
Sbjct  477   QLEDEWFDFTLSSFKVHDLVHSLATIVAQNDCSSVDLDTAEIFEGVRKVSFSGTSLPGIS  536

Query  1680  REEFPQPLL---NLKNLRYFAYSFRV--GTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K LR   +S  +    V++ F +  +     LR L L+    ++LP
Sbjct  537   NFDGVPPFLRKPTSKRLRAIMFSSEIYGQYVTREFARTCISKCNNLRHLDLKYGIFEKLP  596

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             SSI  LK LR L +S+N  +K LP+ I  L +L+ L +  C +L +LPRN   +L+SL+ 
Sbjct  597   SSICNLKHLRTLIISSNNRLKKLPDTICDLQSLEVLEVTGCLELGDLPRNM-NRLVSLRF  655

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L++T+++ +LQ      L  LQ L L +C   +   +    +  LR L I +C     LP
Sbjct  656   LHITTKQKNLQDTGIQYLENLQILALLRCPNLEVLFQGTCRLTHLRRLAIMDCEKPIFLP  715

Query  2205  AGIRHLAKLEKLWIWNCE  2258
                  L  L  L I  C+
Sbjct  716   --FVELIDLHTLQISKCK  731



>ref|XP_007162205.1| hypothetical protein PHAVU_001G133000g [Phaseolus vulgaris]
 gb|ESW34199.1| hypothetical protein PHAVU_001G133000g [Phaseolus vulgaris]
Length=877

 Score =   450 bits (1157),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 320/845 (38%), Positives = 497/845 (59%), Gaps = 35/845 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+ DI E++L K+ S   +E S  +++  ++  +++TLS +K VL DA+ ++ + H
Sbjct  1     MAEYFVFDIAESLLRKLASFVCEEASRVYDVYEDIIGIKDTLSIVKGVLLDAEHKKEQRH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V  DA+D+LD     +L +++   SG    KV  LF+  + L++RF++ 
Sbjct  61    GLREWLRQIQNVCLDAEDVLDGLECQNLRKQVLKASGSTRMKVDHLFSSSNSLVFRFRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ +R R ++IA D   F  +     + +   + R+ ++S V  S +IGR+SD+E I+
Sbjct  121   HQIKHVRRRFDKIAADGNKFGLERIEVDHRLV--QRRDMSYSHVDASGVIGRESDREEII  178

Query  612   GMLMKSCDEEDT---ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              +LM+     D    +SV  +PIVG+GGLGKTTL KLV+ND R+   F  ++WV +S+DF
Sbjct  179   KLLMQPHPHGDGYGDQSVCVVPIVGIGGLGKTTLAKLVFNDKRIDDLFPLKMWVCISDDF  238

Query  783   SLSKVIEKILRSATG----------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED  932
              + ++I KI+ SA+           ++   LD++QLQ  L   L   +YLLVLDD+WN+D
Sbjct  239   DIRQIIIKIINSASASAPSIALAHQENINRLDIEQLQSRLRLKLSGQKYLLVLDDIWNDD  298

Query  933   QHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
             + KW  L++L+  G  GS+++VTTRS  +A++ GT  +Y L GLS  +CF LF+K AF+E
Sbjct  299   RAKWIELKDLIKVGAVGSKIVVTTRSNSIASMVGTVPSYVLEGLSMENCFSLFVKWAFKE  358

Query  1113  QEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD  1289
              E +    L+EIGKEIV+KC GVPLAV++LGS L+   D + W  +R +EIWKI+Q + D
Sbjct  359   GEGKNYPYLLEIGKEIVKKCRGVPLAVRSLGSSLFLIVDLERWEFVRYHEIWKIKQNKDD  418

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             ILP LKLSYDQMP +LR  FA+  ++PK         + LW + G +QSP G+++LEN+ 
Sbjct  419   ILPALKLSYDQMPSYLRHIFAFFSLYPKDYGFSSAEIVILWESLGLLQSPVGNRKLENIA  478

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVH  1649
              QY +EL +R   +D  E F G     K+H+LVHDLA  VA  E L V S    IPE + 
Sbjct  479   RQYIDELQARSLLED-FEDF-GHYYYFKVHDLVHDLALYVAKEELLMVNSLTRYIPEQIR  536

Query  1650  HL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN  1823
             H  V   D+L+   FP+      ++R   +  +  G  S+T +   +  ++ LR L L +
Sbjct  537   HFSVVDNDSLNHVLFPKS----SSVRTILFPLKGTGIDSETLLHTWITRYKYLRYLDLSD  592

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
                + LP+S+  L+ LR L L NNC IK  P  + KL NL+ L+   C +L+ LP+  G 
Sbjct  593   SSFETLPNSVAKLEHLRTLFL-NNCKIKRFPHSLCKLHNLKFLSFRGCMELETLPKRLG-  650

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYEC  2183
              L+SL+ LY+T+++  L +    SL  L  L    C+  KF     Q +  L VL +  C
Sbjct  651   MLVSLRKLYITTKQSVLPEDEFASLRNLHTLSFEYCANLKFLFRREQ-LTFLEVLIVQSC  709

Query  2184  SSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLK  2363
              SL  LP  + +L KLE L++  CE L+L+  E       ++ L L   PKL +LP  ++
Sbjct  710   GSLQLLP--LHNLPKLEVLFVSRCEMLNLNC-EIPIHRLRMKFLHLEHCPKLHTLPQWIQ  766

Query  2364  D-IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVR  2537
             + +D   L+ L +  C  L   P WL   T L+ L+I +CP+L  LP +++  ++   + 
Sbjct  767   ESVDT--LRTLLILNCDTLKMFPKWLTTMTRLKMLHIINCPKLLCLPSEMQGLTALDDLT  824

Query  2538  IIDCP  2552
             I  CP
Sbjct  825   IEGCP  829



>gb|KDP26028.1| hypothetical protein JCGZ_21061 [Jatropha curcas]
Length=557

 Score =   439 bits (1129),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 237/520 (46%), Positives = 330/520 (63%), Gaps = 5/520 (1%)
 Frame = +3

Query  717   YNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGR  896
             YND+RV +NF  ++WV VS++F ++ + ++I  SATG+S+G L MDQLQ  L   L   +
Sbjct  3     YNDERVEKNFQLKMWVCVSQEFDVTTLAKEITSSATGRSYGDLTMDQLQARLRRSLGGRK  62

Query  897   YLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHD  1076
             +LLVLDDVWNE+  KW  LR LL     GS++IVTTRS KVA++ G   AYNL GLS  D
Sbjct  63    FLLVLDDVWNENLVKWVELRGLLEGCALGSKIIVTTRSSKVASVVGNDFAYNLPGLSHKD  122

Query  1077  CFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRE  1253
             C  LFLK  F   QE +  NL++ G EIV+KCGGVPLAV+TLGS+LY  T+E+ W+ IR+
Sbjct  123   CLSLFLKWEFNPGQEKQYPNLIDTGNEIVRKCGGVPLAVRTLGSLLYSSTEEKTWVSIRD  182

Query  1254  NEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQ  1433
             NEIWK++ ++ DILP+LKLSYD MP +L++CFAYC +FPK   +     I  W+A G ++
Sbjct  183   NEIWKLQHQKNDILPVLKLSYDHMPSYLKRCFAYCSLFPKNYVLYSFELIRFWMAYGLLE  242

Query  1434  SPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNV  1613
             SPD D+EL+  G ++  EL SR   QD+ +   G    CK+H+LVHDLA SVA +EC  V
Sbjct  243   SPDEDEELKENGLRFVKELWSRSFLQDIED--HGFFFTCKMHDLVHDLAISVAQSECSTV  300

Query  1614  KSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLN  1790
                 P + E V HL F   NL  ++ P+ L  L+ +R   +  R +G  S TF+   +  
Sbjct  301   NFLTPSVDEKVRHLSFSGSNLPSQQVPKFLHKLEKVRTIFFPVRGMGPTSGTFIDTCMSR  360

Query  1791  FRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCE  1970
             F+ LRVL L +   + LP+SIG LK LRYL+L  N  ++ LP  I +L NLQTL L  CE
Sbjct  361   FKHLRVLNLSDSCFETLPNSIGTLKNLRYLDLYRNRKLRKLPNSICRLQNLQTLRLEECE  420

Query  1971  QLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHM  2150
             +L+E+PR+  +    L+ L + +++ S  +     L  L++L L++C   +   +  Q +
Sbjct  421   KLEEIPRDI-KHTTRLRFLEIPTKQTSFPENGIGCLSSLRYLSLFQCGNLEKLFDDMQAL  479

Query  2151  KKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL  2270
               LR L I  C SL  LP GIR+L+ LE L I +C +L+L
Sbjct  480   TSLRTLVITSCGSLASLPRGIRNLSALETLVIGDCGKLNL  519



>ref|XP_003624045.1| Disease resistance protein RGA2 [Medicago truncatula]
 gb|AES80263.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=820

 Score =   447 bits (1151),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 325/843 (39%), Positives = 481/843 (57%), Gaps = 68/843 (8%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL  + E+ ++K+ S A +E S A  +  +L++++NT+S IKAVL DA+ +Q +NH
Sbjct  1     MAESFLFSLAESFITKVASRAVEEASLALGVYDDLREIKNTVSLIKAVLLDAELKQKQNH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
             E+++WLQ+++ V YDA+D+++DF   +L + + + SG I  KVR+  +  + L+YR K+ 
Sbjct  61    ELREWLQQIKRVFYDAEDVINDFECEALRKHVVNTSGSIRRKVRRYLSSSNPLVYRLKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ +  RLN+ A  R NF  + N   N V   K RE THS V  SD+IGRD DK+ I+
Sbjct  121   HQIKHVNKRLNKNAAARHNFGLQINDSDNHVV--KRRELTHSHVVDSDVIGRDYDKQKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++   +   +S+S +PIVG+GGLGKTTL K V+ND  + + F  ++WV VS+DF L 
Sbjct  179   DLLLQ---DSGHKSLSVIPIVGIGGLGKTTLAKTVFNDKSLDETFPLKMWVCVSDDFELQ  235

Query  792   KVIEKILRSAT----------GKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
              ++ KIL SA+           ++  +LD+ QLQ HL   L   ++LLVLDDVW+ED+ K
Sbjct  236   HLLVKILNSASVSDATPNLIHEENIKNLDVQQLQTHLRNTLAGKKFLLVLDDVWSEDRVK  295

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
             W  ++ LL  G +GS+V+VTTRS  +A +  T T+Y L GLS  D   +F+K AF+E +E
Sbjct  296   WIEVKNLLQVGDEGSKVLVTTRSHSIAKMMCTNTSYTLQGLSREDSLSVFVKWAFKEGEE  355

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
              +   L+EIGKEIVQKCGG+PLA++TLGS L+ K D +EW  +R+NEIW + QKE DILP
Sbjct  356   KKYPKLIEIGKEIVQKCGGLPLALRTLGSSLFLKDDIEEWKFVRDNEIWNLPQKEDDILP  415

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLS+DQ+P +L++CFA   +F K           LW A  F+ SP+  + LE++GNQ+
Sbjct  416   ALKLSFDQLPSYLKRCFACFSLFVKDFHFSNYSVTVLWEALDFLPSPNKGKTLEDVGNQF  475

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +EL SR   QD   +  G +   K+H+LVHDLA  VA  E   +K  +  I ++V HL 
Sbjct  476   LHELQSRSFLQDFYVS--GNVCVFKLHDLVHDLALYVARDEFQLLKFHNENIIKNVLHLS  533

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
             F  ++L  +  P P      LR   +S R    S          F +  +    N ELK 
Sbjct  534   FTTNDLLGQT-PIP----AGLRTILFSIRSQQCS---------FFEQFGI--KGNKELKS  577

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP S                        + KL NLQTL L  C +L++LP   G  L+SL
Sbjct  578   LPDS------------------------VCKLQNLQTLILEGCLKLEKLPNGIG-NLISL  612

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSC-RKFPAEIWQHMKKLRVLRIYECSSLT  2195
             + L++T+ + S   +    L  L+FL +  CSC           +  L+ L I  C ++T
Sbjct  613   RQLHITTMQSSFPDKEIAKLTSLEFLSI--CSCDNLESLLGELELPNLKSLSIIYCGNIT  670

Query  2196  CLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDID  2372
              LP  ++ +  ++ L I NC +L LS+G         L+ L +  LP+L+S P  L+   
Sbjct  671   SLP--LQLIPNVDSLMISNCNKLKLSLGHENAIPRLRLKLLYIESLPQLLSFPQWLQGC-  727

Query  2373  AMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDC  2549
             A  L  L +  C  L  LP+W      L  L I +CP+L  LP+ +    N + + + DC
Sbjct  728   ADTLHSLFIGHCENLEKLPEWSSTFICLNTLTITNCPKLLSLPDDVHCLPNLECLEMKDC  787

Query  2550  PLL  2558
             P L
Sbjct  788   PEL  790



>ref|XP_007145621.1| hypothetical protein PHAVU_007G254300g [Phaseolus vulgaris]
 gb|ESW17615.1| hypothetical protein PHAVU_007G254300g [Phaseolus vulgaris]
Length=849

 Score =   448 bits (1153),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 316/838 (38%), Positives = 490/838 (58%), Gaps = 31/838 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L    E+++ K+ S A +E S A+ +  EL++++ T++ IK VL DA+++   + 
Sbjct  1     MAESLLFSFAESLIGKLASRAVEEASLAFGVHSELQQMKATMALIKGVLLDAEQRNPLSS  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              + +WL+ L+ V  DA+D+ DDF   +L + +    G  + KVR  F+  + L+YR K+ 
Sbjct  61    ALSEWLRLLKRVFSDAEDIADDFQCEALRKHVVKTYGDSSRKVRHFFSTSNPLVYRLKMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I++I  RL ++A  R  F  +  +    V +  +RE THS V PS++ GR+ DK  IV
Sbjct  121   HRIQDINTRLAKLAAQRSMFGLQIIHQDTRVVH--VREMTHSHVNPSNVTGREHDKNQIV  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++    +   ++S +PIVG+GGLGKTTL KLV+ND  +   F  ++WV VS DF L 
Sbjct  179   KLLVQDVHHQ---TLSVIPIVGMGGLGKTTLAKLVFNDTNIDACFSLKMWVCVSNDFELR  235

Query  792   KVIEKILRSATG--KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
              V+ KIL S     ++F + + +QLQ  L   L   ++LLVLDDVWNED  +W +L+E++
Sbjct  236   NVLIKILNSDPNPTENFNNFETEQLQNRLRNTLQGQKFLLVLDDVWNEDCVRWDDLKEII  295

Query  966   MSGCDGSRVIVTTRSIKVATITGT--TTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
              S  +GS+++VTTRS ++AT+  T  +  Y L  LS+ D   LFLK AF +  E +   L
Sbjct  296   DSDVEGSKILVTTRSHEIATMMRTKFSNFYLLECLSEKDSLSLFLKSAFEDGDEKKHPQL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             +EIGKEIV+KCGG+PLA+KT+GS L+ + D++EW  IR+NEIW ++Q E  I P LKLSY
Sbjct  356   LEIGKEIVKKCGGLPLALKTVGSSLFSRVDKKEWESIRDNEIWNLKQNEKSIFPALKLSY  415

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             DQ+P +L+ CFA   +FP+  E        LW A GF+      + + ++  Q  +EL S
Sbjct  416   DQLPSYLKPCFASFSLFPEDNEFCCSHISTLWEALGFLPPSKESESVTDVTYQLLHELWS  475

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL  1676
             R    D ++   G   +  +H+LVHDLA  +A  E   +   +P+I E+V HL F  +NL
Sbjct  476   RSFLSDYIDY--GTDCSFTLHDLVHDLATYIAKGEFERIDLRNPKISENVQHLAFTDNNL  533

Query  1677  SREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
               + F  PL  L++LR     F  G  ++ F+   L   + LRVL L   E + LP  IG
Sbjct  534   LAQAF--PLTGLRSLR-----FPFGMNNEAFLNTILSTCKYLRVLELCCYEYESLPDCIG  586

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLT  2036
              LK LR LNL  +  +K LP+ + KL NLQ L+L  C +L++LP+   + L+SL++L +T
Sbjct  587   KLKHLRCLNLEFSKKLKGLPDSVCKLQNLQNLSLCGCIKLQKLPKGI-KNLISLRSLSIT  645

Query  2037  SQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQH--MKKLRVLRIYECSSLTCLPAG  2210
             ++++   +    SL  L+ L+   CSC      +++   +  L++L +++C SL  +   
Sbjct  646   TRQLDFPEEEIASLTSLEKLIF--CSCDNL-VSLFEGILLPTLKILSLHDCKSLKSV--S  700

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDIDAMKLK  2387
                ++ L+ L I  C++L+LS+  G +     L+SL+L  LP+LV+LP   +      L+
Sbjct  701   FHAISNLKVLNISECDKLELSMSLGNQIPNSRLKSLILKDLPQLVTLPQWFQG-SVNSLE  759

Query  2388  YLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLL  2558
              L +  C     LPDWL     L+ L I +CP L  LPE +   +N K ++II CP L
Sbjct  760   TLAIVDCINFKELPDWLPTLICLKILVIFNCPNLLSLPENMHHLTNLKELKIIGCPEL  817



>ref|XP_002525457.1| leucine-rich repeat containing protein, putative [Ricinus communis]
 gb|EEF36947.1| leucine-rich repeat containing protein, putative [Ricinus communis]
Length=1177

 Score =   457 bits (1175),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 285/656 (43%), Positives = 415/656 (63%), Gaps = 18/656 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L    + +  K+ S   +E       K EL+KL++TLSTI AVL DA+++Q K+ 
Sbjct  1     MAEIVLIAFLQVLFDKLASSQLEEYGMWMGAKKELEKLESTLSTIAAVLEDAEDRQVKDK  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V++WL KL+D V DADD LD+F T +L +K++S +     V      P       K+  
Sbjct  61    AVRNWLTKLKDAVLDADDALDEFATKALQQKVKSQNDSKHWVSSFLLVPKSAALYVKMEF  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL---REQTHSFVRPSDIIGRDSDKES  605
             K++ I  RLN IA +R NFHF E   +  VE  K    R QTHSFV  S+I GR+ DK  
Sbjct  121   KMKGINERLNAIALERVNFHFNEG--IGDVEKEKEDDERRQTHSFVIESEIFGREKDKAD  178

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             IV ML+     ED   +S +PIVG+GG+GKTTL +L +ND +V + F  R+W+ VSEDF 
Sbjct  179   IVDMLIGWGKGED---LSIIPIVGMGGMGKTTLAQLAFNDVKVKEFFKLRMWICVSEDFD  235

Query  786   LSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             + ++ + I+ + T +    L MD LQ  L   L   R+LLVLDDVW+ED +KW  LR LL
Sbjct  236   VQRLTKAIIEAVTKEGCDLLGMDLLQTRLRDRLAGERFLLVLDDVWSEDYNKWDRLRTLL  295

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLV  1139
               G  GS++IVT+RS +VA I  + +   L+GLS+ DC+ LF K AF     E  PR +V
Sbjct  296   RGGAKGSKIIVTSRSARVAAIMSSLSTCYLAGLSEDDCWTLFSKRAFGIGGAEETPR-MV  354

Query  1140  EIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYD  1319
              IGKEIV+KCGG PLAV TLGS+++ + DEQEW+++++NE+WK+ Q+   ILP L++SY+
Sbjct  355   AIGKEIVKKCGGNPLAVNTLGSLMHSRRDEQEWIYVKDNELWKLPQECDGILPALRISYN  414

Query  1320  QMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSR  1499
              +P +L++CFAY  +FPK  EI ++  I +W+A+G ++  + D++LE++GN YF  L+ R
Sbjct  415   HLPSYLKRCFAYAAVFPKDYEINKDRLIQMWIAEGLVEISNCDEKLEDMGNTYFKYLVWR  474

Query  1500  FCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE-IPESVHHLVFHADNL  1676
               FQ   E  DG I++CKIH+L+HDLAQ VAG EC  +++G  + IP+   HL    + +
Sbjct  475   SFFQVARECEDGSIISCKIHDLMHDLAQFVAGVECSVLEAGSNQIIPKGTRHLSLVCNKV  534

Query  1677  SREEFPQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
             + E  P+     KNL    A + +   V     +   L FR L VL+L +  +++LP+S+
Sbjct  535   T-ENIPKCFYKAKNLHTLLALTEKQEAVQ--VPRSLFLKFRYLHVLILNSTCIRKLPNSL  591

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLK  2021
             G L  LR L++S+  +I++LP+ I+ LVNLQTLNL +C +L+ELP+N  + L+SL+
Sbjct  592   GKLIHLRLLDVSHT-DIEALPKSITSLVNLQTLNLSHCFELQELPKN-TRNLISLR  645


 Score = 75.9 bits (185),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 118/248 (48%), Gaps = 33/248 (13%)
 Frame = +3

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
             L+ LPS    L  L  L +S    + SL   +  L NL++L++  C++L  LPR      
Sbjct  886   LRVLPS----LTSLATLRISEFSEVISLEREVENLTNLKSLHIKMCDKLVFLPRGISN--  939

Query  2010  MSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSS  2189
                    LTS               L  L ++ CS      EI Q +  LR L I  C  
Sbjct  940   -------LTS---------------LGVLGIWSCSTLTSLPEI-QGLISLRELTILNCCM  976

Query  2190  LTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDI  2369
             L+ L AG++HL  LEKL I  C ++   + E ++   SLQSL +    K  SLP G++ +
Sbjct  977   LSSL-AGLQHLTALEKLCIVGCPKMVHLMEEDVQNFTSLQSLTISHCFKFTSLPVGIQHM  1035

Query  2370  DAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIID  2546
                 L+ L +   P L  LP+W++N  LL+ L I DCP L+ LP  ++  ++ + + I  
Sbjct  1036  TT--LRDLHLLDFPGLQTLPEWIENLKLLRELSIWDCPNLTSLPNAMQHLTSLEFLSIWK  1093

Query  2547  CPLLNG*C  2570
             CP L   C
Sbjct  1094  CPNLEKRC  1101


 Score = 58.5 bits (140),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 89/194 (46%), Gaps = 17/194 (9%)
 Frame = +3

Query  1707  NLKNLRYFAYSFRVGTVSK-TFVKKTLLNFRRLRVLMLQNLE-LKELPSSIGFLKQLRYL  1880
             NL NL+    S  +    K  F+ + + N   L VL + +   L  LP   G +  LR L
Sbjct  915   NLTNLK----SLHIKMCDKLVFLPRGISNLTSLGVLGIWSCSTLTSLPEIQGLI-SLREL  969

Query  1881  NLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQK  2060
              + N C + SL   +  L  L+ L ++ C ++  L     Q   SL++L ++       K
Sbjct  970   TILNCCMLSSLAG-LQHLTALEKLCIVGCPKMVHLMEEDVQNFTSLQSLTISH----CFK  1024

Query  2061  RSSVSLGFLQFLLLYKCSCRKFPA-----EIWQHMKKLRVLRIYECSSLTCLPAGIRHLA  2225
              +S+ +G      L       FP      E  +++K LR L I++C +LT LP  ++HL 
Sbjct  1025  FTSLPVGIQHMTTLRDLHLLDFPGLQTLPEWIENLKLLRELSIWDCPNLTSLPNAMQHLT  1084

Query  2226  KLEKLWIWNCEELD  2267
              LE L IW C  L+
Sbjct  1085  SLEFLSIWKCPNLE  1098



>gb|KEH41282.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=867

 Score =   447 bits (1151),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 320/851 (38%), Positives = 501/851 (59%), Gaps = 35/851 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+F+ DI +++L K+ S A ++ S  ++L  +L+ +++TLS +K +L DA+E + + H
Sbjct  1     MIESFIFDIVDSLLGKLASYAYEQASPVYSLYEDLRSIKDTLSIVKGMLLDAEETKIQYH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL--RSCSGILTKVRKLFTRPDGLIYRFKI  428
                +W ++++++ YDA+D+L+ F      +++   SCS  + KVR  F   + L +R ++
Sbjct  61    GFHEWRRQIQNICYDAEDVLEKFELQHKRKQVLKASCSNRM-KVRHFFCSSNSLAFRLRM  119

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
               +I++IR RL+++A D   F       V+P    + RE T+  V    +IGR+SD+E I
Sbjct  120   AKQIKDIRDRLDKVATDGTKFGLA-TINVDPRLIVQKREMTYPDVDALSVIGRESDREEI  178

Query  609   VGMLMKS---CDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             + +LM++    D +  +S+S +P+VG+GGLGKTTL KLV+ND R+ + F  ++WV VS++
Sbjct  179   IKLLMQAHPHGDGDGDKSLSVIPMVGIGGLGKTTLAKLVFNDKRIDELFQLKMWVCVSDN  238

Query  780   FSLSKVIEKILRSATGKSFGH------------LDMDQLQEHLNGVLCSGRYLLVLDDVW  923
             F + ++I KI+ SA   +  H            LD+ QL   L   L S ++LLVLDDVW
Sbjct  239   FDIRQIIIKIINSAVNSASAHMSGLALQENIINLDIVQLVSLLKQTLSSQKFLLVLDDVW  298

Query  924   NEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCA  1103
             N+D+ KW  L++L+  G  GS+++VTTR+  +A++ G   +Y L GLS  DC  LF+K A
Sbjct  299   NDDRAKWIELKDLIKVGTRGSKIMVTTRNNSIASMMGNVPSYVLQGLSLKDCLSLFVKWA  358

Query  1104  FRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQK  1280
             F+E +E +  NLVEIGKEIV+KC GVPLAV+TLGS L+ K D   W+ +R++E+W ++Q+
Sbjct  359   FKEGEEEKYPNLVEIGKEIVKKCQGVPLAVRTLGSSLFSKFDLNTWIFVRDSELWNLKQQ  418

Query  1281  ETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELE  1460
             + DILP LKLSYDQMP +LRQCFAY  ++PK         I LWVA G +Q  +G ++LE
Sbjct  419   KDDILPALKLSYDQMPSYLRQCFAYFSLYPKDITFCSLDIIALWVALGLVQPRNGSEKLE  478

Query  1461  NLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPE  1640
             ++  +Y +EL SR   QD  +  +G I   K+H+LVHDL+  VA AE L V S    IPE
Sbjct  479   DIAREYIDELNSRSFLQDFED--NGWICVFKVHDLVHDLSLYVAKAEFLVVDSHIQNIPE  536

Query  1641  SVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLM  1814
              V HL +   D+L    FP+     +N+R   +    VG  S++ + K +  ++ LR+L 
Sbjct  537   QVRHLSIVENDSLGHTLFPKS----RNVRSILFPIDGVGLDSESLLYKWISRYKFLRLLN  592

Query  1815  LQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRN  1994
             L+    + LP+SI  L+ + +L+LS +  IK LP  I KL+NLQ L L  C +L+E+P+ 
Sbjct  593   LRYSSFEYLPNSIAKLEHMCFLDLSYSKKIKRLPNSICKLLNLQVLLLTGCTELEEMPKG  652

Query  1995  FGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQ-HMKKLRVLR  2171
              G +L+SL+ L +T+++  L      SL  L  L  + C   K+     Q     L  L 
Sbjct  653   LG-KLISLRQLMITTKQSVLLDNEFASLNNLHTLGFHFCDNLKYLFSREQTQFTSLETLA  711

Query  2172  IYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm-glPKLVSL  2348
             ++ C S   L   + +  KL+ L+I  CE+L+LS+             L +   P  ++L
Sbjct  712   LHSCKSFDSLT--LDNFPKLQNLFIRGCEKLNLSLKNDSAIQRLKMKHLYIWEFPSFLTL  769

Query  2349  PAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLP-EQIRSSSN  2525
             P  +  + A  L+ L +   P L  LP+ L   + L+RL+I +CP L  LP + +R ++ 
Sbjct  770   PRWVLSV-ADILETLVIYNFPNLEMLPECLTTMSHLKRLHIGNCPNLLNLPSDMLRLTTI  828

Query  2526  AKVRIIDCPLL  2558
              K+ I  CP L
Sbjct  829   EKLYIEGCPEL  839



>ref|XP_007162219.1| hypothetical protein PHAVU_001G134100g [Phaseolus vulgaris]
 ref|XP_007162220.1| hypothetical protein PHAVU_001G134100g [Phaseolus vulgaris]
 gb|ESW34213.1| hypothetical protein PHAVU_001G134100g [Phaseolus vulgaris]
 gb|ESW34214.1| hypothetical protein PHAVU_001G134100g [Phaseolus vulgaris]
Length=847

 Score =   446 bits (1148),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 314/823 (38%), Positives = 488/823 (59%), Gaps = 24/823 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE FL  I E++++K+ S   +E S    L   L+++  TLS +KAVL DA+E+Q +N+
Sbjct  1     MAELFLFSIAESLIAKLSSWTYEETSQVLRLYHHLREVSQTLSLVKAVLLDAEEKQQENY  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
             E+++WL++++ V  DA+++LD+F   +L +++    G  T KV   F+  + L++ +++ 
Sbjct  61    EMREWLRQIKHVFSDAENMLDEFECETLRKEVVQAHGSTTIKVAHFFSSSNPLVFHYRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I++I+ RL+++A DR  F   E   V+     + R+ T+S+V  SD+IGR+ DKE+I+
Sbjct  121   QQIQKIKKRLDKVAADRHKFGL-ETIDVDRRSVHR-RDMTYSYVIDSDVIGRNQDKENII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++   + + +S+S +PIVG+GGLGKTTL K+V+ND R+ + F  ++WV VS DF + 
Sbjct  179   QLLVQQNPKNNDKSLSIIPIVGMGGLGKTTLAKIVFNDRRINELFPLKMWVCVSIDFEIK  238

Query  792   KVIEKILRS----ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             + I KI+ S    A  ++   LD++QLQ  L   L S ++LLVLDDVWNED  KW  LR 
Sbjct  239   QEIIKIINSNNASAHQQNLDKLDVEQLQSQLRNKLVSQKFLLVLDDVWNEDLVKWVELRN  298

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQ-EYRPRNL  1136
             L+  G  GS+++VTTR+   A++ GT  +Y L GLS+ D   LF+K AF+E  E R   L
Sbjct  299   LMQVGAAGSKILVTTRNHATASMMGTVPSYILEGLSEEDSLSLFVKWAFKEGVEKRYPYL  358

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             ++IG+EIV+KC GVPLAV+TLG +LY K  ++EW  +R+N+ W   +    + P LKLS+
Sbjct  359   IDIGREIVKKCKGVPLAVRTLGGLLYLKDKKEEWEFVRDNKNWSSIKVGNAMFPPLKLSF  418

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLS  1496
             DQMP +LR+CFA   ++P G         +LW A G + SP+ +Q L++  NQY +EL S
Sbjct  419   DQMPSNLRKCFALFNLYPCGYAFESFDVTSLWGALGLLPSPNRNQILKHDANQYISELFS  478

Query  1497  RFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPES--VHHLVFHAD  1670
             R   QDVV+   G   A KIH+LVHD A+ + G + + V+      PE   V HL F  +
Sbjct  479   RSFLQDVVDYGIG--FAFKIHDLVHDNARYL-GKDSIIVRYPFVFTPEHRYVQHLSF-PE  534

Query  1671  NLSREEFP-QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             N+  E FP Q  +  + + +      VG  S+ F+ K +     LR L L +   K LP 
Sbjct  535   NVGIENFPIQKFVGARTILFPTPG--VGANSEAFLLKFVSRCNYLRFLDLSDSMYKVLPP  592

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              IG LK LRYL+L NN ++K LP+ +  L+ L+ L L  C +L  LP+   ++++SL+ L
Sbjct  593   YIGKLKHLRYLSLENNKSLKRLPDSLCNLLKLEVLILSRCTELVALPKGL-RKMISLQHL  651

Query  2028  YLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMK--KLRVLRIYECSSLTCL  2201
              +T+++  L +    +L  LQ L +  C+  +    ++  +K   L+VL I  C SL  L
Sbjct  652   EITTKQRVLPEDEIANLSSLQTLRIEFCNNVE---SLFGGIKLLTLKVLCITSCQSLKSL  708

Query  2202  PAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMK  2381
             P  I +  KLE L + NC+ L+LS          L+ +  + LP+L++LP  ++      
Sbjct  709   PLDIEYFPKLETLLVDNCDVLELSNEHNQNSNLRLKIVNFISLPQLLTLPHWIQG-STDT  767

Query  2382  LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI  2510
             L+YL ++ C  L  LP WL   T L+ L +  CP +  L E I
Sbjct  768   LQYLLISSCNNLVGLPQWLSAMTCLKTLRVISCPNMLSLHEDI  810



>gb|KHG06754.1| Disease resistance RGA2 [Gossypium arboreum]
Length=785

 Score =   444 bits (1141),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 320/762 (42%), Positives = 454/762 (60%), Gaps = 48/762 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAETFL DI E VL+KIV L+  E+  A+N K +LKKL++T+ +IKAVL DA+ QQ +N 
Sbjct  1     MAETFLFDIAERVLAKIVHLSVYEVRLAFNAKTDLKKLEDTMISIKAVLLDAERQQHQNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT--KVRKLFTRPDGLIYRFKI  428
             +++  + KLRD+ YDA+D++DDF   +L ++       +   KVR L +    L +  K+
Sbjct  61    KLRLCMWKLRDIFYDAEDVIDDFKCEALRKQDAFNHPNINNLKVRVLGSCCLPLSFSLKM  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKE---NYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             +HKI++I GRL ++A +  +F  ++   N +V        R +T SFV  SD+IGRD DK
Sbjct  121   SHKIKDINGRLGELATEWNSFDLRQCSDNRHV-------FRRETISFVHSSDVIGRDEDK  173

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E+I+GMLM+   E    SV  +PIVGLGGLGKTTL +LVYNDDRV   F  ++W+ VSE+
Sbjct  174   ENIIGMLMEPSAER---SVPVIPIVGLGGLGKTTLAQLVYNDDRVTSLFPLKIWICVSEE  230

Query  780   FSLSKVIEKILRSATGK-SFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             F LS++ + I++S   +     L ++ LQ  L  +L   ++LLVLDDVWNE+Q KW  LR
Sbjct  231   FDLSRLFKLIIQSVNAEVRCDDLTLEALQARLRSLLNDRKFLLVLDDVWNENQAKWVELR  290

Query  957   ELLMS--GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR  1130
              +L S  G   S++IVTTRS+KVA+I  +   Y L GL   DC  LF+K AF + E R  
Sbjct  291   NVLRSTDGFSPSKIIVTTRSLKVASIMSSIPPYLLKGLPLEDCLTLFIKWAFNDGEERHY  350

Query  1131  -NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              NLV IG+EIV+KC GVPLAV+TLGS+L+ KT E +W++IRE+EIW++EQ E DILP+LK
Sbjct  351   PNLVRIGEEIVKKCKGVPLAVRTLGSLLFQKTGESDWIYIRESEIWRLEQHENDILPVLK  410

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSY+ +P HL++C A+  ++ K E    +  I LW+A G ++ P  +Q+ E++G +Y NE
Sbjct  411   LSYNHLPSHLQRCLAFLSLYKKDEIYYSDRVIRLWMANGLLEHPKQNQKWEDVGKRYLNE  470

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA  1667
             LLSR C  +  + F G     K+H+LVHDLA  V+  EC  V S    + E+V HL+   
Sbjct  471   LLSR-CLIEKEKDF-GLDFNFKMHDLVHDLALDVSQKECKTVNSKTEMVDENVRHLLLCD  528

Query  1668  DNLSREEFPQPLLNLKNLRYFAYSF------RVGTVSKTFVKKTLLNFRRLRVLMLQNLE  1829
               L   E P+ L  +KN+R            R   V K+ +   + NF+ LR L L +  
Sbjct  529   QKLV--EVPRVLEEMKNVRTVIIQAASKRPKRSEIVDKSLINLCVSNFKYLRALELTDSP  586

Query  1830  LKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQL  2009
             L  LP+SIG LK LR L+L+   +I+ LP    KL +LQ+LNL     LK+LP +  Q+L
Sbjct  587   LTALPNSIGTLKHLRDLDLARCEDIQKLPSSFYKLRSLQSLNL-GGTYLKQLPDSV-QRL  644

Query  2010  MSLKTLYLTSQEV---SLQKRSSV--------------SLGFLQFLLLYKCSCRKFPAEI  2138
             + L  L +T +E     +Q   S+              S   LQ L +  C         
Sbjct  645   IELTHLEITIKECLPEGMQYLKSLRTLFLNLPRLLLQGSSSTLQQLQISWCENLSVLPAW  704

Query  2139  WQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEEL  2264
               ++  L  L+I  C +L+ LP GI  L+ L +L I  C EL
Sbjct  705   LLNLTSLHKLKIVGCINLSALPEGIDLLSNLRELTIDGCPEL  746



>ref|XP_011011367.1| PREDICTED: disease resistance protein RGA2-like isoform X4 [Populus 
euphratica]
Length=853

 Score =   446 bits (1147),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 325/822 (40%), Positives = 465/822 (57%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP   +LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVMFAVLPATRALPEQLFQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +PD ++N   LQ L I DCP L+
Sbjct  770   GSAESLQTFIIIGCPNIGEMPDCIRNLKKLQNLEISDCPRLN  811



>ref|XP_008350652.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=1040

 Score =   451 bits (1161),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 286/662 (43%), Positives = 411/662 (62%), Gaps = 18/662 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L +I E ++  +   A +E    + +K ELKKL+ T++ IK VL DA+ ++A NH
Sbjct  1     MAEGVLFNIAEGIIGSLXXXAJZEXGLLYGVKDELKKLEKTVTKIKNVLLDAEXKKA-NH  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V +WL+ L DVVYDADDLLD+F T +  R++   +    KVR  F+  + LI+R KI H
Sbjct  60    XVTEWLKSLEDVVYDADDLLDEFYTEARWRQMVXGNKFSKKVRLFFSSSNQLIFRLKIGH  119

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+EIR  LN I  D R   F  +  +          ++HSFVR  +IIGRD DK  IV 
Sbjct  120   KIKEIRETLNVIEXDXR---FXXDERLZEARFVXXERESHSFVRKEEIIGRDRDKREIVZ  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             + +   D    E+VS + +VG+GGLGKT L +LV+ND+ V ++F+ ++W+ +S+ F L+ 
Sbjct  177   LXL---DPIPKENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIWICISDTFELNV  233

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +++KI+ SAT ++ G+L++DQLQ  L  ++   RYLLVLDDVWNE++ KW +L+ LLM G
Sbjct  234   LVKKIIESATSRTLGNLELDQLQNDLRKLIDGKRYLLVLDDVWNENREKWLSLKXLLMGG  293

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR-EQEYRPRNLVEIGK  1151
               GSR+++TTRS  V   + T   Y L GL + + + LF + AF+ EQE    ++  IG 
Sbjct  294   ARGSRILITTRSEVVXKXSDTNKPYXLRGLEEKESWSLFKQMAFKTEQESENPSIKAIGV  353

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EIV KC G+PLA++T+G MLY K  E EWL  + N++ K+ Q+ +DILP L LSYD +P 
Sbjct  354   EIVGKCKGIPLAIRTIGRMLYSKNRENEWLAFKNNDLSKVNQEASDILPTLXLSYDILPS  413

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             HL+ CFAYC +FPK  EI  +  +NLW AQGF++S D ++ LE+ G +YF EL  R  FQ
Sbjct  414   HLKHCFAYCSLFPKDHEIDIKTLVNLWXAQGFVKSJDQNESLEDXGYEYFLELAWRSFFQ  473

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF-HA-DNLSRE  1685
             +V     G I +CK+H+L+HDLA+SV+G E   V   +    E + H+ F H+      E
Sbjct  474   EVTYDXFGMIRSCKMHDLMHDLAKSVSGMEITIVVEXEDNFSEKLRHVSFDHSIGPWLIE  533

Query  1686  EFPQPLLNLKNLRYFAY--SFRVG----TVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             + P  LL    LR F Y   +R G       K+F      NF+ LR+L L  L ++ LP+
Sbjct  534   KIPTSLLKAHKLRTFFYISEYRYGFHDDGSIKSFCNAIASNFKSLRMLSLNGLVIRALPN  593

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             S+  L+ LRYL+L  N  I+ LP+ I +L NLQTLNL  C+ L ELPR+   +L +L+ L
Sbjct  594   SLRKLRHLRYLDLRGN-PIERLPKWIVRLQNLQTLNLSGCDMLVELPRDI-NKLFNLRHL  651

Query  2028  YL  2033
              +
Sbjct  652   MV  653



>ref|XP_004298083.1| PREDICTED: putative disease resistance protein RGA1-like [Fragaria 
vesca subsp. vesca]
Length=1000

 Score =   450 bits (1157),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 304/748 (41%), Positives = 447/748 (60%), Gaps = 55/748 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E        ++L K+ S    +    + +  E+KKL+NTLSTIKAVL DA+E+Q K+H
Sbjct  1     MVEAVPFGTAADILIKLGSSTFQKFGLIYGVNKEIKKLENTLSTIKAVLLDAEEKQEKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V+DW++KL +VVY+ADDLLD F T +  R+L +      +VR+ F++   L +++K++ 
Sbjct  61    LVQDWIRKLNEVVYEADDLLDAFETKA--RQLEN-----HQVREFFSKT--LAFKYKMSR  111

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNP---VENGKLREQTHSFVRPSDIIGRDSDKES  605
             K+RE R RL++IA D   F+F++   +     VE    RE+THSF+  S ++GR  +KE 
Sbjct  112   KLRETRERLDEIAGDISKFNFRDRSLIISDIGVEINNRREETHSFMVESAVVGRKREKEE  171

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             +V  L     E   E+V    IVG+GGLGKTTL K++YNDDRV   F+ ++WV    DF+
Sbjct  172   MVEFLTNPPSE--GENVYVTAIVGIGGLGKTTLAKMLYNDDRVGNYFEFKMWVWGYGDFN  229

Query  786   LSKVIEKILRSAT-----GKSFGH--------LDMDQLQEHLNGVLCSGRYLLVLDDVWN  926
             L  + EKILRS+         F H        L M++LQ  L   L   RYLLVLDDVWN
Sbjct  230   LYSIAEKILRSSATNELEDSEFYHQHILMQKKLLMEELQILLRKKLDGKRYLLVLDDVWN  289

Query  927   EDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF  1106
              ++  W  L +LL  G +G++V+VTTRS K+ ++    + + L  LS+ + + LF + AF
Sbjct  290   VNRESWLQLNDLLKGGANGTKVVVTTRSTKITSLMDIDSPFVLHDLSEEESWTLFKQLAF  349

Query  1107  ---REQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQ  1277
                RE+E+    LV IG+ IV+KCGGVPLA++TLGSM+  K +E EW+ I+  EIW++ +
Sbjct  350   KGGREEEHP--ELVPIGRRIVKKCGGVPLAIRTLGSMMRYKANEIEWIAIQNTEIWELPK  407

Query  1278  KETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQEL  1457
             +E D+L ILKLSYD MP +L+QCF+YC +FPKG  I +++ + LW+AQG+I  P  ++ L
Sbjct  408   EENDVLKILKLSYDHMPIYLKQCFSYCALFPKGYAIEKKMLVELWIAQGYIHLPGKERNL  467

Query  1458  ENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAE--CLNVKSGDPE  1631
             E +G+ YF EL+ R  FQ+V +  +G +++C +H+L+HDL+++VAG+E    +V  GD  
Sbjct  468   EEIGDMYFKELIERSLFQEVKKDANGILISCHMHDLIHDLSRAVAGSEVSVCSVDVGD--  525

Query  1632  IPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVL  1811
             I E VHHL F     S  E P  LL  K  R F    +      +     + N R LRVL
Sbjct  526   ISERVHHLSFSCYLPSSWEVPIALLKAKKTRTFMLPLQDQAYKISSHNSIISNLRCLRVL  585

Query  1812  MLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPR  1991
              L NL + EL +S+G L  LRYL+LS N ++ +LP  IS L NLQTL L  C +L++LPR
Sbjct  586   DLHNLRINELSNSVGKLTHLRYLDLSGNVSMTALPASISNLQNLQTLKLNRCYRLEQLPR  645

Query  1992  NFGQQLMSLKTLYLTSQEVSLQKRSSVSLGF-----LQFLLLYKCSCRKFPAEIWQHMKK  2156
             + G ++ SL+ L +T      +K + + LG      LQ L L+    +   + +   + +
Sbjct  646   DIG-KMTSLRHLEIT----GCRKLNHMPLGMGNLVSLQTLPLFILGKKDLFSGVSGGLDE  700

Query  2157  LRVLRIYECSSLTCLPAGIRHLAKLEKL  2240
             L        S L CL  G+ H+  LE +
Sbjct  701   L--------SGLNCL-KGVLHVVHLEHV  719



>gb|KHN43715.1| Putative disease resistance protein RGA3 [Glycine soja]
Length=846

 Score =   445 bits (1145),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 320/850 (38%), Positives = 493/850 (58%), Gaps = 29/850 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E++L K+ S A ++ S A  +  +L++++ T++ +KA+L DA++++ +N+
Sbjct  1     MAESLLFSVAESLLGKLASRAVEKASLAMGVYHDLQQMRVTMALVKALLLDAEQKKQQNN  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              + +WL++++ V  DA+D++D+F   +L + + +  G ++ KVR+LF+  + L+YR ++ 
Sbjct  61    ALSEWLRQIKRVFSDAEDIVDNFECEALRKHVVNTHGSVSRKVRRLFSTSNPLVYRLRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              +I+ I+ RL ++A DR  F  + N     V +   RE THS V  S++IGR+ DK+ I+
Sbjct  121   REIKGIKNRLEKVAADRHMFGLQINDMDTRVVHR--REMTHSHVNASNVIGREDDKKKII  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++  D  DT S S + I G GG+GKTTL KLV+ND  + + F  ++WV VS DF L 
Sbjct  179   ELLLQ--DGNDT-SPSVISIEGFGGMGKTTLAKLVFNDLIIDECFPLKMWVCVSNDFELR  235

Query  792   KVIEKILRSATG---KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              V+ KIL S      ++F + +M+QLQ  L   L   ++LLVLDDVWNE++ KW  L+++
Sbjct  236   NVLIKILNSTPNPRNENFKNFEMEQLQNRLRNTLHRQKFLLVLDDVWNENRVKWNELKDI  295

Query  963   LMSGCDGSRVIVTTRSIKVATI--TGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-N  1133
             +  G +GS+++VTTRS  +A +  T ++  Y L GLS+     LFLK AF + E R    
Sbjct  296   IDIGVEGSKILVTTRSHAIAVMMRTKSSNYYRLEGLSEEHSLSLFLKSAFDDGEERKHPQ  355

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             LVEIGKEI++KCGG+PLAV+TLGS L  + + QEW  +R+NEIW + Q E DILP L+LS
Sbjct  356   LVEIGKEILKKCGGIPLAVRTLGSSLVSRVNRQEWESLRDNEIWNLPQNEQDILPALELS  415

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELL  1493
             YDQ+P +L++CFA   + P+  +I       LW A GF+  P   + + ++ NQ+  EL 
Sbjct  416   YDQLPSYLKRCFACFSLAPEDFDISSFYVTLLWEALGFLPQPKEGETIHDVANQFLRELW  475

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN  1673
              R    D ++   G     K+H+LV DLA  VA  E   +    P I E   HL F  +N
Sbjct  476   LRSFLTDFLDM--GSTCRFKLHDLVRDLAVYVAKGEFQILYPHSPNIYEHAQHLSFTENN  533

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
             +         ++L  +      F V   ++ F+   +   + LRVL L   + + LP SI
Sbjct  534   MLG-------IDLVPIGLRTIIFPVEATNEAFLYTLVSRCKYLRVLDLSYSKYESLPRSI  586

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYL+LS N  ++ LP  + KL NLQTL+L  C +L ELP+   ++L+SL+ L +
Sbjct  587   GKLKHLRYLDLSGNQKLEELPHSMYKLQNLQTLDLRGCIKLHELPKGI-RKLISLRQLLV  645

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGI  2213
             T+++     +   +L  ++ L L+ C+  +   E  Q +  LR L    C SL       
Sbjct  646   TTRQPEFPDKEIANLTSIETLELHSCNNLESLFEEIQ-ISTLRFLNFSGCGSLKSF--SF  702

Query  2214  RHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
               +  LE L I+NC +L+LS+G G E     L+ L+L  L +LV+LP  L+   A  L  
Sbjct  703   HAIKNLESLVIFNCSKLELSMGLGNEIPASRLKLLVLQSLSQLVTLPRWLRG-SASTLHS  761

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLLNG*  2567
             L + GC  L  LP+WL N   L+ L IE CP+L  LP+ +   +N + + I DCP L   
Sbjct  762   LLIVGCNNLEELPEWLSNLNCLKLLMIEHCPKLLSLPDSMHHLTNLEHLEINDCPELCKR  821

Query  2568  CGDTGTRLSW  2597
             C   G  L W
Sbjct  822   C-QPGVGLDW  830



>ref|XP_010024462.1| PREDICTED: putative disease resistance protein RGA1 [Eucalyptus 
grandis]
Length=791

 Score =   444 bits (1141),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 310/800 (39%), Positives = 476/800 (60%), Gaps = 29/800 (4%)
 Frame = +3

Query  207   IKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRK  386
             I+ VL DA+++QAK   V+ WL KL+D  YDA+D+LD+F + +L  + RS      KV  
Sbjct  2     IQKVLADAEQKQAKEEAVRLWLLKLKDFCYDAEDVLDEFESRALWWRARST--FKRKVCY  59

Query  387   LFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVR  566
             L +      ++FK+  K++E+  RL++I E++  F+   + +  P+     + +THSFV 
Sbjct  60    LSSWLSNFSFQFKMADKMKELGRRLDRINEEKIKFNLLSDVHEMPIVP---QRETHSFVP  116

Query  567   PSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNF  746
              S +IGR+ +K+ I+ +LM S D+     +  +PI+G+GG GKTTL KLVYNDD V ++F
Sbjct  117   TSKVIGRNVEKKKIIELLMGS-DDGSVGKIGVIPIIGMGGSGKTTLAKLVYNDDEVKKHF  175

Query  747   DTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLD----MDQLQEHLNGVLCSGRYLLVLD  914
             D  +W+S+  +F ++++I  I+     KS GH +    +D LQ  L  ++ + R L V+D
Sbjct  176   DYLVWLSMPVEFKVTEIIIDII-----KSLGHKEEYDKLDMLQNCLRSMVENKRCLFVMD  230

Query  915   DVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFL  1094
             DVW   +  W+ L + L    +GS+VIVT+R+  VA+I GT     L+ LS  D   LF+
Sbjct  231   DVWEVKEDAWRELTKSLEGVSEGSKVIVTSRNNSVASIMGTVPPLKLANLSKEDSLTLFV  290

Query  1095  KCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKI  1271
             KCAF + QE    +L+ IG+EIV KC G PLAV TLG  L+ + + +EW ++R++++W++
Sbjct  291   KCAFDQGQEKNHPDLMVIGEEIVGKCKGNPLAVTTLGCSLHSRNNRKEWEYVRDSKMWRL  350

Query  1272  EQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQ  1451
             +   T+ILP L++SYD MP +L+QCFAYC +FPK         I LW++ GFIQS   +Q
Sbjct  351   K---TNILPSLRISYDLMPSYLKQCFAYCSIFPKKYNFINNELIQLWISNGFIQSSGNNQ  407

Query  1452  ELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPE  1631
             EL+ +G QY  EL SR  F    EA+   +L  ++H+L+++LA SVA  E  N+++   +
Sbjct  408   ELQEIGRQYLEELRSRSFFNVNEEAY--PLLFIRMHDLIYELAISVAQPESSNIRAWTQD  465

Query  1632  IPESVHHLVF-HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLN-FRRLR  1805
             I     ++ F +   + ++     L  L  +R         + S+ F  +T ++ F+ LR
Sbjct  466   ISWRTRYISFPNPSGVPKDVVSGCLNKLSRVRTIVCEELGSSDSEEFFLETCISQFKHLR  525

Query  1806  VLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKEL  1985
             VL L +     LP SI  LK LRYL+L  N NIK LP+ + +L NLQTL L  C +L+EL
Sbjct  526   VLWLDDSSFHLLPRSICRLKHLRYLSLCGNSNIKKLPKSVCELYNLQTLILGGCNELEEL  585

Query  1986  PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRV  2165
             P +  + ++SL+ L++T+++    K     L  L +L + +C   +   +  Q +  LR 
Sbjct  586   PTSI-KHMISLRFLWVTTKQQHFLKSGIGCLTSLWWLGIAECKNLEALFDDIQSLTSLRT  644

Query  2166  LRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDL--SVgegmegleslqslllmglPKL  2339
             L I +C  LT LP GI++L  LE L I +CE L L  S   G   +  LQ+    GLP L
Sbjct  645   LSIVDCPKLTSLPQGIKNLKALEDLLILDCESLRLAESESNGPRSMSRLQTFRFQGLPGL  704

Query  2340  VSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIR-S  2516
             +SLP  L+   A  L+ +R+A CP+L+ALP+WLQNC+ L+ L IE CPELS LP+ IR  
Sbjct  705   ISLPGWLEG-SASTLEMIRIAYCPKLSALPEWLQNCSSLRTLEIESCPELSSLPDGIRLI  763

Query  2517  SSNAKVRIIDCPLLNG*CGD  2576
              +  K+RI +C  ++  CG+
Sbjct  764   PTLTKLRISNCEKVSS-CGE  782



>ref|XP_011011365.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Populus 
euphratica]
Length=867

 Score =   446 bits (1146),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 325/822 (40%), Positives = 465/822 (57%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP   +LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVMFAVLPATRALPEQLFQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +PD ++N   LQ L I DCP L+
Sbjct  770   GSAESLQTFIIIGCPNIGEMPDCIRNLKKLQNLEISDCPRLN  811



>ref|XP_011011369.1| PREDICTED: disease resistance protein RGA2-like isoform X6 [Populus 
euphratica]
Length=851

 Score =   445 bits (1144),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 325/822 (40%), Positives = 465/822 (57%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP   +LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVMFAVLPATRALPEQLFQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +PD ++N   LQ L I DCP L+
Sbjct  770   GSAESLQTFIIIGCPNIGEMPDCIRNLKKLQNLEISDCPRLN  811



>ref|XP_006575252.1| PREDICTED: putative disease resistance protein RGA4-like isoform 
X1 [Glycine max]
Length=866

 Score =   445 bits (1145),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 323/865 (37%), Positives = 500/865 (58%), Gaps = 30/865 (3%)
 Frame = +3

Query  30    IPSWIMIS*QSPRASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTI  209
             IP+ + +    P+  MAE+ L  + E++L K+ S A ++ S A  +  +L++++ T++ +
Sbjct  7     IPASLSLHSYLPKI-MAESLLFSVAESLLGKLASRAVEKASLAMGVYHDLQQMRVTMALV  65

Query  210   KAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRK  386
             KA+L DA++++ +N+ + +WL++++ V  DA+D++D+F   +L + + +  G ++ KVR+
Sbjct  66    KALLLDAEQKKQQNNALSEWLRQIKRVFSDAEDIVDNFECEALRKHVVNTHGSVSRKVRR  125

Query  387   LFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVR  566
             LF+  + L+YR ++  +I+ I+ RL ++A DR  F  + N     V +   RE THS V 
Sbjct  126   LFSTSNPLVYRLRMAREIKGIKNRLEKVAADRHMFGLQINDMDTRVVHR--REMTHSHVN  183

Query  567   PSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNF  746
              S++IGR+ DK+ I+ +L++  D  DT S S + I G GG+GKTTL KLV+ND  + + F
Sbjct  184   ASNVIGREDDKKKIIELLLQ--DGNDT-SPSVISIEGFGGMGKTTLAKLVFNDLIIDECF  240

Query  747   DTRLWVSVSEDFSLSKVIEKILRSATG---KSFGHLDMDQLQEHLNGVLCSGRYLLVLDD  917
               ++WV VS DF L  V+ KIL S      ++F + +M+QLQ  L   L   ++LLVLDD
Sbjct  241   PLKMWVCVSNDFELRNVLIKILNSTPNPRNENFKNFEMEQLQNRLRNTLHRQKFLLVLDD  300

Query  918   VWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATI--TGTTTAYNLSGLSDHDCFDLF  1091
             VWNE++ KW  L++++  G +GS+++VTTRS  +A +  T ++  Y L GLS+     LF
Sbjct  301   VWNENRVKWNELKDIIDIGVEGSKILVTTRSHAIAVMMRTKSSNYYRLEGLSEEHSLSLF  360

Query  1092  LKCAFREQEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWK  1268
             LK AF + E R    LVEIGKEI++KCGG+PLAV+TLGS L  + + QEW  +R+NEIW 
Sbjct  361   LKSAFDDGEERKHPQLVEIGKEILKKCGGIPLAVRTLGSSLVSRVNRQEWESLRDNEIWN  420

Query  1269  IEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGD  1448
             + Q E DILP L+LSYDQ+P +L++CFA   + P+  +I       LW A GF+  P   
Sbjct  421   LPQNEQDILPALELSYDQLPSYLKRCFACFSLAPEDFDISSFYVTLLWEALGFLPQPKEG  480

Query  1449  QELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP  1628
             + + ++ NQ+  EL  R    D ++   G     K+H+LV DLA  VA  E   +    P
Sbjct  481   ETIHDVANQFLRELWLRSFLTDFLDM--GSTCRFKLHDLVRDLAVYVAKGEFQILYPHSP  538

Query  1629  EIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRV  1808
              I E   HL F  +N+         ++L  +      F V   ++ F+   +   + LRV
Sbjct  539   NIYEHAQHLSFTENNMLG-------IDLVPIGLRTIIFPVEATNEAFLYTLVSRCKYLRV  591

Query  1809  LMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELP  1988
             L L   + + LP SIG LK LRYL+LS N  ++ LP  + KL NLQTL+L  C +L ELP
Sbjct  592   LDLSYSKYESLPRSIGKLKHLRYLDLSGNQKLEELPHSMYKLQNLQTLDLRGCIKLHELP  651

Query  1989  RNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVL  2168
             +   ++L+SL+ L +T+++     +   +L  ++ L L+ C+  +   E  Q +  LR L
Sbjct  652   KGI-RKLISLRQLLVTTRQPEFPDKEIANLTSIETLELHSCNNLESLFEEIQ-ISTLRFL  709

Query  2169  RIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVS  2345
                 C SL         +  LE L I+NC +L+LS+G G E     L+ L+L  L +LV+
Sbjct  710   NFSGCGSLKSF--SFHAIKNLESLVIFNCSKLELSMGLGNEIPASRLKLLVLQSLSQLVT  767

Query  2346  LPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSN  2525
             LP  L+   A  L  L + GC  L  LP+WL N   L+ L IE CP+L  LP+ +   +N
Sbjct  768   LPRWLRG-SASTLHSLLIVGCNNLEELPEWLSNLNCLKLLMIEHCPKLLSLPDSMHHLTN  826

Query  2526  AK-VRIIDCPLLNG*CGDTGTRLSW  2597
              + + I DCP L   C   G  L W
Sbjct  827   LEHLEINDCPELCKRC-QPGVGLDW  850



>gb|KCW48143.1| hypothetical protein EUGRSUZ_K01875 [Eucalyptus grandis]
Length=840

 Score =   444 bits (1142),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 318/838 (38%), Positives = 486/838 (58%), Gaps = 48/838 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E+ L  I E VL KI S A  +  + +N + ++++L+ TL+ IKAVL DA+EQ+AK+H
Sbjct  1     MVESLLFSIAEGVLGKIASPALQKAVAIYNFENQIQELRETLTAIKAVLLDAEEQKAKDH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL  L+ V YDA+D+LD+    +L +++ S  G +  KV + F+  + LI R K++
Sbjct  61    RLQVWLDGLQHVFYDAEDVLDELECEALRKQVISRYGCVRGKVHRFFSLSNPLILRAKLS  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HK++EIR RL++IA D+  F        N V +   RE T+S+V  SD+IGRD+DKE I+
Sbjct  121   HKVKEIRERLSRIAIDKDQFDLNVRRVDNGVAHMHSREMTYSYVNKSDVIGRDADKEEII  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              MLM+  D+++   +S +PIVG+GGLGKT L KLVYND+R+ + F+ +LWV V +DF L 
Sbjct  181   EMLMQPTDDKN---LSVIPIVGMGGLGKTALAKLVYNDNRMKEQFELQLWVCVPKDFDLK  237

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K+IE I++ AT +S  + D+ QLQ  L   +   +YLLVLDDVW++D+ +WK LR+LL  
Sbjct  238   KIIEGIIKDATSQSLSNFDIQQLQTRLQDTIKDKKYLLVLDDVWSKDRRRWKELRDLLSV  297

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G   S++IVTTRS++VA+I GT  A+NL GLS  +   LF + AF E+E  P   L++IG
Sbjct  298   GASESKIIVTTRSLEVASILGTHPAHNLKGLSHENSMALFKRWAFDEKEKEPCPELLKIG  357

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+K  GVPL +  LGS+L+ K +E  W +IR+++ W++ + E D+LP+LKLSYD +P
Sbjct  358   NDIVKKSLGVPLLLIILGSLLHAKDEEMYWAYIRDSKTWELVEVERDVLPVLKLSYDDLP  417

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCF    + PK ++      +  W A G I S   +  +E+ G +Y  +L  R   
Sbjct  418   SHLKQCFPILSLLPKVKKFRDHHLVRRWRAFGLISSARENLTVEDAGVEYIKDLWRRSLI  477

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHA---DNLS  1679
             QDV E     IL  ++H+LVH LA SVA   C  V     EI E V ++       DN+S
Sbjct  478   QDVEEI--ELILKFEVHDLVHSLAMSVAQNYCSIVDLDTTEISERVRYVSIPTASLDNIS  535

Query  1680  REEFPQPLL---NLKNLRYFAYSFRV--GTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K LR   + ++V  G +++ F +  +     LR L L     +ELP
Sbjct  536   NYDGVPPFLRKKTAKRLRAIVFQYKVDDGVITRNFARTCISKCSHLRFLDLSYGSFEELP  595

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
             SSI  LKQLR L L  N  +K LP+ I KL +L  L++  C +L +LP+N  ++L++L+ 
Sbjct  596   SSICNLKQLRSLLLFRNKQLKKLPDAICKLQSLLELDVNGCTELGKLPKNM-KRLVNLRF  654

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFL---------LLYKCSCR----------------KFP  2129
             L++T+++ SLQ+     L  LQFL         +L++ +CR                  P
Sbjct  655   LFITTKQKSLQESGIQYLENLQFLGLEACKNLQVLFEGTCRLTHLQELEIVDCGRPISVP  714

Query  2130  AEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAK-LEKLWIWNCEELDLSVgegmeglesl  2306
              E    +K+L    + E SSL  +P         L  L I N E++   +    E   +L
Sbjct  715   FEELTSLKRL----VIEGSSLMLIPEKKSSFPSCLRLLSITNFEQVMELLQCLNECACTL  770

Query  2307  qslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDC  2480
             +S  +   P  +++P  L +    +LK +R+  CP L+++P  +++   L+ L+IE C
Sbjct  771   ESFCVYDCPSFMAIPKWLPN--HTRLKEIRLIRCPNLSSMPQEIRSLAALKELHIEHC  826



>ref|XP_007162202.1| hypothetical protein PHAVU_001G132700g [Phaseolus vulgaris]
 gb|ESW34196.1| hypothetical protein PHAVU_001G132700g [Phaseolus vulgaris]
Length=863

 Score =   444 bits (1143),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 317/843 (38%), Positives = 479/843 (57%), Gaps = 61/843 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F+ +I E++L K+ S   +E+S A++L  +++ L++TL  +K +L DA+E++ K H
Sbjct  1     MAEYFVFEIAESLLGKLASNLYEEVSRAFDLYEDVQGLRDTLLIVKGLLLDAEEKKEKKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSG-ILTKVRKLFTRPDGLIYRFKIT  431
              +++WL+++++V  D +DLLD F + SL +++   SG    KV   F+  + L++RF++ 
Sbjct  61    GLREWLRQIQNVCLDPEDLLDGFESQSLRKQVLKASGSTRMKVDHFFSSSNSLVFRFRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL--REQTHSFVRPSDIIGRDSDKES  605
              +I+ +R RL++IA D   F  ++      ++   L  RE T+S V  S +IGR+ ++E 
Sbjct  121   RQIKNVRRRLDKIAADGSKFGLEKI----DIDQSCLQRREMTYSHVDASRVIGREKNREE  176

Query  606   IVGMLMK---SCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE  776
             I+ +LM+     D    +SV  +PIVG+GGLGKTTL KLV+ND R+   F  ++WV +S+
Sbjct  177   IMKLLMQPHLHGDGYGDQSVCVIPIVGIGGLGKTTLAKLVFNDKRMDDLFPLKMWVCISD  236

Query  777   DFSLSKVIEKILRSATG--------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED  932
             DF + ++I KI+ SA+         +S  +LD++QLQ  L   L   +YLLVLDDVWNE+
Sbjct  237   DFDIRQIIVKIINSASDPIISAVPQESINNLDIEQLQSRLRHKLSYQKYLLVLDDVWNEN  296

Query  933   QHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
             + KW  L++L+  G  GS++IVTTRS  +A++ GT  +Y L GLS  +C  +FLK  FRE
Sbjct  297   RSKWIELKDLIKVGAIGSKIIVTTRSHSIASMMGTVPSYVLEGLSAENCLSMFLKWPFRE  356

Query  1113  QEYRPR-NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD  1289
              E +   NLVEIGKEIV+KCGGV LA+KT GS L+   D + W  +R++E+  ++Q++ D
Sbjct  357   GEEKEHPNLVEIGKEIVKKCGGVQLALKTSGSSLFSVFDLERWEIMRDHELLNLKQQKDD  416

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             ILP LKLSYDQMP +LR CFA+  ++PK          N WV  G ++S  G Q++EN+G
Sbjct  417   ILPSLKLSYDQMPSYLRHCFAFFSLYPKDFAFTSAEMANFWVTLGLLRSAFGSQQIENVG  476

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVH  1649
               Y  EL SR   +D ++   G     K+H+LVHDL+  VA  E L V S   +IPE + 
Sbjct  477   KLYIYELYSRSFLEDFLDF--GTHYYFKLHDLVHDLSLYVAKEEFLMVNSHTHKIPEQIR  534

Query  1650  HL-VFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN  1823
             H+ V   D+LS   FP+     + +R   +    VG  S+  ++  +  ++ LR L L +
Sbjct  535   HISVVENDSLSHTLFPK----FRGVRTIIFPVDGVGVGSEYLLETWIKRYKYLRHLDLSD  590

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
                +  P+SI  L+ LR L+L NNC+IK LP    KL NLQ L L  C  L+ LP+  G 
Sbjct  591   SSFETFPNSIAKLEHLRALSLDNNCSIKRLPNSFCKLQNLQILYLRRCLGLETLPKRLG-  649

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQ-HMKKLRVLRIYE  2180
              L+SL+ LY+T+++            FL  L+   C   KF     Q  +  L VL I  
Sbjct  650   MLISLRKLYITTKQSM----------FLHSLIFEYCDNLKFLFRGAQTQLPSLEVLMIQS  699

Query  2181  CSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPK-------L  2339
             C +L  LP  +  L KLE L +  C  L+LS+         +   L +   K       L
Sbjct  700   CENLESLPLHL--LPKLEVLILTRCVMLNLSLISERPIQRLMIKNLYIEQYKCDFSCSGL  757

Query  2340  VSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLY------------IEDCP  2483
              +LP  ++   +  L+ L +  C  L  LP+WL   T L+ L+            I+ CP
Sbjct  758   HTLPQWIQGA-SNTLRTLSILNCHCLEKLPEWLNTMTHLKMLHIMHRLGALEDLIIDGCP  816

Query  2484  ELS  2492
             EL 
Sbjct  817   ELG  819



>ref|XP_010659380.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659381.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010659382.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659383.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659384.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659385.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659386.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659387.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659388.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659389.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659390.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
Length=1005

 Score =   448 bits (1153),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 275/665 (41%), Positives = 409/665 (62%), Gaps = 29/665 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     I EN+L K+ S    EI   + +  EL+KL+  LST+ AVL DA+E+Q  +H
Sbjct  1     MAEQIPFGIAENLLMKLGSAVFHEIGLMYGVGGELRKLKEKLSTVGAVLLDAEEKQESSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V DW+++L+DVVYDADDLLDDF T  L RK         +V   F+  + L +RFK+ H
Sbjct  61    AVADWVRRLKDVVYDADDLLDDFATEDLRRKTDDRGRFAAQVSDFFSPSNQLAFRFKMAH  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVN-PVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              I+ IR RL+ IA D   F+       + PV N + RE +    +   I+GRD +++ ++
Sbjct  121   GIKAIRERLDDIANDISKFNLISGVIPDVPVRNREWRETSSVVEKSHKIVGRDENRKEVI  180

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +LM+S  +E+   V  + I GLG      LV   YND RVV  F+ ++WV VS+DF + 
Sbjct  181   ELLMQSSTQENLSKVVIVGIGGLGKTTLAQLV---YNDQRVVSYFNLKMWVCVSDDFDVK  237

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
              ++  I++SAT +   +L++DQLQ+ L+  L   RYLLVLDDVWNED  KW  L  LL  
Sbjct  238   ILVRNIIKSATNRDVENLELDQLQQRLHRNLDGKRYLLVLDDVWNEDVRKWGQLITLLPV  297

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR-NLVEIG  1148
             G  GS+++VTTRS +VA++ G  + Y + GL D + +DLF   AF+++E +   NLV IG
Sbjct  298   GATGSKILVTTRSTRVASVIGVDSPYIVEGLKDDESWDLFESLAFKKEEEKMHPNLVAIG  357

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             K+IV+ C G+PL ++TLG  LY KT E++WL IR N+   +   E++IL +L+LSYD +P
Sbjct  358   KDIVKMCKGIPLVIETLGRTLYFKTQERDWLSIRNNKNLMLLGDESNILSVLRLSYDNLP  417

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCF YC +FPK   I +++ + LW+AQG++Q  D +++LE++GNQYF +LLSR  F
Sbjct  418   THLKQCFVYCTLFPKDYRIEKKLLVKLWMAQGYLQESDENRDLEDVGNQYFEDLLSRSLF  477

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHADNLSRE  1685
             Q         +L+CK+H+L+HDLAQS+  +E + V +    IPE +HH+ +F+  N    
Sbjct  478   QKAENENANNVLSCKVHDLMHDLAQSIVKSEIIIVTNDVKIIPERIHHVSLFNKSN----  533

Query  1686  EFPQPLLNLKNLRYFA-----YSFRVGTV------SKTFVKKTLLNFRRLRVLMLQNLEL  1832
             E P+ L+  K +R F      ++ R G        + TF+     + + LRV+ + +   
Sbjct  534   EMPEGLMG-KPIRTFVIGKPDWNLRTGPFYGDYYSTDTFIS----SLKYLRVMKV-SFRP  587

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
              E+P+S+  L  LRYL+LS+    K+LP  I++L NLQTL L  CE LKELP +  ++L+
Sbjct  588   HEVPTSLDKLSHLRYLDLSHGL-FKNLPSAITRLKNLQTLKLFRCENLKELPID-TKKLI  645

Query  2013  SLKTL  2027
             +L+ L
Sbjct  646   NLRHL  650



>ref|XP_007204163.1| hypothetical protein PRUPE_ppa017615mg, partial [Prunus persica]
 gb|EMJ05362.1| hypothetical protein PRUPE_ppa017615mg, partial [Prunus persica]
Length=772

 Score =   441 bits (1134),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 300/761 (39%), Positives = 437/761 (57%), Gaps = 50/761 (7%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             +   ++ K+ S+  +EIS AW ++ +L+KL +T+S IK VL DA+++QA N +++ WL++
Sbjct  8     LATRLIEKLGSIVSEEISLAWGVQADLQKLGHTMSIIKDVLLDAEQKQAHNQQLRSWLRQ  67

Query  279   LRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRG  455
             L+ V  DA+DLLD+F   +L +++  +      KVR+ F+R + +  R K+ H+I+EI+ 
Sbjct  68    LKHVFLDAEDLLDEFECEALRKEVVETFHPTTGKVRRFFSRSNPIALRSKVAHQIKEIKE  127

Query  456   RLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCD  635
             RL+++  +R  F    +   +   +G        FV  S +IGR   K+ IV +L++  D
Sbjct  128   RLDELKSNRAIF----DSLTSIDHHGGGDHHERPFVPASKVIGRQYQKKQIVNLLVEQGD  183

Query  636   EEDTES--VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKI  809
             ++   +  VS +PIVG+GGLGKTTL K VY+D RVV +F+ R+W SV  DF L+++   I
Sbjct  184   DDGNSNNKVSVIPIVGIGGLGKTTLAKWVYDDKRVVGHFELRMWQSVPVDFELTRLTRLI  243

Query  810   LRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGC-DG  983
             L SA        L +DQLQ  L   L   ++LLVLDDVWN D  KW  LR+LL  G   G
Sbjct  244   LGSALDTEISDKLTLDQLQGRLREALKDKKFLLVLDDVWNHDALKWSQLRDLLTEGAKSG  303

Query  984   SRVIVTTRSIKVATITGTTTA-YNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEI  1157
             S+++VTTRS  VA I GT  A  NL  LSD D   LF++CAF+E  E    NL E+GK+I
Sbjct  304   SKILVTTRSTAVAEIMGTIPANINLEFLSDKDSVSLFVECAFKEGHEKEYPNLFEMGKDI  363

Query  1158  VQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILPILKLSYDQMPYH  1334
             V+KCGGVPLAVKTLGS LY KTDE+EW  +R++EIW+++Q++   ILP L+LSY ++P H
Sbjct  364   VRKCGGVPLAVKTLGSQLYSKTDEREWKLVRDSEIWELKQEDDGHILPALRLSYTRLPPH  423

Query  1335  LRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQS--PDGDQELENLGNQYFNELLSRFC  1505
             LRQC AYCC   K   +      I  W+A G +      G+ ELE++G  YF +L +R  
Sbjct  424   LRQCLAYCCHLRKDRTQYTSYALIRYWMAHGILDQSRAHGNMELEDIGELYFKDLWARSF  483

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESVHHLVFHADNLSR  1682
             FQ+V +   G      +H+L+HDL QSVA  EC  VKS +  +I E+V HL F    L+ 
Sbjct  484   FQNVTDY--GMYYDFDMHDLIHDLVQSVAQGECFTVKSANTKDISENVRHLTFLEAGLNV  541

Query  1683  EEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFL  1862
                 Q L  ++ +     +  +  + ++F+      F+ LRVL L    L+ LPSSIG L
Sbjct  542   STTMQKLNKVRTI-----TADIRDIDESFMCTCFSRFKYLRVLQLPTCSLQVLPSSIGSL  596

Query  1863  KQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQ  2042
             K LRYL+LS N  I  LP  I +L +LQ L++  CE L+E PR   + L+SL +L LT++
Sbjct  597   KHLRYLDLSFNKAITKLPNAICRLQSLQALHVDGCENLEEWPREISK-LISLTSLCLTTK  655

Query  2043  EVSLQKRS--------------------------SVSLGFLQFLLLYKCSCRKFPAEIWQ  2144
             + +  K                              +   LQ L + KC   +   E  +
Sbjct  656   QTNFTKNGYQGTPLKLQKLFIGQLPRLVALPEWFQGAANALQVLTIAKCKNLEALPEWLE  715

Query  2145  HMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELD  2267
                 L  L +Y C  L+ LP G+R L  L +L I +C +L+
Sbjct  716   SFTSLTKLVLYSCQKLSSLPEGMRSLTSLRELVIDDCPKLE  756



>ref|XP_010918020.1| PREDICTED: putative disease resistance protein RGA3 [Elaeis guineensis]
Length=1117

 Score =   451 bits (1160),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 304/730 (42%), Positives = 429/730 (59%), Gaps = 45/730 (6%)
 Frame = +3

Query  99    ITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQK  278
             I + V+ K+ S    ++  A ++K +++KLQ+ L TI  VL DA+ +   +  ++ WL+K
Sbjct  14    ILKIVIQKLGSGLWKQMGLASSVKKDVEKLQSVLETITDVLEDAENRSISDKPLQGWLRK  73

Query  279   LRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGR  458
             LRD  +DADD++D+F T +L +K+   + I  KVR  F+  + +I+  KI  K++EIR R
Sbjct  74    LRDAAFDADDVVDEFQTEALRQKIEENNCITRKVRDFFSLNNSIIFYHKIARKVKEIRER  133

Query  459   LNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDE  638
             L+QI+E+R  FH  E      +    L  +T+SFV  S+I GRD DK+ ++  L+    +
Sbjct  134   LDQISEERLKFHLSER----SIPERSLERETYSFVIESEIYGRDDDKKEVINFLVYVDTD  189

Query  639   EDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRS  818
             +D   VS LPIVGLGG+GKTTL +LVYND R+ + F+ R+WV + E+F + ++I  I+  
Sbjct  190   KD---VSVLPIVGLGGVGKTTLAQLVYNDKRIDEQFELRMWVCIGENFDIPRIIRAIIER  246

Query  819   ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIV  998
              TG +    D++ +Q  L   L   R+LLVLDDVWNE++ +W+ L+ LL  G  GS++IV
Sbjct  247   VTGTNCELSDIEIMQSLLREKLRERRFLLVLDDVWNEEEAEWERLKPLLRGGKKGSKIIV  306

Query  999   TTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEIGKEIVQKCG  1172
             TTRS +VA+I G++    L  L   DC+ LF + AF     E  P +LV+IGK+IVQKCG
Sbjct  307   TTRSERVASIMGSSALLRLPVLPTDDCWTLFRQRAFGLGRAEETP-SLVKIGKKIVQKCG  365

Query  1173  GVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFA  1352
             G+PLA K LGS++  K  E EWL ++ +EIWK+  KET ILP L+LSYD +P HL+QCFA
Sbjct  366   GLPLAAKALGSLMSSKRGEVEWLAVKNSEIWKLPAKETGILPALRLSYDHLPSHLKQCFA  425

Query  1353  YCCMFPKGEEIPREVFINLWVAQGFIQSP-DGDQELENLGNQYFNELLSRFCFQDVVEAF  1529
             YC +FPK   I RE  I LW+A+GFI  P D + +LEN+GNQ+FN LL R  FQD  +  
Sbjct  426   YCSLFPKDYSIERERLIQLWIAEGFINHPSDNNMDLENIGNQFFNNLLWRSFFQDAEKDS  485

Query  1530  DGEILACKIHNLVHDLAQSVAGAECLNVKSG-DPEIPESVHHLVFHADNLSREEFPQPLL  1706
             DG +  CK+H+LVHDLA  V G E   +++G D  I     +      N    E  Q   
Sbjct  486   DGNVTVCKMHDLVHDLACFVIGDEAGIMEAGKDTLISHRCRYSSVDQINDKTSECLQLAS  545

Query  1707  NLKNLR--YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYL  1880
                 LR   F + FR+ TV+ + V     N   LRVL LQ   L++L S I  LK LRYL
Sbjct  546   KTMKLRSLIFLFDFRIRTVNISAVS----NLTYLRVLDLQLSGLQKLSSRISRLKHLRYL  601

Query  1881  NLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTSQEVSLQK  2060
             +LSN   I++LP  IS L NLQ LNLINC+ L+ LP                        
Sbjct  602   DLSNTL-IEALPNSISSLYNLQVLNLINCKNLEALPDPIA--------------------  640

Query  2061  RSSVSLGFLQFLLLYKC-SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEK  2237
                 SL  LQ L L  C + ++ P ++ + M+ LR L I  C  LT +P  +  L+ L  
Sbjct  641   ----SLYNLQVLNLAYCRNLKELPKDM-RKMRNLRHLCIARCHRLTRMPPKMSQLSNLRT  695

Query  2238  LWIWNCEELD  2267
             L ++   E D
Sbjct  696   LSMFAVGEED  705



>gb|KCW48061.1| hypothetical protein EUGRSUZ_K01810 [Eucalyptus grandis]
Length=824

 Score =   442 bits (1138),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 315/827 (38%), Positives = 463/827 (56%), Gaps = 54/827 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+FL+ I E VL KI SLA  E  + + ++ +L ++++T++ IKAVL DA+EQQAK+H
Sbjct  1     MAESFLSGIAEGVLGKIASLAVQEAVAIYGVENQLSEVKHTVAAIKAVLLDAEEQQAKSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL +L+DV                                L+   D L    +  +
Sbjct  61    RLQVWLDQLQDV--------------------------------LYDAEDVL---DEFDN  85

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+EIR RL++I+ ++      E    N V + + R  T SF+   +I+GRD DK+ I+ 
Sbjct  86    KIKEIRERLSRISTEKDQLELAERSADNDVAHYQSRPMTCSFISELNIVGRDIDKDKIIN  145

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM+S D+E+   +S +PIVG+GGLGKTTL KLVYNDDRV + F  R WV V ED  LSK
Sbjct  146   LLMQSVDDEN---ISVIPIVGIGGLGKTTLAKLVYNDDRVQEQFKLRKWVCVPEDLDLSK  202

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
              IE+I++ ATG S G+ D+ QLQ  L   +   +YLLVLDD+W+ D+ +W +LR+LL  G
Sbjct  203   TIERIVKDATGPSLGNFDIQQLQTLLLETIKDKKYLLVLDDMWSNDRVRWMDLRDLLSQG  262

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIGK  1151
               GS++IVTTR+ ++A +  T   +NL GLS  D   LF K AF E++  P   L+EIG 
Sbjct  263   ASGSKIIVTTRNSEIARMMETHPMHNLKGLSHGDSMVLFRKWAFDEKKMEPCPKLLEIGN  322

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV+K  GVPL VKTLG +LY K +E  W HIR++E W I + + DI P+LKLSYD +P 
Sbjct  323   QIVEKSHGVPLLVKTLGCLLYAKHEEWYWAHIRDSETWNIAKVQKDIGPVLKLSYDYLPS  382

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             +L+ CFA   +  K  +     F   W+A G + S    Q LE+   +Y  EL ++   +
Sbjct  383   NLKHCFAALSLLKKDSQCNSSDFARCWMALGLVSSTREKQALEDGVVEYLKELWNKSLIE  442

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFH---ADNLSR  1682
             +V +   G +L  K+H+LVHDLA  VA  +   V     EI + V H+ F    +  +S 
Sbjct  443   EVKQF--GSLLTFKMHDLVHDLALIVAKKDYSMVGLDTAEISKGVRHVSFSSFLSKGISN  500

Query  1683  EEFPQPLL---NLKNLRYFAYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELPSS  1850
              +   P L     K LR       +   ++K F++  L   +RLR+L L N   +ELPSS
Sbjct  501   SDGVPPFLRKPTSKRLRAITSHCELDEAITKEFIRTCLSKCKRLRILQLPNGSFEELPSS  560

Query  1851  IGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             IG LKQLR L L+ N  +K LP+ I +L NL  L+   C +L  LP+N   +L+SL+ LY
Sbjct  561   IGNLKQLRSLYLNGNKQLKKLPDSICELQNLLILSFYGCPKLGNLPKNMN-RLVSLRYLY  619

Query  2031  LTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAG  2210
             +T+++ SLQ+        LQ L++  C   +   E    +  L+ LRI  C     +   
Sbjct  620   VTTKQKSLQECGMQYPENLQHLVIQGCENLQVLFEGTCKLIHLKHLRIENCGG--PIFVH  677

Query  2211  IRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKY  2390
                L  L  L I +C +L L+       L +L+ L +    +++ L   L  I +  L+ 
Sbjct  678   FEKLIALHTLAIEDC-KLTLTQENKSNFLLNLKILEITNCEQVMELLQCL--IGSCTLEL  734

Query  2391  LRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK  2531
             L +  CP+LTA+P+WL N T L+ +   +C  LS LP+ +RS +  K
Sbjct  735   LSIDDCPKLTAVPEWLPNHTNLKCIQFIECSNLSLLPQGVRSLTALK  781



>ref|XP_010679788.1| PREDICTED: putative disease resistance protein RGA3 [Beta vulgaris 
subsp. vulgaris]
Length=843

 Score =   443 bits (1139),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 313/855 (37%), Positives = 482/855 (56%), Gaps = 37/855 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQD--------EISSAWNLKPELKKLQNTLSTIKAVLRDA  230
             MAET +  + +++L K+V+   D         I  A ++K ++K +   LS I AVL+DA
Sbjct  1     MAETIILPLAKSILEKLVTFPLDLALNDVTERIKLAKSVKKDVKTIHGNLSAICAVLKDA  60

Query  231   DEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFT-RPDG  407
             + +Q  +H +K WL  L+ VVY+ DDLLD+    +L R +      L ++R   +   + 
Sbjct  61    EAKQYASHAIKVWLTDLKSVVYELDDLLDEVAYDALRRSVNK-GHFLPQLRYYLSPSSNP  119

Query  408   LIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTH---SFVRPSDI  578
             L+ RF ++  I+++R +L  +   + +F       VNPVE   +        S+V  S I
Sbjct  120   LVTRFHLSQNIKDLREKLASVVAKKNDFGLT----VNPVEIPIVERDLFNDCSYVNESVI  175

Query  579   IGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYND--DRVVQNFDT  752
             +GRD  K+ ++  L+          V  LP+VG+GG+GKTTL KLVY D        FD 
Sbjct  176   VGRDEAKKELITRLLAHGTAVTCPCV--LPVVGMGGIGKTTLAKLVYKDLSHLTGDQFDM  233

Query  753   RLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNED  932
             +LW  VS  F+LSK++E I+  A+     +L ++QL   L  +L   +Y LVLDDVW +D
Sbjct  234   KLWACVSHKFNLSKLLENIINQASNDVTSNLTLEQLVRKLQNLLNGKKYFLVLDDVWLDD  293

Query  933   QHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE  1112
                W +L+ +   G  GS ++VTTRS +VA+IT T   Y+L  L D  C+ +F + AF E
Sbjct  294   ASDWTDLKSIFEGGKVGSAILVTTRSAQVASITQTIKPYDLDRLPDDVCWSIFEQLAFME  353

Query  1113  QEY-RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRE-NEIWKIEQKET  1286
              E  +  NL EIG+ IV+KC GVPL VK++GS+L    DE EW  I   + +  +  +  
Sbjct  354   DEKNKYPNLYEIGRSIVEKCAGVPLVVKSIGSLLRRVRDEGEWQRINNADSVANLHGESN  413

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
              +L +L++SYD++P HL+ CF YC +  K  E+     I LW A G ++  DG  E+E  
Sbjct  414   KVLQLLRISYDKLPSHLKPCFVYCALKAKDVELYPTQLIYLWNAHGLLKLQDGAGEIEAC  473

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
             G      L+SR   +     F+  I AC IH+L+HD+A  + G E   V   +  + ES 
Sbjct  474   GYANAMNLVSRSLLEQPKFEFNETIFACNIHDLLHDVAVDILGNELAFVTCDELHVSEST  533

Query  1647  HHLVF---HADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLML  1817
              H+++     D++  +EFP+ LLN K  R F + +R+  VS++F++  + NF  LR+L +
Sbjct  534   RHIIWGYEAPDSIWDKEFPKDLLNAKKARTFKFGYRMNHVSRSFLEGVISNFSCLRILEI  593

Query  1818  QNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              + + +ELP SIG LK LR L LS N  +KSLP+ I  L+NLQTL+L +CEQLKELP+  
Sbjct  594   GDSQFEELPRSIGNLKHLRGLKLSYNPLLKSLPDTICNLLNLQTLDLYSCEQLKELPKKI  653

Query  1998  GQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQ-----HMKKLR  2162
               +L++++   +T+ + SL       L  L+FL +Y C   K    +W      ++  +R
Sbjct  654   -YRLLNVRYFVITTCQTSLVGTKFNRLRSLRFLWIYNC---KGLVSLWDDGDVGNLTSIR  709

Query  2163  VLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLV  2342
              L I  C  LT LP  ++ LA LE L I NCE LDL   + + G + LQSL ++ +P+L 
Sbjct  710   RLYIQNCPLLTRLPNNLKSLALLEDLVISNCEALDLEENQCLSGFQKLQSLAIIEVPQLR  769

Query  2343  SLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-S  2519
              LP G++   A  L+YL ++GC  L+ LPD L+   +L+++ I +CP+L  LPE   +  
Sbjct  770   RLPDGIQST-ATSLRYLCISGCDNLSQLPDGLKQFVMLRKILINNCPKLMALPEGFPNLD  828

Query  2520  SNAKVRIIDCPLLNG  2564
             ++ ++ I +CP L+G
Sbjct  829   AHQELSIRNCPQLSG  843



>ref|XP_008240999.1| PREDICTED: putative disease resistance protein RGA3 [Prunus mume]
Length=727

 Score =   439 bits (1129),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 298/718 (42%), Positives = 435/718 (61%), Gaps = 33/718 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     +   ++ K+ S+A ++IS AW +K +LKKLQ T+STIK VL DA+++QA N 
Sbjct  1     MAEVAFP-LATKLIEKLGSIASEQISLAWGVKADLKKLQRTMSTIKDVLLDAEQKQAHNQ  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
             +++ WL++L+DV  DA+DLLD+F   +L R++  +  G + KVR+ F+R + + +RF++ 
Sbjct  60    QIRSWLRQLKDVFLDAEDLLDEFECEALRREVVETFHGTIGKVRRFFSRSNPIAFRFRVG  119

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             ++I+EIR RL+++  ++  F   ++  + P   G    +   FV  S +IGR+S+KE IV
Sbjct  120   NEIKEIRERLDELKSNKAIF---DSLTILPHGYGGDNHE-RPFVPASKVIGRESEKEEIV  175

Query  612   GMLMKSCDEEDTES----VSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
              +LM+  D++ + +    VS +PIVG+GGLGKTTL K VY++ RVV +F+ R+W SV  D
Sbjct  176   NLLMQQGDDDQSRNSDNKVSVIPIVGIGGLGKTTLAKWVYDNKRVVGHFELRMWASVPVD  235

Query  780   FSLSKVIEKILRSATGKSFG-HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             F L+++   IL SA        L +DQLQ  L   L   ++LLVLDDVW +D  KW  LR
Sbjct  236   FELTRLTRLILASALDTEISDKLTLDQLQGRLCEALKDKKFLLVLDDVWKDDALKWSQLR  295

Query  957   ELLMSGC-DGSRVIVTTRSIKVATITGTTTA-YNLSGLSDHDCFDLFLKCAFRE---QEY  1121
             +LL  G   GS+++VTTRS  VA I GT  A  NL  LS  DC  LF++CAF+E   ++Y
Sbjct  296   DLLTEGAKSGSKILVTTRSTAVADIMGTIPANINLEFLSFKDCLSLFVECAFKEGCDKDY  355

Query  1122  RPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-ILP  1298
              P+ L E+GK+IV+KCGGVPLAVKTLGS LY KTDE+EW  + ++EIW++EQ++   ILP
Sbjct  356   -PK-LFEMGKDIVRKCGGVPLAVKTLGSQLYSKTDEREWKLVSDSEIWELEQEDAGHILP  413

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGE-EIPREVFINLWVAQGFIQSP--DGDQELENLG  1469
              L+LSY ++P HL+QC AYC    K   E      I  W+A G +      G+ ELE++G
Sbjct  414   ALRLSYTRLPPHLQQCLAYCSHLQKDRIECSSYALIRYWMAHGILDQSRVHGNMELEDIG  473

Query  1470  NQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP-EIPESV  1646
               YF +L +R  FQ+V +   G      +H+L+HDL QSV   EC  VKS +  +I E+V
Sbjct  474   ELYFKDLSARSFFQNVTD--HGMYYEIDMHDLIHDLLQSVVQGECFIVKSANTKDISENV  531

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNL  1826
              HL F     +     Q L  ++ +           + ++F+      F+ LRVL L   
Sbjct  532   RHLTFLEAGQNVSTTSQKLNKVRTVVAEEIE-----IDESFMCTCFSRFKYLRVLQLPTC  586

Query  1827  ELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQ  2006
              L+ LP SIG LK LR+LNL+ N  I  LP  I +L +LQTL    CE L+ELP++   +
Sbjct  587   SLQVLPKSIGSLKHLRFLNLNFNEAITKLPNAICRLQSLQTLYFGGCENLEELPKDIS-K  645

Query  2007  LMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCS-CRKFPAEIWQHMKKLRVLRIY  2177
             L+SL +L  T+++ S  +     L  LQFL + KCS     P E   ++  LR L ++
Sbjct  646   LISLTSLGFTTKQTSFTENGVGCLKSLQFLTIIKCSNLTSLPCET-SYLTSLRTLALH  702



>gb|KEH31343.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=855

 Score =   442 bits (1136),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 317/869 (36%), Positives = 486/869 (56%), Gaps = 62/869 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA T ++ +  N+L K+++ A   IS A  L+ E+  LQNTL+ I A + DA+ +Q +N+
Sbjct  1     MAST-VSGLLTNMLDKLLTTAFHNISMAKGLQREVTNLQNTLTIINAFILDAENKQTQNN  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGIL-TKVRK-LFTRPDGLIYRFKI  428
              +  WLQ+L+D ++DA D+ D+    SL + +    G   TKV++ L +  + L +R ++
Sbjct  60    SISLWLQQLKDALFDARDIFDEIEFESLRKHVVKKHGTFNTKVQRFLSSSTNPLTFRVQM  119

Query  429   THKIREIRGRLNQIAEDRRNFHF--KENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
              HKI+ +  R++QIA  R        EN+  +   + ++  +THS+VRPS +IGRD +KE
Sbjct  120   AHKIKHMNTRIDQIASLRMKLGLIVSENH-ASGSSSTRVTRETHSYVRPSHVIGRDGEKE  178

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              I+  LM      D + +  +PIVG+GGLGKTTL +LVYNDDRV++ FD R+WV VS+ F
Sbjct  179   KIIKFLMDPLLVSDDDEIDVIPIVGIGGLGKTTLAQLVYNDDRVIELFDLRMWVFVSDVF  238

Query  783   SLSKVIEKILRSATGKSFG--HLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
              + +++  IL++  G          DQLQ  L   L   ++LLVLDDVWNED  +W  L+
Sbjct  239   DVKRLVLDILKAMHGMEVDAHKYSFDQLQNMLRERLWGKKFLLVLDDVWNEDYREWLELK  298

Query  957   ELLMSGCDG------SRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAF--RE  1112
              LL+   DG      +++I TTRS +VA+I G    ++L  L + DC  LF+KCAF   E
Sbjct  299   NLLLGMHDGDDDKLGNKIITTTRSDRVASIMGNAYKHSLKYLPEEDCLQLFVKCAFPAGE  358

Query  1113  QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETD-  1289
              ++ PR L+EIGK+I +KC G+PLAV +LG +L  +  E EW  +R++EIWK+  ++ D 
Sbjct  359   AKHNPR-LMEIGKDIARKCKGLPLAVVSLGCLLRARPGESEWKKVRDSEIWKVNPQDDDG  417

Query  1290  ILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLG  1469
             IL  LKLSY+ +   L+QCF+YC +FPKG E      I+ W+A G +Q+ + D+E E+LG
Sbjct  418   ILAALKLSYNHLSSGLKQCFSYCSIFPKGYEYTNLELISFWMAHGLLQTKNEDEEPEDLG  477

Query  1470  NQYFNELLSRFCFQDVVE---AFDG------EILAC---KIHNLVHDLAQSVAGAECLNV  1613
               Y  EL+SR  F+   E     DG      E+L     K+H+LVHDLA     +E   V
Sbjct  478   EFYIQELVSRSFFECAAEEQLVIDGLISEELELLGINFFKMHDLVHDLAVFTMQSERAVV  537

Query  1614  KSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNF  1793
             K     I E V HL F         F +    ++ + ++  S +   +++ FVK     F
Sbjct  538   KFKSTNIKEKVQHLSFSDSGEGVPTFGKMPSKIRTIGFWHASQKELAITEPFVKWISNKF  597

Query  1794  RRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQ  1973
             + +RVL +Q    + LP     +K LR L+LS    ++ LP+ I  L NL+ LNL  C  
Sbjct  598   KYIRVLNIQGSNFQFLPDCFDKMKHLRSLDLSYCQRLEKLPDSICMLHNLEVLNLCRCVS  657

Query  1974  LKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMK  2153
             L  +P+N    L+SL+ L++T++   L   S + +G                     ++K
Sbjct  658   LAYIPKNL-LNLISLRILWITTKITDL---SFIGIG---------------------NLK  692

Query  2154  KLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEEL---DLSVgegmegleslqslllm  2324
              L++L ++ C +L  LP  +RHL+ L++L I  CEE+   +    +       L+ + + 
Sbjct  693   YLQILILWNCDNLVFLPRDLRHLSALKRLTIEACEEVVSFEDEGEDDENYSLKLERVSID  752

Query  2325  glPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
              LP LV+LP  L+      L+YL ++ C  L ALP+WL N T L+ L I DCP L+ LP+
Sbjct  753   KLPNLVALPGWLRRA-GTTLRYLGISECSSLMALPEWLVNLTSLETLLIADCPNLT-LPQ  810

Query  2505  QIRSSSNAK-VRIIDCPLLNG*CG-DTGT  2585
              +    N + ++I  CP L   C  +TG+
Sbjct  811   HMDRLQNLQNLKIYGCPQLVERCNQNTGS  839



>ref|XP_008354961.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=1133

 Score =   449 bits (1156),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 287/664 (43%), Positives = 415/664 (63%), Gaps = 28/664 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L +I E ++  +  LA +E+   + +K ELKKL+ T++ IK VL DA++++A NH
Sbjct  1     MAEGVLFNIAEGIIGSLQKLALEEMGLLYGVKDELKKLEKTVTKIKNVLLDAEKKKA-NH  59

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V +WL+ L DV+YD DDLLD+F T +  R++ + +    KVR  F+  + LI+R KI H
Sbjct  60    GVTEWLKSLEDVIYDVDDLLDEFYTEARWRQMVTGNKFSKKVRLFFSSSNQLIFRLKIGH  119

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKL---REQTHSFVRPSDIIGRDSDKES  605
             KI+EIR  LN I  D+R F F E      +E  +      ++HSFVR  +IIGRD DK  
Sbjct  120   KIKEIRETLNVIEADKR-FQFDER-----LEEARFVSKERESHSFVRKEEIIGRDKDKRE  173

Query  606   IVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFS  785
             IVG+L+   D    E+VS + +VG+GGLGKT L +LV+ND+ V ++F+ ++WV VS+ F 
Sbjct  174   IVGLLL---DPIPIENVSIISLVGIGGLGKTALAQLVFNDETVQKHFELKIWVCVSDIFE  230

Query  786   LSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELL  965
             L+ ++ KI    T ++ G+L++DQLQ  L  ++   RYLLVLDDVWN+++ KW +L+ LL
Sbjct  231   LNVLVAKI----TSRTPGNLELDQLQNDLRKLIDGKRYLLVLDDVWNDNREKWLSLKSLL  286

Query  966   MSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR-EQEYRPRNLVE  1142
             M G  GSR+++TTRS     +  T   Y L GL + + + LF + AF+ EQE    ++  
Sbjct  287   MGGARGSRILITTRS---EVVVDTNKPYFLRGLEEKESWSLFKQMAFKTEQESENPSIKA  343

Query  1143  IGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQ  1322
             IG EIV KC G+PLA++T+G MLY K    EWL  + N++ K+ Q+ +DILP L LSYD 
Sbjct  344   IGVEIVGKCKGIPLAIRTIGRMLYSKNRXNEWLAFKNNDLSKVNQEASDILPTLXLSYDI  403

Query  1323  MPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRF  1502
             +P HL+ CFAYC +FPK  EI  +  +NLWVAQGF++S D ++ LE++G +YF EL+ R 
Sbjct  404   LPSHLKHCFAYCSLFPKDXEIDXKTLVNLWVAQGFVKSLDQNESLEDVGYEYFLELVWRS  463

Query  1503  CFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
              FQ+V     G I +CK+H+L+HDLA+SV+G E   V   +    E++ H  F       
Sbjct  464   FFQEVTYDEFGMISSCKMHDLMHDLAKSVSGMEITIVVEKEDNFSENLRHANFSIGPWLS  523

Query  1683  EEFPQPLLNLKNLRYF----AYSFRVG-TVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             +  P  LL    LR F     Y +  G   SK+F      NF+ LR+L L  L +  LP+
Sbjct  524   KTIPTSLLKAHKLRTFFYISKYLYSFGDDGSKSFCNAIASNFKSLRMLSLNELCIIALPN  583

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
             S+  L+ LRYL+LS N  IK LP+ I +L NLQTL+L  C++L ELPR+   +L +L+ L
Sbjct  584   SLRKLRHLRYLDLSGN-RIKRLPKWIVRLQNLQTLDLSRCDKLVELPRDI-NKLFNLRHL  641

Query  2028  YLTS  2039
              +  
Sbjct  642   MVVG  645



>ref|XP_011011371.1| PREDICTED: putative disease resistance protein RGA3 isoform X8 
[Populus euphratica]
 ref|XP_011011372.1| PREDICTED: putative disease resistance protein RGA3 isoform X8 
[Populus euphratica]
Length=844

 Score =   441 bits (1134),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 324/822 (39%), Positives = 464/822 (56%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP  ++LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVIFEELPATLALPEQLLQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +P+ + N   LQ L I  CP LS
Sbjct  770   GCAESLQTFIIRGCPNIEEMPECISNLNKLQNLEITRCPRLS  811



>ref|XP_011011370.1| PREDICTED: putative disease resistance protein RGA3 isoform X7 
[Populus euphratica]
Length=851

 Score =   441 bits (1135),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 324/822 (39%), Positives = 464/822 (56%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP  ++LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVIFEELPATLALPEQLLQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +P+ + N   LQ L I  CP LS
Sbjct  770   GCAESLQTFIIRGCPNIEEMPECISNLNKLQNLEITRCPRLS  811



>ref|XP_011011368.1| PREDICTED: putative disease resistance protein RGA3 isoform X5 
[Populus euphratica]
Length=853

 Score =   441 bits (1134),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 324/822 (39%), Positives = 464/822 (56%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP  ++LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVIFEELPATLALPEQLLQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +P+ + N   LQ L I  CP LS
Sbjct  770   GCAESLQTFIIRGCPNIEEMPECISNLNKLQNLEITRCPRLS  811



>ref|XP_011011364.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Populus euphratica]
Length=869

 Score =   441 bits (1135),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 324/822 (39%), Positives = 464/822 (56%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP  ++LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVIFEELPATLALPEQLLQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +P+ + N   LQ L I  CP LS
Sbjct  770   GCAESLQTFIIRGCPNIEEMPECISNLNKLQNLEITRCPRLS  811



>ref|XP_011011366.1| PREDICTED: putative disease resistance protein RGA3 isoform X3 
[Populus euphratica]
Length=867

 Score =   441 bits (1135),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 324/822 (39%), Positives = 464/822 (56%), Gaps = 27/822 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE F  +I +++L K+ S A  E   A  L+ +L +L+  L  I AVL DA++QQ+KN 
Sbjct  1     MAEAFATEIAKSLLGKLGSFAVQEFRLACGLQDDLARLEERLKAINAVLSDAEKQQSKNE  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILT-KVRKLFTRPDGLIYRFKIT  431
              ++ WL  LR V YDA+D+LD+    +L R++    G  + KV+  FT  + + +R ++ 
Sbjct  61    RIRLWLHMLRKVFYDAEDVLDEIECETLQRQVVKTKGSTSRKVQHFFTSSNRIAFRLRMG  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENY----YVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             H I++I  RL +I+  + +F+  E      +V   E G  R    SF   S +I RD DK
Sbjct  121   HNIKKIIERLAEISALKSDFNLSEQAIDCSHVLHEETGMNR----SFDSFSGLIRRDEDK  176

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E I+ +L+      D      LPIVG+GGLGKT+L K V + + V ++F  ++ V VS+D
Sbjct  177   ERIINLLIPPFKVGDAHP-RVLPIVGMGGLGKTSLAKSVGDAEIVERHFQLKMEVCVSDD  235

Query  780   FSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRE  959
             FSL +VI+KI++SATG+    LD  +LQ+ L  +L   +YLL+LDDVWNED  KW  L+ 
Sbjct  236   FSLKQVIQKIIKSATGERCADLDEGELQKKLEEILNGRKYLLLLDDVWNEDAKKWLLLKP  295

Query  960   LLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNL  1136
             +L  G DGS++IVTTRS +VA I GT  AYNLS L   DC  LF KCAF+E Q     NL
Sbjct  296   VLSKGADGSKIIVTTRSQRVAEIMGTVPAYNLSHLGKEDCLLLFCKCAFKEGQMALYPNL  355

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGKEIV KC  VPLAV  LG+ LY K DE EW  +R++E W  E++   ILP LK+SY
Sbjct  356   IGIGKEIVAKCKQVPLAVINLGTQLYGKIDETEWKSVRDSEKW--EEEGDVILPALKISY  413

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFI-QSPDGDQELENLGNQYFNELL  1493
              ++P HL++CF YC +FPK  +    + +  W+A G I QS + ++ LE++G +Y  EL+
Sbjct  414   QRLPTHLKRCFLYCSVFPKDYQFGDCILVQFWMAHGLILQSANPNENLEDVGLRYVRELI  473

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL-VFHAD  1670
             SR  FQD  +     I   K+H+L+HDLA S+A  E   + S + +I ES  HL V  ++
Sbjct  474   SRCFFQDYEDCI--VIAYFKMHDLIHDLAASLAQNEFSIISSQNHQISESSRHLSVLDSN  531

Query  1671  NLSREEFPQPLLNLKNLRYFAYSFRV-GTVSKTFVKKTLLNFRRLRVLMLQN-LELKELP  1844
             +   +   +      ++R   ++  + G   KT  +K L  F+ LR L L +  E +  P
Sbjct  532   SFFHQTLNKFSNEFDHVRSIVFADSIAGPTCKTDFEKCLSGFKYLRSLELMDPSEFEVFP  591

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
               IG LK LRYL L  N  +K LP+ I KL NLQ L +   E L+ELP +  + ++SL+ 
Sbjct  592   ERIGALKHLRYLYLVVNTEMKRLPKSIFKLPNLQAL-VAAGEGLEELPEDV-RHMISLRF  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L L +Q+  L +     L  LQ L +  C   +   E  Q +K LR L I +C  L  LP
Sbjct  650   LLLFTQQKRLPEGGIGCLECLQTLFIVWCENLENLCEDMQGLKSLRKLFIAKCHGLISLP  709

Query  2205  AGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslll------mglPKLVSLPAGLKD  2366
               I+ L  LE+  I +CE+LDL   E  +G +     L         LP  ++LP  L  
Sbjct  710   RSIKCLTTLEEFCIIDCEKLDLITIEEEKGKKIQSLSLSLRIVIFEELPATLALPEQLLQ  769

Query  2367  IDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELS  2492
               A  L+   + GCP +  +P+ + N   LQ L I  CP LS
Sbjct  770   GCAESLQTFIIRGCPNIEEMPECISNLNKLQNLEITRCPRLS  811



>ref|XP_010917835.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
 ref|XP_010917836.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
 ref|XP_010917837.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
 ref|XP_010917838.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
Length=1089

 Score =   446 bits (1148),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 282/650 (43%), Positives = 404/650 (62%), Gaps = 20/650 (3%)
 Frame = +3

Query  72    SMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKN  251
             + A +  + I E V+ K+ S    E+  A ++K +++ LQ+ L TI  VL DA+ +   +
Sbjct  4     AAAVSIASSILEIVIQKLGSGLWKEMGFASSVKKDVENLQSVLITINDVLYDAESRSISD  63

Query  252   HEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKIT  431
               +  WL+KLRD  +DADD++D+F T +L +K+   + I+ KVR  F+  + +I+  KI 
Sbjct  64    KALHGWLRKLRDAAFDADDVVDEFQTEALRQKIEENNCIIRKVRDFFSLNNPIIFHHKIA  123

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
              KI EIR RL+QI+E+R  FH  E      + +  L  +T+SFV  S+I GRD DKE ++
Sbjct  124   RKIEEIRERLDQISEERLKFHLSEK----SIPDRPLERETYSFVVESEIYGRDDDKEEVI  179

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+    ++D   VS LPIVGLGG+GKTTL +LVYND R+ ++F+ R+WV +SE+F + 
Sbjct  180   NFLVHVDTDKD---VSVLPIVGLGGVGKTTLAQLVYNDRRIGEHFELRMWVCISENFDIP  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             ++I  I+   TG +    D++ +Q  L   L   R+LLVLDDVWNE++ +W+ L+ LL  
Sbjct  237   RIIRAIVERVTGTNCELSDIEMMQSLLREKLRERRFLLVLDDVWNEEEAEWERLKPLLRG  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEI  1145
             G  G++++VTTRS +VA I G++    L GLS  DC+ LF + AF     E  PR L EI
Sbjct  297   GKKGNKIVVTTRSKRVACIMGSSAPLRLQGLSIADCWTLFRQRAFGLGRGEETPR-LAEI  355

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             GKEIVQKCGG+PLA K LGS++  K  E EWL ++ +EIWK+  KET ILP L+LSYD +
Sbjct  356   GKEIVQKCGGLPLAAKALGSLISSKRGEVEWLAVKNSEIWKLPAKETGILPALRLSYDHL  415

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+ CFAYC +FPK   I RE  I LW+A+GFIQ  D + +LEN+GNQ+FN+LL R  
Sbjct  416   PSHLKPCFAYCSLFPKDFRIDRERLIQLWIAEGFIQPSDSNMDLENIGNQFFNDLLWRSF  475

Query  1506  FQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSRE  1685
             FQD     DG +  CK+H+LVHDLA  V G E + +   D +   S H   + + + +++
Sbjct  476   FQDAERDSDGNVTVCKMHDLVHDLACCVIGDEAV-IMEVDKDTSIS-HRCRYSSVDFNKD  533

Query  1686  EFPQPLL------NLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPS  1847
             +  + L        L++L +  +      V K FV   + N   LRVL LQN  L++L +
Sbjct  534   KSSECLQLAYKTKKLRSLIFLHFPSEEANV-KNFVFYVVSNLTYLRVLDLQNTCLEKLSN  592

Query  1848  SIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNF  1997
              IG LK LR+L+LSN   I++LP  I+ L NLQ LNL  C  L ELP++ 
Sbjct  593   RIGRLKHLRFLDLSNTL-IQALPNSIASLHNLQVLNLSYCGNLFELPKDM  641



>ref|XP_008810760.1| PREDICTED: putative disease resistance protein RGA3 [Phoenix 
dactylifera]
Length=1057

 Score =   446 bits (1146),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 322/863 (37%), Positives = 475/863 (55%), Gaps = 78/863 (9%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+  L+ +   V+ K       +  + W +  +L+KL+ TL  I++ L  A+E+Q K  
Sbjct  1     MADVLLSALLPVVMEKATGRVLQQFGAMWGIHEKLEKLKRTLLAIQSKLGVAEERQVKEA  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              VK WL  L++  Y+ADD+LD+F   ++ RK      +  KVR  F+  + + +R K+  
Sbjct  61    GVKSWLAALKNAAYEADDILDEFNVEAMRRKAEIQIDMTKKVRSFFSLGNPVWFRLKMGR  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             ++  I  ++ ++ ++   F F+    V      + R  T S V   D+IGR+ D E IV 
Sbjct  121   ELHAIVEKIEKLVDEGNKFGFE----VKTQPQKRDRRDTDSCVIGFDVIGREEDTEKIVK  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L+     +D ++V+ LPIVG+GGLGKTTL +L+YNDDRV  +F  R+WVSVS++F ++K
Sbjct  177   LLLA---HDDFQNVAVLPIVGMGGLGKTTLAQLIYNDDRVKTHFQPRIWVSVSDEFDVAK  233

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             + + I+ SA     G  +M  LQ  L  V+   RYLLVLDD+WNEDQ KW  LR LL +G
Sbjct  234   LAKAIIASAKDVECGLSNMKLLQRRLREVVSGKRYLLVLDDIWNEDQAKWDELRTLLETG  293

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
              +GSR++VTTRS + ++I GT   Y LS L++  C+ LF K AF  +   P+NLV IGK+
Sbjct  294   GEGSRIVVTTRSERASSIMGTLRTYRLSPLAEDHCWALFRKRAFMRRAEEPQNLVNIGKQ  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KCGG+PLA K LGS++  K++  EWL +R++ I  +   E  ILP L+LSY  +P H
Sbjct  354   IVKKCGGLPLAAKLLGSLMSTKSELAEWLSVRDHNIGDLPVGENGILPALRLSYSHLPSH  413

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFA+C +FPK  E+ +++ I LW+A GFI S DG +ELE+ G++ F+EL  R+ FQD
Sbjct  414   LKQCFAFCAIFPKDYEMEKDLLIQLWMANGFIPS-DGSKELEDKGHEIFDELAWRYFFQD  472

Query  1515  VVEAFD-GE---------ILACKIHNLVHDLAQSVAGAECLNV----KSGDPEIPESVHH  1652
             + EA D G+         I  CK+H L+HDLA+S+ G ECL++    + GD  I  +  H
Sbjct  473   IKEAEDYGDRSNKHELYSITTCKMHELMHDLARSIMGNECLSILEPARRGD--ISMNTRH  530

Query  1653  LV----FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQ  1820
             L     FH  N+ R      L N  N+R    S + G  +   V       + LR L L 
Sbjct  531   LCTSENFHL-NIHRT-----LNNYPNIRTVLSSIK-GFHTSITVTADSSKPKSLRALDLH  583

Query  1821  NLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLIN------------  1964
             N  +  LP +I +LK LRYL+LS + +I++LP+  S L NLQTL L N            
Sbjct  584   NTTITGLPIAIEYLKHLRYLDLSGS-DIEALPDTTSTLFNLQTLKLSNCWNLSKLPEDMR  642

Query  1965  ------------CEQLKELPRNFGQQLMSLKTL--YLTSQEVSLQKRSSVSLGFLQFLLL  2102
                         C +LK LP + G QL SL+TL  Y+   +   +     SL    FL L
Sbjct  643   NMSSLRHLYIHKCRRLKHLPASIG-QLSSLRTLTKYIVGNDAGRRIAELNSLNLGGFLEL  701

Query  2103  YKCSCR-KFPAEIWQHMKKLRVLRIYECSSLTCLP-AGIRHLAKLEKLWIWNCEELDLSV  2276
             Y    +   P   W+++  L  + +  C  L   P    R L  L+K+ I  C++L   V
Sbjct  702   YNLRNQSSSPLAFWKNLTSLLAVSMDYCDDLVYWPETEFRGLKSLKKISICGCKKL---V  758

Query  2277  gegmegleslqslllmglPKLVSLPAGLKDIDAM--------KLKYLRVAGCPELTALPD  2432
             G     L S  S     LP L  L   ++  D++         L+ L V  CP+L +L +
Sbjct  759   GPSCLPLSSSSSGDGELLPNLEEL--DIRSCDSLLELPMLPASLRILEVHNCPKLNSLTE  816

Query  2433  WLQNCTLLQRLYIEDCPELSYLP  2501
              L++ T L+R+ +  CP L+ LP
Sbjct  817   GLRHATALERVIMSGCPNLTSLP  839



>ref|XP_002265970.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=1211

 Score =   449 bits (1155),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 294/654 (45%), Positives = 410/654 (63%), Gaps = 17/654 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA--K  248
             MAE     I E++L+K+ S+A  EI     +  EL+KL+NTL TIKAVL DA++QQ   K
Sbjct  1     MAEQIPFSIAESLLTKLGSIALQEIGLVHGVHKELRKLENTLYTIKAVLVDAEKQQQEEK  60

Query  249   NHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKI  428
             +  V+ W+++L+DVVYDADDLLDDF    L  K     GI  +V +LFT    L +R K+
Sbjct  61    SRAVESWVRRLKDVVYDADDLLDDFAVQHLRPKNDMQRGIARQVSRLFTSKSQLAFRLKM  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              H+I++IR R ++IA D   F+F     ++     + RE THSFV  S+IIGRD +KE +
Sbjct  121   GHRIKDIRLRFDEIANDISKFNFLPRPIIDVGVENRGRE-THSFVLTSEIIGRDENKEDL  179

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             V +LM S +EE+   +S + IVG+GGLGKTTL +LVYND+RV++ F+ R+WV VS+DF  
Sbjct  180   VELLMPSGNEEN---LSIVAIVGMGGLGKTTLAQLVYNDERVLKYFEIRIWVCVSDDFDT  236

Query  789   SKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
               +++KIL+S T +  G L++D L+  L+  L   RYLLVLDDVWN++   W  LR LL 
Sbjct  237   KTLVKKILKSTTNEVVGDLELDILKNQLHEKLNQKRYLLVLDDVWNDNFESWDQLRILLT  296

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIG  1148
              G  GS+++VTTRS KVA+     + Y L GL +   +DLF K  FR QE   ++LV IG
Sbjct  297   VGAKGSKILVTTRSAKVASAMKIDSPYVLEGLREDQSWDLFEKLTFRGQEKVCQSLVTIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEI++ C GVPL +++LGS L  K ++  WL IR NE         +IL +LKLSYD +P
Sbjct  357   KEIIKMCKGVPLVIRSLGSTLQFKAEKSHWLSIRNNENLMSLDVGDNILRVLKLSYDNLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HLRQCFAYC +FPK  +I R V + +W+AQG+I + D    LE++G+QYF ELLS+  F
Sbjct  417   VHLRQCFAYCGLFPKDHKIERRVLVQIWIAQGYIHTSDERHHLEDIGDQYFEELLSKSFF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q+V +   G IL+CK+H+L+HDLAQSVAG+EC  +K+        V     H   +    
Sbjct  477   QEVEKDSYGNILSCKMHDLIHDLAQSVAGSECSFLKNDMGNAIGRVLERARHVSLVEALN  536

Query  1689  FPQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
               Q +L  K+LR  F +S +             L  R LRVL L  L ++++P S+G L 
Sbjct  537   SLQEVLKTKHLRTIFVFSHQEFPCD--------LACRSLRVLDLSRLGIEKVPISVGKLN  588

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              LRYL+LS N     LP  ++   +LQTL L  CE+LK LPR+  ++L++L+ L
Sbjct  589   HLRYLDLSYN-EFDVLPNSVTSFHHLQTLKLFKCEELKALPRDM-RKLINLRHL  640


 Score = 75.5 bits (184),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 110/228 (48%), Gaps = 25/228 (11%)
 Frame = +3

Query  1923  ISKLVNLQTLNLINCEQLKEL-----PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFL  2087
             IS+ +NL +L L +C +L EL     P     QL S  +L    +E++L   S   L  L
Sbjct  938   ISECLNLTSLELHSCPRLSELHICGCPNLTSLQLPSFPSL----EELNLDNVSQELLLQL  993

Query  2088  QFLLLYKCSCR--------KFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLW  2243
              F+     S             +E  + +  L  L I +C SL  L  GI+HL  L+ L 
Sbjct  994   MFVSSSLKSVSISRIDDLISLSSEGLRCLTSLSNLLINDCHSLMHLSQGIQHLTTLKGLR  1053

Query  2244  IWNCEELDLSVgegmegl-----eslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
             I  C ELDLS  E  +        SL  L +  +PKLVSLP GL  +    L+ L +  C
Sbjct  1054  ILQCRELDLSDKEDDDDTPFQGLRSLHHLHIQYIPKLVSLPKGL--LQVTSLQSLTIGDC  1111

Query  2409  PELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDC  2549
               L  LPDW+ + T L+ L I DCP+L  LPE+IR  S  + +RI  C
Sbjct  1112  SGLATLPDWIGSLTSLKELQISDCPKLKSLPEEIRCLSTLQTLRISLC  1159



>emb|CDP07780.1| unnamed protein product [Coffea canephora]
Length=937

 Score =   442 bits (1137),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 299/687 (44%), Positives = 420/687 (61%), Gaps = 36/687 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE     I E++L K+ S A   ++    +K E++KL NTL+ I+AVL DADEQQ K+ 
Sbjct  1     MAEAIPFGIAESMLLKLGSSAFQHVALISGVKDEVRKLSNTLTAIEAVLADADEQQEKSL  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              V++W++ L++VVYDADD+LD+F T + + +      +  +V + F+  + L +R+ +  
Sbjct  61    LVQNWIKNLKEVVYDADDILDEFSTKASITEADLLGRVKNQVTQFFSSSNQLAFRYNMAK  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KIR+IR RL++IA +   F+F+       VEN K REQTHS+V  S + GR  DKE IV 
Sbjct  121   KIRKIRERLDEIAFEMAKFNFRVRSVNVRVEN-KEREQTHSYVLASSVTGRQEDKEEIVK  179

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM S D++    VS + IVG+GGLGKTTL KLVYND+R+V+NF  R+W+SV   F+L  
Sbjct  180   LLMCSSDQQ---PVSPIAIVGIGGLGKTTLAKLVYNDERIVRNFGLRMWISVYNQFNLKS  236

Query  795   VIEKILRSATGKSFGH-------------LDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQ  935
             ++EKIL  A G  F +             L+M+QLQ  +   L   +YLLV+DDVW+E++
Sbjct  237   IMEKIL--ACGIEFDNFEMEAEKNRVTEKLEMEQLQILVREKLSGKKYLLVVDDVWSENR  294

Query  936   HKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-  1112
               W  L ELL  G  GS++ VTTRS KVA        Y L  L +   ++LF + AFR+ 
Sbjct  295   DIWIQLSELLQGGRWGSKIAVTTRSQKVAFALDAEYTYMLQALPEDASWNLFRQLAFRKG  354

Query  1113  QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDI  1292
             QE +  +LV+IGK IV+KC GVPLA++TLGSML CK +E EWL I+ENEIW++     D+
Sbjct  355   QEDKHPSLVQIGKNIVKKCHGVPLAIRTLGSMLRCKREENEWLSIQENEIWELH----DV  410

Query  1293  LPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGN  1472
             + ILKLSYD +P +L+QCF YC +FPKG  +  +  I LW+AQG+I       +LE++G 
Sbjct  411   MNILKLSYDHLPSNLKQCFTYCSLFPKGYVLEIKNLIQLWMAQGYIHQLGMGDQLEDIGL  470

Query  1473  QYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             QY  EL  R  FQDV    +  I +CK+H+L+HDLA SVA  EC    S    I E VHH
Sbjct  471   QYSEELQLRSFFQDVKRDDNNNITSCKMHDLMHDLACSVAKPECCVADSDGSNISERVHH  530

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGT---VSKTFVKKTLLNFRRLRVLMLQN  1823
             + F +   +    P  LL ++ +R     F   T   ++     + L   RRLRVL L N
Sbjct  531   VSFRSYLPASWTLPPSLLRVQKVRTLLLPFHYHTGCSIANVAFDQCL---RRLRVLDLHN  587

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
               +++LP  +G LK LRYL+LS N  + +LP  ISKL NLQTL L  C +L ELP N   
Sbjct  588   QRIQKLPRGVGNLKHLRYLDLSKNA-LTTLPNSISKLQNLQTLKLDRCYKLVELP-NQIT  645

Query  2004  QLMSLKTLYLTSQEVSLQKRSSVSLGF  2084
             +++SL+ L ++    +  K + + LGF
Sbjct  646   RIVSLRHLEIS----TCSKLTHMPLGF  668



>ref|XP_006603615.1| PREDICTED: NBS-LRR disease resistance protein isoform X1 [Glycine 
max]
Length=750

 Score =   436 bits (1122),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 283/732 (39%), Positives = 421/732 (58%), Gaps = 35/732 (5%)
 Frame = +3

Query  426   ITHKIREIRGRLNQIAEDRRNFHFKE-NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKE  602
             +  +I+++  RL+++A DR  F  +  +     V        THS V  SD+IGR+ DKE
Sbjct  1     MAQQIKDVSKRLDKVAADRHKFGLRIIDVDTRVVHRRDTSRMTHSRVSDSDVIGREHDKE  60

Query  603   SIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDF  782
              I+ +LM+    +D +S+S +PIVG+GGLGKTTL + V+ND R+ + F  ++WV VS+DF
Sbjct  61    KIIELLMQQNPNDDDKSLSVIPIVGIGGLGKTTLAQFVFNDKRIYECFSLKMWVCVSDDF  120

Query  783   SLSKVIEKILRSATG-------KSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHK  941
              ++++I KI+ SA         ++   +D++QLQ  L   L   ++LLVLDDVWN+D+ K
Sbjct  121   DINQLIMKIINSANDANAPFRQQNLNMVDLEQLQNQLRSKLAGKKFLLVLDDVWNDDRVK  180

Query  942   WKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QE  1118
             W  LR L+  G  GS+++VTTR   +A++ GT T++ L  LS  +   LF+K AF+E +E
Sbjct  181   WVELRNLIQEGVAGSKILVTTRIDSIASMMGTVTSHKLQRLSSENSLSLFVKWAFKEGEE  240

Query  1119  YRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILP  1298
              +  +LV IGKEIV+KC G+PLAV+TLGS L+ K +  EW  +R+NEIW + QK+ DILP
Sbjct  241   QKHPHLVNIGKEIVKKCRGIPLAVRTLGSSLFSKFEANEWECVRDNEIWNLPQKKDDILP  300

Query  1299  ILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQY  1478
              LKLSYD +P +LRQCFA   ++PK  E      + LW A G + SP  ++ LE++  QY
Sbjct  301   ALKLSYDFLPSYLRQCFALFSLYPKDYEFRSFEVVRLWGALGVLASPRKNETLEDVVKQY  360

Query  1479  FNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLV  1658
              +ELLSR   QD ++   G     +IH+LVHDLA  V   ECL V S    IPE++ HL 
Sbjct  361   LDELLSRSFLQDFIDC--GTFYQFRIHDLVHDLAVFVTKEECLLVNSHIQNIPENIRHLS  418

Query  1659  FHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKE  1838
             F   +     F    + ++ +  F      G V ++ +   +  F+ LRVL L     K 
Sbjct  419   FAEYSCLGNSFTSKSVVVRTI-MFPNGAEGGNV-ESLLNTCVSKFKLLRVLDLSYSTCKT  476

Query  1839  LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSL  2018
             LP SIG LK LRY ++ NN NIK LP  I KL NLQ L++  C++LK LP+   ++L+SL
Sbjct  477   LPRSIGKLKHLRYFSIENNRNIKRLPNSICKLQNLQLLSVRGCKKLKALPKAL-RKLISL  535

Query  2019  KTLYLTSQEVSLQKRSSVSLGFLQFLLLYKC-------SCRKFPAEIWQHMKKLRVLRIY  2177
             + L +T+++  L      +L  L  L +             KFPA        L+ L + 
Sbjct  536   RHLKITTKQPVLPYSEITNLITLAHLYIASSHNMESILGGVKFPA--------LKTLYVV  587

Query  2178  ECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmgl----PKLVS  2345
             +C SL  LP  + +  +LE L++ +C  LDL + +     ++ +  L        P+LV+
Sbjct  588   DCHSLKSLPLDVTNFPELETLFVVDCVNLDLELWKDDHEEQNPKLKLKYVAFWGLPQLVA  647

Query  2346  LPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SS  2522
             LP  L++  A  L+ L +  C  L  LP+WL   T L+ L I DCP+L  LP+ I   ++
Sbjct  648   LPQWLQET-ANSLQTLFIKNCDNLEMLPEWLSTLTNLKALEISDCPKLISLPDNIHHLTA  706

Query  2523  NAKVRIIDCPLL  2558
               ++RI+ CP L
Sbjct  707   LERLRIVGCPEL  718



>ref|XP_009587022.1| PREDICTED: disease resistance protein RGA2-like [Nicotiana tomentosiformis]
Length=857

 Score =   440 bits (1131),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 300/758 (40%), Positives = 440/758 (58%), Gaps = 45/758 (6%)
 Frame = +3

Query  390   FTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRP  569
             F+R +   YR ++   +R++   L++I  +R  F              +    T + V  
Sbjct  105   FSRSNPFAYRIRLCLVMRKLIKMLDKIGRNRVFFKRMACGGFPSPHRARGLTHTRAHVHD  164

Query  570   SDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFD  749
             S ++GRD D++ +V  L+KS DE    ++   P+VG GG+GKTTL KLVYND R+V +F 
Sbjct  165   SGVVGRDFDRDIVVETLLKSGDEA---ALFVFPVVGFGGIGKTTLAKLVYNDPRIVSHFQ  221

Query  750   TRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNE  929
              R+WV VS  F + K++E+I+ S       + DM++LQ  +   L   +Y++VLDDVWNE
Sbjct  222   LRVWVRVSRVFQVEKLLEQIVNSVREDLCENDDMNELQTLVRETLYEKKYMIVLDDVWNE  281

Query  930   DQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR  1109
             D  KW  L +LLM G  GS+++VTTR+  VA+I GT  AY L GLS  DC  LFL  AF 
Sbjct  282   DPVKWDELNKLLMVGACGSKILVTTRNEAVASIMGTVPAYCLKGLSSEDCLTLFLSKAFE  341

Query  1110  E-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKET  1286
             E QE    NLV I  +IVQKC G PL +  LGS L+ +T E EW  ++ +E+W   Q + 
Sbjct  342   EGQEVLYPNLVGIASDIVQKCEGNPLLLMLLGSSLHMETKEWEWHEVKNHEMWNSNQND-  400

Query  1287  DILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENL  1466
             +I P L +SY+++P +L+ C AYC + PK   I  +  I LWVA+G +  P+G ++LE++
Sbjct  401   NISPALIVSYERLPSNLKVCLAYCSILPKDCVIEIDKLIQLWVAEGLVNQPNGSEDLEHI  460

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESV  1646
             G QYF ELLSR  FQ+V E        CK+H+ VHDLA S AG E   V S    I + V
Sbjct  461   GIQYFQELLSRSFFQEVEEYRSVITSLCKLHDFVHDLALSAAGVEFCTVNSHTHNISDEV  520

Query  1647  HHLVFHADNLSREEFPQPLLNLKNLRYFAYSFR-VGTVSKTFVKKTLLNFRRLRVLMLQN  1823
              H+ F   +LS +E P  LLN + LR  ++S   VG +S  FV+  +  F +LRVL + +
Sbjct  521   RHVAFSDYDLSGKELPASLLNNQTLRTISFSVDGVGPMSTMFVENCIARFMQLRVLDISD  580

Query  1824  LELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQ  2003
                 ELP S+G LK LRYL++S+N +IK LP+ I+KL++LQTL + +C QL+ELP++ G 
Sbjct  581   SCFDELPRSVGELKYLRYLDISSNGSIKELPDSINKLLSLQTLRVSHCPQLEELPKDIG-  639

Query  2004  QLMSLKTLYLTSQEVSL---------QKRSSV---SLGF---LQFLLLYKCSCRKFPAEI  2138
              L+SL+ L++T+++ S           K+SS    ++G+   L+ L ++ C+     +E 
Sbjct  640   NLISLRHLHITTKQSSFPDKAIGCLSXKQSSFPDKAIGYLSPLRSLYIHSCTNLISLSEG  699

Query  2139  WQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqsll  2318
              Q++  LR L I  C  LT  P+ +++L  LE L I +C+EL L   + +EGL  ++S++
Sbjct  700   LQYLTSLRTLAIIGCPRLTFFPSAMKYLTALENLLIVDCKELTLLEWQDIEGLTMIRSMV  759

Query  2319  l----------------------mglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPD  2432
             +                       GLP+LVSLP  L+   A  L+YLRV  CP  +ALP 
Sbjct  760   IGGLPGLESKDVQCLGNLKMLVLAGLPQLVSLPRWLEGSSA-TLQYLRVERCPNFSALPK  818

Query  2433  WLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAKVRIID  2546
             WL+N   L++L I  C ++S LPE +   +  KV  ID
Sbjct  819   WLENLIALEKLEISKCHKVSSLPEGMSCLTKLKVLRID  856



>gb|KDP26034.1| hypothetical protein JCGZ_21067 [Jatropha curcas]
Length=613

 Score =   431 bits (1109),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 257/599 (43%), Positives = 362/599 (60%), Gaps = 13/599 (2%)
 Frame = +3

Query  717   YNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRS-ATGKSFGHLDMDQLQEHLNGVLCSG  893
             YND RVV +F+ +LWV VS++F L  VI KIL   +TG+ +  LD++QLQ  L   L   
Sbjct  11    YNDPRVVTHFELKLWVCVSDNFHLQTVIIKILNCVSTGQRYVGLDIEQLQRALREALQRK  70

Query  894   RYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDH  1073
             RYLLVLDDVWNED+ KW +L+ LLM G +GS +I TTRS  VATI GT   Y L  L + 
Sbjct  71    RYLLVLDDVWNEDRKKWVDLKTLLMVGANGSTIIATTRSNDVATIMGTVAPYALGRLPEP  130

Query  1074  DCFDLFLKCAFREQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRE  1253
             DC  LF +CAF E + +  NL+  G++IV KC GVPLAV TLG++LY  TD+  W  + E
Sbjct  131   DCLSLFFRCAFGEVQNQNPNLIHYGEQIVSKCKGVPLAVITLGTLLYSVTDDSAWKFVME  190

Query  1254  NEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQ  1433
             +EIWK++QK+  I+P LKLSY+ MP +L++CFAYC +FPK         +  W++ G IQ
Sbjct  191   SEIWKLKQKDNYIMPALKLSYELMPAYLKRCFAYCSIFPKDYPFDDVELVYFWMSHGLIQ  250

Query  1434  SPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNV  1613
             S + ++ELEN+G +YF EL SR CF       DG +  CK+H+L+HDLA SV   ECL V
Sbjct  251   SSNENEELENVGLRYFQELCSR-CFFQEFYIIDGHV-KCKMHDLIHDLALSVTQNECLTV  308

Query  1614  KSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAY-SFRVGTV-SKTFVKKTLL  1787
              +G+  + +S+ HL F    L  ++ P PL +L ++R  +  + R G V S+ F++  + 
Sbjct  309   INGNEPLSDSIRHLSFPYPQLLPQDLPTPLQDLDSVRTVSILNERSGAVASEVFIETCIS  368

Query  1788  NFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINC  1967
              F+ LR L L    +  LP  I  LK LRYL+L  N  IK LPE I KL +LQTL L +C
Sbjct  369   KFKYLRTLDLGFSRVAVLPRGIAKLKHLRYLSLYGNIRIKRLPESICKLQSLQTLLLGDC  428

Query  1968  EQLKELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQH  2147
             + L+ELP++  + L+SL+ L++T+Q+  L       LG L++L +  C   ++     Q 
Sbjct  429   DGLRELPKDI-KYLISLRMLWITTQQRYLPNGGIGCLGSLRYLFIIGCENLEYLFGDIQG  487

Query  2148  MKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllm-  2324
             +KKL+ L I  C SL  LP  ++ LA L+ L + +CE LDL++ EG++  +S   L  + 
Sbjct  488   LKKLQTLVIRHCHSLVSLPPSVKFLAALKTLVVASCENLDLTMEEGIDSQDSTSQLFSLC  547

Query  2325  -----glPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPE  2486
                  GLPKLV  P  L       LK ++VA C      P+++     L+ L I  CP+
Sbjct  548   KLEIEGLPKLVDFPQWLLHRSNTGLKVIKVACCCNFRNFPNYMHGIPSLE-LRITGCPQ  605



>emb|CAN67734.1| hypothetical protein VITISV_017638 [Vitis vinifera]
Length=1211

 Score =   449 bits (1154),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 295/654 (45%), Positives = 408/654 (62%), Gaps = 17/654 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA--K  248
             MAE     I E++L+K+ S+A  EI     +  EL+KL+NTL TIKAVL DA++QQ   K
Sbjct  1     MAEQIPFSIAESLLTKLGSIALQEIGLVHGVHKELRKLENTLYTIKAVLVDAEKQQQEEK  60

Query  249   NHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKI  428
             +  V+ W+++L+DVVYDADDLLDDF    L  K     GI  +V +LFT    L +R K+
Sbjct  61    SRAVESWVRRLKDVVYDADDLLDDFAVQHLRPKNDMQRGIARQVSRLFTSKSQLAFRLKM  120

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
              H+I++IR R ++IA D   F+F     ++     + RE THSFV  S+IIGRD +KE I
Sbjct  121   GHRIKDIRLRFDEIANDISKFNFLPRPIIDVGVENRGRE-THSFVLTSEIIGRDENKEDI  179

Query  609   VGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSL  788
             V +LM S +EE+   +S + IVG+GGLGKTTL +LVYND+RV++ F+ R+WV VS+DF  
Sbjct  180   VELLMPSGNEEN---LSIVAIVGMGGLGKTTLAQLVYNDERVLKYFEIRIWVCVSDDFDT  236

Query  789   SKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLM  968
               +++KIL+S T +  G L++D L+  L+  L   RYLLVLDDVWN++   W  LR LL 
Sbjct  237   KTLVKKILKSTTNEVVGDLELDILKNQLHEKLNQKRYLLVLDDVWNDNFESWDQLRILLT  296

Query  969   SGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIG  1148
              G  GS+++VTTRS KVA+     + Y L GL +   +DLF K  FR QE   ++LV IG
Sbjct  297   VGAKGSKILVTTRSAKVASAMKIDSPYVLEGLREDQSWDLFEKLTFRGQEKVCQSLVTIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEI++ C GVPL +++LGS L  K ++  WL IR NE         +IL +LKLSYD +P
Sbjct  357   KEIIKMCKGVPLVIRSLGSTLQFKAEKSHWLSIRNNENLMSLDVGBNILRVLKLSYDNLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HLRQCFAYC +FPK  +I R V +  W+AQG+I + D    LE++G+QYF ELLS+  F
Sbjct  417   VHLRQCFAYCGLFPKDHKIERRVLVQXWIAQGYIHTSDERHHLEDIGDQYFEELLSKSFF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q+V +   G IL+CK+H+L+HDLAQSVAG+EC  +K+        V     H   +    
Sbjct  477   QEVEKDXYGNILSCKMHDLIHDLAQSVAGSECSFLKNDMGNAIGRVLERARHVSLVEALN  536

Query  1689  FPQPLLNLKNLR-YFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLK  1865
               Q +L  K+LR  F +S +             L  R LRVL L  L  +++P S+G L 
Sbjct  537   SLQEVLKTKHLRTIFVFSHQEFPCD--------LACRSLRVLDLSRLGXEKVPISVGKLN  588

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL  2027
              LRYL+LS N     LP  ++   +LQTL L  CE+LK LPR+  ++L++L+ L
Sbjct  589   HLRYLDLSYN-EFDVLPNSVTSFHHLQTLXLFKCEELKALPRDM-RKLINLRHL  640


 Score = 75.1 bits (183),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 110/228 (48%), Gaps = 25/228 (11%)
 Frame = +3

Query  1923  ISKLVNLQTLNLINCEQLKEL-----PRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFL  2087
             IS+ +NL +L L +C +L EL     P     QL S  +L    +E++L   S   L  L
Sbjct  938   ISECLNLTSLELHSCPRLSELHICGCPNLTSLQLPSFPSL----EELNLDNVSQELLLQL  993

Query  2088  QFLLLYKCSCR--------KFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLW  2243
              F+     S             +E  + +  L  L I +C SL  L  GI+HL  L+ L 
Sbjct  994   MFVSSSLKSVSISRIDDLISLSSEGLRCLTSLXNLLINDCHSLMHLSQGIQHLTXLKGLR  1053

Query  2244  IWNCEELDLSVgegmegl-----eslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGC  2408
             I  C ELDLS  E  +        SL  L +  +PKLVSLP GL  +    L+ L +  C
Sbjct  1054  ILQCRELDLSDKEDDDDTPFQGLRSLHHLHIQYIPKLVSLPKGL--LQVTSLQSLTIGDC  1111

Query  2409  PELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDC  2549
               L  LPDW+ + T L+ L I DCP+L  LPE+IR  S  + +RI  C
Sbjct  1112  SGLATLPDWIGSLTSLKELQISDCPKLKSLPEEIRCLSTLQTLRISLC  1159



>ref|XP_006421374.1| hypothetical protein CICLE_v10006631mg [Citrus clementina]
 gb|ESR34614.1| hypothetical protein CICLE_v10006631mg [Citrus clementina]
Length=546

 Score =   428 bits (1101),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 247/543 (45%), Positives = 357/543 (66%), Gaps = 7/543 (1%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             M E F     E +L K+ S A +E+   + LK +L+KL+ TL+ +K+V+ DA+E+Q  +H
Sbjct  1     MVELFFP--IEKLLEKLGSFAYEELLFFYGLKNDLEKLKKTLTIVKSVVLDAEEKQVHSH  58

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++D L+KL+D  YDA+D+LD+F   +L R++     I  K+R  F   + + +RFK+ H
Sbjct  59    QLRDGLEKLKDACYDAEDVLDEFEVENLRRQVIKQRSIGRKLRHFFGSSNPIAFRFKMGH  118

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             +I++IR R ++I      F+       +     + RE THSFV PS+IIGRD D+E I+ 
Sbjct  119   QIKKIRERFDEITSMMGKFNLTPRLDDHRQGLHEEREHTHSFVLPSNIIGRDKDREKIIE  178

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +LM+  D+E +E+VS +PIVGLGGLGKT L KL+YND RV ++F  ++W+ VSE+F   +
Sbjct  179   LLMQRSDDE-SETVSVIPIVGLGGLGKTALAKLMYNDQRVEEHFQLKIWICVSENFGERQ  237

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             ++ K++ S TG++ G+LD D+LQ+ L   L   R LLV+DDVWNED   W +L+ LL+ G
Sbjct  238   IMTKMIDSVTGENHGNLDPDRLQKVLQDSLNGKRQLLVMDDVWNEDPRAWGDLKSLLLGG  297

Query  975   CDGSRVIVTTRSIKVATITGT---TTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEI  1145
               GS+++VTTRS KVA+I GT   T  YNL  L   DC  LF+K AF+E + +  NL++I
Sbjct  298   AKGSKILVTTRSNKVASIMGTMIGTPGYNLQDLPYKDCLALFMKFAFKEGQEKYPNLIKI  357

Query  1146  GKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQM  1325
             G++IV+KC G+PLAV+TLGS+LY  TDE +W ++R N++WK  Q   DILP L+LSY+Q+
Sbjct  358   GEKIVEKCRGIPLAVRTLGSLLYGSTDEHDWEYVRHNDMWKFRQGHDDILPALRLSYNQL  417

Query  1326  PYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFC  1505
             P HL+QCFAYC +FPK  +      I  W+A G +QSP  ++ELEN+G  YF EL SR  
Sbjct  418   PPHLKQCFAYCSIFPKDYKFTSAFLIQFWMAHGLLQSPSENEELENIGMWYFKELCSRSF  477

Query  1506  FQDV-VEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSR  1682
             FQD+  E    E++  +IH L+HDLA  +A  EC  V S    IP++V HL F   N  R
Sbjct  478   FQDLGYEVPLLELIEFQIHELMHDLALLMAKGECPMVNSDSQSIPKNVRHLSFVGANALR  537

Query  1683  EEF  1691
              +F
Sbjct  538   NDF  540



>gb|AAO37645.1| NBS-LRR resistance protein RGH1 [Manihot esculenta]
Length=1035

 Score =   443 bits (1140),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 279/654 (43%), Positives = 412/654 (63%), Gaps = 23/654 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+  L+++  ++++K+ S A  EI   W +K ELKKL+ T+S+I+ VL DA+EQQ  N 
Sbjct  1     MADGVLSNVVGDIITKLGSRALHEIGLWWGVKGELKKLEATVSSIRNVLLDAEEQQKLNR  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +VK WL++L +VVYDADDL+DDF T +L R++ + + +  +V   F+  + L+Y FK+ H
Sbjct  61    QVKGWLERLEEVVYDADDLVDDFATEALRRRVMTGNRMTKEVSLFFSSSNKLVYGFKMGH  120

Query  435   KIREIRGRLNQIAEDRR-NFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             K++ IR RL  I  DR+ N   + +      E    R+QT S + P  +IGR+ DK++I 
Sbjct  121   KVKAIRERLADIEADRKFNLEVRTDQ-----ERIVWRDQTTSSL-PEVVIGREGDKKAIT  174

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +++ S  EE    VS L IVG+GGLGKTTL +++ ND+ +  +F+ R+WV VSE F + 
Sbjct  175   QLVLSSNGEE---CVSVLSIVGIGGLGKTTLAQIILNDEMIKNSFEPRIWVCVSEHFDVK  231

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
               + KIL SATG     L ++ L+  L  ++   +YLLVLDDVWNE++ KW+NL+ LL+ 
Sbjct  232   MTVGKILESATGNKSEDLGLEALKSRLEKIISGKKYLLVLDDVWNENREKWENLKRLLVG  291

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGK  1151
             G  GS++++TTRS KVA I+GTT  + L GLS  + + LFL  A   QE +  N+ E+GK
Sbjct  292   GSSGSKILITTRSKKVADISGTTAPHVLEGLSLDESWSLFLHVALEGQEPKHANVREMGK  351

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             EI++KC GVPLA+KT+ S+LY K  E EWL     E+ +I Q   DI+P LKLSYD +P 
Sbjct  352   EILKKCHGVPLAIKTIASLLYAKNPETEWLPFLTKELSRISQDGNDIMPTLKLSYDHLPS  411

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQ  1511
             HL+ CFAYC ++PK   I  +  I+LW+AQGFI+SP     LE++G +YF +L  R  FQ
Sbjct  412   HLKHCFAYCAIYPKDYVIDVKTLIHLWIAQGFIESPSTSDCLEDIGLEYFMKLWWRSFFQ  471

Query  1512  DVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEF  1691
             +V     G + +CK+H+L+HDLA +V G     V S  P I E  HH+      L+    
Sbjct  472   EVERDRCGNVESCKMHDLMHDLATTVGGKRIQLVNSDTPNIDEKTHHVA-----LNLVVA  526

Query  1692  PQPLLN-LKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQ  1868
             PQ +LN  K +R    S     V + F+ K   N + LRV  + +  +  + +SI  LK 
Sbjct  527   PQEILNKAKRVRSILLS-EEHNVDQLFIYK---NLKFLRVFTMYSYRI--MDNSIKMLKY  580

Query  1869  LRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLY  2030
             LRYL++S+N  +K+L   I+ L+NLQ L++  C QLKELP++  ++L++L+ LY
Sbjct  581   LRYLDVSDNEKLKALSNSITDLLNLQVLDVSYCVQLKELPKDI-KKLVNLRHLY  633



>ref|XP_010938821.1| PREDICTED: disease resistance protein RGA2-like, partial [Elaeis 
guineensis]
Length=1240

 Score =   448 bits (1153),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 278/671 (41%), Positives = 414/671 (62%), Gaps = 36/671 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+  L+ +   V+ K       +    W ++ +L+KL+ TLS I +VL DA+++Q ++ 
Sbjct  1     MADVLLSALLPVVMKKAADRILQQFGVIWGMEEKLEKLERTLSAILSVLGDAEQRQVEDP  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              VK WL  L+D  Y+ADD+LD+F   ++ RK      +  +VR  F+  + + +RFK+  
Sbjct  61    AVKRWLAALKDAAYEADDVLDEFNVEAMRRKTEIQIDMSKRVRSFFSLHNPVWFRFKMGQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++EI  ++++IA +R  F F     V      + R Q+HS++  S++IGR+ DKE IV 
Sbjct  121   KLKEIVQKIDEIAAERIRFGFT----VTTQPQNRDRPQSHSYIDESNVIGREEDKEKIVK  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L+   D +  ++V+ LPIVG+GGLGKTTL + VY D RV ++F   +WV VS++F ++K
Sbjct  177   LLL---DHDRNQNVAVLPIVGMGGLGKTTLAQFVYRDKRVEKHFQPLIWVCVSDEFDIAK  233

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +   I+ SATG      +M+ LQ  L  V+   RYLLVLDDVWNEDQ KW  L+ LL +G
Sbjct  234   LARAIISSATGTECQESNMELLQRRLREVVSGKRYLLVLDDVWNEDQAKWDELKTLLGTG  293

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
              +GSR+IVT R+ +V++I GT  AY L GL++ D + LF K AF +    P  L +IGKE
Sbjct  294   GEGSRIIVTARNEQVSSIMGTLDAYLLKGLTEDDSWTLFRKRAFEKGAEVPPTLAKIGKE  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KCGG+PLAVKTLGS+++ K+ E+EWL +R+++IW ++  E  ILP L+LSY  +P H
Sbjct  354   IVKKCGGLPLAVKTLGSLMHSKSQEKEWLSVRDSDIWDMQVGEDGILPALRLSYSHLPSH  413

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFA+C +F K  E+ +++ I LW+A GFI S  G +ELE+ G++ FNEL SR  FQD
Sbjct  414   LKQCFAFCAIFQKDYEMDKDLLIQLWMANGFIPS-GGRKELEDKGHEIFNELASRSFFQD  472

Query  1515  VVEAFD--------GEIL---ACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVF  1661
             + E           GE+     CK+H+L+HDLAQS+ G ECL+V   DP   E V     
Sbjct  473   IKEVAGYYGFYGSRGELYCTTTCKMHDLMHDLAQSITGNECLSVV--DPATLEDVSKKTR  530

Query  1662  HAD-------NLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQ  1820
             H         N+ R     P  N++ L   +  +     ++  V       R LR L L 
Sbjct  531   HLGTSGHFILNIHRILNTSP--NIRTLLSLSTEWS----NRIMVTADSSKPRSLRALGLT  584

Query  1821  NLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG  2000
             + ++  LP SIGFLK LRYL+LS   +I++LP+  S L+NLQTL L NC++L++LP++  
Sbjct  585   HPDISRLPISIGFLKHLRYLDLSRT-DIEALPDATSTLLNLQTLKLSNCDELRKLPKDM-  642

Query  2001  QQLMSLKTLYL  2033
             + +  L+ LY+
Sbjct  643   RNMSDLRHLYI  653


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 68/164 (41%), Gaps = 40/164 (24%)
 Frame = +3

Query  2085  LQFLLLYKCS----CRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWN  2252
             L++L + +C       K PA        LR L +  C     +  G+RH   L+ ++I +
Sbjct  1077  LEYLNIIRCDGLVELPKLPA-------TLRSLSVQYCPKFNSMTEGLRHATALDDIYITD  1129

Query  2253  CEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPD  2432
             C                         P L SLP G   + A  LK L + GC  L+ LP 
Sbjct  1130  C-------------------------PSLTSLPEGFGQLTA--LKSLILKGCSNLSYLPQ  1162

Query  2433  WLQNCTLLQRLYIEDCPELSYLPE--QIRSSSNAKVRIIDCPLL  2558
              +Q  T L+ L I  CP LS LPE  Q R     +++I  CP L
Sbjct  1163  GMQGLTALEGLIIGRCPRLSSLPEGLQQRLPGLQRLKIEGCPKL  1206



>ref|XP_010938816.1| PREDICTED: putative disease resistance protein RGA3 [Elaeis guineensis]
Length=1217

 Score =   447 bits (1150),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 277/664 (42%), Positives = 409/664 (62%), Gaps = 38/664 (6%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+  L+ +   V+ K       +    W ++ +L+KL+ TLS  ++VL DA+++Q K+ 
Sbjct  1     MADVLLSALLPVVMKKAADRLLQQFGVIWGMEEKLEKLERTLSAFQSVLGDAEQRQVKDA  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +VK WL  L+D  Y+ADD+LD+F   ++ RK      +  KVR  F+  + + +RFK+  
Sbjct  61    DVKRWLAALKDAAYEADDILDEFNVEAMRRKTEIQIDMSKKVRSFFSLHNPVWFRFKMGQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++EI  ++++IA  R  F F     V      + R QTHS+   S++IGR+ DK+ IV 
Sbjct  121   KLKEIVQKIDEIAAKRNRFGFT----VTAQPQNRDRPQTHSYFDESNVIGREEDKKKIVK  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L+   D +  ++V+ LPIVG+GGLGKTTL + VY D+RVV++F+  +WV VS++F ++K
Sbjct  177   LLL---DHDRNQNVAVLPIVGMGGLGKTTLAQFVYRDERVVEHFELLIWVCVSDEFDVAK  233

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             + + ++ SATG      +M+ LQ  L  VL   RYLLVLDDVWNEDQ KW  L+ LL +G
Sbjct  234   LAKAVIASATGTECQESNMELLQRRLREVLSGKRYLLVLDDVWNEDQAKWDELKTLLGTG  293

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
              +GSR+IVTTRS + ++I GT   Y+L  L++ D + LF K AF E    P  L +IGKE
Sbjct  294   GEGSRIIVTTRSERASSIMGTLPTYHLLYLTEDDSWTLFRKRAFEEGAEVPPTLEKIGKE  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+K GG+PLAVKTLGS+++ K++E+EWL +R++EIWK++  E  ILP L+LSY  +P H
Sbjct  354   IVKKFGGLPLAVKTLGSLMHSKSEEKEWLSVRDSEIWKMQVGEDGILPALRLSYTHLPSH  413

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFA+C +FPK  E+ +++ I LW+A GFI S DG +ELE+ G++ FNEL     F+D
Sbjct  414   LKQCFAFCAIFPKDYEMEKDLLIQLWMANGFIPS-DGKKELEDKGHEIFNELAWNSFFKD  472

Query  1515  V--VEAFDG-----------EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHL  1655
             +  VE ++                CK+H+L+H LAQS+ G ECL+  + DP   E++   
Sbjct  473   IKEVEEYNEYTVHRFRHKLYHTTTCKMHDLMHGLAQSIMGNECLS--TVDPATLENISAK  530

Query  1656  VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELK  1835
               H     R  +  PL N  N+        V   SK            LR L +   E++
Sbjct  531   TRHL----RTYYDVPLNNYPNIHTLLSRTTVADSSKP---------TSLRALGVHQYEMR  577

Query  1836  ELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMS  2015
              LP SIGFLK LRYL+LS   +IK+LP   S L NLQTL L +C  L++LP++  + ++S
Sbjct  578   RLPISIGFLKHLRYLDLSRT-DIKALPNATSTLFNLQTLKLSHCWSLQKLPKDM-RNMIS  635

Query  2016  LKTL  2027
             L+ L
Sbjct  636   LRHL  639


 Score = 55.8 bits (133),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 96/217 (44%), Gaps = 25/217 (12%)
 Frame = +3

Query  1956  LINCEQLKELPRNFGQQLMSLKTL--YLTSQEVSLQKRSSVSLGFLQFLLLYKC------  2111
             L +  Q    P  F + L SL +L  Y     V   +     L FL+ L +  C      
Sbjct  978   LFSSSQQAASPLGFWKNLTSLLSLEIYDCDDLVYWPEEEFRGLSFLKKLKIDDCCKWVGP  1037

Query  2112  ------SCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLS  2273
                   S     AE+  ++++L V+R      L  LP  +R       L++ +C EL+ S
Sbjct  1038  SNLPLSSSTSGDAELLPNLEELNVIRCDGLLELPKLPTTLR------SLYVQHCPELN-S  1090

Query  2274  VgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTL  2453
             +  G++   +L S+ +   P L SLP G   + A  LK LR+  C  L+ LP+ +Q  T 
Sbjct  1091  MTAGLQRATALNSINISNCPSLTSLPEGFGQLTA--LKSLRIDNCSNLSYLPEGMQGLTA  1148

Query  2454  LQRLYIEDCPELSYLPE--QIRSSSNAKVRIIDCPLL  2558
             L  L I  CP LS LP+  Q R  S   + I  CP L
Sbjct  1149  LHLLTIAYCPRLSSLPKGLQQRLPSLLSLDIRGCPKL  1185



>ref|XP_003625120.1| NBS-LRR disease resistance protein [Medicago truncatula]
 gb|AES81338.1| NBS-LRR disease resistance protein [Medicago truncatula]
 gb|KEH23616.1| NBS-LRR disease resistance protein [Medicago truncatula]
Length=862

 Score =   436 bits (1122),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 315/856 (37%), Positives = 497/856 (58%), Gaps = 46/856 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+F+ DI  ++L K+ S A +E S A+ +  +L+  ++TLS +  VL DA+ ++ + H
Sbjct  1     MAESFVFDIAHSLLGKLASYAYEEASLAYGVYKDLQGFKDTLSIVSGVLLDAECKKDQKH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK--LRSCSGILTKVRKLFTRPDGLIYRFKI  428
              V++WL++++++ YDA+D+LD F  L   RK  +++      KVR  F+  + L++RF++
Sbjct  61    GVREWLRQIQNICYDAEDVLDGF-NLQDKRKQVVKASRSRRVKVRHFFSSSNPLVFRFRM  119

Query  429   THKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESI  608
               +I+EIR R++++A D   F       V+P    + RE T+  +  S +IGR+++++ I
Sbjct  120   ARQIKEIRDRMDKVAADGVRFGLTN---VDPGLVVQQREMTYPHIDASSVIGRENEQDEI  176

Query  609   VGMLMKSCDEEDT---ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             + +LM+S    D     S+  +PIVG+GGLGKTT+ K V+ND R+ Q F  ++WV +S+D
Sbjct  177   INLLMQSHPHSDGGGDNSLCVIPIVGIGGLGKTTIAKSVFNDKRMDQLFQLKMWVCISDD  236

Query  780   FSLSKVIEKILRSATGKSF----------------GHLDMDQLQEHLNGVLCSGRYLLVL  911
             F++ K+I  I+ SAT   F                 +LD+ QL   L   L   ++L+VL
Sbjct  237   FNIRKIIINIINSATTSIFTSSSAPSSGSAQLENINNLDIVQLVSRLRQKLSGQKFLVVL  296

Query  912   DDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLF  1091
             DDVWN+D+ KW  L++L+  G  GS++IVTTRS  +A++ G    Y L GLS  DC  LF
Sbjct  297   DDVWNDDRAKWLELKDLIKVGAPGSKIIVTTRSNSIASMMGDVPPYLLKGLSPKDCLSLF  356

Query  1092  LKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWK  1268
             +K AF+E +E +  NLVEIGKEIV+KC GVPLAV+TLGS L+   D  +W  +R++E+W 
Sbjct  357   VKWAFKEGEEKKYPNLVEIGKEIVKKCQGVPLAVRTLGSSLFSNFDISKWEFVRDSEMWN  416

Query  1269  IEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGD  1448
             +EQK+  ILP LKLSYDQMP ++RQCF Y  ++PK     R V  +LWVA G +QS  G 
Sbjct  417   LEQKKDGILPALKLSYDQMPSYMRQCFVYISLYPKDYIFHRTVMCSLWVAHGLVQSLQGS  476

Query  1449  QELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDP  1628
             ++LE++  +Y +EL SR  F  VV  + G      +H+L+HDLA  V+  + + V S   
Sbjct  477   EKLESIARKYIDELHSR-SFIQVVRDY-GSYCIFNVHDLIHDLALYVSREDFVAVNSHTR  534

Query  1629  EIPESVHHL-VFHADNLSREEFPQPLLNLKNLRYFAYSF-RVGTVSKTFVKKTLLNFRRL  1802
              IP+ V HL     D+L  + FP+     + +R   +    +G  +++ + +    ++ L
Sbjct  535   NIPQQVRHLSAVEDDSLDLDLFPKS----RCMRSILFPIPGLGLETESLLNEWASRYKYL  590

Query  1803  RVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKE  1982
             R L L +   + +P+S+  L+ LR+L+LS N  I+ +P  I KL++LQ L L  C +L+ 
Sbjct  591   RYLDLSDSSFETMPNSVAKLEHLRFLDLSFNKKIRIIPNSICKLLHLQVLLLSGCTKLES  650

Query  1983  LPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQH-MKKL  2159
              P+  G +L+SL+ L LT+++        V+L  LQ L  + C   KF   +++H +  +
Sbjct  651   FPKGLG-KLISLRRLILTTKQSVFPHDEFVTLVHLQSLNFHYCDNIKF---LFRHQLPSI  706

Query  2160  RVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgegmegleslqslllmglP-K  2336
               L    C  L  LP  I    KL+ L+I NCE+L+L +             L +     
Sbjct  707   EKLSCDSCGFLESLPLHI--FPKLQTLYIKNCEKLNLLLNNESPIQTLRMKHLYLLCSLS  764

Query  2337  LVSLPAGLKDIDAMK-LKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQI-  2510
             LV+LP  +  + +M+ L+ L +   P L  LP +L   T L++LYI DCP+L  LP  + 
Sbjct  765   LVTLPEWI--VFSMETLETLVIDSLPNLKMLPMFLSTMTRLKKLYIIDCPQLLSLPSDMH  822

Query  2511  RSSSNAKVRIIDCPLL  2558
             R ++  ++ I  CP L
Sbjct  823   RLTALEELCIEGCPEL  838



>ref|XP_007145620.1| hypothetical protein PHAVU_007G254200g [Phaseolus vulgaris]
 gb|ESW17614.1| hypothetical protein PHAVU_007G254200g [Phaseolus vulgaris]
Length=852

 Score =   435 bits (1119),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 309/839 (37%), Positives = 482/839 (57%), Gaps = 32/839 (4%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L  + E+V+ K+ S    E S    +  EL++++ T++ I+ VL DA ++   + 
Sbjct  1     MAESLLFSLAESVIEKLASGVVQEASLILGVHSELQEMKATMALIRGVLLDAQQKNFLSS  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKL-RSCSGILTKVRKLFTRPDGLIYRFKIT  431
              + +WL++++ V  DA+D++DDF   +L + + ++  GI  KV   F+  + L+YR ++ 
Sbjct  61    ALSEWLRQIKRVFSDAEDIVDDFQCEALRKHVVKTYGGISRKVSHFFSTSNPLVYRLRMA  120

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             H+I+ I  RL ++A  R  F  +            +RE THS V PS++ GR+ DK  IV
Sbjct  121   HRIQNINTRLAKLAVQRTMFGLQ--IIDQDTRVVHVREMTHSHVNPSNVTGREHDKNQIV  178

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              +L++    +   ++S +PIVG+GGLGKTTL KLV+ND  +   F  ++WV VS DF L 
Sbjct  179   KLLVQDVHHQ---TLSVIPIVGMGGLGKTTLAKLVFNDPIIDACFPLKMWVCVSNDFELR  235

Query  792   KVIEKILRS---ATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLREL  962
              V+ KIL S   +T ++F + + +Q Q  L  ++   ++ LVLDDVWNED+ +W  L+E+
Sbjct  236   NVLIKILNSVPNSTRENFNNFETEQFQNRLRNIIQGQKFFLVLDDVWNEDRVRWDELKEI  295

Query  963   LMSGCDGSRVIVTTRSIKVATITGT--TTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRN  1133
             +  G +GS+++VTTRS ++AT+  T  + +Y L  LS+ D   LF+K AF +  E +   
Sbjct  296   IDVGVEGSKILVTTRSHEIATMMRTKFSNSYFLQCLSEEDSRSLFVKSAFEDGDEKKHPQ  355

Query  1134  LVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLS  1313
             L+EIG+EIV+KCGG+PLAVKT+GS L+ + D++EW  IR+NEIW ++Q E  ILP LKLS
Sbjct  356   LLEIGEEIVRKCGGLPLAVKTVGSSLFSRVDKKEWESIRDNEIWNLKQNEKGILPALKLS  415

Query  1314  YDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELL  1493
             YDQ+P +L+ CFA   ++P+           +W A GF+      + + ++  Q  +EL 
Sbjct  416   YDQLPSYLKPCFASFSLYPQDLSFTCAHISIIWGALGFLPPSKESESVIDITYQLMHELW  475

Query  1494  SRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADN  1673
             SR    D  +   G     K+H+LVHDLA  +A  E   +   +P+I E+V HLVF  +N
Sbjct  476   SRSFLSDYDDM--GNDCTFKLHDLVHDLATYIAKGEFERIDLRNPKISENVQHLVFMDNN  533

Query  1674  LSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSI  1853
             L  + FP     L  LR  +  F +G  ++  +   L   + LR+L L + E + LP  I
Sbjct  534   LLAQAFP-----LTGLR--SLCFPIGMNNQALLNTFLSRCKYLRILELSSYEFESLPDCI  586

Query  1854  GFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
             G LK LRYLNL  + N++ LP  + KL NLQTL+L  C +L++LP+   + L+SL+ L +
Sbjct  587   GKLKHLRYLNLQVSENLEGLPNSVCKLQNLQTLDLCGCIKLQKLPKGI-RNLISLRNLII  645

Query  2034  TSQEVSLQKRSSVSLGFLQFLLLYKCSCRK--FPAEIWQHMKKLRVLRIYECSSLTCLPA  2207
             T++++   K    SL  L+ L  Y C   +  F   +   +KK   L +++C SL  +  
Sbjct  646   TTKQLDFPKGEIASLTSLENLYFYHCDNLESLFEGILLPTLKK---LSLHDCKSLKFV--  700

Query  2208  GIRHLAKLEKLWIWNCEELDLSVgegmeg-leslqslllmglPKLVSLPAGLKDIDAMKL  2384
                 +  L+ L I  C +L+L +G G +     L+SL L  LP+LV+LP   +   A  L
Sbjct  701   SFDAITNLKGLSISQCYKLELWMGVGNQIPDSRLKSLTLQDLPQLVTLPQWFQG-SANSL  759

Query  2385  KYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRSSSNAK-VRIIDCPLL  2558
             + L +A C     LPDWL     L+ L I +CP L  LP+ +   +N K ++I  CP L
Sbjct  760   ETLVIADCINFKELPDWLPTLISLKILVIINCPNLLSLPDSMHHLTNLKELKIFGCPEL  818



>ref|XP_010938912.1| PREDICTED: putative disease resistance protein RGA4 [Elaeis guineensis]
Length=997

 Score =   439 bits (1130),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 288/724 (40%), Positives = 418/724 (58%), Gaps = 65/724 (9%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+  L+ +   V+ K       +    W ++ +L+KL+ TLS I+++L DA+ +Q K+ 
Sbjct  1     MADVLLSALLPVVMEKATDRLLPQFGVIWGMEEKLEKLERTLSVIQSILGDAENRQVKDP  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              VK WL  L+D  Y+ADD+LD+F   ++ RK +    +  KVR  F+  + + +RFK+  
Sbjct  61    AVKRWLAALKDAAYEADDILDEFNVEAMRRKTQIQIDMSKKVRSFFSLHNPVWFRFKMGQ  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             K++EI  ++++IA +R  F F     V      + R QTHS+V  S++IGR+ DKE IV 
Sbjct  121   KLKEIVQKIDEIAAERIRFGFT----VTTQPQNRDRPQTHSYVDESNVIGREVDKEKIVK  176

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             +L+   D +  ++V+ LPIV +GG+GKTTL KLVY D+RV ++F   +W+  S++F ++K
Sbjct  177   LLL---DHDRNQNVAVLPIVAMGGVGKTTLAKLVYKDERVERHFQPLIWICASDEFDIAK  233

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             + + I+ SATG       M+ LQ  L  V+   RYLLVLDDVWNEDQ KW  L+ LL +G
Sbjct  234   LAKAIIASATGTECQESQMELLQRRLREVVSGKRYLLVLDDVWNEDQAKWDELKTLLGTG  293

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNLVEIGKE  1154
              +GSR+IVT RS KV++I GT     LS L++ D + LF K AF +    P NL +IGKE
Sbjct  294   GEGSRIIVTARSEKVSSIMGTLPTCRLSCLTEDDSWTLFRKRAFEKGADVPPNLEKIGKE  353

Query  1155  IVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYH  1334
             IV+KCGG+PLAVK LGS+++ K+ E+EWL +R++EIW ++  E  ILP L+LSY  +P H
Sbjct  354   IVKKCGGLPLAVKALGSLMHSKSQEKEWLSVRDSEIWDMQVGEDGILPALRLSYGHLPSH  413

Query  1335  LRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCFQD  1514
             L+QCFA+C +FPK  E+ +++ I LW+A GFI S  G +ELE+ G++ FNEL SR  FQD
Sbjct  414   LKQCFAFCAIFPKDYEMEKDLLIQLWMANGFIPS-GGRKELEDKGHEIFNELASRSFFQD  472

Query  1515  VVE-----AFDG---------EILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHH  1652
             + E      FDG          I  CK+H+L HDLA+S+ G ECLN+   +P + E V  
Sbjct  473   IKEVEGHAGFDGFFVRSSKVYYITTCKMHDLTHDLAKSITGNECLNIV--EPAMLEDVSR  530

Query  1653  LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTV--------SKTFVKKTLLNFRRLRV  1808
                H             L L   R F  S  + T+        ++T V       R LR 
Sbjct  531   KTRHLGTSGH-------LTLNIHRTFNTSPNIRTLLSSSTTRSNRTIVTADSSKPRSLRA  583

Query  1809  LMLQNLELKELPSSIGFLKQLRYLNLS----------------------NNC-NIKSLPE  1919
             L L + +++ LP SIGFLK LRYL+LS                      ++C  +  LPE
Sbjct  584   LALDDYKIRRLPISIGFLKHLRYLDLSCTGVEALPDATTTLLNLQTLKLSHCWKLCKLPE  643

Query  1920  CISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTL--YLTSQEVSLQKRSSVSLGFLQF  2093
              +  + +L+ L +  C+ LK LP   G QL SL+TL  Y+   +   +      L    F
Sbjct  644   DMRNMSSLRHLYIDGCDSLKHLPAGMG-QLSSLRTLTKYIVGNDAGRRISELNGLDLGGF  702

Query  2094  LLLY  2105
             L LY
Sbjct  703   LELY  706



>ref|XP_008779138.1| PREDICTED: putative disease resistance protein RGA3 [Phoenix 
dactylifera]
Length=693

 Score =   429 bits (1103),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 270/652 (41%), Positives = 387/652 (59%), Gaps = 18/652 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE   + +   V  K+ +    E   +  +  ELKKL++TLSTI  VL DA+ +Q K  
Sbjct  1     MAEVVASSLLRLVFDKLGNKILKEFGLSMGVDKELKKLESTLSTIHDVLEDAEARQVKEK  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL+KL+DV YD DD+LD+    +  R+  +   +  KVR+L + P+  +++ KI  
Sbjct  61    ALRGWLRKLKDVAYDVDDVLDEAAAKAAKRRPENKGPMTEKVRQLSSIPNSFLFQSKIAR  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI++IR RL +IA +R  FH +E    N      +RE+T S +  S + GR+ DKE I  
Sbjct  121   KIKKIRERLEEIAGERTKFHLQERVAENIRTETAVREETGSLIDESQVYGREEDKEKITD  180

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
              L+   D  D   +  + IVGLGGLGKTT+ +LVYND RV ++F+  +WV VS+DF + +
Sbjct  181   FLI---DMSDGSDLGVIAIVGLGGLGKTTVAQLVYNDQRVREHFEQMIWVCVSDDFDIKR  237

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             +   I+ + +G  F   +MD +Q  L  ++   R+LLVLDDVW+E+  KW  +R LL+  
Sbjct  238   LTRSIIETVSGSEFSLTEMDLMQHKLRKLIEDKRFLLVLDDVWSENYEKWDRVRTLLIGS  297

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR--EQEYRPRNLVEIG  1148
               GS+VIVTTRS +V +I GT   + LSGLS+ DC  LF K AF     E  P NLV IG
Sbjct  298   ARGSKVIVTTRSERVTSIMGTVAPHFLSGLSEGDCCLLFEKRAFGLGGSEKTP-NLVAIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KEIV+KCGGVPLA K LGS++  +  E +WL I+E+EIW +   E +ILP L LSY+ +P
Sbjct  357   KEIVKKCGGVPLAAKALGSLMRFRRGESQWLAIKESEIWNLPNDENEILPALMLSYNHLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCFAYC +FP+GEEI       LW+A+GF+QS +G   LE++G Q  +ELLSR  F
Sbjct  417   SHLKQCFAYCSIFPRGEEIRSRELAQLWIAEGFVQSSNGSTYLEDVGLQCVDELLSRSLF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q   +  DG +   K+H+L+HDLA+SVAG EC    +G+  +   +     ++  + R  
Sbjct  477   QSGQKDRDGVVRQVKMHDLLHDLARSVAGDECSVADAGNKSV---ISQSCRYSSLVCRGP  533

Query  1689  FP---QPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLN-----FRRLRVLMLQNLELKELP  1844
                  +PL + + LR   +    GT  +   +  +L       + LR L L    +K +P
Sbjct  534   INSAWEPLKDAERLRTLYFVASRGTTKEEDKEDDVLQAIFSKMKLLRALHLSQCPMKAMP  593

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFG  2000
              S+  L+ LRYLNLS   +I++LP CI  L NLQ L+L  C QL+ LP   G
Sbjct  594   VSVTKLEHLRYLNLSQT-DIETLPPCIGDLQNLQILDLSCCTQLRTLPETVG  644



>ref|XP_010058642.1| PREDICTED: putative disease resistance protein RGA1 [Eucalyptus 
grandis]
 gb|KCW73431.1| hypothetical protein EUGRSUZ_E01908 [Eucalyptus grandis]
Length=795

 Score =   432 bits (1112),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 295/738 (40%), Positives = 435/738 (59%), Gaps = 23/738 (3%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE+ L     +VL KI S    E  + +N++ ++ +L+ TL+ IKAVL DA+ +QAKN 
Sbjct  1     MAESLLFS---SVLGKIASPVLQEAIAIYNIENQILELRETLTAIKAVLLDAEVRQAKNA  57

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS-CSGILTKVRKLFTRPDGLIYRFKIT  431
              ++ WL +L+   YDA+D+LD+    +L +++ S   G+  KVR+ F+  + L++R +I+
Sbjct  58    LLQVWLDQLQHAFYDAEDVLDELECEALRKQVISRYGGVKGKVRRFFSTSNPLMFRAEIS  117

Query  432   HKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIV  611
             HKI+EIR RL++I+  +  F+       N V + + RE THSF+   D++GR+ DKE I+
Sbjct  118   HKIKEIRERLSKISTKKDQFNLNMWSVDNGVGHTRSRE-THSFISNLDVVGRNIDKEKII  176

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
              MLM+     D +++S  PIVG+GGLGKTTL KLVYNDD+V + F  R WV V EDF L 
Sbjct  177   EMLMRP----DDKNLSVFPIVGIGGLGKTTLAKLVYNDDKVKEQFTLRRWVCVPEDFDLR  232

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             K IE I++ AT +     D++QLQ  L G++   +++LVLD VW+ D+ +WK LRELL  
Sbjct  233   KTIEGIIKDATPQDLSIFDIEQLQNSLQGIIKDKKFILVLDYVWSNDRRRWKELRELLSR  292

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRP-RNLVEIG  1148
             G   S++IVTTRS++VA+I GT   +NL GLS  D   LF K AF E+E  P  +L+EIG
Sbjct  293   GASESKIIVTTRSVEVASIVGTHPVHNLKGLSHEDSMALFKKWAFDEKEKEPCLDLLEIG  352

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
              +IV+K  G+PL V TLGS+LY + D++ W HIR++E W++ + + DI+PILKLSYD +P
Sbjct  353   NDIVKKTQGIPLLVTTLGSLLYSRNDDRHWKHIRDSETWELVEVKKDIVPILKLSYDHLP  412

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HLR+CFA   ++P+G  +       LW+A G I S      LE++G  Y  EL  R   
Sbjct  413   SHLRRCFAAFSLYPRGFRMKAPYVARLWMALGLIGSKREKLALEDVGIDYIKELWKRSLI  472

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNL---S  1679
             Q+V E   G +L  K+H+L+H LA SVA  +C  V     +I E V  + F + +L   S
Sbjct  473   QEVEEY--GPVLTFKVHDLIHSLAISVAQNDCSIVGLDTTDISEGVSCVSFSSTSLEGIS  530

Query  1680  REEFPQPLL---NLKNLRYFAYSFRV--GTVSKTFVKKTLLNFRRLRVLMLQNLELKELP  1844
               +   P L     K L    +  +V  G +++ F +  +     +R L L     +ELP
Sbjct  531   NFDGVPPFLRKPTSKRLHAIIFQNQVDDGVITREFARTCISKCNHIRFLDLSRGSFEELP  590

Query  1845  SSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKT  2024
              SI  LKQLR L L  N  +K LP  I KL +L  L+L  C +L  LP+N  ++L+SL+ 
Sbjct  591   RSICNLKQLRSLLLDENKQLKKLPSTICKLQSLLELSLTGCSKLGNLPKNM-KRLVSLRY  649

Query  2025  LYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLP  2204
             L +T+++ SLQ+     +  L FL +  C   +   E    + +L++L+I        L 
Sbjct  650   LNITTKQKSLQESGIQYMENLHFLGVTGCENLEVFFEGASRLTRLQLLKIGNYEGPISLL  709

Query  2205  AGIRHLAKLEKLWIWNCE  2258
              G   L  LE L I  C+
Sbjct  710   FG--DLIALESLNIDTCK  725



>ref|XP_007052428.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX96585.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative isoform 2 [Theobroma cacao]
Length=1115

 Score =   441 bits (1134),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 275/668 (41%), Positives = 425/668 (64%), Gaps = 31/668 (5%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L+ + + +  K  S   +  +     + E++KLQ  LSTI+AVL DA+++QA + 
Sbjct  1     MAEAVLSALLQVIFEKSTSETFETYALLRGTEKEMRKLQGVLSTIQAVLEDAEDRQAMDK  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRS------CSGILTKVRKLFTRPDGLIY  416
              VK+WL KL+DV YDADDLL+++ T +  R+L S         IL +VR  F++ + +++
Sbjct  61    AVKNWLIKLKDVAYDADDLLEEYMTEASRRRLESHDYKKLSRFILNEVRYFFSQSNPILF  120

Query  417   RFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSD  596
             R+++ +K+  I  RL+ +A++R  FH  +    +       R Q+ S++  S+++GR++D
Sbjct  121   RYQMRNKLENIAERLDAVADERFKFHLGDRL-ADSRSQFPQRLQSDSYLLESEVLGREAD  179

Query  597   KESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSE  776
             +E IV +L+ S D+ D   VS LP+VG+GGLGKTTL KLVYND+RV ++F+ R+WV VSE
Sbjct  180   QEKIVTLLLSSADQRD---VSVLPVVGMGGLGKTTLAKLVYNDERVQEHFECRIWVCVSE  236

Query  777   DFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             DF + ++++ I+ S TG      + + +   +  ++   R+LLVLDDVWN+DQ KW  L+
Sbjct  237   DFDVKRLMKAIIESMTGNRCDLQETESIHRRVQELIRRLRFLLVLDDVWNDDQEKWDRLK  296

Query  957   ELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPR--  1130
               +  G  GS+++VTTRS KVA +TGT   Y+L GLSD DC+ LF   AF+    RP   
Sbjct  297   NSVRHGSVGSKILVTTRSEKVALVTGTFAPYHLEGLSDEDCWLLFEHRAFKSG--RPEES  354

Query  1131  -NLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILK  1307
              + + IGKEI +KC GVPLA K+LGS++Y +    EWL ++++EIW++ ++E  ILP+L+
Sbjct  355   SSFIAIGKEIAKKCRGVPLAAKSLGSLMYLRRKRSEWLFVKDSEIWRLVEEENGILPVLR  414

Query  1308  LSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNE  1487
             LSYD +P HL+QCFAYC +FPK   I ++  I LW+A+GFIQ P G    E +GN+YFNE
Sbjct  415   LSYDSLPSHLKQCFAYCSLFPKNCRINKDKLILLWIAEGFIQVPPGKSP-EEVGNEYFNE  473

Query  1488  LLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVK-SGDPEIPESVHHL-VF  1661
             LL    FQ+     D  I+ C++H+L+HDLA++VAG+ C+ V+ S    +P    +L VF
Sbjct  474   LLWSSFFQNATTDHDKNIMDCEMHHLLHDLAKAVAGSSCVTVEVSKRLSVPTGTRYLSVF  533

Query  1662  HADNLSREEFPQPLLNLKNLRYF---AYSFRVGTVSKTFVKKTLLNFRRLRVLMLQNLEL  1832
              ADN    + P+   N   LR F   +  ++   VS    +K +L+ + LR L + N  +
Sbjct  534   CADN----KIPRGSRNACKLRSFLLLSGHWKTAEVS----RKLILSLKSLRSLDISNTGI  585

Query  1833  KELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLM  2012
             K++  SIG +  LRYL+LS+   IK LP  +  L NLQ+L L +C +L++LP++  ++L+
Sbjct  586   KKISKSIGLMIHLRYLDLSSTL-IKRLPNTVCSLFNLQSLILKHCTRLEKLPKDM-RKLI  643

Query  2013  SLKTLYLT  2036
             +L+ L L+
Sbjct  644   NLRHLNLS  651



>ref|XP_010677314.1| PREDICTED: uncharacterized protein LOC104892985 [Beta vulgaris 
subsp. vulgaris]
Length=2382

 Score =   456 bits (1172),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 296/727 (41%), Positives = 414/727 (57%), Gaps = 55/727 (8%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA   L+ I E VL  + S A DEI+SAW  K  ++ L+NT++T+K VL DA+++QA +H
Sbjct  1     MAVAVLSSIAEEVLKNLGSSALDEIASAWGFKARIESLKNTINTLKDVLLDAEKRQADSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
              ++ WL +L  V+Y ADDL D+F T++  RKL   + ++ +V   F+  + + + F I+ 
Sbjct  61    AIRGWLTRLTSVIYAADDLFDEFTTVASRRKLLGGNKLIKEVHTFFSCSNQIAFAFTISK  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVG  614
             KI+ IR  L+ I +D   F F    Y       + R+ T+SFV   +IIGRD DK++I+ 
Sbjct  121   KIKTIRRELDDIVKDGTQFEFVHRSYEKGRVMHRRRDDTYSFVDAEEIIGRDDDKKAILD  180

Query  615   MLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSK  794
             ML+      + E +S +PIVG+GGLGKTTL +L+YND ++ + F+ RLWV VS+ F +  
Sbjct  181   MLLVQSTSIEHEVLSVIPIVGMGGLGKTTLAQLIYNDSQIEEYFELRLWVCVSDVFDIKG  240

Query  795   VIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMSG  974
             + EKIL SAT      L+M+QLQ  L   +   +YLLVLDDVWNE + +W  LR LL  G
Sbjct  241   ITEKILMSATNTEPPKLEMEQLQGRLQNEISDKKYLLVLDDVWNEKREEWLKLRALLKIG  300

Query  975   CDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGK  1151
               GS+V+VTTRS +VA I G+   Y L GLS+   +DLF K A+   Q  R  +L+E+GK
Sbjct  301   RMGSKVLVTTRSREVAKIMGSVPLYELQGLSEEKSWDLFQKMAYEPGQAQRKSHLMEVGK  360

Query  1152  EIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMPY  1331
             +IV+KC  VPLA++TLGS+LY K DE +WL + +  +  I   + D + ILKLSY  +  
Sbjct  361   DIVKKCANVPLAIRTLGSLLYGK-DESKWLSLNDTSLANIPADQNDTMSILKLSYFHLWS  419

Query  1332  HLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPD-GDQELENLGNQYFNELLSRFCF  1508
              L+ CFAYC +FPK  E  ++  I+LW+A+GFI   D  ++ LE LG +YF+ LL R  F
Sbjct  420   PLKNCFAYCALFPKDYEFDKDTLIDLWMAEGFIAPTDFENRALEELGEEYFHILLQRCFF  479

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             QD+     G I  CK+H+L+HDLAQ VAG  C   K  D      +HH+ F      + +
Sbjct  480   QDIQRDEWGFITRCKMHDLMHDLAQEVAGFNCKVAKLEDINFDNKIHHVSFDYCLNFQWK  539

Query  1689  FPQPLLNLKNLRYFAYSFRV---GTVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGF  1859
              P  +LNLK LR F    ++      SK+   + + NFR LRVL + NL +K LP+S+G 
Sbjct  540   IPNSMLNLKLLRTFLLPAQMKDGSPFSKSICLQLISNFRGLRVLDIHNLGIKSLPNSVGQ  599

Query  1860  LKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS  2039
             L  LRYL+LS    IK LP  I++L NLQTL L  C +L+ LP N               
Sbjct  600   LIHLRYLDLSTT-PIKKLPGSITELHNLQTLKLYGCLRLRRLPTNI--------------  644

Query  2040  QEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
                                               + +  LR L I EC  LT +P GI  
Sbjct  645   ----------------------------------RALANLRSLDIGECHYLTHMPPGIGE  670

Query  2220  LAKLEKL  2240
             L  L KL
Sbjct  671   LTSLHKL  677


 Score =   450 bits (1158),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 298/741 (40%), Positives = 432/741 (58%), Gaps = 46/741 (6%)
 Frame = +3

Query  66    RASMAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQA  245
             + +MAE  L  +   VL K+ S+  D+ +SAW  K EL+KL+N++ +IK  L DA+E+QA
Sbjct  1185  KETMAEAILYGVAVEVLKKMGSMTLDKTASAWGFKGELEKLKNSICSIKDFLMDAEEKQA  1244

Query  246   KNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFK  425
              +H V+ WL++L  VVY ADDL D   T++  ++L   + ++ +V+  F++ + + +   
Sbjct  1245  DSHAVRGWLERLATVVYAADDLFDQVATVASRKQLMGRNKLVNEVQTFFSQSNQIAFAIN  1304

Query  426   ITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENG----KLREQTHSFVRPSDIIGRDS  593
             I+ KI+ IR  L+ I  D   F F       PVE      K R+QT+S V   ++IGRD 
Sbjct  1305  ISRKIKIIRQGLDDIVNDSAQFAF----IARPVEEKGIVCKRRDQTYSIVDAEEVIGRDG  1360

Query  594   DKESIVGMLMKSCDEEDT-----ESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRL  758
             DK +I+ ML+ SC   D      E +  + IVG+GGLGKTTL +LVYND  V ++FD RL
Sbjct  1361  DKNAILDMLLTSCSTNDDHEHQREVLPVITIVGIGGLGKTTLAQLVYNDPLVEEHFDLRL  1420

Query  759   WVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSG---------------  893
             WV VS+ F +  + E IL+S T K   +L+++QLQ  L   + +G               
Sbjct  1421  WVCVSDVFDIKVITENILKSITLKETQNLEIEQLQGQLRKEVGAGNEIANKRSKMEQQDQ  1480

Query  894   --------RYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAY  1049
                     +YLLVLDDVWNE++ +W  LR LL  G  GS+++VTTRS+KVA I GT   Y
Sbjct  1481  LHKEVGDKKYLLVLDDVWNEEREEWLKLRTLLKVGRKGSKILVTTRSLKVAKIMGTVPPY  1540

Query  1050  NLSGLSDHDCFDLFLKCAFRE-QEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTD  1226
              L GLSD + ++LF K AF   Q  + ++LVE+G+EI++KC   PLA++TLG++LY + D
Sbjct  1541  ELQGLSDENSWELFQKMAFEPGQAQQQQHLVEVGREIIKKCVNCPLAIRTLGNLLYGE-D  1599

Query  1227  EQEWLHIRENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFIN  1406
             E +W  +R+  + KI + +  I+ ILKLSY  +   L+ CFAYC +FPKG E  +E  I+
Sbjct  1600  ENKWFSLRKRSLAKIPENKNGIIKILKLSYHHLQSPLKNCFAYCALFPKGYEFDKETLID  1659

Query  1407  LWVAQGFIQSP--DGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLA  1580
             LW+A+GFI     DG + LE +  +YF  LL R  FQD+     G + +CK+H+L+HDLA
Sbjct  1660  LWIAEGFITPSDIDGSENLEEIAEEYFLTLLRRCFFQDIKRDEWGAMKSCKMHDLMHDLA  1719

Query  1581  QSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREEFPQPLLNLKNLRYFAYSFRVG---  1751
             Q VAG +C   K    E+   ++HL        R   P    NL+ LR F    ++    
Sbjct  1720  QQVAGVKCKVTKLDGGELNGKIYHLSVDYSLDQRWMIPSCTPNLELLRTFLLPEQIKDGL  1779

Query  1752  TVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISK  1931
             T+SK+  ++ +L F  LRVL L NL L  LP+SIG L  LRYLNLS  C I+ LP+ I+K
Sbjct  1780  TLSKSICQQLILRFGCLRVLDLHNLGLYSLPNSIGRLIHLRYLNLSKTC-IEELPKTITK  1838

Query  1932  LVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS-QEVSLQKRSSVSLGFLQFLLLYK  2108
             L NLQTL L  C  L+ LP+N  +QL+ L+ L L    E+         L  L+ L L+ 
Sbjct  1839  LHNLQTLKLHRCLSLRRLPKNI-RQLVKLRNLDLGKCDELDYMPSGIEELTSLEKLPLFI  1897

Query  2109  CSCRKFPAEIWQHMKKLRVLR  2171
              +C+      ++ ++ L  LR
Sbjct  1898  VNCKHLGTARFKDLRNLEKLR  1918


 Score = 73.9 bits (180),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 85/149 (57%), Gaps = 8/149 (5%)
 Frame = +3

Query  2157  LRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgeg----megleslqslllm  2324
             LR L+   C SL  +  G+ HL  LE+L +W+CE+LD  + +          SL+SL L 
Sbjct  1007  LRCLQFTHCKSLRNISKGLEHLTALEELVLWDCEQLDFPLEDDNMPWKAFNSSLRSLRLH  1066

Query  2325  glPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPE  2504
              + KLVSLP GL+ + +  L+ L+V G  EL  LPDW+ +   L+ + ++   +L+ LPE
Sbjct  1067  VISKLVSLPNGLQYLTS--LRSLKVTGNYELAELPDWISSLQSLKYMELDSSDKLTSLPE  1124

Query  2505  QIRS-SSNAKVRIIDCPLLNG*C-GDTGT  2585
               R  ++  ++RI +CP L   C G +GT
Sbjct  1125  GFRELTTLNQLRIEECPELTKRCRGPSGT  1153


 Score = 61.6 bits (148),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 80/156 (51%), Gaps = 11/156 (7%)
 Frame = +3

Query  2130  AEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELDLSVgeg--------  2285
              EI   +  LR L    C SL C+  G+ HL  LE+L    CE+LDLS+ E         
Sbjct  2204  GEICTSLISLRYLEFSFCDSLRCISKGLEHLTSLEELVFRQCEKLDLSLHEEQEDEDMPW  2263

Query  2286  megleslqslllmglPKLVSLPAGLKDIDAMKLKYLRVAGCPELTALPDWLQNCTLLQRL  2465
                  SL SL+   +PKL+ LP+GL+ +    L+ L+++   EL  +P+W+   + L  +
Sbjct  2264  KTFETSLHSLVFHKMPKLLRLPSGLQHL--TNLRSLQISDNDELMEVPEWISCFSSLSYM  2321

Query  2466  YIEDCPELSYLPEQI-RSSSNAKVRIIDCPLLNG*C  2570
              +  CP+++ LP    + ++  +++I+ C  L   C
Sbjct  2322  ELYKCPKITSLPNSFSKLTALNELQIVGCDGLTESC  2357



>gb|KCW64144.1| hypothetical protein EUGRSUZ_G01790 [Eucalyptus grandis]
Length=995

 Score =   437 bits (1125),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 265/659 (40%), Positives = 405/659 (61%), Gaps = 11/659 (2%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MA+ F+  I   +++ +VS A + +   W +K EL+ L++T+STI+AVL  A+EQ  ++H
Sbjct  1     MADAFIVGIAGKIVANLVSQALENVGKLWGVKHELEVLRDTVSTIQAVLEHAEEQYYQSH  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITH  434
             +++ WL+KL+D  YDA D++++F   +L R LR  + I   VR  F+  + L ++ ++++
Sbjct  61    QIQVWLEKLKDAFYDAQDVVEEFKIEALRRDLRGHNEISKGVRTFFSSSNQLAFKLRMSY  120

Query  435   KIREIRGRLNQIAEDRRNFHFKENYYVNPVENG-KLREQTHSFVRPSDIIGRDSDKESIV  611
             K+R +R ++  I +DR+ FH  E     PV+   + RE+THSF+R  DI GRD DK++++
Sbjct  121   KVRTVREKIEAIKDDRK-FHLDERPVDLPVKRKLRKREETHSFIREGDITGRDDDKKNVM  179

Query  612   GMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLS  791
               L+   D +  E VS LPIVG+GGLGKT L + VYND+ V + F+ ++WV VS DF + 
Sbjct  180   KFLL---DSDMKEHVSILPIVGIGGLGKTALAQCVYNDEMVSKQFNLKMWVCVSNDFDMK  236

Query  792   KVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLRELLMS  971
             +V++ I+  A  K      M++LQ  L   +   RYLLVLDD+WN ++  W +L+ LLM 
Sbjct  237   RVVKNIITCAKKKKPTEDAMERLQSELRAAIDGKRYLLVLDDLWNAERETWLSLKNLLMG  296

Query  972   GCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFR-EQEYRPRNLVEIG  1148
             G  GS+++VTTR   VA IT T   + L GLS+    DL +K AFR E+E +  +++ IG
Sbjct  297   GARGSKILVTTRLPLVAEITHTIPPHVLKGLSESASIDLLMKMAFRKEEEIQDPDMLTIG  356

Query  1149  KEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSYDQMP  1328
             KE+V+KC GVPL V+ +GS+L+ K  + EWLH +++E+  + Q E +I  +L+LSYD++P
Sbjct  357   KEMVRKCSGVPLVVRAVGSLLFFKKTKPEWLHFKDHELPDVSQSEDNIKSVLRLSYDRLP  416

Query  1329  YHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQSPDGDQELENLGNQYFNELLSRFCF  1508
              HL+QCF  C +FPK  EI ++  +NLWVA+GFIQ  +    LE++ + YF ELL    F
Sbjct  417   SHLKQCFTLCSLFPKDYEIKKQTLVNLWVAEGFIQPSNKTPHLEDIAHGYFMELLRSNFF  476

Query  1509  QDVVEAFDGEILACKIHNLVHDLAQSVAGAECLNVKSGDPEIPESVHHLVFHADNLSREE  1688
             Q   +        CK+H+L+HDLA  VA  E    +     I ES  HL + +       
Sbjct  477   QYFQKHPFTREETCKMHDLMHDLACLVARTEYGVAQDDTKTINESTRHLSYGSIFNLMGG  536

Query  1689  FPQPLLNLKNLR-YFAYSFRVG---TVSKTFVKKTLLNFRRLRVLMLQNLELKELPSSIG  1856
              P   L  + +R   +  + VG     S+  +++ + NF+ LR+L L    +K++P SI 
Sbjct  537   LPISCLKARTVRTILSTCWGVGQQEPTSEADLRQLIQNFKSLRILDLHATNVKKMPRSIC  596

Query  1857  FLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYL  2033
              LK L YL+LS N  +K LP  I++L NLQTLNL  C  L+ELPR   ++L+SL+ L L
Sbjct  597   KLKYLTYLDLSYNDALKRLPNSITRLQNLQTLNLSGCISLEELPRGV-KKLVSLRNLDL  654



>ref|XP_007018346.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
 gb|EOY15571.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
Length=1179

 Score =   442 bits (1136),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 288/671 (43%), Positives = 414/671 (62%), Gaps = 44/671 (7%)
 Frame = +3

Query  75    MAETFLADITENVLSKIVSLAQDEISSAWNLKPELKKLQNTLSTIKAVLRDADEQQAKNH  254
             MAE  L  + + V  K+ S    EI+     K E+KKLQ  L  ++AVL+DA+E+QA + 
Sbjct  1     MAEIVLCPLLQVVFEKLASRFLKEIAGRCGFKDEIKKLQRALRAMQAVLQDAEERQATDK  60

Query  255   EVKDWLQKLRdvvydaddllddFGTLSLLRK-----LRSCSGILTKVRKLFTRPDGLIYR  419
              +K WL +L++V +DADDLL++FG  ++L++         S I+  +R   T     + R
Sbjct  61    NLKLWLSELKEVAFDADDLLEEFGPEAMLQENDNSLTEQVSNIVPSLRPFMT----YLTR  116

Query  420   FKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENGKLREQTHSFVRPSDIIGRDSDK  599
             F    ++++IR RL+ + E+R NF  K+      ++N + RE T SFV  S++IGR+ DK
Sbjct  117   FP---ELKQIRERLDVLLEERSNFKLKKRDADEKIKNLQKRE-TGSFVIESEVIGREEDK  172

Query  600   ESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSED  779
             E IV ML+ + +    E VS +P+VGLGGLGKTTL +LVYND+RV++NF+ R+WV V++D
Sbjct  173   EKIVEMLLLTTERRANEVVSIIPLVGLGGLGKTTLAQLVYNDERVMRNFELRMWVCVNDD  232

Query  780   FSLSKVIEKILRSATGKSFGHL-DMDQLQEHLNGVLCSGRYLLVLDDVWNEDQHKWKNLR  956
             F + K++  ++ SAT +    L  MD LQ  L  +L   RYLLVLDDVWNED  +W+ L+
Sbjct  233   FDVRKILNLMIESATRRRCDDLVGMDVLQSQLRDLLVRRRYLLVLDDVWNEDVDEWEKLK  292

Query  957   ELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDHDCFDLFLKCAFREQEYRPRNL  1136
              LL  G +GS+VIVTTRS KVATI GT ++++L GLS  DC+ LF + AF   +    +L
Sbjct  293   ILLKFGAEGSKVIVTTRSAKVATIMGTVSSHHLKGLSHEDCWALFKQRAFAHDQEDYPDL  352

Query  1137  VEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHIRENEIWKIEQKETDILPILKLSY  1316
             + IGK+IV+KCGGVPLA KTLGS++  K + +EWL ++ENE+  + ++ET ILP LKLSY
Sbjct  353   LPIGKQIVKKCGGVPLAAKTLGSLMRFKREPEEWLSVQENELRNVCEEETGILPALKLSY  412

Query  1317  DQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGFIQS----------PDGDQELENL  1466
               +P HL+ CF YC +FPK   I +E  I+LW+A+G I+S           +  + LEN+
Sbjct  413   SHLPSHLKVCFMYCSIFPKNYVIKKEKLIHLWIAEGLIESCEYPMRAATTREERKSLENV  472

Query  1467  GNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAE-------CLNVKSGD  1625
             G+ YFN+L+    F++V +  DG+++ CK+H+LVHDLA+SVAG E       CL      
Sbjct  473   GSNYFNDLMWTLFFEEVKKNSDGDVIECKMHDLVHDLAKSVAGEEFFIFERDCL------  526

Query  1626  PEIPESVHHL--VFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSKTFVKKTLLNFRR  1799
             P+    V ++  V H+++ +    P+ L   K LR   + F  G  S         +FR 
Sbjct  527   PKNLSRVRYMSVVCHSESCT---IPEALYEAKKLRTLIFLFPKGG-SGEVPADLFSHFRN  582

Query  1800  LRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLK  1979
             LRVL L    +K L S++  LK LRYL LSN   + +LPE IS L NLQ LNL  C +L 
Sbjct  583   LRVLDLGYSGIKRLQSTVSCLKHLRYLGLSNTF-VATLPETISSLYNLQVLNLSGCAELT  641

Query  1980  ELPRNFGQQLM  2012
              LPR+  +  M
Sbjct  642   RLPRDLARMCM  652


 Score = 93.6 bits (231),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 116/238 (49%), Gaps = 32/238 (13%)
 Frame = +3

Query  1866  QLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQLKELPRNFGQQLMSLKTLYLTS-Q  2042
              L  L +S+   +  +P  +  LV+L++L +  CE+L  LP+   Q L  L++L ++   
Sbjct  936   HLMSLTISSCPKLHRIPPSLGNLVSLKSLTIRWCEELLSLPQQL-QNLTCLQSLEISECH  994

Query  2043  EVSLQKRSSVSLGFLQFLLLYKCS-CRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRH  2219
              +S   +S   L  L++L +  CS  R  P E+ QH+  L  L I  C  L  LP+   +
Sbjct  995   SLSTLPQSIDRLISLKYLSIENCSNLRSLPIEL-QHLGSLEHLTIMYCPRLASLPSDWHN  1053

Query  2220  LAKLEKLWIWNCEELDLSVgegmegleslqslllmglPKLVSLPAGLKDIDAMKLKYLRV  2399
             L+ L  L + +C                         P+L SLP  +K + A  L+ L +
Sbjct  1054  LSMLRSLCLLSC-------------------------PELSSLPESIKHVTA--LQNLEI  1086

Query  2400  AGCPELTALPDWLQNCTLLQRLYIEDCPELSYLPEQIRS-SSNAKVRIIDCPLLNG*C  2570
              GCP L  LP+W+ N +LL+ L I DCP L+ LPE +   S+  ++ I +CP L   C
Sbjct  1087  HGCPGLNVLPEWVANLSLLRSLAISDCPNLTSLPEGLECLSTLQRLSIQECPRLEQHC  1144


 Score = 67.8 bits (164),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 80/157 (51%), Gaps = 6/157 (4%)
 Frame = +3

Query  1815  LQNLELKE------LPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNLQTLNLINCEQL  1976
             LQ+LE+ E      LP SI  L  L+YL++ N  N++SLP  +  L +L+ L ++ C +L
Sbjct  985   LQSLEISECHSLSTLPQSIDRLISLKYLSIENCSNLRSLPIELQHLGSLEHLTIMYCPRL  1044

Query  1977  KELPRNFGQQLMSLKTLYLTSQEVSLQKRSSVSLGFLQFLLLYKCSCRKFPAEIWQHMKK  2156
               LP ++    M      L+  E+S    S   +  LQ L ++ C       E   ++  
Sbjct  1045  ASLPSDWHNLSMLRSLCLLSCPELSSLPESIKHVTALQNLEIHGCPGLNVLPEWVANLSL  1104

Query  2157  LRVLRIYECSSLTCLPAGIRHLAKLEKLWIWNCEELD  2267
             LR L I +C +LT LP G+  L+ L++L I  C  L+
Sbjct  1105  LRSLAISDCPNLTSLPEGLECLSTLQRLSIQECPRLE  1141



>ref|XP_008775988.1| PREDICTED: putative disease resistance protein RGA3 [Phoenix 
dactylifera]
Length=1107

 Score =   440 bits (1131),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 291/723 (40%), Positives = 417/723 (58%), Gaps = 43/723 (6%)
 Frame = +3

Query  174   ELKKLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRdvvydaddllddFGTLSLLRKLR  353
             EL+KL++TLSTI  VL DA+ +Q K   ++ WL+KL+DV YD DD+LD+    +  R+  
Sbjct  6     ELRKLESTLSTIHDVLEDAEARQVKEKALRGWLRKLKDVAYDVDDVLDEAAAKAAKRRSE  65

Query  354   SCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQIAEDRRNFHFKENYYVNPVENG  533
             +   +  KVR+L + P+  +++ KI  KI++IR RL +IA +R  FH +E    N     
Sbjct  66    NKGHMTEKVRQLSSIPNSFLFQSKIARKIKKIRERLEEIAGERTKFHLQERVAENIRTET  125

Query  534   KLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEEDTESVSFLPIvglgglgkttlvkl  713
              +RE+T S +  S + GR+ DKE I   L+   DE D   +  + IVGLGGLGKTT+ +L
Sbjct  126   AVREETGSLIDESQVYGREEDKEKITDFLIDMSDESD---LGVIAIVGLGGLGKTTVAQL  182

Query  714   vYNDDRVVQNFDTRLWVSVSEDFSLSKVIEKILRSATGKSFGHLDMDQLQEHLNGVLCSG  893
             VYND RV ++F+  +WV VS+DF + ++   I+ + +G  F   +MD +Q  L  ++   
Sbjct  183   VYNDQRVRKHFEKMMWVYVSDDFDIKRLTRSIIETVSGSEFSLTEMDLMQHELRNLIEDK  242

Query  894   RYLLVLDDVWNEDQHKWKNLRELLMSGCDGSRVIVTTRSIKVATITGTTTAYNLSGLSDH  1073
             R+LLVLDDVW+E+  KW  LR +L+    GS+V+VTTRS +VA+I GT   + LSGLS+ 
Sbjct  243   RFLLVLDDVWSENYEKWDRLRTMLIGSARGSKVVVTTRSERVASIMGTVAPHFLSGLSED  302

Query  1074  DCFDLFLKCAFR--EQEYRPRNLVEIGKEIVQKCGGVPLAVKTLGSMLYCKTDEQEWLHI  1247
             DC+ LF K AF     E  P NLV IGKEIV+KCGGVPLA K LGS++  +  E +WL I
Sbjct  303   DCWLLFEKRAFGLGGSEKTP-NLVAIGKEIVKKCGGVPLAAKALGSLMRFRRGESQWLAI  361

Query  1248  RENEIWKIEQKETDILPILKLSYDQMPYHLRQCFAYCCMFPKGEEIPREVFINLWVAQGF  1427
             +E+EIW +   E +ILP L LSY+ +P HL+QCFAYC +FP+GEEI     + LW+A+GF
Sbjct  362   KESEIWNLPNDENEILPALMLSYNHLPSHLKQCFAYCSIFPRGEEIRSRELVQLWIAEGF  421

Query  1428  IQSPDGDQELENLGNQYFNELLSRFCFQDVVEAFDGEILACKIHNLVHDLAQSVAGAECL  1607
             +QS +G   LE++G Q  +ELLSR  FQ   +  DG +   K+H+L+HDLA+SVAG EC 
Sbjct  422   VQSSNGSTYLEDVGLQCVDELLSRSLFQCGQKDTDGVVRQVKMHDLLHDLARSVAGDECS  481

Query  1608  NVKSGDPE-IPESVHH--LVFHADNLSREEFPQPLLNLKNLRYFAYSFRVGTVSK-----  1763
                +G+   I +S  +  LV      S  E   PL + + LR   +    G   +     
Sbjct  482   VADAGNKSVISQSCRYSSLVCRGPINSAWE---PLKDAERLRTLYFVASRGMTKEEDKED  538

Query  1764  TFVKKTLLNFRRLRVLMLQNLELKELPSSIGFLKQLRYLNLSNNCNIKSLPECISKLVNL  1943
               ++      + LR L L    +K +P S+  L+ LRYLNLS   +I++LP CI  L NL
Sbjct  539   DVLQAIFSKMKLLRALHLSQCPMKAMPVSVTKLEHLRYLNLSQT-DIETLPPCIGALQNL  597

Query  1944  QTLNLINCEQLKELPRNFGQ-------QLMSLKTLYLTSQEVS-LQKRSSVSLGFLQFLL  2099
             Q L+L  C+QL+ LP   G         L+  K L    + V  ++   ++ L F Q   
Sbjct  598   QILDLSCCKQLRALPETVGDLQNLQILDLLGCKQLRALPETVGYVRNLQNLDLSFSQIRT  657

Query  2100  L----------------YKCSCRKFPAEIWQHMKKLRVLRIYECSSLTCLPAGIRHLAKL  2231
             L                Y     + P  + ++M+ L  L IY C  L C+P GI  L++L
Sbjct  658   LPESLSSLLNLQSLSLRYCYFLHRLPGNM-KNMRSLIHLDIYHCFELVCMPPGIGQLSQL  716

Query  2232  EKL  2240
               L
Sbjct  717   RTL  719



>ref|XP_004511173.1| PREDICTED: putative disease resistance protein RGA3-like [Cicer 
arietinum]
Length=847

 Score =   432 bits (1112),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 316/836 (38%), Positives = 478/836 (57%), Gaps = 46/836 (6%)
 Frame = +3

Query  120   KIVSLAQDEISSAWNLKPELK----KLQNTLSTIKAVLRDADEQQAKNHEVKDWLQKLRd  287
             KIV      +++ +NL    K    KL+N +S I AVL DA+++Q  NH V+DWL KLRD
Sbjct  15    KIVEELSTVLTNKYNLYSSFKHDFIKLKNDMSAISAVLLDAEKKQENNHLVEDWLMKLRD  74

Query  288   vvydaddllddFGTLSLLRKLRSCSGILTKVRKLFTRPDGLIYRFKITHKIREIRGRLNQ  467
              ++DA+DLLDD     L +K+ +   I+T VR      D       +  +I++I  R+N+
Sbjct  75    ALHDAEDLLDDINVEFLRQKVEAELKIVTWVRNFCILSD-------MDDRIKKIIVRINE  127

Query  468   IAEDRRNFHFKE--NYYVNPVENGKLREQTHSFVRPSDIIGRDSDKESIVGMLMKSCDEE  641
             +A    + H +E   Y VN     ++           +++GR+ D++ ++  L+     E
Sbjct  128   VANMISSLHLRELDQYQVNASNRQRVMNSISYMRCCREVVGREEDEKKVIERLL-----E  182

Query  642   DTESVSFLPIvglgglgkttlvklvYNDDRVVQNFDTRLWVSVSEDFSLSKVIEK-ILRS  818
              ++S   +PIVG+GGLGKT LV L+++DDR+   FD R+WV VS+D+S+ ++ EK ++R 
Sbjct  183   KSDSFVVVPIVGIGGLGKTALVNLIFDDDRIKDGFDLRIWVDVSDDWSIERIWEKKVVRG  242

Quer