BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24895_g3_i2 len=1177 path=[13034:0-266 14394:267-334 13370:335-367
13402:368-383 11527:384-544 10942:545-598 10996:599-847
13865:848-872 13890:873-1027 10738:1028-1054 14070:1055-1176]

Length=1177
                                                                      Score     E

gb|AHL69786.1|  dehydration-responsive element-binding protein          196   3e-56   
gb|EYU38994.1|  hypothetical protein MIMGU_mgv1a025975mg                182   2e-51   
gb|ADZ95598.1|  C-repeat binding facor                                  182   2e-51   
emb|CDP09813.1|  unnamed protein product                                183   4e-51   
ref|XP_011073844.1|  PREDICTED: dehydration-responsive element-bi...    181   5e-51   
ref|XP_011081035.1|  PREDICTED: dehydration-responsive element-bi...    180   1e-50   
ref|NP_001274894.1|  AP2 domain CBF protein                             178   9e-50   
gb|ABH08746.1|  CBF/DREB-like transcription factor 1                    179   1e-49   Citrus trifoliata [hardy orange]
gb|ACB45092.1|  CRT binding factor 3                                    177   2e-49   Solanum commersonii
gb|ACB45095.1|  CRT binding factor 3                                    176   4e-49   Solanum tuberosum [potatoes]
ref|XP_006477388.1|  PREDICTED: dehydration-responsive element-bi...    176   1e-48   
gb|ACI42860.1|  dehydration-responsive element-binding protein 1B       174   5e-48   Rosa hybrid cultivar
ref|XP_002509703.1|  Dehydration-responsive element-binding prote...    174   6e-48   Ricinus communis
gb|EYU29844.1|  hypothetical protein MIMGU_mgv1a014021mg                173   6e-48   
gb|ACB45086.1|  CRT binding factor 3                                    172   8e-48   Solanum habrochaites
ref|XP_006358388.1|  PREDICTED: dehydration-responsive element-bi...    174   8e-48   
ref|XP_009764159.1|  PREDICTED: dehydration-responsive element-bi...    174   9e-48   
gb|ACB45078.1|  CRT binding factor 3                                    172   9e-48   Solanum habrochaites
ref|XP_009784267.1|  PREDICTED: dehydration-responsive element-bi...    171   5e-47   
ref|XP_006440529.1|  hypothetical protein CICLE_v10021923mg             171   6e-47   
ref|XP_009619193.1|  PREDICTED: dehydration-responsive element-bi...    172   6e-47   
gb|ACU00265.1|  dehydration-responsive element-binding factor 1         169   2e-46   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFQ59977.1|  CRT/DRE binding factor 1                                170   2e-46   
ref|XP_010278524.1|  PREDICTED: dehydration-responsive element-bi...    170   2e-46   
ref|XP_002276153.1|  PREDICTED: dehydration-responsive element-bi...    170   2e-46   Vitis vinifera
ref|XP_004298771.1|  PREDICTED: dehydration-responsive element-bi...    171   2e-46   
gb|ACU00263.1|  dehydration-responsive element-binding factor 1         168   3e-46   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADE62311.1|  dehydration-responsive element-binding protein 1A       169   4e-46   
gb|ACU00264.1|  dehydration-responsive element-binding factor 1         168   5e-46   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KDO63570.1|  hypothetical protein CISIN_1g026103mg                   169   6e-46   
gb|ABN58746.1|  C-repeat binding factor                                 168   6e-46   Ageratina adenophora
gb|ABI95805.1|  C-repeat binding factor                                 168   6e-46   Ageratina adenophora
ref|XP_007040121.1|  AP2/ERF domain-containing transcription fact...    169   6e-46   
ref|XP_009611618.1|  PREDICTED: dehydration-responsive element-bi...    168   7e-46   
gb|KDP25514.1|  hypothetical protein JCGZ_20670                         168   8e-46   
ref|XP_007218312.1|  hypothetical protein PRUPE_ppa010935mg             168   1e-45   
gb|AAS77819.1|  CBF3                                                    167   1e-45   Solanum lycopersicum
gb|ABP64695.1|  putative C-repeat binding protein 4                     167   1e-45   Populus trichocarpa [western balsam poplar]
gb|AIQ82502.1|  CBF4                                                    168   2e-45   
gb|AIQ82473.1|  CBF4                                                    167   2e-45   
ref|XP_009611054.1|  PREDICTED: dehydration-responsive element-bi...    167   2e-45   
ref|XP_002299565.1|  hypothetical protein POPTR_0001s08710g             166   2e-45   Populus trichocarpa [western balsam poplar]
gb|AEK94313.1|  C-repeat binding factor 4                               166   2e-45   
ref|XP_011030036.1|  PREDICTED: dehydration-responsive element-bi...    167   3e-45   
gb|KDP25515.1|  hypothetical protein JCGZ_20671                         166   4e-45   
ref|XP_011101172.1|  PREDICTED: dehydration-responsive element-bi...    166   4e-45   
gb|EYU19514.1|  hypothetical protein MIMGU_mgv1a026630mg                166   4e-45   
gb|AIQ82504.1|  CBF4                                                    166   5e-45   
gb|ACE73696.1|  DREB4                                                   166   5e-45   Nicotiana tabacum [American tobacco]
ref|XP_002318846.1|  hypothetical protein POPTR_0012s13870g             167   6e-45   Populus trichocarpa [western balsam poplar]
gb|ABK95675.1|  unknown                                                 167   6e-45   Populus trichocarpa [western balsam poplar]
gb|AGY31292.1|  C-repeat binding factor 4c                              166   7e-45   
gb|AHN65494.1|  dehydration-responsive element binding protein          166   7e-45   
gb|EYU19512.1|  hypothetical protein MIMGU_mgv1a025309mg                166   8e-45   
gb|ABD90468.1|  dehydration-responsive element-binding protein 1A       165   8e-45   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011029176.1|  PREDICTED: dehydration-responsive element-bi...    166   8e-45   
gb|KDP22330.1|  hypothetical protein JCGZ_26161                         165   1e-44   
gb|AHN65439.1|  dehydration-responsive element binding protein          166   1e-44   
gb|AHN65457.1|  dehydration-responsive element binding protein          166   1e-44   
gb|AHN65438.1|  dehydration-responsive element binding protein          166   1e-44   
ref|XP_010317563.1|  PREDICTED: CBF1 protein isoform X1                 164   1e-44   
gb|AHN13908.1|  dehydration-responsive element binding factor           166   1e-44   
gb|AIQ82483.1|  CBF4                                                    165   1e-44   
gb|AIQ82507.1|  CBF4                                                    165   1e-44   
ref|XP_010255545.1|  PREDICTED: dehydration-responsive element-bi...    165   1e-44   
gb|AGY31291.1|  C-repeat binding factor 4b                              166   2e-44   
gb|AIQ82505.1|  CBF4                                                    165   2e-44   
gb|AHN65441.1|  dehydration-responsive element binding protein          166   2e-44   
ref|XP_006358387.1|  PREDICTED: dehydration-responsive element-bi...    165   2e-44   
gb|AHN65456.1|  dehydration-responsive element binding protein          165   2e-44   
gb|AIQ82376.1|  CBF3                                                    163   3e-44   
gb|ACB45080.1|  CRT binding factor 2                                    164   3e-44   Solanum habrochaites
gb|ACB45088.1|  CRT binding factor 2                                    164   3e-44   Solanum habrochaites
gb|AIQ82369.1|  CBF3                                                    162   4e-44   
gb|ACB45082.1|  CRT binding factor 5                                    162   5e-44   Solanum tuberosum [potatoes]
gb|AGH33879.1|  DREB68                                                  164   5e-44   
gb|AIQ82506.1|  CBF4                                                    163   6e-44   
emb|CBJ94884.1|  CBF2 protein                                           162   6e-44   Populus balsamifera [balsam poplar]
ref|XP_010324621.1|  PREDICTED: dehydration-responsive element-bi...    163   7e-44   
gb|ABC79626.1|  CBF1                                                    163   8e-44   Populus tomentosa [Chinese white poplar]
gb|AIU92956.1|  C-repeat/dehydration-responsive element-binding f...    164   9e-44   
ref|XP_010106004.1|  Dehydration-responsive element-binding prote...    163   1e-43   
ref|XP_002509702.1|  Dehydration-responsive element-binding prote...    162   1e-43   Ricinus communis
gb|AIU92962.1|  C-repeat/dehydration-responsive element-binding f...    163   1e-43   
emb|CBJ94893.1|  CBF2 protein                                           162   1e-43   Populus trichocarpa [western balsam poplar]
gb|AIQ82398.1|  CBF3                                                    161   1e-43   
gb|AIQ82400.1|  CBF3                                                    161   1e-43   
gb|AIU92952.1|  C-repeat/dehydration-responsive element-binding f...    163   1e-43   
gb|AIQ82399.1|  CBF3                                                    161   1e-43   
ref|XP_002298067.2|  dehydration responsive element binding prote...    162   1e-43   Populus trichocarpa [western balsam poplar]
gb|AIU92955.1|  C-repeat/dehydration-responsive element-binding f...    163   1e-43   
gb|ABP98987.1|  CBF/DREB1 transcription factor 1                        161   2e-43   Betula pendula [white birch]
gb|AIU92950.1|  C-repeat/dehydration-responsive element-binding f...    163   2e-43   
gb|ADU03763.1|  C-repeat binding factor transcriptional activator       160   2e-43   
gb|AIU92949.1|  C-repeat/dehydration-responsive element-binding f...    163   2e-43   
gb|ABO48365.1|  C-repeat binding facor 3                                162   2e-43   Populus trichocarpa [western balsam poplar]
gb|AIU92965.1|  C-repeat/dehydration-responsive element-binding f...    162   2e-43   
gb|AIU92946.1|  C-repeat/dehydration-responsive element-binding f...    162   2e-43   
emb|CBI34750.3|  unnamed protein product                                161   2e-43   
gb|AAY43213.1|  CRT/DRE binding factor 1                                162   2e-43   Hevea brasiliensis [jebe]
gb|AIU92957.1|  C-repeat/dehydration-responsive element-binding f...    162   2e-43   
gb|AIU92964.1|  C-repeat/dehydration-responsive element-binding f...    162   2e-43   
ref|XP_009759409.1|  PREDICTED: dehydration-responsive element-bi...    160   3e-43   
gb|ABP98988.1|  CBF/DREB1 transcription factor 2                        160   3e-43   Betula pendula [white birch]
ref|XP_008361312.1|  PREDICTED: dehydration-responsive element-bi...    160   3e-43   
gb|AIU92963.1|  C-repeat/dehydration-responsive element-binding f...    162   4e-43   
gb|AIU92947.1|  C-repeat/dehydration-responsive element-binding f...    162   4e-43   
gb|AIU92948.1|  C-repeat/dehydration-responsive element-binding f...    162   4e-43   
ref|XP_006358389.1|  PREDICTED: dehydration-responsive element-bi...    162   4e-43   
gb|ACB45098.1|  CRT binding factor 2B                                   161   4e-43   Solanum tuberosum [potatoes]
gb|EYU19513.1|  hypothetical protein MIMGU_mgv1a020585mg                160   5e-43   
gb|EYU19515.1|  hypothetical protein MIMGU_mgv1a026372mg                160   6e-43   
gb|AFV93473.1|  CBF transcription factor                                160   6e-43   
ref|XP_004308117.1|  PREDICTED: dehydration-responsive element-bi...    160   7e-43   
ref|XP_009609482.1|  PREDICTED: dehydration-responsive element-bi...    160   7e-43   
gb|AIU92958.1|  C-repeat/dehydration-responsive element-binding f...    161   7e-43   
gb|ACB45097.1|  CRT binding factor 2A                                   160   8e-43   Solanum tuberosum [potatoes]
ref|XP_009586780.1|  PREDICTED: dehydration-responsive element-bi...    160   8e-43   
gb|AGN53198.1|  CBF-like protein                                        160   1e-42   
gb|AEF79999.1|  DREB transcription factor                               160   1e-42   
gb|ADE41100.1|  AP2 domain class transcription factor                   160   1e-42   
ref|XP_008364557.1|  PREDICTED: dehydration-responsive element-bi...    160   1e-42   
gb|AHN65437.1|  dehydration-responsive element binding protein          160   1e-42   
gb|AFA50332.1|  dehydration-responsive element-binding protein 2        160   1e-42   
dbj|BAN51850.2|  putative C-repeat binding factor 2                     160   1e-42   
gb|AIU92953.1|  C-repeat/dehydration-responsive element-binding f...    160   1e-42   
ref|XP_008234474.1|  PREDICTED: dehydration-responsive element-bi...    161   1e-42   
gb|AFB83707.1|  CBF1                                                    159   2e-42   
gb|ABC79627.1|  CBF2                                                    159   2e-42   Populus tomentosa [Chinese white poplar]
ref|XP_008369501.1|  PREDICTED: dehydration-responsive element-bi...    159   2e-42   
ref|NP_001274919.1|  AP2 domain CBF protein                             159   2e-42   
gb|AGH33880.1|  DREB69                                                  159   2e-42   
ref|XP_009781787.1|  PREDICTED: dehydration-responsive element-bi...    159   2e-42   
gb|ABO48363.1|  C-repeat binding facor 1                                158   2e-42   Populus trichocarpa [western balsam poplar]
gb|AHN65392.1|  dehydration-responsive element binding protein          159   3e-42   
gb|AHN65433.1|  dehydration-responsive element binding protein          159   3e-42   
gb|AFA50331.1|  dehydration-responsive element-binding protein 1        158   3e-42   
gb|AAG43549.1|AF211531_1  Avr9/Cf-9 rapidly elicited protein 111B       158   3e-42   Nicotiana tabacum [American tobacco]
ref|XP_009339654.1|  PREDICTED: dehydration-responsive element-bi...    159   3e-42   
gb|AGR40677.1|  C-repeat binding factor 3                               159   3e-42   
gb|AHN13909.1|  dehydration-responsive element binding factor           159   3e-42   
gb|AHN65388.1|  dehydration-responsive element binding protein          159   3e-42   
gb|AHN65412.1|  dehydration-responsive element binding protein          159   4e-42   
gb|KEH26611.1|  dehydration-responsive element-binding protein, p...    158   4e-42   
gb|ABB72792.1|  dehydration responsive element binding protein          158   4e-42   Medicago truncatula
gb|AGR40678.1|  C-repeat binding factor 3                               158   4e-42   
gb|AEM97873.1|  AP2 domain class transcription factor                   158   4e-42   
gb|AHZ90672.1|  CBF/DREB1 transcription factor 1                        158   5e-42   
gb|ABF29699.1|  AP2 domain CBF protein                                  158   5e-42   Populus suaveolens [Mongolian poplar]
gb|AHN65417.1|  dehydration-responsive element binding protein          158   5e-42   
ref|XP_009118070.1|  PREDICTED: dehydration-responsive element-bi...    157   5e-42   
ref|XP_009791610.1|  PREDICTED: dehydration-responsive element-bi...    158   6e-42   
emb|CDY16016.1|  BnaC08g41070D                                          157   6e-42   
gb|ABY78835.1|  putative DRE-binding protein DREB1                      157   6e-42   Medicago sativa [alfalfa]
ref|XP_009593083.1|  PREDICTED: dehydration-responsive element-bi...    158   6e-42   
gb|AHH86060.1|  CRT/DRE-binding factor 2                                158   7e-42   
gb|ABX80063.1|  CRT/DRE binding factor 2                                158   7e-42   Medicago truncatula
gb|AHN65418.1|  dehydration-responsive element binding factor pro...    157   8e-42   
gb|ACY38600.1|  DREB-like protein 1                                     157   8e-42   Medicago sativa subsp. x varia
gb|AHN65435.1|  dehydration-responsive element binding protein          157   8e-42   
gb|ACB45091.1|  CBF1-2 fusion protein                                   157   8e-42   Solanum pimpinellifolium [currant tomato]
gb|AGH33881.1|  DREB70                                                  158   8e-42   
ref|XP_011076240.1|  PREDICTED: dehydration-responsive element-bi...    157   1e-41   
ref|XP_004140794.1|  PREDICTED: dehydration-responsive element-bi...    157   1e-41   
gb|KEH26600.1|  dehydration-responsive element-binding protein 1B       158   1e-41   
ref|XP_004234350.1|  PREDICTED: dehydration-responsive element-bi...    157   1e-41   
gb|AGR40694.1|  C-repeat binding factor 6                               157   1e-41   
gb|AIY26287.1|  CRT/DRE-binding factor                                  157   1e-41   
gb|KEH26590.1|  CBF/DREB1 transcription factor                          157   2e-41   
ref|XP_011029177.1|  PREDICTED: dehydration-responsive element-bi...    157   2e-41   
gb|AGR40696.1|  C-repeat binding factor 5                               158   2e-41   
ref|XP_004171792.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    156   2e-41   
ref|XP_011014147.1|  PREDICTED: dehydration-responsive element-bi...    157   2e-41   
gb|AGY31293.1|  C-repeat binding factor 2                               157   2e-41   
ref|XP_010058217.1|  PREDICTED: dehydration-responsive element-bi...    158   2e-41   
ref|NP_172721.1|  dehydration-responsive element-binding protein 1F     155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009784265.1|  PREDICTED: dehydration-responsive element-bi...    155   3e-41   
emb|CAH10191.1|  avirulence-like protein 1                              156   3e-41   Festuca arundinacea [tall fescue]
ref|XP_004244599.1|  PREDICTED: dehydration-responsive element-bi...    156   3e-41   
ref|XP_006417217.1|  hypothetical protein EUTSA_v10009978mg             155   3e-41   
gb|AHL44969.1|  CBF6B                                                   155   4e-41   
gb|AIU39990.1|  dehydration responsive element-binding protein          156   4e-41   
gb|AFJ14631.1|  dehydration-responsive element-binding protein          159   4e-41   
gb|AEB69782.1|  CBF                                                     156   4e-41   
gb|AAV66464.1|  drought responsive element binding protein              155   5e-41   Glycine soja [wild soybean]
ref|NP_001235507.1|  CBF-like protein                                   155   5e-41   
ref|NP_001280599.1|  dehydration-responsive element-binding prote...    155   5e-41   
emb|CCF23020.1|  drought responsive element binding protein 1           155   5e-41   
gb|ADZ23480.1|  CBF transcription factor 2                              154   6e-41   
gb|ABY78834.2|  putative DRE-binding protein DREB1s                     154   6e-41   Medicago falcata [sickle alfalfa]
ref|XP_009759325.1|  PREDICTED: dehydration-responsive element-bi...    155   6e-41   
gb|AIQ82329.1|  CBF1                                                    154   6e-41   
ref|XP_010061399.1|  PREDICTED: dehydration-responsive element-bi...    155   7e-41   
emb|CDY57075.1|  BnaCnng31550D                                          154   7e-41   
gb|ABU55675.1|  CBF4-like protein                                       154   7e-41   Ampelopsis glandulosa var. brevipedunculata [Amur peppervine]
gb|AGR40683.1|  C-repeat binding factor 2                               155   7e-41   
gb|AGR40695.1|  C-repeat binding factor 6                               154   9e-41   
ref|XP_002886439.1|  hypothetical protein ARALYDRAFT_475045             153   9e-41   
gb|AHH86061.1|  CRT/DRE-binding factor 3                                155   9e-41   
ref|XP_007210188.1|  hypothetical protein PRUPE_ppa017761mg             155   1e-40   
ref|XP_008238783.1|  PREDICTED: dehydration-responsive element-bi...    155   1e-40   
gb|ABP98989.1|  CBF/DREB1 transcription factor 3                        154   1e-40   Betula pendula [white birch]
ref|XP_007152343.1|  hypothetical protein PHAVU_004G122000g             154   1e-40   
gb|AGR40697.1|  C-repeat binding factor 5                               155   1e-40   
gb|ACJ63286.1|  C-repeat binding factor 1                               154   1e-40   
ref|XP_008437209.1|  PREDICTED: dehydration-responsive element-bi...    154   2e-40   
ref|XP_008439162.1|  PREDICTED: dehydration-responsive element-bi...    153   2e-40   
gb|ACB45084.1|  CRT binding factor 4                                    153   2e-40   Solanum commersonii
ref|XP_011041633.1|  PREDICTED: dehydration-responsive element-bi...    154   2e-40   
ref|XP_010058216.1|  PREDICTED: dehydration-responsive element-bi...    155   2e-40   
gb|ABF59745.1|  CBF-like transcription factor                           153   2e-40   Cocos nucifera
ref|XP_007209556.1|  hypothetical protein PRUPE_ppa010909mg             154   2e-40   
ref|XP_009341269.1|  PREDICTED: dehydration-responsive element-bi...    154   2e-40   
gb|ACH63209.1|  CRT/DRE binding factor                                  155   2e-40   Rheum australe [Himalayan rhubarb]
gb|AAQ88400.1|  CaCBF1B                                                 153   2e-40   Capsicum annuum
ref|XP_007210989.1|  hypothetical protein PRUPE_ppa021197mg             154   2e-40   
gb|AIQ82297.1|  CBF1                                                    153   3e-40   
ref|XP_006303182.1|  hypothetical protein CARUB_v10010303mg             153   3e-40   
gb|AIQ82301.1|  CBF1                                                    152   3e-40   
ref|XP_002321877.1|  hypothetical protein POPTR_0015s13830g             154   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010061546.1|  PREDICTED: dehydration-responsive element-bi...    153   3e-40   
gb|ACF77118.1|  CBF4a                                                   154   3e-40   Populus hopeiensis
gb|ADZ23479.1|  CBF transcription factor 1                              152   3e-40   
gb|AGR40690.1|  C-repeat binding factor 8                               153   4e-40   
ref|XP_004511604.1|  PREDICTED: dehydration-responsive element-bi...    153   4e-40   
gb|KEH26589.1|  CBF/DREB1 transcription factor                          154   4e-40   
gb|ACE73694.1|  DREB2                                                   152   4e-40   Nicotiana tabacum [American tobacco]
ref|XP_009758148.1|  PREDICTED: dehydration-responsive element-bi...    152   4e-40   
gb|AFL48190.1|  C-repeat binding factor 1                               153   5e-40   
ref|XP_009785658.1|  PREDICTED: dehydration-responsive element-bi...    153   5e-40   
gb|ACB45083.1|  CRT binding factor 4                                    152   5e-40   Solanum tuberosum [potatoes]
gb|ACB45096.1|  CRT binding factor 1                                    154   5e-40   Solanum tuberosum [potatoes]
gb|AGR40691.1|  C-repeat binding factor 8                               154   6e-40   
gb|ACB45094.1|  CRT binding factor 2                                    153   6e-40   Solanum commersonii
ref|XP_009777001.1|  PREDICTED: uncharacterized protein LOC104226669    157   6e-40   
ref|XP_006353374.1|  PREDICTED: dehydration-responsive element-bi...    153   6e-40   
gb|AFN06404.1|  ethylene-responsive element binding protein             152   6e-40   
gb|ABG75914.1|  dehydration responsive element binding protein 1A       152   7e-40   Medicago truncatula
gb|AHI59143.1|  CBF4                                                    153   7e-40   
gb|ABR23056.1|  DRE-binding transcription factor swDREB1                153   7e-40   Ipomoea batatas [batate]
gb|ABF59738.1|  CBF-like transcription factor                           152   7e-40   Trachycarpus fortunei
dbj|BAE17131.1|  LhCBF1                                                 152   7e-40   Solanum habrochaites
ref|XP_003517455.1|  PREDICTED: dehydration-responsive element-bi...    152   8e-40   
gb|ACF77119.1|  CBF4b                                                   152   8e-40   Populus hopeiensis
gb|ADU03762.1|  C-repeat binding factor                                 152   9e-40   
gb|AFU54609.1|  C-repeat binding factor                                 152   9e-40   
ref|XP_007209842.1|  hypothetical protein PRUPE_ppa014628mg             152   1e-39   
emb|CBZ41764.1|  drought responsive element binding protein 1           152   1e-39   
gb|AFK45852.1|  unknown                                                 153   1e-39   
ref|XP_007155567.1|  hypothetical protein PHAVU_003G212800g             154   1e-39   
gb|KEH26592.1|  dehydration-responsive element-binding protein 1B       153   1e-39   
ref|XP_010519227.1|  PREDICTED: dehydration-responsive element-bi...    151   1e-39   
ref|XP_011016549.1|  PREDICTED: dehydration-responsive element-bi...    152   1e-39   
ref|XP_009588056.1|  PREDICTED: dehydration-responsive element-bi...    151   1e-39   
gb|ACB45087.1|  CRT binding factor 1                                    151   1e-39   Solanum habrochaites
gb|EYU25052.1|  hypothetical protein MIMGU_mgv1a012186mg                152   2e-39   
gb|AAR88363.1|  DREB-like protein 1                                     151   2e-39   Capsicum annuum
ref|XP_008246095.1|  PREDICTED: dehydration-responsive element-bi...    152   2e-39   
gb|ACI42859.1|  dehydration-responsive element-binding protein 1A       151   2e-39   Rosa hybrid cultivar
gb|KCW90750.1|  hypothetical protein EUGRSUZ_A02826                     150   2e-39   
emb|CDP05249.1|  unnamed protein product                                151   2e-39   
ref|XP_004496025.1|  PREDICTED: dehydration-responsive element-bi...    151   2e-39   
gb|AFU54607.1|  C-repeat binding factor                                 151   2e-39   
gb|AFU54606.1|  C-repeat binding factor                                 151   2e-39   
gb|ADF43034.1|  CBF/DREB1-like protein b                                151   2e-39   
dbj|BAC20184.1|  dehydration responsive element binding protein 1...    151   2e-39   Prunus avium [gean]
ref|NP_176491.1|  ERF/AP2 transcription factor DDF2                     149   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AIQ82316.1|  CBF1                                                    150   3e-39   
ref|XP_010061486.1|  PREDICTED: dehydration-responsive element-bi...    150   3e-39   
ref|NP_001287934.1|  dehydration-responsive element-binding prote...    151   3e-39   
gb|AGR40686.1|  C-repeat binding factor 10                              150   3e-39   
gb|AFU81298.1|  C-repeat binding factor 1                               150   3e-39   
gb|KCW90755.1|  hypothetical protein EUGRSUZ_A02832                     149   3e-39   
ref|XP_009344260.1|  PREDICTED: dehydration-responsive element-bi...    151   3e-39   
ref|NP_001234123.1|  CBF1 protein                                       150   3e-39   
ref|NP_001274856.1|  CBF2                                               151   4e-39   
ref|XP_009344259.1|  PREDICTED: dehydration-responsive element-bi...    150   4e-39   
gb|EPS68879.1|  hypothetical protein M569_05891                         150   4e-39   
gb|EYU19516.1|  hypothetical protein MIMGU_mgv1a020838mg                150   4e-39   
gb|AGL07696.1|  CBF/DREB 4                                              151   4e-39   
gb|ACB45079.1|  CRT binding factor 1                                    150   4e-39   
gb|AIU92967.1|  C-repeat/dehydration-responsive element-binding f...    151   5e-39   
ref|XP_009148577.1|  PREDICTED: dehydration-responsive element-bi...    149   6e-39   
ref|XP_009614214.1|  PREDICTED: dehydration-responsive element-bi...    149   6e-39   
gb|ABF59736.1|  CBF-like transcription factor                           149   6e-39   
gb|ADF43035.2|  CBF/DREB1-like protein c                                150   7e-39   
ref|NP_001267504.1|  uncharacterized protein LOC100819565               150   7e-39   
gb|AIL00823.1|  C-repeat binding factor 4                               149   7e-39   
ref|XP_010933895.1|  PREDICTED: dehydration-responsive element-bi...    149   8e-39   
gb|ABU55678.1|  CBF4-like protein                                       148   8e-39   
gb|ABF59740.1|  CBF-like transcription factor                           149   8e-39   
gb|ACF15446.1|  C-repeat binding factor 1c                              149   9e-39   
ref|XP_002280097.1|  PREDICTED: dehydration-responsive element-bi...    149   1e-38   
gb|AIL00787.1|  C-repeat binding factor 4                               149   1e-38   
ref|XP_009377921.1|  PREDICTED: dehydration-responsive element-bi...    150   1e-38   
gb|ACZ37076.1|  CRT/DRE binding factor                                  149   1e-38   
gb|AIL00822.1|  C-repeat binding factor 4                               149   1e-38   
ref|XP_010919216.1|  PREDICTED: dehydration-responsive element-bi...    149   1e-38   
gb|AIL00764.1|  C-repeat binding factor 4                               149   1e-38   
gb|AAZ20446.1|  CBF1                                                    149   1e-38   
ref|XP_009607270.1|  PREDICTED: dehydration-responsive element-bi...    149   1e-38   
gb|AIL00783.1|  C-repeat binding factor 4                               149   2e-38   
gb|ADE41123.1|  AP2 domain class transcription factor                   149   2e-38   
gb|ABF59746.1|  CBF-like transcription factor 1                         148   2e-38   
gb|AAW58104.1|  CBF-like transcription factor                           148   2e-38   
ref|XP_006391789.1|  hypothetical protein EUTSA_v10023865mg             147   2e-38   
gb|ABQ59086.1|  CBF/DREB1 transcription factor                          149   2e-38   
dbj|BAC20183.1|  dehydratiion responsive element binding protein ...    149   2e-38   
gb|AEG64738.1|  DREB protein                                            148   2e-38   
ref|XP_010061439.1|  PREDICTED: dehydration-responsive element-bi...    147   2e-38   
gb|AHJ08666.1|  CRT/DRE-binding factor 1                                148   2e-38   
ref|XP_006301487.1|  hypothetical protein CARUB_v10021910mg             147   2e-38   
gb|AIL00794.1|  C-repeat binding factor 4                               148   2e-38   
ref|XP_010061462.1|  PREDICTED: dehydration-responsive element-bi...    148   2e-38   
gb|KCW90748.1|  hypothetical protein EUGRSUZ_A02824                     148   2e-38   
gb|ABF59744.1|  CBF-like transcription factor                           148   2e-38   
gb|ADY17814.1|  CBF4 transcription factor                               148   2e-38   
gb|AGR40674.1|  C-repeat binding factor 14                              148   2e-38   
gb|ACB45093.1|  CRT binding factor 1                                    148   3e-38   
gb|ABF59741.1|  CBF-like transcription factor 2                         147   3e-38   
gb|ABF59737.1|  CBF-like transcription factor                           147   3e-38   
gb|AIU92971.1|  C-repeat/dehydration-responsive element-binding f...    149   3e-38   
gb|ACJ26754.1|  AP2 domain CBF protein                                  148   3e-38   
ref|XP_002510847.1|  Dehydration-responsive element-binding prote...    148   3e-38   
gb|AGL07697.1|  CBF/DREB 3                                              148   3e-38   
gb|ACF94686.1|  dehydration-responsive element-binding factor 1/C...    148   3e-38   
gb|AIQ82333.1|  CBF2                                                    146   3e-38   
gb|ABB51637.1|  C-repeat binding facor 1a                               147   4e-38   
ref|XP_009110634.1|  PREDICTED: dehydration-responsive element-bi...    147   4e-38   
ref|XP_006364144.1|  PREDICTED: dehydration-responsive element-bi...    147   4e-38   
gb|AIQ82363.1|  CBF2                                                    146   4e-38   
gb|AIQ82342.1|  CBF2                                                    146   4e-38   
gb|ABV65907.2|  CRT/DRE-binding factor 1                                147   5e-38   
ref|XP_010676556.1|  PREDICTED: dehydration-responsive element-bi...    147   5e-38   
ref|XP_009371278.1|  PREDICTED: dehydration-responsive element-bi...    147   5e-38   
gb|AIQ82354.1|  CBF2                                                    146   5e-38   
ref|XP_008377096.1|  PREDICTED: dehydration-responsive element-bi...    147   6e-38   
gb|AIL00786.1|  C-repeat binding factor 4                               147   6e-38   
gb|AIQ82360.1|  CBF2                                                    145   7e-38   
gb|ABU55677.1|  CBF4-like protein                                       145   7e-38   
gb|AIQ82339.1|  CBF2                                                    145   7e-38   
gb|AGR40685.1|  C-repeat binding factor 2a                              146   8e-38   
gb|ACY79411.1|  CRT-binding factor 1                                    147   8e-38   
dbj|BAD43714.1|  putative transcription factor DREB1A                   145   8e-38   
ref|XP_003611157.1|  Dehydration-responsive element-binding prote...    147   8e-38   
ref|XP_007158456.1|  hypothetical protein PHAVU_002G153900g             146   8e-38   
gb|AIT39762.1|  C-repeat binding factor 2                               146   1e-37   
gb|ABU55674.1|  CBF4-like protein                                       145   1e-37   
ref|NP_001287933.1|  uncharacterized protein LOC103337407               146   1e-37   
gb|AIL00808.1|  C-repeat binding factor 4                               146   1e-37   
ref|XP_008376515.1|  PREDICTED: dehydration-responsive element-bi...    146   1e-37   
gb|ABF59739.1|  CBF-like transcription factor                           145   1e-37   
gb|AFL48191.1|  C-repeat binding factor 2                               146   1e-37   
ref|XP_007209547.1|  hypothetical protein PRUPE_ppa010800mg             146   1e-37   
gb|ABH08745.1|  CBF/DREB-like transcription factor a                    145   2e-37   
emb|CDY31270.1|  BnaC08g15650D                                          145   2e-37   
ref|XP_009623988.1|  PREDICTED: dehydration-responsive element-bi...    145   2e-37   
ref|XP_004511603.1|  PREDICTED: dehydration-responsive element-bi...    147   2e-37   
gb|AIQ82361.1|  CBF2                                                    144   2e-37   
gb|ACF15447.1|  C-repeat binding factor 1d                              145   2e-37   
gb|ABI74671.1|  C-repeat binding factor 1                               145   2e-37   
gb|ABU55680.1|  CBF4-like protein                                       144   2e-37   
gb|KEH26595.1|  dehydration-responsive element-binding protein          145   2e-37   
ref|XP_010418309.1|  PREDICTED: dehydration-responsive element-bi...    144   2e-37   
gb|ABX80062.1|  CRT/DRE binding factor 1                                145   3e-37   
gb|ACZ37079.1|  CRT/DRE binding factor                                  145   3e-37   
gb|ABU55679.1|  CBF4-like protein                                       144   3e-37   
gb|ACZ37077.1|  CRT/DRE binding factor                                  145   3e-37   
gb|ACZ37078.1|  CRT/DRE binding factor                                  145   3e-37   
gb|ABU55676.1|  CBF4-like protein                                       144   3e-37   
ref|XP_006421846.1|  hypothetical protein CICLE_v10007068mg             145   3e-37   
ref|XP_010693509.1|  PREDICTED: dehydration-responsive element-bi...    145   4e-37   
gb|ABU55672.1|  CBF4-like protein                                       143   5e-37   
ref|XP_003536483.1|  PREDICTED: dehydration-responsive element-bi...    144   5e-37   
gb|ACZ37080.1|  CRT/DRE binding factor                                  144   5e-37   
ref|XP_010473531.1|  PREDICTED: dehydration-responsive element-bi...    143   5e-37   
gb|ABU55673.1|  CBF4-like protein                                       143   6e-37   
gb|AEM97872.1|  AP2 class transcription factor                          144   6e-37   
ref|XP_006491857.1|  PREDICTED: dehydration-responsive element-bi...    144   7e-37   
ref|XP_003611158.1|  Dehydration-responsive element-binding prote...    144   7e-37   
ref|XP_008803257.1|  PREDICTED: dehydration-responsive element-bi...    144   9e-37   
gb|AHL44967.1|  CBF5                                                    142   9e-37   
gb|ABO93604.1|  DREBa                                                   143   1e-36   
ref|XP_009112988.1|  PREDICTED: dehydration-responsive element-bi...    142   1e-36   
gb|AIQ82365.1|  CBF2                                                    142   1e-36   
ref|XP_010430380.1|  PREDICTED: dehydration-responsive element-bi...    142   1e-36   
gb|ACJ54953.1|  DREB1                                                   144   1e-36   
gb|AAR28672.1|  CBF-like transcription factor                           144   2e-36   
gb|KFK43527.1|  hypothetical protein AALP_AA1G137500                    142   2e-36   
ref|XP_003592322.1|  Dehydration-responsive element binding protein     142   2e-36   
gb|ADL74429.1|  CRT/DRE binding factor 4                                142   2e-36   
gb|ACY79412.1|  CRT-binding factor 1                                    143   2e-36   
dbj|BAC20185.1|  dehydration responsive element binding protein 1...    140   2e-36   
gb|AIQ82367.1|  CBF2                                                    141   2e-36   
gb|ABU55664.1|  CBF1-like protein                                       142   3e-36   
gb|AIL00538.1|  C-repeat binding factor 1                               143   3e-36   
gb|AAQ98869.2|  putative dehydration responsive element binding p...    142   4e-36   
gb|KDO65655.1|  hypothetical protein CISIN_1g029015mg                   141   4e-36   
ref|XP_002892697.1|  hypothetical protein ARALYDRAFT_471409             141   4e-36   
gb|AGR40679.1|  C-repeat binding factor 12                              142   4e-36   
gb|ABU55657.1|  CBF1-like protein                                       142   5e-36   
gb|ABU55659.1|  CBF1-like protein                                       142   5e-36   
gb|AIL00479.1|  C-repeat binding factor 1                               142   6e-36   
gb|AAR28671.1|  CBF-like transcription factor                           142   6e-36   
ref|XP_004515794.1|  PREDICTED: dehydration-responsive element-bi...    141   6e-36   
gb|AIL00487.1|  C-repeat binding factor 1                               142   6e-36   
gb|ABD65473.1|  DREB1-like transcription factor                         141   7e-36   
gb|ABV22882.2|  putative DRE-binding protein DREB1                      141   7e-36   
gb|AGR40692.1|  C-repeat binding factor 7                               142   8e-36   
ref|NP_001235037.1|  dehydration-responsive element binding prote...    141   8e-36   
gb|AEQ49674.1|  DREB1                                                   141   8e-36   
ref|XP_007143366.1|  hypothetical protein PHAVU_007G066500g             140   8e-36   
gb|AGR40688.1|  C-repeat binding factor 9                               140   9e-36   
ref|XP_004252643.1|  PREDICTED: dehydration-responsive element-bi...    141   9e-36   
gb|ABV27138.1|  C-repeat binding factor 3                               140   1e-35   
gb|AAP83936.3|  putative dehydration responsive element binding p...    140   1e-35   
gb|KEH26591.1|  dehydration-responsive element-binding protein 1B       141   1e-35   
gb|AIL00500.1|  C-repeat binding factor 1                               142   1e-35   
gb|ABF61217.1|  CBF/DREB1 transcription factor                          142   1e-35   
gb|KHN34435.1|  Dehydration-responsive element-binding protein 1F       141   2e-35   
gb|AIL00480.1|  C-repeat binding factor 1                               141   2e-35   
gb|AIL00558.1|  C-repeat binding factor 1                               140   3e-35   
ref|XP_004143933.1|  PREDICTED: dehydration-responsive element-bi...    140   3e-35   
gb|AGR40693.1|  C-repeat binding factor 7                               140   3e-35   
gb|AIL00501.1|  C-repeat binding factor 1                               140   3e-35   
gb|ABV27118.1|  C-repeat binding factor 2                               139   3e-35   
gb|ADY17818.1|  CBF1 transcription factor                               140   3e-35   
gb|KCW90751.1|  hypothetical protein EUGRSUZ_A02827                     139   3e-35   
gb|ABU55656.1|  CBF1-like protein                                       140   3e-35   
gb|AIL00491.1|  C-repeat binding factor 1                               140   3e-35   
gb|AIL00526.1|  C-repeat binding factor 1                               140   3e-35   
gb|AIL00557.1|  C-repeat binding factor 1                               140   3e-35   
ref|XP_009411456.1|  PREDICTED: dehydration-responsive element-bi...    139   3e-35   
gb|AIL00542.1|  C-repeat binding factor 1                               140   3e-35   
gb|AIL00537.1|  C-repeat binding factor 1                               140   3e-35   
ref|XP_003550880.1|  PREDICTED: dehydration-responsive element-bi...    140   3e-35   
gb|AIL00495.1|  C-repeat binding factor 1                               140   3e-35   
gb|AIL00525.1|  C-repeat binding factor 1                               140   4e-35   
ref|XP_010546028.1|  PREDICTED: dehydration-responsive element-bi...    138   4e-35   
ref|XP_010061496.1|  PREDICTED: dehydration-responsive element-bi...    139   4e-35   
gb|AIL00533.1|  C-repeat binding factor 1                               140   4e-35   
gb|AIL00521.1|  C-repeat binding factor 1                               140   4e-35   
gb|AIL00539.1|  C-repeat binding factor 1                               140   4e-35   
gb|AFC89543.1|  DREB1                                                   139   4e-35   
gb|AIL00534.1|  C-repeat binding factor 1                               140   4e-35   
gb|AIL00514.1|  C-repeat binding factor 1                               140   5e-35   
ref|XP_010536489.1|  PREDICTED: dehydration-responsive element-bi...    139   5e-35   
gb|AIL00475.1|  C-repeat binding factor 1                               140   5e-35   
ref|XP_008807522.1|  PREDICTED: dehydration-responsive element-bi...    139   6e-35   
gb|AAC99371.1|  CRT/DRE binding factor 2                                139   7e-35   
gb|AIL00536.1|  C-repeat binding factor 1                               139   7e-35   
gb|ACI15606.1|  DRE/CRT-binding factor 2                                139   7e-35   
gb|ABV27100.1|  C-repeat binding factor 2                               139   7e-35   
gb|AIL00523.1|  C-repeat binding factor 1                               139   7e-35   
ref|XP_002532187.1|  CBF-like transcription factor, putative            140   7e-35   
ref|XP_008807523.1|  PREDICTED: dehydration-responsive element-bi...    138   7e-35   
gb|AGR40689.1|  C-repeat binding factor 9                               138   8e-35   
gb|AIL00506.1|  C-repeat binding factor 1                               139   8e-35   
gb|ACB20695.1|  CBF-like protein 1                                      139   8e-35   
gb|AFN93974.1|  CBF1                                                    139   9e-35   
ref|XP_010061558.1|  PREDICTED: dehydration-responsive element-bi...    139   9e-35   
ref|XP_010061567.1|  PREDICTED: dehydration-responsive element-bi...    139   9e-35   
ref|XP_003525540.1|  PREDICTED: dehydration-responsive element-bi...    139   9e-35   
gb|AAG43548.1|AF211530_1  Avr9/Cf-9 rapidly elicited protein 111A       137   9e-35   
gb|ABB51638.1|  C-repeat binding facor 1b                               138   1e-34   
gb|KCW77611.1|  hypothetical protein EUGRSUZ_D01925                     139   1e-34   
ref|XP_010533717.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    137   1e-34   
gb|ACJ63287.1|  C-repeat binding factor 1                               137   1e-34   
ref|XP_004163110.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    137   1e-34   
ref|XP_009384526.1|  PREDICTED: dehydration-responsive element-bi...    137   1e-34   
gb|ACU00273.1|  dehydration-responsive element-binding factor 1         138   1e-34   
gb|AIL00502.1|  C-repeat binding factor 1                               139   1e-34   
ref|XP_004143704.1|  PREDICTED: dehydration-responsive element-bi...    137   1e-34   
gb|AIL00513.1|  C-repeat binding factor 1                               139   1e-34   
gb|AAR28673.1|  CBF-like transcription factor                           139   1e-34   
ref|NP_001289653.1|  dehydration-responsive element-binding prote...    137   2e-34   
gb|AIL00559.1|  C-repeat binding factor 1                               138   2e-34   
gb|ABU55658.1|  CBF1-like protein                                       139   2e-34   
gb|AIL00510.1|  C-repeat binding factor 1                               138   3e-34   
ref|XP_004496614.1|  PREDICTED: dehydration-responsive element-bi...    136   3e-34   
gb|AIL00515.1|  C-repeat binding factor 1                               137   4e-34   
gb|ABV27090.1|  C-repeat binding factor 2                               137   4e-34   
gb|AIL00520.1|  C-repeat binding factor 1                               137   4e-34   
ref|XP_010494384.1|  PREDICTED: dehydration-responsive element-bi...    136   4e-34   
gb|AET87124.1|  DREB1C                                                  136   5e-34   
gb|ABU55661.1|  CBF1-like protein                                       136   5e-34   
gb|AIL00508.1|  C-repeat binding factor 1                               137   6e-34   
ref|XP_010438876.1|  PREDICTED: dehydration-responsive element-bi...    136   6e-34   
ref|XP_010061450.1|  PREDICTED: dehydration-responsive element-bi...    135   7e-34   
ref|XP_010054790.1|  PREDICTED: dehydration-responsive element-bi...    139   7e-34   
gb|ABF70207.1|  C-repeat binding factor                                 136   7e-34   
gb|AIL00519.1|  C-repeat binding factor 1                               137   7e-34   
ref|XP_008467214.1|  PREDICTED: dehydration-responsive element-bi...    135   8e-34   
ref|NP_567719.1|  dehydration-responsive element-binding protein 1C     135   8e-34   
gb|AGR40675.1|  C-repeat binding factor 14                              136   9e-34   
gb|AIL00524.1|  C-repeat binding factor 1                               136   1e-33   
gb|AIL00509.1|  C-repeat binding factor 1                               136   1e-33   
gb|ABU55660.1|  CBF1-like protein                                       134   1e-33   
ref|XP_010458688.1|  PREDICTED: dehydration-responsive element-bi...    135   1e-33   
gb|ACU00272.1|  dehydration-responsive element-binding factor 1         135   1e-33   



>gb|AHL69786.1| dehydration-responsive element-binding protein [Camellia sinensis]
Length=250

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 154/237 (65%), Gaps = 21/237 (9%)
 Frame = -3

Query  1112  SEMDYSTSNSDPNYCGGYGF---PQGEGWSGGR--ASHSD-EEVILAESRPKKRAGRKKF  951
             S MD S++ SDP Y     F   P  E  +  R  A+HSD E +ILA SRPKKRAGRKKF
Sbjct  2     SSMDTSSTCSDP-YLFRSNFQNSPLSESDACTRQGATHSDGETIILASSRPKKRAGRKKF  60

Query  950   KETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAA  771
             KETRHPVYRG+RRRN NKWVCE+REP K+ RIWLGTYPT EMAARAHDVAALAL+GQ A 
Sbjct  61    KETRHPVYRGIRRRNTNKWVCELREPNKKSRIWLGTYPTAEMAARAHDVAALALKGQLAC  120

Query  770   TLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE----------CEEEIVITTPTSV  621
              LNFADSVW+LPVP S DAKD+R AAVEAAEAFRP +           EE+I+    +  
Sbjct  121   -LNFADSVWKLPVPVSKDAKDIRSAAVEAAEAFRPSDHLCNDNTGSRVEEKILSDGVSGT  179

Query  620   EAppp-ppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  453
             +         +GT + +       E D     MQG  LG MADG LLSP P +G  F
Sbjct  180   KVCHDGASSSNGTRDNVCHMDEEEEKDAIF-DMQGLILG-MADGPLLSPPPCVGARF  234



>gb|EYU38994.1| hypothetical protein MIMGU_mgv1a025975mg [Erythranthe guttata]
Length=207

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 134/189 (71%), Gaps = 10/189 (5%)
 Frame = -3

Query  1013  SDEEVIL--AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             SDEE +L  A + PKKRAGRKKFKETRHPVYRGVRRRN++KWVCE+REPT QKR+WLGTY
Sbjct  11    SDEEEVLNLAAANPKKRAGRKKFKETRHPVYRGVRRRNSDKWVCELREPTAQKRVWLGTY  70

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PTPEMAARAHDVAALALRG+ AA LNFADSVWRLPVPAS DA+DLRKAAVEAAEAFRP E
Sbjct  71    PTPEMAARAHDVAALALRGK-AACLNFADSVWRLPVPASKDARDLRKAAVEAAEAFRPPE  129

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
               EE       S E        D T      +      D +   ++   +  +A+G LLS
Sbjct  130   SGEEFCSEQRRSEEV-----AADST--NGGGNVAGGVSDLYDVVLEDLDMERLAEGVLLS  182

Query  479   PAPSLGKGF  453
             P P LG  F
Sbjct  183   PPPCLGWRF  191



>gb|ADZ95598.1| C-repeat binding facor [Fraxinus americana]
Length=224

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 144/224 (64%), Gaps = 24/224 (11%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVY  927
             MD   S SDPN  G +  P+          HSDEEVILA +RPKKRAGRKKFKETRHP+Y
Sbjct  1     MDSLGSCSDPNPFGVFDMPEIPSLK----EHSDEEVILASNRPKKRAGRKKFKETRHPIY  56

Query  926   RGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSV  747
             RG+R+RN++KWVCE+REP+ QKRIWLGTYPT EMAARAHDVAALA RGQ A  LNFADSV
Sbjct  57    RGIRQRNSDKWVCELREPSNQKRIWLGTYPTAEMAARAHDVAALAFRGQLAC-LNFADSV  115

Query  746   WRLPVPASVDAKDLRKAAVEAAEAFRPKE------CEEEIVITTPTSVEApppppPVDGT  585
             W LPVP S D KD++KAA+EAAE FRP E       +E ++ +T  S         +D T
Sbjct  116   WCLPVPVSKDVKDIQKAALEAAELFRPPEEGGGTILQENVMDSTGVS---GGNSTTLDTT  172

Query  584   WNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  453
               +         PD  ++ M    + +M  G L+SP PSL    
Sbjct  173   KTL---------PDCDVSYMNEDSVTNMG-GVLMSPPPSLDHSL  206



>emb|CDP09813.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 147/245 (60%), Gaps = 31/245 (13%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVY  927
             MD S+S SDP+  G          +  RA +SDEE+IL+ SRPKKRAGRKKFKETRHPVY
Sbjct  1     MDASSSCSDPHPFGS--LSDVSPTTAQRAINSDEEIILSSSRPKKRAGRKKFKETRHPVY  58

Query  926   RGVRRR--NNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFAD  753
             RG+RRR  N+NKWVCE+REP KQ RIWLGTYPT EMAARA+DVAALALRG  A  LNFAD
Sbjct  59    RGIRRRRWNSNKWVCELREPNKQSRIWLGTYPTAEMAARAYDVAALALRGHLAC-LNFAD  117

Query  752   SVWRLPVPASVDAKDLRKAAVEAAEAFRPK-ECE------------------------EE  648
             SVWRLPVP S DAKD+RKAA EAAE FR + EC+                        EE
Sbjct  118   SVWRLPVPESRDAKDIRKAAAEAAEMFRSQEECDNTTSEASASGSGSESGDHHHDRVGEE  177

Query  647   IVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPS  468
             I   T  + E            N    +  +   D  L  +  G +  MA+G LLSP   
Sbjct  178   IGDITHDNNEVSSFDHGEALQKNGEESTSSMFMDDEALFDVH-GLMAHMAEGLLLSPPHC  236

Query  467   LGKGF  453
             LG G+
Sbjct  237   LGDGY  241



>ref|XP_011073844.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Sesamum indicum]
Length=188

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 119/152 (78%), Gaps = 11/152 (7%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVY  927
             MD  TSNS     GG            R SHSDEEVILA S PKKRAGRKKFKETRHPVY
Sbjct  1     MDSPTSNS--QSLGGL--------DSRRMSHSDEEVILASSHPKKRAGRKKFKETRHPVY  50

Query  926   RGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSV  747
             RGVRRRN++KWVCE+REP+KQKRIWLG  PT EMAARAHDVAALALRGQ  A LNFADSV
Sbjct  51    RGVRRRNSDKWVCELREPSKQKRIWLGGVPTAEMAARAHDVAALALRGQM-ACLNFADSV  109

Query  746   WRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             WRLPVPAS D KD+RKAA++AAEAF+P   EE
Sbjct  110   WRLPVPASNDPKDIRKAAMQAAEAFQPGAAEE  141



>ref|XP_011081035.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Sesamum indicum]
Length=209

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 141/196 (72%), Gaps = 21/196 (11%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              R+++SDEE+ILA SRPKKRAGRKKFKETRHPVYRGVRRRN+NKWVCE+REP+KQKRIWL
Sbjct  15    ARSAYSDEELILAASRPKKRAGRKKFKETRHPVYRGVRRRNSNKWVCELREPSKQKRIWL  74

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             G+YPTPEMAARAHDVAALALRGQ A  LNFADSVWRLP+PAS +AKDLRKAA EAAEAFR
Sbjct  75    GSYPTPEMAARAHDVAALALRGQMAC-LNFADSVWRLPIPASKEAKDLRKAAAEAAEAFR  133

Query  668   PKE----CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             P+     C+E+    T T  +                 SP +   +G L       +  +
Sbjct  134   PRATEEVCQEQRKEETSTDNDGEKKA------------SPDLC--NGILYDELS--IARL  177

Query  500   ADGNLLSPAPSLGKGF  453
             A+G LLSP P LG  F
Sbjct  178   AEGVLLSPPPCLGWRF  193



>ref|NP_001274894.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26758.1| AP2 domain CBF protein [Solanum tuberosum]
Length=218

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 124/174 (71%), Gaps = 9/174 (5%)
 Frame = -3

Query  1031  GGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIW  852
               RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RIW
Sbjct  29    NNRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKTRIW  88

Query  851   LGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  672
             LGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+F
Sbjct  89    LGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESF  147

Query  671   RPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             RP + EEE V+TT      P     +D      MP        G LT M  G +
Sbjct  148   RPLKSEEESVVTTGDQSSTPDDMFFMDEEALFCMP--------GLLTNMAEGLM  193



>gb|ABH08746.1| CBF/DREB-like transcription factor 1 [Citrus trifoliata]
Length=243

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = -3

Query  1025  RASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             R +HSDEEV+L A SRPKKRAGR+ FKETRHP++RGVRRRNNNKWVCE+REP KQ RIWL
Sbjct  34    RGAHSDEEVVLLATSRPKKRAGRRVFKETRHPIFRGVRRRNNNKWVCELREPNKQTRIWL  93

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94    GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGN  489
             P++ E E        +E            N L+P   +   +  +  M  G L  MA+G 
Sbjct  153   PRDDELEESNIHHVKLEEVQKTMQE----NTLLPENVLYMDEQAVFDMP-GLLADMAEGL  207

Query  488   LLSPAPSL  465
             LLSP P +
Sbjct  208   LLSPPPLI  215



>gb|ACB45092.1| CRT binding factor 3 [Solanum commersonii]
Length=217

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 125/175 (71%), Gaps = 9/175 (5%)
 Frame = -3

Query  1034  SGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRI  855
             S  RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RI
Sbjct  27    SPNRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKTRI  86

Query  854   WLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEA  675
             WLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAA++
Sbjct  87    WLGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAKS  145

Query  674   FRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             FRP + EEE V+TT      P     +D      MP        G LT M  G +
Sbjct  146   FRPLKSEEESVVTTGDQTSTPDDMFFMDEEALFCMP--------GLLTNMAEGLM  192



>gb|ACB45095.1| CRT binding factor 3 [Solanum tuberosum]
Length=217

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 124/175 (71%), Gaps = 9/175 (5%)
 Frame = -3

Query  1034  SGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRI  855
             S  RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RI
Sbjct  27    SPNRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKTRI  86

Query  854   WLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEA  675
             WLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+
Sbjct  87    WLGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAES  145

Query  674   FRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             FRP + EEE V+ T      P     +D      MP        G LT M  G +
Sbjct  146   FRPLKSEEESVVITGDQSSTPDDMFFMDEEALFCMP--------GLLTNMAEGLM  192



>ref|XP_006477388.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Citrus sinensis]
Length=243

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 135/186 (73%), Gaps = 7/186 (4%)
 Frame = -3

Query  1025  RASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             R +HSDEEV+L A SRPKKRAGR+ FKETRHP++RGVR RNNNKWVCE+REP KQ RIWL
Sbjct  34    RGAHSDEEVLLLATSRPKKRAGRRVFKETRHPIFRGVRMRNNNKWVCELREPNKQTRIWL  93

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94    GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGN  489
             P++ E E        +E            N L+P   +   +  +  M  G L  MA+G 
Sbjct  153   PRDDELEESNIHHVKLEEVQKTMQE----NTLLPENVLYMDEHAVFDMP-GLLADMAEGL  207

Query  488   LLSPAP  471
             LLSP P
Sbjct  208   LLSPPP  213



>gb|ACI42860.1| dehydration-responsive element-binding protein 1B [Rosa hybrid 
cultivar]
Length=231

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 146/214 (68%), Gaps = 26/214 (12%)
 Frame = -3

Query  1118  FSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETR  939
             F S++  S+S+SD N   G G          R + SDEEV+LA + PKKRAGRKKFKETR
Sbjct  20    FGSDLPESSSHSDNNSGNGVG----------RMNLSDEEVMLAATYPKKRAGRKKFKETR  69

Query  938   HPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNF  759
             HPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAA++LRG+ +A LNF
Sbjct  70    HPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAAISLRGR-SACLNF  128

Query  758   ADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWN  579
             ADS WRLPVPAS  AKD++ AA +AAEAFRP   E E+V  + T+ EA            
Sbjct  129   ADSAWRLPVPASTSAKDIQTAAAQAAEAFRPTGEESEVVSGSVTATEAE-----------  177

Query  578   VLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              L P   + E D F  GM  G L +MA+G LLSP
Sbjct  178   -LEPVFCMDEEDVF--GMP-GLLANMAEGMLLSP  207



>ref|XP_002509703.1| Dehydration-responsive element-binding protein 1F, putative [Ricinus 
communis]
 gb|EEF51090.1| Dehydration-responsive element-binding protein 1F, putative [Ricinus 
communis]
Length=230

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 135/208 (65%), Gaps = 10/208 (5%)
 Frame = -3

Query  1094  TSNSDPN-YCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGV  918
             T  SDP  +     F   +  +  RA HSDEEV+LA S PKKRAGR+ FKETRHPV+RGV
Sbjct  3     TQFSDPYPFDKHESFSPSDSTTSRRAVHSDEEVLLATSYPKKRAGRRVFKETRHPVFRGV  62

Query  917   RRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRL  738
             R RNN+KWVCE+REP K+ RIWLGTYPTPEMAARAHDVAALALRG+ +A LNFADS WRL
Sbjct  63    RNRNNDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRL  121

Query  737   PVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApp-pppPVDGTWNVLMPSP  561
             PVP S D  D+R+AA EAAE FRP+E   ++     + VE         D    V     
Sbjct  122   PVPVSTDPNDIRRAAHEAAELFRPQEFGGQVTRKFGSVVEQDAGEASSSDSKQEV-----  176

Query  560   PIMEPDGFLTGMQGGFLGSMADGNLLSP  477
               ++ + FL     G L  MA+  LLSP
Sbjct  177   SYIDEEDFLD--MPGLLARMAERPLLSP  202



>gb|EYU29844.1| hypothetical protein MIMGU_mgv1a014021mg [Erythranthe guttata]
Length=203

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 103/111 (93%), Gaps = 1/111 (1%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             SHSDEEVILA S PKKRAGRKKFKETRHPVYRGVRRRN+++WVCE+REPTKQ RIWLGTY
Sbjct  7     SHSDEEVILASSHPKKRAGRKKFKETRHPVYRGVRRRNSDRWVCELREPTKQNRIWLGTY  66

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVE  687
             PT EMAARAHDVAALALRGQ AA LNFADSVWRLPVPAS D KD+RKAAVE
Sbjct  67    PTAEMAARAHDVAALALRGQ-AACLNFADSVWRLPVPASTDPKDIRKAAVE  116



>gb|ACB45086.1| CRT binding factor 3 [Solanum habrochaites]
Length=203

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 128/186 (69%), Gaps = 12/186 (6%)
 Frame = -3

Query  1061  YGFPQGEGWSGG--RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVC  888
             Y  P+ E  S    RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVC
Sbjct  3     YSDPRIESSSSDSIRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKWVC  62

Query  887   EIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKD  708
             E+REP K+ RIWLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD
Sbjct  63    EVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKD  121

Query  707   LRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTG  528
             ++KAA EAAE+FRP + EEE  +    S   P     +D      MP        G LT 
Sbjct  122   IQKAAAEAAESFRPLKSEEEESVVKDQST-TPDDMFFMDEEALFCMP--------GLLTN  172

Query  527   MQGGFL  510
             M  G +
Sbjct  173   MAEGLM  178



>ref|XP_006358388.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Solanum tuberosum]
Length=238

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 134/203 (66%), Gaps = 20/203 (10%)
 Frame = -3

Query  1013  SDEE---VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             SDEE   ++LA SRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCE+REP++QKRIWLGT
Sbjct  21    SDEEGLILLLASSRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCELREPSQQKRIWLGT  80

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             YPTPEMAARAHDVAALALRG   ATLNFADS WRLPVPAS D KD+R+AAV AA+AF   
Sbjct  81    YPTPEMAARAHDVAALALRGNL-ATLNFADSRWRLPVPASKDPKDIRQAAVIAAQAFSQD  139

Query  662   E----CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQG--------  519
                    EE+   T   ++        +G+ +        M+ +  L+   G        
Sbjct  140   TEVDYMNEEVNSNTTDEIDIARVN---NGSSSDFSAKELSMDMENILSCNGGEDNYMLET  196

Query  518   -GFLGSMADGNLLSPAPSLGKGF  453
              G+   MA+  L SP P LG  F
Sbjct  197   EGWREKMAEELLFSPTPRLGSCF  219



>ref|XP_009764159.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Nicotiana sylvestris]
Length=247

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 132/197 (67%), Gaps = 18/197 (9%)
 Frame = -3

Query  1001  VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMa  822
             ++LA SRPKKRAGRKKFKETRHP+YRGVRRRNNNKWVCE+REP+KQKRIWLGTYPTPEMA
Sbjct  36    ILLASSRPKKRAGRKKFKETRHPIYRGVRRRNNNKWVCELREPSKQKRIWLGTYPTPEMA  95

Query  821   arahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIV  642
             ARAHDVAALALRG  +ATLNFADS+WRLPV  S D KDLR+AAV+AAEAFR    + E+V
Sbjct  96    ARAHDVAALALRGN-SATLNFADSLWRLPVIVSKDPKDLRQAAVKAAEAFRQ---DPELV  151

Query  641   IT------TPTSVEApppppPVDGTWN---VLMPSPPIMEPDGFLTGMQG-----GFLGS  504
                       ++ E       V+G  N   V       ME +       G      +   
Sbjct  152   RVDYMNEEVNSNEEVKCQENFVNGNGNDMGVKEVKMKNMEIENIFCSNWGENSEESWQEK  211

Query  503   MADGNLLSPAPSLGKGF  453
             MA+G L SP P LG  F
Sbjct  212   MAEGLLFSPTPRLGNCF  228



>gb|ACB45078.1| CRT binding factor 3 [Solanum habrochaites]
Length=203

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 128/186 (69%), Gaps = 12/186 (6%)
 Frame = -3

Query  1061  YGFPQGEGWSGG--RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVC  888
             Y  P+ E  S    RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVC
Sbjct  3     YSDPRIESSSSDSFRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKWVC  62

Query  887   EIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKD  708
             E+REP K+ RIWLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD
Sbjct  63    EVREPNKKSRIWLGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKD  121

Query  707   LRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTG  528
             ++KAA EAAE+FRP + EEE  +    S   P     +D      MP        G LT 
Sbjct  122   IQKAAAEAAESFRPLKSEEEESVVKDQST-TPDDMFFMDEEALFCMP--------GLLTN  172

Query  527   MQGGFL  510
             M  G +
Sbjct  173   MAEGLM  178



>ref|XP_009784267.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=220

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SD EV+LA + PKKRAGRKKF+ETRHPVYRGVR+RN++KWVCE+R+P K+ RIWL
Sbjct  27    NRANLSDGEVLLALNNPKKRAGRKKFRETRHPVYRGVRKRNSDKWVCEVRQPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAA+ALRG+ +A LNFADSVW+LPVPAS DAKD+++AAVEAAEAFR
Sbjct  87    GTYPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLPVPASADAKDIQRAAVEAAEAFR  145

Query  668   PKECE  654
             P E E
Sbjct  146   PSESE  150



>ref|XP_006440529.1| hypothetical protein CICLE_v10021923mg [Citrus clementina]
 gb|ESR53769.1| hypothetical protein CICLE_v10021923mg [Citrus clementina]
Length=243

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 131/179 (73%), Gaps = 7/179 (4%)
 Frame = -3

Query  1025  RASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             R +HSDEEV+L A SRPKKRAGR+ FKETRHP++RGVRRRNNNKWVCE+REP KQ RIWL
Sbjct  34    RGAHSDEEVVLLATSRPKKRAGRRVFKETRHPIFRGVRRRNNNKWVCELREPNKQTRIWL  93

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94    GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADG  492
             P++ E E        +E            N L+P   +   +  +  M  G L  MA+G
Sbjct  153   PRDDELEESNIHHVKLEEVQKTMQE----NTLLPENVLYMDEHAVFDMP-GLLADMAEG  206



>ref|XP_009619193.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Nicotiana tomentosiformis]
Length=256

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 130/202 (64%), Gaps = 25/202 (12%)
 Frame = -3

Query  1001  VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMa  822
             ++LA SRPKKRAGRKKFKETRHP+YRGVRRRNNNKWVCE+REP+KQKRIWLGTYPTPEMA
Sbjct  43    ILLASSRPKKRAGRKKFKETRHPIYRGVRRRNNNKWVCELREPSKQKRIWLGTYPTPEMA  102

Query  821   arahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK-------  663
             ARAHD+AALALRG  +ATLNFADS+WRLPV  S D KDLR+AAV+AAEAFR         
Sbjct  103   ARAHDIAALALRGN-SATLNFADSLWRLPVIVSKDPKDLRQAAVKAAEAFRQDPELVGVD  161

Query  662   ------------ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQG  519
                         +C+E +V      +E            NVL         +  +  ++G
Sbjct  162   YMNEEVNSNDEVKCQENVVNGGGYDMEVKELKMQNKEMENVLCCD---WGENSDMLEIEG  218

Query  518   GFLGSMADGNLLSPAPSLGKGF  453
              +   M  G L SP P LG  F
Sbjct  219   SWQEKM--GLLFSPTPRLGNCF  238



>gb|ACU00265.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 128/186 (69%), Gaps = 19/186 (10%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDE+V LA   PKKRAGRKKFKETRHPVYRGVR+R++ KWVCE+REP K+KR+WLGTY
Sbjct  18    STSDEDVHLASQNPKKRAGRKKFKETRHPVYRGVRKRDSGKWVCEVREPNKKKRVWLGTY  77

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV AAEAFR   
Sbjct  78    PTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSTNVKDIQKAAVNAAEAFR--S  134

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
               +++ +   +               N +  +  I   D  + GMQ GF   MA+G +L 
Sbjct  135   VNDDVALAEES---------------NQVKDNHVIYMDDDVVFGMQ-GFFADMAEGMMLP  178

Query  479   PAPSLG  462
             P  S+G
Sbjct  179   PPKSIG  184



>gb|AFQ59977.1| CRT/DRE binding factor 1 [Morus alba var. multicaulis]
Length=230

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 131/185 (71%), Gaps = 15/185 (8%)
 Frame = -3

Query  1031  GGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIW  852
             G R + SDEEV+LA S PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIW
Sbjct  35    GRRMNFSDEEVVLASSCPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIW  94

Query  851   LGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  672
             LGT+PT EMAARAHDVAA+ALRG+ +  LNFADS WRLPVPAS D KD++KAA EAAEAF
Sbjct  95    LGTFPTAEMAARAHDVAAIALRGR-STCLNFADSAWRLPVPASPDPKDIQKAASEAAEAF  153

Query  671   RPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADG  492
             RP +  E+       + E P     V  + +V       M+ +    GM  G L +MA+G
Sbjct  154   RPVDMAED-------TGEKPAADAAVAESEDVF-----FMDEEAVF-GMP-GLLTNMAEG  199

Query  491   NLLSP  477
              LL P
Sbjct  200   MLLPP  204



>ref|XP_010278524.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nelumbo nucifera]
Length=228

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 13/183 (7%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             RA+HSDEEV+LA S PKKRAGRKKF+ETRHPVYRGVRRRN+NKWVCE+REP K+ RIWLG
Sbjct  36    RAAHSDEEVMLASSHPKKRAGRKKFRETRHPVYRGVRRRNSNKWVCEVREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVP S D KD++KAA EAAEAFRP
Sbjct  96    TFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPVSADPKDIQKAAAEAAEAFRP  154

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
             +E +        ++ +  P       + NVL      M+ +    GM  G L +MA+G L
Sbjct  155   QESD-----AMSSADDVKPENATATSSENVL-----YMDEEAIF-GMP-GLLTNMAEGLL  202

Query  485   LSP  477
             LSP
Sbjct  203   LSP  205



>ref|XP_002276153.1| PREDICTED: dehydration-responsive element-binding protein 1E 
[Vitis vinifera]
 emb|CAN68351.1| hypothetical protein VITISV_011647 [Vitis vinifera]
Length=244

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 137/229 (60%), Gaps = 29/229 (13%)
 Frame = -3

Query  1076  NYCGGYGFPQ------------GEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHP  933
              +C  Y FP                W   R   SDEEV+LA  RPKKRAGR+KFKETRHP
Sbjct  6     QFCNSYPFPSDSHSVSTPESSSASDWQTRRTIQSDEEVLLASDRPKKRAGRRKFKETRHP  65

Query  932   VYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFAD  753
             VYRGVRRRN NKWVCE+REP K+ RIWLGTYPT EMAARAHDVAALA RG+  A LNFAD
Sbjct  66    VYRGVRRRNGNKWVCELREPNKKSRIWLGTYPTAEMAARAHDVAALAFRGR-KACLNFAD  124

Query  752   SVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIV-ITTPTSVEApppppPVD-----  591
             S W LPVP S D+ ++R+AA  AAEAFRP+E ++         SVEA       D     
Sbjct  125   SAWSLPVPVSKDSMEIRRAAAAAAEAFRPQEFQDHSSGDARKESVEAAESVARTDRRPES  184

Query  590   ---GTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  453
                   N+L+    ++    F T    G L +MA+  L SP P LG GF
Sbjct  185   IKTSAQNLLLTREELI----FDT---AGLLITMAEEPLHSPPPCLGDGF  226



>ref|XP_004298771.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Fragaria vesca subsp. vesca]
Length=256

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 132/195 (68%), Gaps = 22/195 (11%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R++HSDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+ RIWLG
Sbjct  43    RSAHSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEVREPNKKTRIWLG  102

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALALRG+  A LNFADS WRLPVPAS D  D+R+AA EAAE FRP
Sbjct  103   TYPTAEMAARAHDVAALALRGK-QACLNFADSAWRLPVPASKDQLDIRRAAAEAAETFRP  161

Query  665   KE-------CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGF--  513
             +E       CE++    +    +       +D             + +GF    +  F  
Sbjct  162   QEFGGVSSSCEDDYYQESNNEADQEVAKISLDSAEK---------KNEGFYEDEEAVFDM  212

Query  512   ---LGSMADGNLLSP  477
                L SMA+G LLSP
Sbjct  213   PRLLTSMAEGLLLSP  227



>gb|ACU00263.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 129/186 (69%), Gaps = 19/186 (10%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDE+V LA   PKKRAGRKKFKETRHPVYRGVR+R++ KWVCE+REP K+KR+WLGTY
Sbjct  18    STSDEDVHLASQNPKKRAGRKKFKETRHPVYRGVRKRDSGKWVCEVREPNKKKRVWLGTY  77

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR   
Sbjct  78    PTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSSNVKDIQKAAVKAAEAFR--S  134

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
               +++ +   +               N +  +  I   D  + GMQ GF   MA+G +L 
Sbjct  135   VNDDVALAEES---------------NQVKENHVIYMDDDVVFGMQ-GFFADMAEGLMLP  178

Query  479   PAPSLG  462
             P  S+G
Sbjct  179   PPKSIG  184



>gb|ADE62311.1| dehydration-responsive element-binding protein 1A [Ageratina 
adenophora]
Length=219

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 127/181 (70%), Gaps = 20/181 (11%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRR++ KWVCE+REP K+ R+WLGTY
Sbjct  35    SFSDEEVMLASKNPKKRAGRKKFRETRHPVYRGVRRRDSGKWVCEVREPNKKTRVWLGTY  94

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFRP E
Sbjct  95    PTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFRPTE  153

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
              +  ++     S E       VD               D  +  MQ GFL  MA+G +L 
Sbjct  154   TDVAVI---EESNELTGNVFCVD---------------DESIFEMQ-GFLADMAEGMMLP  194

Query  479   P  477
             P
Sbjct  195   P  195



>gb|ACU00264.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (69%), Gaps = 19/187 (10%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
              S SDE+V LA   PKK+AGRKKFKETRHPVYRGVR+R++ KWVCE+REP K+KR+WLGT
Sbjct  17    CSTSDEDVHLASQNPKKQAGRKKFKETRHPVYRGVRKRDSGKWVCEVREPNKKKRVWLGT  76

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             YPT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR  
Sbjct  77    YPTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSTNVKDIQKAAVKAAEAFR--  133

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                +++ +   +               N +  +  I   D  + GMQ GF   MA+G +L
Sbjct  134   YVNDDVTLAEES---------------NQVKENHVIYMDDDVVFGMQ-GFFADMAEGMML  177

Query  482   SPAPSLG  462
              P  S+G
Sbjct  178   PPPKSIG  184



>gb|KDO63570.1| hypothetical protein CISIN_1g026103mg [Citrus sinensis]
Length=243

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 130/179 (73%), Gaps = 7/179 (4%)
 Frame = -3

Query  1025  RASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             R +HSDEEV+L A SRPKKRAGR+ FKETRHP++RGVR RNNNKWVCE+REP KQ RIWL
Sbjct  34    RGAHSDEEVVLLATSRPKKRAGRRVFKETRHPIFRGVRMRNNNKWVCELREPNKQTRIWL  93

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94    GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADG  492
             P++ E E        +E            N L+P   +   +  +  M  G L  MA+G
Sbjct  153   PRDDELEESNIHHVKLEEVQKTMQE----NTLLPENVLYMDEHAVFDMP-GLLADMAEG  206



>gb|ABN58746.1| C-repeat binding factor [Ageratina adenophora]
Length=219

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 127/181 (70%), Gaps = 20/181 (11%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRR++ KWVCE+REP K+ R+WLGTY
Sbjct  35    SFSDEEVMLASKNPKKRAGRKKFRETRHPVYRGVRRRDSGKWVCEVREPNKKTRVWLGTY  94

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFRP E
Sbjct  95    PTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFRPTE  153

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
              +  ++     S E       VD               D  +  MQ GFL  MA+G +L 
Sbjct  154   TDVAVI---EESNELTGNVFCVD---------------DESIFEMQ-GFLADMAEGMMLP  194

Query  479   P  477
             P
Sbjct  195   P  195



>gb|ABI95805.1| C-repeat binding factor [Ageratina adenophora]
Length=219

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 127/181 (70%), Gaps = 20/181 (11%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDEEV+LA   PKKRAGRKKF+ETRHP+YRGVRRR++ KWVCE+REP K+ R+WLGTY
Sbjct  35    SFSDEEVMLASKNPKKRAGRKKFRETRHPIYRGVRRRDSGKWVCEVREPNKKTRVWLGTY  94

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFRP E
Sbjct  95    PTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFRPTE  153

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
              +  ++     S E       VD               D  +  MQ GFL  MA+G +L 
Sbjct  154   TDVAVI---EESNELTGNVFCVD---------------DESIFEMQ-GFLADMAEGMMLP  194

Query  479   P  477
             P
Sbjct  195   P  195



>ref|XP_007040121.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY24622.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=241

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 144/224 (64%), Gaps = 17/224 (8%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFP--------QGEGWSGGRASHSDEEV-ILAESRPKKRAGRKK  954
             MD S+  SD   C  Y  P          E  +  RA HSDEEV +LA SRPKKRAGR+ 
Sbjct  1     MDISSQFSDLFSCRSYSMPADRVEPSSSSEAGTVRRAVHSDEEVLVLATSRPKKRAGRRI  60

Query  953   FKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFA  774
             FKETRHP++RGVRRRN +KWVCE+REP K+ RIWLGTYPTPEMAARAHDVAALA RG+ A
Sbjct  61    FKETRHPIFRGVRRRNKDKWVCELREPNKKTRIWLGTYPTPEMAARAHDVAALAFRGK-A  119

Query  773   ATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEAppppp-P  597
             A LNFADS WRLPVPAS DA D+R+AA EAAEAF P+E   +++ ++    E+       
Sbjct  120   ACLNFADSAWRLPVPASNDAVDIRRAAAEAAEAFGPQEL--DVLSSSDAKQESVKASDGE  177

Query  596   VDGTWNVLMPSPPIMEPDGFLTGMQG----GFLGSMADGNLLSP  477
             V  +   L  S  + E   FL           L SMA+G LLSP
Sbjct  178   VSSSTGNLGNSKIVSEKVHFLDEEAMFDMPKLLVSMAEGLLLSP  221



>ref|XP_009611618.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611619.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X2 [Nicotiana tomentosiformis]
Length=232

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 113/131 (86%), Gaps = 5/131 (4%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             ++SDEEV+LA + PKKRAGRKKF+ETRHPVYRG+RRRN+NKWVCE+REP K+ RIWLGT+
Sbjct  40    NYSDEEVMLASNYPKKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTF  99

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT EMAARAHDVAA++LRG+ +A LNFADS WRLP+P S  AKD++KAAVEAAEAFRP E
Sbjct  100   PTAEMAARAHDVAAISLRGR-SACLNFADSAWRLPIPTSAAAKDIQKAAVEAAEAFRPVE  158

Query  659   CE----EEIVI  639
                   +EI++
Sbjct  159   SHGENFKEIIV  169



>gb|KDP25514.1| hypothetical protein JCGZ_20670 [Jatropha curcas]
Length=227

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 129/189 (68%), Gaps = 23/189 (12%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R++HSDEEV+LA S PKKRAGR+ FKETRHP++RGVR+RNN KWVCE+REP K+ RIWLG
Sbjct  28    RSAHSDEEVLLATSYPKKRAGRRIFKETRHPIFRGVRKRNNEKWVCELREPNKKTRIWLG  87

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S +A+D+R+AA EAAE FR 
Sbjct  88    TYPTPEMAARAHDVAALALRGK-SACLNFADSSWRLPVPVSKEAQDIRRAAHEAAEMFRS  146

Query  665   KECEE------EIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGS  504
              E E+        V +  + ++       +D      MP                G L +
Sbjct  147   GETEKCGVEYSGEVSSRNSELKQENDVSYIDEEAVFDMP----------------GLLAN  190

Query  503   MADGNLLSP  477
             MA+G LLSP
Sbjct  191   MAEGPLLSP  199



>ref|XP_007218312.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|EMJ19511.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|AGL07695.1| CBF/DREB 6 [Prunus persica]
 gb|AGS13699.1| C-repeat binding factor [Prunus persica]
Length=229

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 128/179 (72%), Gaps = 12/179 (7%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEE++LA + PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  40    SDEELLLASTYPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPT  99

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA+ LRG+ +A LNFADS WRLPVPAS +AKD++  A EAAEAFRP   E
Sbjct  100   AEMAARAHDVAAIKLRGR-SACLNFADSAWRLPVPASANAKDIQTTASEAAEAFRPP-AE  157

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
               + ++  ++V A       +  +         M+ +    GM  G L +MA+G LLSP
Sbjct  158   GSVEVSGASAVAASESKSASEQVF--------YMDEEAVF-GMP-GLLANMAEGMLLSP  206



>gb|AAS77819.1| CBF3 [Solanum lycopersicum]
 gb|ACB45090.1| CRT binding factor 3 [Solanum pimpinellifolium]
Length=205

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 126/188 (67%), Gaps = 14/188 (7%)
 Frame = -3

Query  1061  YGFPQGEGWSGG----RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKW  894
             Y  P+ E  S      RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KW
Sbjct  3     YSDPRIESCSSFSDSIRANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKW  62

Query  893   VCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDA  714
             VCE+REP K+ RIWLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP P S D 
Sbjct  63    VCEVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPDSSDT  121

Query  713   KDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFL  534
             KD++KAA +AAE FRP + EEE  +    S   P     +D      MP        G L
Sbjct  122   KDIQKAAAQAAEIFRPLKSEEEESVVKDQST-TPDDMFFMDEEALFCMP--------GLL  172

Query  533   TGMQGGFL  510
             T M  G +
Sbjct  173   TNMAEGLM  180



>gb|ABP64695.1| putative C-repeat binding protein 4 [Populus trichocarpa]
Length=209

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 123/183 (67%), Gaps = 17/183 (9%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
             +E  E  V               + G  +V         P         G L  MA+G L
Sbjct  138   QEFGENDVFFKEAVF-------AMPGENDVFFEEAVFDMP---------GLLVDMAEGLL  181

Query  485   LSP  477
             LSP
Sbjct  182   LSP  184



>gb|AIQ82502.1| CBF4, partial [Populus balsamifera]
Length=246

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>gb|AIQ82473.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82474.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82475.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82476.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82477.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82478.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82479.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82480.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82481.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82482.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82486.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82487.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82488.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82489.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82490.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82491.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82492.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82493.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82494.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82495.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82496.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82497.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82498.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82499.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82500.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82501.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82503.1| CBF4, partial [Populus balsamifera]
Length=231

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>ref|XP_009611054.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana tomentosiformis]
Length=232

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             ++SDEEV+LA + PKKRAGRKKF+ETRHPVYRG+RRRN+NKWVCE+REP K+ RIWLGT+
Sbjct  40    NYSDEEVMLASNYPKKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTF  99

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+P S  AKD++KAAVEAAEAFRP
Sbjct  100   PTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPTSAAAKDIQKAAVEAAEAFRP  156



>ref|XP_002299565.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
 gb|EEE84370.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
Length=213

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 125/183 (68%), Gaps = 13/183 (7%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
             +E          ++ EA      + G  +V         P         G L  MA+G L
Sbjct  138   QEFGGHPAKQQDSNAEA---VFAMPGENDVFFEEAVFDMP---------GLLVDMAEGLL  185

Query  485   LSP  477
             LSP
Sbjct  186   LSP  188



>gb|AEK94313.1| C-repeat binding factor 4, partial [Fragaria x ananassa]
Length=198

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 142/217 (65%), Gaps = 26/217 (12%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVY  927
             M  S+S+SD N  GG G          R + SDEEV+LAE+ PKKRAGRKKFKETRHPVY
Sbjct  1     MLESSSHSD-NNSGGVG----------RMALSDEEVMLAETYPKKRAGRKKFKETRHPVY  49

Query  926   RGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSV  747
             RGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAA+ALRG+  A LNFADS 
Sbjct  50    RGVRRRNSGKWVCEVREPNKKTRIWLGTFPTTEMAARAHDVAAIALRGR-NACLNFADSA  108

Query  746   WRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMP  567
             WRLPVPAS  AKD++ AA EAAEAFRP   E E+V     +VE                P
Sbjct  109   WRLPVPASNSAKDIQTAAAEAAEAFRPNRGESEVVSKATEAVEEESE-----------QP  157

Query  566   SPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKG  456
                + E D F  GM  G L +MA+G LL P    G G
Sbjct  158   VFYMDEEDVF--GMP-GLLANMAEGMLLPPPHYNGYG  191



>ref|XP_011030036.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Populus euphratica]
Length=251

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  56    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  115

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  116   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  174

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M    I        GM  G L +MA+G LL P 
Sbjct  175   GGELMRTVDEGEKAADTAAEAGEEVFYMDEEAIF-------GMP-GLLANMAEGMLLPP-  225

Query  473   PSLGKG  456
             P  G G
Sbjct  226   PHCGGG  231



>gb|KDP25515.1| hypothetical protein JCGZ_20671 [Jatropha curcas]
Length=230

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 2/130 (2%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R +HSDEEV+LA S PK++AGR+ FKETRHPVYRGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  29    REAHSDEEVLLATSLPKRKAGRRVFKETRHPVYRGVRKRNGNKWVCELREPNKKTRIWLG  88

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVPAS DAK++R+AA +AAE FR 
Sbjct  89    TYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPASRDAKEIRRAASQAAEMFRR  147

Query  665   KECEEEIVIT  636
             +E  +++ IT
Sbjct  148   EES-DDVQIT  156



>ref|XP_011101172.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Sesamum indicum]
Length=203

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 130/189 (69%), Gaps = 23/189 (12%)
 Frame = -3

Query  1043  EGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQ  864
             E  S  +   SDEEVILA + PKKRAGRKKF+ETRHPVYRGVRRR++ KWVCE+REP K+
Sbjct  18    ESSSVEKVHFSDEEVILASNNPKKRAGRKKFRETRHPVYRGVRRRDSGKWVCEVREPNKK  77

Query  863   KRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEA  684
              RIWLGT+PTPEMAARAHDVAA+ALRG+ +A LNFADS WRLPVPASVDAKD+RKAA +A
Sbjct  78    SRIWLGTFPTPEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASVDAKDIRKAAADA  136

Query  683   AEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGS  504
             AEAFRP+  E    + +P                        +M+ D  L GM    L  
Sbjct  137   AEAFRPQSSEPSAAVASPEGFS--------------------LMD-DEALYGMH-ELLDD  174

Query  503   MADGNLLSP  477
             MA+G LL P
Sbjct  175   MAEGLLLPP  183



>gb|EYU19514.1| hypothetical protein MIMGU_mgv1a026630mg [Erythranthe guttata]
Length=229

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 132/204 (65%), Gaps = 26/204 (13%)
 Frame = -3

Query  1055  FPQGEGWSGGRAS--HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEI  882
              PQ +  S    S  HSDEEV LA + PKKRAGRKKF+ETRHPVYRGVR R++ KWVCE+
Sbjct  21    LPQSDQQSSCFTSKNHSDEEVNLASNNPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEV  80

Query  881   REPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLR  702
             REP K+ RIWLGT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++
Sbjct  81    REPNKKTRIWLGTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQ  139

Query  701   KAAVEAAEAFRPK-------ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPD  543
             K A EAAEAFRP+       +  EE  +       +P     +D               +
Sbjct  140   KTAAEAAEAFRPQSSSDSGGDAREETAVAANNYTASPENMYFMD---------------E  184

Query  542   GFLTGMQGGFLGSMADGNLLSPAP  471
               + GM  G + +MA+G ++ P P
Sbjct  185   EMMFGMH-GLVDNMAEGLMMMPPP  207



>gb|AIQ82504.1| CBF4, partial [Populus deltoides]
Length=228

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>gb|ACE73696.1| DREB4 [Nicotiana tabacum]
Length=232

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             ++SDEEV+LA + PKKRAGRKKF+ETRHPVYRG+RRRN+NKWVCE+REP K+ RIWLGT+
Sbjct  40    NYSDEEVMLASNYPKKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWLGTF  99

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+P S  AKD++KA VEAAE FRP E
Sbjct  100   PTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPTSAAAKDIQKATVEAAETFRPVE  158

Query  659   CEEE  648
                E
Sbjct  159   SHRE  162



>ref|XP_002318846.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
 gb|EEE97066.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
Length=255

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAETTAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLLPP-  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>gb|ABK95675.1| unknown [Populus trichocarpa]
Length=255

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAGTTAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLLPP-  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>gb|AGY31292.1| C-repeat binding factor 4c [Populus euphratica]
Length=223

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|AHN65494.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65498.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65499.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65500.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65501.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65502.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP+K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPSKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|EYU19512.1| hypothetical protein MIMGU_mgv1a025309mg [Erythranthe guttata]
Length=229

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = -3

Query  1055  FPQGEGWSGGRAS--HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEI  882
              PQ +  S    S  HSDEEV LA + PKKRAGRKKF+ETRHPVYRGVR R++ KWVCE+
Sbjct  21    LPQSDQQSSCFTSKNHSDEEVNLASNNPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEV  80

Query  881   REPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLR  702
             REP K+ RIWLGT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++
Sbjct  81    REPNKKTRIWLGTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQ  139

Query  701   KAAVEAAEAFRPKECEE  651
             K A EAAEAFRP+   +
Sbjct  140   KTAAEAAEAFRPQSSSD  156



>gb|ABD90468.1| dehydration-responsive element-binding protein 1A [Chrysanthemum 
x morifolium]
Length=203

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 127/186 (68%), Gaps = 19/186 (10%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S SDE+V LA   PKKRAGRKKFKETRHPVYRGVR+R++ KWVCE+REP K+K +WLGTY
Sbjct  18    STSDEDVHLASQNPKKRAGRKKFKETRHPVYRGVRKRDSGKWVCEVREPNKKKSVWLGTY  77

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT +MAARAHDVA LA+RG+ +  LNFADS+WRLPVP S + KD++KAAV+AAEAFRP  
Sbjct  78    PTADMAARAHDVAVLAMRGR-SVCLNFADSLWRLPVPKSSNVKDIQKAAVKAAEAFRP--  134

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
               +++ +   +               N +  +  I   D  +  MQ GF   MA+G +L 
Sbjct  135   VNDDVALAEES---------------NQVKENHVIYMDDDVVFEMQ-GFFADMAEGMMLP  178

Query  479   PAPSLG  462
             P  S+G
Sbjct  179   PPKSIG  184



>ref|XP_011029176.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
 ref|XP_011014145.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
Length=240

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>gb|KDP22330.1| hypothetical protein JCGZ_26161 [Jatropha curcas]
Length=225

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGFPQGEGWSG-GRASHSDEEVILAESRPKKRAGRKKFKETRHPV  930
             MD+ +  SDP   GG+  P  +  S   R + SDEE++LA S PKKRAGRKKF+ETRHPV
Sbjct  1     MDFLSCYSDPLPFGGFDSPVSDSCSAPARTNFSDEELMLASSYPKKRAGRKKFRETRHPV  60

Query  929   YRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADS  750
             YRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAALALRG+ +A LNFADS
Sbjct  61    YRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGR-SACLNFADS  119

Query  749   VWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              WRLPVPAS D KD++KAA EAA AFRP E +
Sbjct  120   SWRLPVPASSDPKDIQKAAAEAARAFRPVEAD  151



>gb|AHN65439.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65444.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65445.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65446.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65455.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65471.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65482.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65484.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65485.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65486.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65488.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65491.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|AHN65457.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|AHN65438.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65440.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65442.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65447.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65448.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65449.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65451.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65453.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65458.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65459.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65460.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65461.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65462.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65463.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65464.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65465.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65466.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65467.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65468.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65470.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65475.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65476.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65477.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65483.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65487.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65489.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65490.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65495.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65497.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>ref|XP_010317563.1| PREDICTED: CBF1 protein isoform X1 [Solanum lycopersicum]
Length=206

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 122/183 (67%), Gaps = 20/183 (11%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             RA+HSDEEVILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVCE+REP K+ RIWLG
Sbjct  19    RANHSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKWVCEVREPNKKTRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP P S D KD++KAA +A E FR 
Sbjct  79    TFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPDSSDTKDIQKAAAQAVEIFRS  137

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
             +E   E   +  TS         VD      MP                G L +MA+G +
Sbjct  138   EEVSGE---SPETSENVQESSDFVDEEAIFFMP----------------GLLANMAEGLM  178

Query  485   LSP  477
             L P
Sbjct  179   LPP  181



>gb|AHN13908.1| dehydration-responsive element binding factor [Populus nigra]
 gb|AHN65443.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65450.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65452.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65454.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65469.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65472.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65473.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65474.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65478.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65479.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65480.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65481.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65492.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65493.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65496.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|AIQ82483.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82484.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82485.1| CBF4, partial [Populus balsamifera]
Length=231

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ R WLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRXWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>gb|AIQ82507.1| CBF4, partial [Populus deltoides]
Length=228

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLGTYP
Sbjct  39    HSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYP  98

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             TPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP+E
Sbjct  99    TPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRPQE  156



>ref|XP_010255545.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Nelumbo nucifera]
Length=229

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 136/186 (73%), Gaps = 16/186 (9%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A+HSDEE++LA S PKKRAGRKKF+ETRHPVYRGVRRRN+N+WVCE+REP K+ RIWLGT
Sbjct  32    ATHSDEEIMLASSHPKKRAGRKKFRETRHPVYRGVRRRNSNRWVCEVREPNKKSRIWLGT  91

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT EMAARAHDVAALALRG+ +A LNFADS WRLPVP S DAKD++KAA EAAEAFRP 
Sbjct  92    FPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPVSTDAKDIQKAAAEAAEAFRPP  150

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIME----PDGFLTGMQGGFLGSMAD  495
             +  + +   +   V+A       D T  + M   P  E     +  + GM  G L +MA+
Sbjct  151   QDSDTM---SNEDVKA-------DNTAPMSMSPEPDNEEMYVDEEAIFGM-PGLLANMAE  199

Query  494   GNLLSP  477
             G LLSP
Sbjct  200   GLLLSP  205



>gb|AGY31291.1| C-repeat binding factor 4b [Populus euphratica]
Length=252

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  56    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  115

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD+++AA EAA  FRP+ C 
Sbjct  116   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQRAAAEAAGGFRPEGCV  174

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M    +        GM  G L +MA+G LL P 
Sbjct  175   GGELMRTVDEGEKAADTAAEAGEEVFYMDEEAVF-------GMP-GLLANMAEGMLLPP-  225

Query  473   PSLGKG  456
             P  G G
Sbjct  226   PHCGGG  231



>gb|AIQ82505.1| CBF4, partial [Populus deltoides]
Length=228

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLGTYP
Sbjct  39    HSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYP  98

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             TPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP+E
Sbjct  99    TPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRPQE  156



>gb|AHN65441.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>ref|XP_006358387.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Solanum tuberosum]
Length=244

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 136/208 (65%), Gaps = 23/208 (11%)
 Frame = -3

Query  1013  SDEE--VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             SDEE  ++LA SRPKKRAGRKKFKETRHP+YRGVRRRNN+KWVCE+REP++QKRIWLGTY
Sbjct  21    SDEEGILLLASSRPKKRAGRKKFKETRHPIYRGVRRRNNSKWVCELREPSQQKRIWLGTY  80

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
              TPEMAARAHDVAALALRG   ATLNFADS WRLPVPAS D KD+R+AAV AA+AF  ++
Sbjct  81    STPEMAARAHDVAALALRGNL-ATLNFADSRWRLPVPASKDPKDIRQAAVIAAQAF-SQD  138

Query  659   CE--------EEIVITTPTSV--EApppppPVDGTWNVLMPSPPIMEPDGFLTGMQG---  519
              E        EEI  +T   +  +        +G+          ++ +  L    G   
Sbjct  139   TELVGIDGMIEEINSSTIDEIKYQEIDITRANNGSSRDFGAKELCIDMENNLCCNWGEDN  198

Query  518   ------GFLGSMADGNLLSPAPSLGKGF  453
                   G+   MA+G L SP P LG  F
Sbjct  199   DMLEMEGWQEKMAEGLLFSPTPRLGSCF  226



>gb|AHN65456.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  19    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  78

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D++D+ +AA EAAE FRP
Sbjct  79    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSQDITRAANEAAELFRP  137

Query  665   KE  660
             +E
Sbjct  138   QE  139



>gb|AIQ82376.1| CBF3, partial [Populus balsamifera]
Length=198

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  10    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  69

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  70    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  128

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  129   GQVMEDXRREDRGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  185



>gb|ACB45080.1| CRT binding factor 2 [Solanum habrochaites]
Length=223

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 125/186 (67%), Gaps = 18/186 (10%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             +EE+ILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVCE+REP K+ RIWLGT+PT 
Sbjct  35    NEEIILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKWVCEVREPNKKSRIWLGTFPTV  94

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDV ALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP +  E
Sbjct  95    EMAARAHDVTALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESE  153

Query  650   EIVITTP-TSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
             E+   +P TS         VD      MP                G L +MA+G +L P 
Sbjct  154   EVSGESPETSENVQESSYFVDEEALFFMP----------------GLLANMAEGLMLPPP  197

Query  473   PSLGKG  456
               L  G
Sbjct  198   QCLEIG  203



>gb|ACB45088.1| CRT binding factor 2 [Solanum habrochaites]
Length=223

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 126/186 (68%), Gaps = 18/186 (10%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             +EE+ILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVCE+REP K+ RIWLGT+PT 
Sbjct  35    NEEIILASNYPKKPAGRKKFRETRHPVYRGVRKRNSGKWVCEVREPNKKSRIWLGTFPTV  94

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP +  E
Sbjct  95    EMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESE  153

Query  650   EIVITTP-TSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
             E+   +P TS         VD      MP                G L +MA+G +L P 
Sbjct  154   EVSGESPETSENVQESSYFVDEEALFFMP----------------GLLANMAEGLMLPPP  197

Query  473   PSLGKG  456
               L  G
Sbjct  198   QCLEIG  203



>gb|AIQ82369.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82370.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82371.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82372.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82373.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82374.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82375.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82377.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82378.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82379.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82380.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82381.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82382.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82383.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82384.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82385.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82386.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82387.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82388.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82389.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82390.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82391.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82392.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82393.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82394.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82395.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82396.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82397.1| CBF3, partial [Populus balsamifera]
Length=198

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  10    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  69

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  70    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  128

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  129   GQVMEDFRREDRGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  185



>gb|ACB45082.1| CRT binding factor 5 [Solanum tuberosum]
Length=189

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             + +  +ILA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RIWLGTYP
Sbjct  5     NKNSSLILASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKSRIWLGTYP  64

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAA+ALRG  +A LNFADS WRLP PAS D KD++KAA EAAE+FRP + 
Sbjct  65    TAEMAARAHDVAAIALRGG-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFRPLKS  123

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             EEE V++T      P     +D      MP        G LT M  G +
Sbjct  124   EEESVVSTGDQSSTPDNMFFMDEEALFCMP--------GLLTNMAEGLM  164



>gb|AGH33879.1| DREB68 [Populus hopeiensis]
Length=255

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN +KWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGSKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FRP
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRP  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>gb|AIQ82506.1| CBF4, partial [Populus deltoides]
Length=228

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R  HSDEEV+LA S PKKRAGR+ F+ETRHPV+RGVR+RN NKWVCE+REP K+ RIWLG
Sbjct  36    RVVHSDEEVLLATSFPKKRAGRRIFRETRHPVFRGVRKRNGNKWVCEMREPNKKSRIWLG  95

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR 
Sbjct  96    TYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFRX  154

Query  665   KE  660
             +E
Sbjct  155   QE  156



>emb|CBJ94884.1| CBF2 protein [Populus balsamifera]
Length=208

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  28    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  87

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  88    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  146

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  147   GQVMEDFRREDRGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  203



>ref|XP_010324621.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Solanum lycopersicum]
Length=244

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 131/207 (63%), Gaps = 21/207 (10%)
 Frame = -3

Query  1013  SDEE--VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S+EE  ++LA S+PKKRAGRKKFKETRHPVYRGVRRRNNNKWVCE+REP++QKRIWLGTY
Sbjct  21    SNEEGILLLASSQPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCELREPSQQKRIWLGTY  80

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
              TPEMAARAHDVAALALRG   ATLNFADS W LPVPAS D KD+R+AAV AA+AF    
Sbjct  81    STPEMAARAHDVAALALRGNL-ATLNFADSRWGLPVPASKDPKDIRQAAVMAAQAFSQDT  139

Query  659   -------CEEEIVITTPTSV--EApppppPVDGTWNVLMPSPPIMEPDGFLTGMQG----  519
                      EE+   T   +  +        DG+ +        ++ +  L    G    
Sbjct  140   ELVGVDYMNEEVNSNTIDEIKYQEIDIARANDGSSSDFGAKELCIDMENILCCNWGEDND  199

Query  518   -----GFLGSMADGNLLSPAPSLGKGF  453
                  G+   MA G L SP P LG  F
Sbjct  200   MLEMEGWQEKMAKGLLFSPTPRLGSCF  226



>gb|ABC79626.1| CBF1 [Populus tomentosa]
Length=231

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLAASRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++    T           D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDHTTENRGEVCSSTNDDIRD--LPSENVSYIDEEAEFNLPGLLANMAEGLLLSP  210



>gb|AIU92956.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 124/186 (67%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M    + E          G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAVETAAEAGEEVFYMDDEAVFE--------MPGLLANMAEGTLLPP-  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>ref|XP_010106004.1| Dehydration-responsive element-binding protein 1D [Morus notabilis]
 gb|AHJ25986.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC07187.1| Dehydration-responsive element-binding protein 1D [Morus notabilis]
Length=239

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RAS+SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+ RIWL
Sbjct  42    SRASNSDEEVILAASRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCELREPNKKTRIWL  101

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAALA RG+ +A LNFADS WRLP PAS DA D+  AA EAA+AFR
Sbjct  102   GTYPTAEMAARAHDVAALAFRGR-SACLNFADSTWRLPAPASSDANDICAAAAEAAKAFR  160

Query  668   PKE  660
             P+E
Sbjct  161   PRE  163



>ref|XP_002509702.1| Dehydration-responsive element-binding protein 1A, putative [Ricinus 
communis]
 gb|EEF51089.1| Dehydration-responsive element-binding protein 1A, putative [Ricinus 
communis]
Length=234

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             G +SHSDEEVILA + PKK AGR+ FKETRHPV+RGVRRRN NKWVCE+R P K+ RIWL
Sbjct  35    GGSSHSDEEVILASNLPKKPAGRRVFKETRHPVFRGVRRRNGNKWVCEVRVPNKKSRIWL  94

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPTPEMAARAHDVAALALRG+ +A LNF+DS WRLP+P+S  A+++R+ A EAAE+FR
Sbjct  95    GTYPTPEMAARAHDVAALALRGK-SACLNFSDSAWRLPIPSSTSAREIRRIAAEAAESFR  153

Query  668   PKE  660
             P+E
Sbjct  154   PQE  156



>gb|AIU92962.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPRGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGNVGEKAAETAAGAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGDG  234



>emb|CBJ94893.1| CBF2 protein [Populus trichocarpa]
Length=211

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  27    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  86

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  87    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  145

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  146   GQVMEDFRREDRGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  202



>gb|AIQ82398.1| CBF3, partial [Populus deltoides]
Length=198

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  8     SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  67

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  68    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  126

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  127   GQVMEDFRREDCGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  183



>gb|AIQ82400.1| CBF3, partial [Populus deltoides]
Length=198

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  8     SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  67

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  68    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  126

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  127   GQVMEDFRREDCGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  183



>gb|AIU92952.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAETAAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>gb|AIQ82399.1| CBF3, partial [Populus deltoides]
 gb|AIQ82401.1| CBF3, partial [Populus deltoides]
Length=198

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  8     SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  67

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  68    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  126

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  127   GQVMEDFRREDCGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  183



>ref|XP_002298067.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
 gb|EEE82872.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
Length=231

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVRSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  210



>gb|AIU92955.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGNVREKAAETAAGAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGDG  234



>gb|ABP98987.1| CBF/DREB1 transcription factor 1 [Betula pendula]
Length=202

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -3

Query  1055  FPQGEGWSGGRASH-SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIR  879
             F Q    S   A H SDEE+ LA   PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+R
Sbjct  4     FSQYSSESESGAMHLSDEEIRLASRNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVR  63

Query  878   EPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRK  699
             EP KQ RIWLGT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLPVPAS  AKD+++
Sbjct  64    EPNKQSRIWLGTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPVPASGTAKDIQR  122

Query  698   AAVEAAEAFRPKE  660
              A EAAE FRP E
Sbjct  123   TAAEAAEEFRPAE  135



>gb|AIU92950.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92954.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92966.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAETAAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>gb|ADU03763.1| C-repeat binding factor transcriptional activator [Malus domestica]
Length=178

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  32    ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEVREPNKKKSRIWLG  91

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+D+ D+R+AA EAAE FRP
Sbjct  92    TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASIDSVDIRRAAAEAAETFRP  150

Query  665   KE  660
              E
Sbjct  151   AE  152



>gb|AIU92949.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAETAAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>gb|ABO48365.1| C-repeat binding facor 3 [Populus trichocarpa]
Length=231

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L SMA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCSSTNDDIRD--LPSENVGYIDEEAEFNMPGLLASMAEGLLLSP  210



>gb|AIU92965.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGC  176



>gb|AIU92946.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92968.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGNVGEKAAETAAGAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGDG  234



>emb|CBI34750.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 124/196 (63%), Gaps = 25/196 (13%)
 Frame = -3

Query  1037  WSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKR  858
             W   R   SDEEV+LA  RPKKRAGR+KFKETRHPVYRGVRRRN NKWVCE+REP K+ R
Sbjct  17    WQTRRTIQSDEEVLLASDRPKKRAGRRKFKETRHPVYRGVRRRNGNKWVCELREPNKKSR  76

Query  857   IWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAE  678
             IWLGTYPT EMAARAHDVAALA RG+  A LNFADS W LPVP S D+ ++R+AA  AAE
Sbjct  77    IWLGTYPTAEMAARAHDVAALAFRGR-KACLNFADSAWSLPVPVSKDSMEIRRAAAAAAE  135

Query  677   AFRPKECEEEIV-ITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             AFRP+E ++         SVEA                          L     G L +M
Sbjct  136   AFRPQEFQDHSSGDARKESVEAAES-----------------------LIFDTAGLLITM  172

Query  500   ADGNLLSPAPSLGKGF  453
             A+  L SP P LG GF
Sbjct  173   AEEPLHSPPPCLGDGF  188



>gb|AAY43213.1| CRT/DRE binding factor 1 [Hevea brasiliensis]
Length=231

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 138/229 (60%), Gaps = 24/229 (10%)
 Frame = -3

Query  1163  MVVHFYY*EFVRFNVFSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAES  984
             M V   Y + + F   S  + Y  S++  + C           S  RA+ SDEEV+LA S
Sbjct  1     MDVFPQYSDSLPFATHSCSLHYPESSTLSDTC-----------SALRANLSDEEVLLASS  49

Query  983   RPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdv  804
              PKKRAGRKKF+ETRHP+YRGVRRRN+ KWVCEIREP K+ RIWLGT+PT EMAARAHDV
Sbjct  50    YPKKRAGRKKFRETRHPIYRGVRRRNSGKWVCEIREPNKKSRIWLGTFPTEEMAARAHDV  109

Query  803   aalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTS  624
             AALALRG+ +A LNFADS WRLPVPAS +AKD+RKAA EAA AF+P+             
Sbjct  110   AALALRGR-SACLNFADSSWRLPVPASREAKDIRKAAAEAAMAFQPE------------G  156

Query  623   VEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              E        +  W        +   D        G L SMA+G LL P
Sbjct  157   TEGFSGELKQENKWTTESAPEDVFYMDEEAVFAMPGLLASMAEGMLLPP  205



>gb|AIU92957.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGNVGEKAAETAAGAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGDG  234



>gb|AIU92964.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK---  663
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  662   -----ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMA  498
                     +E      T+ EA      +D      MP                G L +MA
Sbjct  178   GGELMRTGDEGEKAVETAAEAGDEVFYMDDVAVFGMP----------------GLLANMA  221

Query  497   DGNLLSPAPSLGKG  456
             +G LL P P  G G
Sbjct  222   EGMLLPP-PHCGGG  234



>ref|XP_009759409.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=210

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 132/184 (72%), Gaps = 23/184 (13%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SDEEV+LA + PKKRAGRKKF+ETRHPVYRGVR+RN++KWVCE+R+P K+ RIWL
Sbjct  27    NRANLSDEEVLLASNNPKKRAGRKKFRETRHPVYRGVRKRNSDKWVCEVRQPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAA+ALRG+ +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87    GTYPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGN  489
             P E E +    +P + E+      +D      MP                G L SMA+G 
Sbjct  146   PSESEAD----SPETPES--NKLFMDEEALFCMP----------------GLLASMAEGL  183

Query  488   LLSP  477
             +L P
Sbjct  184   MLPP  187



>gb|ABP98988.1| CBF/DREB1 transcription factor 2 [Betula pendula]
Length=202

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -3

Query  1031  GGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIW  852
              G    SDEE+ LA   PKKRAGR KFKETRHPVYRGVRRRN+ KWVCE+REP KQ RIW
Sbjct  13    SGAMHLSDEEIQLASRNPKKRAGRTKFKETRHPVYRGVRRRNSGKWVCEVREPNKQSRIW  72

Query  851   LGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  672
             LGT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLP+PAS  AKD+++ AVEAAEAF
Sbjct  73    LGTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPLPASGTAKDIQRTAVEAAEAF  131

Query  671   RPKE  660
             RP E
Sbjct  132   RPTE  135



>ref|XP_008361312.1| PREDICTED: dehydration-responsive element-binding protein 1A-like, 
partial [Malus domestica]
Length=211

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 101/122 (83%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA S PKKRAGR+ F ETRHPVYRG RR NN+KWVCE+REP K+K RIWLG
Sbjct  6     ASFSDEEVILASSTPKKRAGRRVFNETRHPVYRGARRMNNDKWVCEMREPNKKKSRIWLG  65

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAAR HDVAALA RG+ A  LNFADS WRLPVPAS D+ D+R+AA EAAE FRP
Sbjct  66    TYPTAEMAARVHDVAALAFRGRLAC-LNFADSAWRLPVPASFDSVDVRRAAEEAAETFRP  124

Query  665   KE  660
              E
Sbjct  125   AE  126



>gb|AIU92963.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK---  663
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  662   -----ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMA  498
                     +E      T+ EA      +D      MP                G L +MA
Sbjct  178   GGELMRTGDEGEKAVETAAEAGEEVFYMDDEAVFGMP----------------GLLANMA  221

Query  497   DGNLLSPAPSLGKG  456
             +G LL P P  G G
Sbjct  222   EGMLLPP-PHCGGG  234



>gb|AIU92947.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92951.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92959.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92960.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92961.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92969.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92970.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK---  663
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  662   -----ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMA  498
                     +E      T+ EA      +D      MP                G L +MA
Sbjct  178   GGELMRTGDEGEKAVETAAEAGEEVFYMDDEAVFGMP----------------GLLANMA  221

Query  497   DGNLLSPAPSLGKG  456
             +G LL P P  G G
Sbjct  222   EGMLLPP-PHCGGG  234



>gb|AIU92948.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK---  663
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  662   -----ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMA  498
                     +E      T+ EA      +D      MP                G L +MA
Sbjct  178   GGELLRTGDEGEKAVETAAEAGEEVFYMDDEAVFGMP----------------GLLANMA  221

Query  497   DGNLLSPAPSLGKG  456
             +G LL P P  G G
Sbjct  222   EGMLLPP-PHCGGG  234



>ref|XP_006358389.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Solanum tuberosum]
Length=249

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 131/205 (64%), Gaps = 24/205 (12%)
 Frame = -3

Query  998  ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaa  819
            +LA S+PKKRAGRKKFKETRHP+YRGVRRR+NNKWVCE+REP +QKRIWLGTYPTPEMAA
Sbjct  28   LLASSQPKKRAGRKKFKETRHPIYRGVRRRDNNKWVCEVREPIEQKRIWLGTYPTPEMAA  87

Query  818  rahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK--------  663
            RAHDVAALALRG   ATLNFADS WRL VP S D ++LR+AA++AAEAF           
Sbjct  88   RAHDVAALALRGNL-ATLNFADSSWRLAVPVSKDPEELRQAAMKAAEAFLQDTESVEINY  146

Query  662  ------------ECEEEIVITTPT-SVEApppppPVDGTWNVLMPSPPIMEPD-GFLTGM  525
                        +C+E IV+   + S         V+   N+ M S      + G    +
Sbjct  147  MNHEEINYSEGVKCQENIVVGGASGSDNNNLVGNEVNNIQNMEMDSILCYNNNWGGNNEI  206

Query  524  QG-GFLGSMADGNLLSPAPSLGKGF  453
            +G  +   M++G+L SP P L   F
Sbjct  207  EGSSWQEKMSEGHLFSPTPHLDSYF  231



>gb|ACB45098.1| CRT binding factor 2B [Solanum tuberosum]
Length=226

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 130/187 (70%), Gaps = 9/187 (5%)
 Frame = -3

Query  1013  SDEEVI-LAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             SDEEVI LA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  28    SDEEVINLASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKSRIWLGTFP  87

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP+  
Sbjct  88    TVEMAARAHDVAALALRGRRSACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPESE  147

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
             E     ++ T+ E       ++ T+ +   S   M+ +        G + +MA+G +L P
Sbjct  148   EVSGECSSSTTPET------LENTFFMKEESSLFMDEEALF--YMPGLIVNMAEGLMLPP  199

Query  476   APSLGKG  456
                L  G
Sbjct  200   PQCLEIG  206



>gb|EYU19513.1| hypothetical protein MIMGU_mgv1a020585mg [Erythranthe guttata]
Length=221

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             ++SDEE+ LA + PKKRAGRKKF+ETRHPVYRGVR R++ KWVCE+REP K+ RIWLGT+
Sbjct  32    NYSDEELNLASNNPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEVREPNKKTRIWLGTF  91

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFRP +
Sbjct  92    PTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFRPSD  150



>gb|EYU19515.1| hypothetical protein MIMGU_mgv1a026372mg [Erythranthe guttata]
Length=227

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 127/183 (69%), Gaps = 11/183 (6%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             +DEEV LA + PKKRAGRKKF+ETRHPVYRGVR R++ KWVCE+REP K+ RIWLGT+PT
Sbjct  32    TDEEVNLASNNPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEVREPNKKTRIWLGTFPT  91

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFRP+   
Sbjct  92    AEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFRPQS--  148

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIME--PDGFLTGMQGGFLGSMADGNLLS  480
                  ++ +  +A           N    SP  M    +  + GM  G + +MA+G ++ 
Sbjct  149   -----SSDSGSDAREETATPAAAANNYTASPENMYFMDEEMMFGMH-GLVDNMAEGLMMM  202

Query  479   PAP  471
             P P
Sbjct  203   PPP  205



>gb|AFV93473.1| CBF transcription factor [Juglans regia]
Length=214

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = -3

Query  1061  YGFPQGEGWSGGRA-SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCE  885
             Y  P  E  S GR  + SDEE++LA   PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE
Sbjct  7     YNSPDSESSSYGRGLNFSDEELLLASRNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCE  66

Query  884   IREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDL  705
             +R+P K+ RIWLGT+PT +MAARAHDVAA+A+RG+ +A LNFADSV RLPVPAS D KD+
Sbjct  67    VRQPNKKSRIWLGTFPTADMAARAHDVAAIAMRGR-SACLNFADSVRRLPVPASGDVKDI  125

Query  704   RKAAVEAAEAFRPKE  660
             ++ A EAAE FRP E
Sbjct  126   QRTAAEAAELFRPAE  140



>ref|XP_004308117.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Fragaria vesca subsp. vesca]
Length=229

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 148/228 (65%), Gaps = 25/228 (11%)
 Frame = -3

Query  1139  EFVRFNVFSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGR  960
             ++   N   S++  S+S+SD N  GG G          R + SDEEV+LA + PKKRAGR
Sbjct  10    QYYDHNPVGSDLLESSSHSDNN-SGGVG----------RMALSDEEVMLAGTYPKKRAGR  58

Query  959   KKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQ  780
             KKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAA+ALRG+
Sbjct  59    KKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGR  118

Query  779   FAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEAppppp  600
              +A LNFADS WRLPVPAS  AKD++ AA EAAEAFRP   E E+V     +VEA    P
Sbjct  119   -SACLNFADSAWRLPVPASNSAKDIQTAAAEAAEAFRPNGEESEVVSKAAEAVEAESEQP  177

Query  599   PVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKG  456
                            M+ +  + GM  G L +MA+G LL P    G G
Sbjct  178   VF------------YMDVEEDVFGMP-GLLANMAEGMLLPPPQYSGYG  212



>ref|XP_009609482.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana tomentosiformis]
Length=217

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 130/188 (69%), Gaps = 23/188 (12%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SDEEV+LA + PKKRAGRKKF ETRHPVYRGVR+RN++KWVCE+R P K+ RIWL
Sbjct  27    NRANLSDEEVLLASNNPKKRAGRKKFHETRHPVYRGVRKRNSDKWVCEMRLPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP  EMAARAHDVAA+ALR + +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87    GTYPIAEMAARAHDVAAIALRSR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  668   PKECE----EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             P E E    E    TTP ++E       +D      MP                GFL SM
Sbjct  146   PSESETISGESCAGTTPETLE--NDKFFMDEEALFCMP----------------GFLASM  187

Query  500   ADGNLLSP  477
             A+G +L P
Sbjct  188   AEGLMLPP  195



>gb|AIU92958.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 126/194 (65%), Gaps = 26/194 (13%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK---  663
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+   
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRV  177

Query  662   -----ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMA  498
                     +E      T+ EA      +D      MP                G L +MA
Sbjct  178   GGELMRTGDEGEKAVETAAEAGEEVFYMDDEAVFGMP----------------GLLANMA  221

Query  497   DGNLLSPAPSLGKG  456
             +G LL P P  G G
Sbjct  222   EGMLLPP-PHRGGG  234



>gb|ACB45097.1| CRT binding factor 2A [Solanum tuberosum]
Length=234

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 120/173 (69%), Gaps = 6/173 (3%)
 Frame = -3

Query  1013  SDEEVI-LAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             SDEEVI LA + PKK AGRKKF+ETRHPV+RG+R RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  36    SDEEVINLASNNPKKPAGRKKFRETRHPVFRGIRMRNSGKWVCEVREPNKKSRIWLGTFP  95

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FRP E 
Sbjct  96    TAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFRPSES  154

Query  656   EEE----IVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             EE       ITTP + E            +  M    +    G +  M  G +
Sbjct  155   EEVSGECSNITTPETPEKALSMNEEAQVNSFFMDEEALFYMPGLIANMAEGLM  207



>ref|XP_009586780.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009586781.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
isoform X2 [Nicotiana tomentosiformis]
Length=217

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 130/188 (69%), Gaps = 23/188 (12%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SDEEV+LA + PKKRAGRKKF ETRHPVYRGVR+RN++KWVCE+R P K+ RIWL
Sbjct  27    NRANLSDEEVLLASNNPKKRAGRKKFHETRHPVYRGVRKRNSDKWVCEMRLPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP  EMAARAHDVAA+ALRG+ +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87    GTYPIAEMAARAHDVAAIALRGR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  668   PKECE----EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             P E E    E    TTP ++E       +D      MP                G L SM
Sbjct  146   PSESEAISGESCAGTTPETLE--NDKFFMDEEALFCMP----------------GLLASM  187

Query  500   ADGNLLSP  477
             A+G +L P
Sbjct  188   AEGLMLPP  195



>gb|AGN53198.1| CBF-like protein [Camellia sinensis]
Length=239

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 129/188 (69%), Gaps = 17/188 (9%)
 Frame = -3

Query  1034  SGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRI  855
             +G  A  SDEEV+LA S PKKR GRKK +ETRH VYRGVR R+N+KWVCE+REP K+ RI
Sbjct  38    AGPAARFSDEEVLLASSCPKKRGGRKKVRETRHQVYRGVRWRSNSKWVCEVREPNKKSRI  97

Query  854   WLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEA  675
             WLGT+PT EMAARAHDVAA+ALRG+ A  LNFADSVW+LP+PAS+   D++KAA EAAEA
Sbjct  98    WLGTFPTAEMAARAHDVAAIALRGRLAC-LNFADSVWKLPIPASLKPTDIQKAATEAAEA  156

Query  674   FRPKECEEEIV--ITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             FRP     E+   +T P +V A              MP   +   +  + GM  GFL +M
Sbjct  157   FRPSLQYLEVSGDVTKPENVPAT-------------MPEKILYVDEEAVFGMP-GFLANM  202

Query  500   ADGNLLSP  477
             ++G +L P
Sbjct  203   SEGLMLPP  210



>gb|AEF79999.1| DREB transcription factor [Corylus heterophylla]
Length=227

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             HSDEEVILA S+PK+RAGRKKFKETRHPVYRGVRRRNNNKWV E+R+P ++ RIWLGTYP
Sbjct  32    HSDEEVILASSKPKRRAGRKKFKETRHPVYRGVRRRNNNKWVSEMRKPKEKTRIWLGTYP  91

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             + EMAARAHDVAALALRG  +A LNFADS W L +PAS DA ++R+AA  AAE FRP + 
Sbjct  92    SAEMAARAHDVAALALRGT-SACLNFADSAWSLRMPASTDAGEIRRAAAVAAEGFRPSD-  149

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
             ++ +      SV+       +D           +M  D        G L  MA G LLSP
Sbjct  150   DQFVEEDCGESVKGSCEELVLDHHHQ-----ESVMYLDEEALYDMPGLLVKMAQGLLLSP  204

Query  476   AP  471
              P
Sbjct  205   PP  206



>gb|ADE41100.1| AP2 domain class transcription factor [Malus domestica]
Length=236

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  32    ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLG  91

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+D+ D+R+AA EAAE FRP
Sbjct  92    TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASIDSVDIRRAAAEAAETFRP  150

Query  665   KE  660
              E
Sbjct  151   AE  152



>ref|XP_008364557.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Malus domestica]
 gb|AGL07698.1| CBF/DREB 2 [Malus domestica]
 gb|AGM16327.1| C-repeat binding factor 2 [Malus domestica]
Length=236

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  32    ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLG  91

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+D+ D+R+AA EAAE FRP
Sbjct  92    TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASIDSVDIRRAAAEAAETFRP  150

Query  665   KE  660
              E
Sbjct  151   AE  152



>gb|AHN65437.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D     +  G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFIMPGLLANMAEGLLLSP  210



>gb|AFA50332.1| dehydration-responsive element-binding protein 2 [Manihot esculenta]
Length=231

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  1040  GWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK  861
             G S  RAS SDEEV+LA S PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ 
Sbjct  32    GCSAPRASLSDEEVLLASSYPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKS  91

Query  860   RIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAA  681
             RIWLGT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++KAA EAA
Sbjct  92    RIWLGTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASTDAKDIQKAAAEAA  150

Query  680   EAFRP  666
              AF+P
Sbjct  151   MAFQP  155



>dbj|BAN51850.2| putative C-repeat binding factor 2 [Pyrus pyrifolia var. culta]
Length=236

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  32    ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLG  91

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+D+ D+R+AA EAAE FRP
Sbjct  92    TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASIDSVDIRRAAAEAAETFRP  150

Query  665   KE  660
              E
Sbjct  151   AE  152



>gb|AIU92953.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA   PKKRAGRKK +ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  59    SDEEVMLASRNPKKRAGRKKLRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  118

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C 
Sbjct  119   AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCV  177

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPA  474
                ++ T    E         G     M        D  + GM  G L +MA+G LL P 
Sbjct  178   GGELMRTGDEGEKAAETAAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PP  228

Query  473   PSLGKG  456
             P  G G
Sbjct  229   PHCGGG  234



>ref|XP_008234474.1| PREDICTED: dehydration-responsive element-binding protein 1B 
[Prunus mume]
Length=268

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 14/180 (8%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SD+EV+LA + PKKRAGRKKFKETRHPVYRGVRRRN+ KWV E+REP K+ RIWLGT+PT
Sbjct  79    SDDEVLLASTYPKKRAGRKKFKETRHPVYRGVRRRNSGKWVSEVREPNKKTRIWLGTFPT  138

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR-PKEC  657
              EMAARAHDVAA+ALRG+ +A LNFADS WRLPVPAS +AKD++  A EAAEAFR P E 
Sbjct  139   AEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASANAKDIQTTASEAAEAFRPPAEG  197

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +E+     +   A  P      +  V       M+ +    GM  G L +MA+G LLSP
Sbjct  198   SDEV-----SGASAVAPSECASASEQVF-----YMDEEAVF-GMP-GLLANMAEGMLLSP  245



>gb|AFB83707.1| CBF1 [Manihot esculenta]
Length=231

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  1040  GWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK  861
             G S  RAS SDEEV+LA S PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ 
Sbjct  32    GCSAPRASLSDEEVLLASSYPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKS  91

Query  860   RIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAA  681
             RIWLGT+PT EMAARAHDVAALALRG ++A LNFADS WRLPVPAS DAKD++KAA EAA
Sbjct  92    RIWLGTFPTAEMAARAHDVAALALRG-WSACLNFADSSWRLPVPASTDAKDIQKAAAEAA  150

Query  680   EAFRP  666
              AF+P
Sbjct  151   MAFQP  155



>gb|ABC79627.1| CBF2 [Populus tomentosa]
Length=231

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN ++WVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLAASRPKKRAGRRIFKETRHPIFRGVRKRNGDRWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++    T           D   +  +PS  +   D          L +MA+G LLSP
Sbjct  154   GQVMEDHTTEDRGEVCSSTNDDIRD--LPSENVSYIDEEAESNMPWLLANMAEGLLLSP  210



>ref|XP_008369501.1| PREDICTED: dehydration-responsive element-binding protein 1A-like, 
partial [Malus domestica]
Length=211

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 100/122 (82%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA S PKKRAGR+ F ETRHPVYRG RR NN+KWVCE+REP K+K RIWLG
Sbjct  6     ASFSDEEVILASSTPKKRAGRRVFNETRHPVYRGARRXNNDKWVCEMREPNKKKSRIWLG  65

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAAR HDVAALA RG+ A  LNFAD  WRLPVPAS D+ D+R+AA EAAE FRP
Sbjct  66    TYPTAEMAARVHDVAALAFRGRLAC-LNFADXAWRLPVPASXDSVDVRRAAEEAAETFRP  124

Query  665   KE  660
              E
Sbjct  125   AE  126



>ref|NP_001274919.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26757.1| AP2 domain CBF protein [Solanum tuberosum]
Length=227

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 130/190 (68%), Gaps = 18/190 (9%)
 Frame = -3

Query  1013  SDEEVI-LAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             SDEEVI LA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  32    SDEEVINLASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKSRIWLGTFP  91

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAA AHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP+  
Sbjct  92    TVEMAAIAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPE--  148

Query  656   EEEI---VITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
              EE+     TTP ++E          T+ +   S   M+ +        G + +MA+G +
Sbjct  149   SEEVSGECSTTPETLE---------NTFFMKEESSLFMDEEALF--YMPGLIANMAEGLM  197

Query  485   LSPAPSLGKG  456
             L P   L  G
Sbjct  198   LPPPQCLEIG  207



>gb|AGH33880.1| DREB69 [Populus hopeiensis]
Length=231

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLAASRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++    T           D   +  +PS  +   D          L +MA+G LLSP
Sbjct  154   GQVMEDHTTEDRGEVCSSTNDDIRD--LPSENVSYIDEEAEFNMPWLLANMAEGLLLSP  210



>ref|XP_009781787.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=219

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+HSDEEV+LA + PKKRAGRKKF+ETRHPVYRGVR+RN++KWVCE+REP K+ RIWL
Sbjct  27    NRANHSDEEVMLASNNPKKRAGRKKFRETRHPVYRGVRKRNSDKWVCELREPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+P+ EMAARAHDVAA+ALRG  +A LNFADS W+LP+PAS DAKD++KAA EAAEAFR
Sbjct  87    GTFPSAEMAARAHDVAAIALRGH-SACLNFADSAWKLPIPASTDAKDIQKAAAEAAEAFR  145

Query  668   PKECE  654
               E E
Sbjct  146   SSEAE  150



>gb|ABO48363.1| C-repeat binding facor 1 [Populus trichocarpa]
Length=192

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 121/181 (67%), Gaps = 10/181 (6%)
 Frame = -3

Query  998  ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaa  819
            +LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAA
Sbjct  1    MLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAA  60

Query  818  rahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVI  639
            RAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C    ++
Sbjct  61   RAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELM  119

Query  638  TTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGK  459
             T    E         G     M    +        GM  G L +MA+G LL P P  G 
Sbjct  120  RTGDEGEKAAETTAEAGEEVFYMDDEAVF-------GMP-GLLANMAEGMLLPP-PHCGG  170

Query  458  G  456
            G
Sbjct  171  G  171



>gb|AHN65392.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65393.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65394.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65395.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65396.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65397.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|AHN65433.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEKAEFNMPGLLANMAEGLLLSP  210



>gb|AFA50331.1| dehydration-responsive element-binding protein 1 [Manihot esculenta]
Length=219

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 142/220 (65%), Gaps = 32/220 (15%)
 Frame = -3

Query  1127  FNVFSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFK  948
             F+ +S  + +++ +  P+ C    F             SDE+++LA S PKKRAGRKKF+
Sbjct  4     FSQYSDSLPFASHSWSPDTCSAANF-------------SDEDILLASSYPKKRAGRKKFR  50

Query  947   ETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAAT  768
             ETRHPVYRGVR+RN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAALALRG+ +A 
Sbjct  51    ETRHPVYRGVRQRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGR-SAC  109

Query  767   LNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE---EEIVITTPTSVEApppppP  597
             LNFADS WRLPVPAS +AKD++KAA EAA AF+P   E   EE+ +   T+ EA      
Sbjct  110   LNFADSSWRLPVPASSEAKDIQKAAAEAAMAFQPVGTEGFCEEVKLENKTTTEA------  163

Query  596   VDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                T  V       M+ +    GM  G L  MA+G LL P
Sbjct  164   --ATEEVF-----YMDEEAVF-GMP-GLLAYMAEGMLLPP  194



>gb|AAG43549.1|AF211531_1 Avr9/Cf-9 rapidly elicited protein 111B [Nicotiana tabacum]
Length=219

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+HSDEEV+LA + PKKRAGRKKF+ETRHPVYRGVR+RN++KWVCE+REP K+ RIWL
Sbjct  27    NRANHSDEEVMLASNNPKKRAGRKKFRETRHPVYRGVRKRNSDKWVCELREPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+P+ EMAARAHDVAA+ALRG+ +A LNFADS W+LP+PAS DAKD++KAA EAAEAFR
Sbjct  87    GTFPSAEMAARAHDVAAIALRGR-SACLNFADSAWKLPIPASTDAKDIQKAAAEAAEAFR  145

Query  668   PKECE  654
               E E
Sbjct  146   SSEAE  150



>ref|XP_009339654.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Pyrus x bretschneideri]
Length=236

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  32    ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLG  91

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS D+ D+R+AA EAAE FRP
Sbjct  92    TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASTDSVDIRRAAAEAAETFRP  150

Query  665   KE  660
              E
Sbjct  151   AE  152



>gb|AGR40677.1| C-repeat binding factor 3 [Medicago truncatula]
Length=227

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -3

Query  1100  YSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRG  921
             Y T+NS  +       P  EG      S  +EE+ LA + PKKRAGRKKFKETRHPVYRG
Sbjct  2     YPTTNSVSSSSSDMSLPNSEG--SHWMSICNEEMRLAATTPKKRAGRKKFKETRHPVYRG  59

Query  920   VRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWR  741
             VR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LNFADS WR
Sbjct  60    VRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWR  118

Query  740   LPVPASVDAKDLRKAAVEAAEAFRP  666
             LP PA+  AKD++KAA EAAEAFRP
Sbjct  119   LPKPATTQAKDIQKAATEAAEAFRP  143



>gb|AHN13909.1| dehydration-responsive element binding factor [Populus nigra]
 gb|AHN65373.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65374.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65375.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65376.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65377.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65378.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65379.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65380.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65381.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65382.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65383.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65384.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65385.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65386.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65387.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65389.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65390.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65391.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65398.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65399.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65400.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65401.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65402.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65403.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65404.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65405.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65406.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65407.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65408.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65409.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65410.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65411.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65413.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65414.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65415.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65416.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65419.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65420.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65421.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65422.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65423.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65424.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65425.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65426.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65427.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65428.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65429.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65430.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65431.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65432.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65434.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|AHN65388.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|AHN65412.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEICCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|KEH26611.1| dehydration-responsive element-binding protein, putative [Medicago 
truncatula]
Length=227

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -3

Query  1100  YSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRG  921
             Y T+NS  +       P  EG      S  +EE+ LA + PKKRAGRKKFKETRHPVYRG
Sbjct  2     YPTTNSVSSSSSDMSLPNSEG--SHWMSICNEEMRLAATTPKKRAGRKKFKETRHPVYRG  59

Query  920   VRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWR  741
             VR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LNFADS WR
Sbjct  60    VRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWR  118

Query  740   LPVPASVDAKDLRKAAVEAAEAFRP  666
             LP PA+  AKD++KAA EAAEAFRP
Sbjct  119   LPKPATTQAKDIQKAATEAAEAFRP  143



>gb|ABB72792.1| dehydration responsive element binding protein [Medicago truncatula]
 gb|ABX80064.1| CRT/DRE binding factor 3 [Medicago truncatula]
 gb|AGR40676.1| C-repeat binding factor 3 [Medicago truncatula]
Length=227

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -3

Query  1100  YSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRG  921
             Y T+NS  +       P  EG      S  +EE+ LA + PKKRAGRKKFKETRHPVYRG
Sbjct  2     YPTTNSVSSSSSDMSLPNSEG--SHWMSICNEEMRLAATTPKKRAGRKKFKETRHPVYRG  59

Query  920   VRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWR  741
             VR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LNFADS WR
Sbjct  60    VRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWR  118

Query  740   LPVPASVDAKDLRKAAVEAAEAFRP  666
             LP PA+  AKD++KAA EAAEAFRP
Sbjct  119   LPKPATTQAKDIQKAATEAAEAFRP  143



>gb|AGR40678.1| C-repeat binding factor 3 [Medicago truncatula]
Length=229

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -3

Query  1100  YSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRG  921
             Y T+NS  +       P  EG      S  +EE+ LA + PKKRAGRKKFKETRHPVYRG
Sbjct  2     YPTTNSVSSSSSDMSLPNSEG--SHWMSICNEEMRLAATTPKKRAGRKKFKETRHPVYRG  59

Query  920   VRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWR  741
             VR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LNFADS WR
Sbjct  60    VRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWR  118

Query  740   LPVPASVDAKDLRKAAVEAAEAFRP  666
             LP PA+  AKD++KAA EAAEAFRP
Sbjct  119   LPKPATTQAKDIQKAATEAAEAFRP  143



>gb|AEM97873.1| AP2 domain class transcription factor [Corylus mandshurica]
 gb|AEM97874.1| CBF domain class transcription factor [Corylus yunnanensis]
Length=227

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             H++EEVILA S+PK+RAGRKKFKETRHPVYRGVRRRNNNKWV E+R+P ++ RIWLGTYP
Sbjct  32    HANEEVILASSKPKRRAGRKKFKETRHPVYRGVRRRNNNKWVSEMRKPNEKTRIWLGTYP  91

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             + EMAARAHD+AALALRG  +A LNFADS W L VPAS DA ++R+AA  AAE FRP + 
Sbjct  92    SAEMAARAHDLAALALRGT-SACLNFADSAWSLRVPASTDAGEIRRAAAVAAEGFRPSD-  149

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
             ++ +      SV+       +D           +M  D        G L  MA G LLSP
Sbjct  150   DQFVEEDCGESVKGSCEELVLDHHHQ-----ESVMYLDEEALYDMPGLLVKMAQGLLLSP  204

Query  476   AP  471
              P
Sbjct  205   PP  206



>gb|AHZ90672.1| CBF/DREB1 transcription factor 1 [Fraxinus mandshurica]
Length=222

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 124/184 (67%), Gaps = 19/184 (10%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SDEEV+LA + PK+RAGRKKF ETRHPVYRGVRRR + KWVCE+REP K+ RIWL
Sbjct  36    SRANFSDEEVLLASNNPKRRAGRKKFNETRHPVYRGVRRRKSGKWVCEVREPNKKSRIWL  95

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+PT EMAARAHDVAA+ALR + +A LNFADS W+LPVPAS DAKD++KAA EAA+ F 
Sbjct  96    GTFPTAEMAARAHDVAAIALRRR-SACLNFADSAWKLPVPASTDAKDIQKAAAEAAKTFG  154

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGN  489
                 E +      TS EA             + P       +  L GM  G + +MA+G 
Sbjct  155   QPNSESD------TSEEA-----------TAISPENVFSTDEEALFGMP-GLIDNMAEGL  196

Query  488   LLSP  477
             +L P
Sbjct  197   MLPP  200



>gb|ABF29699.1| AP2 domain CBF protein [Populus suaveolens]
Length=231

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLAASRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++    T           D   +  +PS  +   D          L +MA+G LLSP
Sbjct  154   GQVMEDFTTEGRGEVCSSSNDDIRD--LPSENVSYIDEEAEFNMPWLLANMAEGLLLSP  210



>gb|AHN65417.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 122/179 (68%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
               ++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GHVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>ref|XP_009118070.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Brassica rapa]
 gb|AHL44968.1| CBF6A [Brassica rapa subsp. chinensis]
 emb|CDY26574.1| BnaA09g47030D [Brassica napus]
Length=205

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             ++++++LAE RPKKRAGR  FKETRHPVYRG+RRRN +KWVCEIREPT Q+RIWLGTYPT
Sbjct  3     NNDDIMLAEMRPKKRAGRIVFKETRHPVYRGIRRRNGDKWVCEIREPTHQRRIWLGTYPT  62

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP E E
Sbjct  63    AEMAARAHDVAAFALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFRPTEFE  121

Query  653   EEIVI  639
               I +
Sbjct  122   SGITV  126



>ref|XP_009791610.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana sylvestris]
Length=235

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 134/196 (68%), Gaps = 10/196 (5%)
 Frame = -3

Query  1040  GWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK  861
             G   G  ++ DEEV+LA + PKKRAGRKKF+ETRHPVYRG+RRRN+NKWVCE+REP K+ 
Sbjct  36    GSCSGTPNYFDEEVMLASNYPKKRAGRKKFRETRHPVYRGIRRRNSNKWVCEVREPNKKS  95

Query  860   RIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAA  681
             RIWLGT+PT EMAARAHDVAA+AL+G+ +A LNFADS WRLP+PAS  AKD++KAA EAA
Sbjct  96    RIWLGTFPTAEMAARAHDVAAIALKGR-SACLNFADSAWRLPIPASAAAKDIQKAAAEAA  154

Query  680   EAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSM  501
             EAFRP   E +I  +    ++        +   NVL      ++ +        G L +M
Sbjct  155   EAFRP--LESDIENSREIIIDLVIQEVVAELPDNVL-----FLDEEALF--YMPGLLANM  205

Query  500   ADGNLLSPAPSLGKGF  453
             A+G +L P   +  G+
Sbjct  206   AEGLMLPPPQCIIDGY  221



>emb|CDY16016.1| BnaC08g41070D [Brassica napus]
Length=201

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             ++++++LAE RPKKRAGR  FKETRHPVYRG+RRRN +KWVCEIREPT Q+RIWLGTYPT
Sbjct  3     NNDDIMLAEMRPKKRAGRIVFKETRHPVYRGIRRRNGDKWVCEIREPTHQRRIWLGTYPT  62

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP E E
Sbjct  63    AEMAARAHDVAAFALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFRPTEFE  121

Query  653   EEIVI  639
               I +
Sbjct  122   SGITV  126



>gb|ABY78835.1| putative DRE-binding protein DREB1 [Medicago sativa]
Length=216

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  1046  GEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTK  867
              + +S   AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  
Sbjct  15    SKDFSPFDASSPDSEVRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNT  74

Query  866   QKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVE  687
             + RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS+WRLP+PAS   KD++KAA +
Sbjct  75    KTRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFADSMWRLPIPASSSIKDIQKAATK  133

Query  686   AAEAFRP  666
             AAEAFRP
Sbjct  134   AAEAFRP  140



>ref|XP_009593083.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Nicotiana tomentosiformis]
Length=234

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = -3

Query  1025  RASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             RA  SDEEVIL A S+PKKRAGRKKFKETRHPVYRGVR+RNN+KWVCE+REP+ QKRIWL
Sbjct  15    RAETSDEEVILLASSKPKKRAGRKKFKETRHPVYRGVRKRNNDKWVCELREPSTQKRIWL  74

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             G+YPT EMAARAHDV ALAL+G   ATLNFADS WRL VP S D KDLR+AA +AAEAFR
Sbjct  75    GSYPTVEMAARAHDVVALALKGHL-ATLNFADSAWRLQVPVSKDPKDLRQAAAKAAEAFR  133

Query  668   PKE  660
             P E
Sbjct  134   PGE  136



>gb|AHH86060.1| CRT/DRE-binding factor 2 [Avicennia marina]
Length=227

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -3

Query  1040  GWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK  861
             G S  R + SDEEVILA + PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ 
Sbjct  35    GGSCNRTNFSDEEVILASNTPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKS  94

Query  860   RIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAA  681
             RIWLGT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRL VPAS DAKD++KAA EAA
Sbjct  95    RIWLGTFPTVEMAARAHDVAAMALRGR-SACLNFADSAWRLTVPASTDAKDIQKAAAEAA  153

Query  680   EAFRPKECE  654
             EAFRP+  E
Sbjct  154   EAFRPQALE  162



>gb|ABX80063.1| CRT/DRE binding factor 2 [Medicago truncatula]
Length=230

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 8/169 (5%)
 Frame = -3

Query  1106  MDYSTSNSDPNY-----CGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKET  942
             MD  T+N+  ++     C    FP  EG  G   S S+EEV LA + PKKRAGRKKFKET
Sbjct  1     MDMFTNNNSYSHPFSPTCSESSFPNSEGSQG--MSISNEEVRLAATTPKKRAGRKKFKET  58

Query  941   RHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLN  762
             RHPVYRGVR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LN
Sbjct  59    RHPVYRGVRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LN  117

Query  761   FADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEA  615
             FADS WRLP+PA+  AKD++KAA +AAEAFRP +      I T  S  A
Sbjct  118   FADSAWRLPIPATTQAKDIQKAAAQAAEAFRPDKTSITNDIDTAISTSA  166



>gb|AHN65418.1| dehydration-responsive element binding factor protein [Populus 
nigra]
Length=231

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNF+DS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFSDSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDRGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|ACY38600.1| DREB-like protein 1 [Medicago sativa subsp. x varia]
Length=216

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  1046  GEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTK  867
              + +S   AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  
Sbjct  15    SKDFSPFDASSPDSEVRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNT  74

Query  866   QKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVE  687
             + RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS+WRLP+PAS   KD++KAA +
Sbjct  75    KTRIWLGTFPTPEMAARAHDVAAVALRGRYAC-LNFADSMWRLPIPASSSIKDIQKAATK  133

Query  686   AAEAFRP  666
             AAEAFRP
Sbjct  134   AAEAFRP  140



>gb|AHN65435.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65436.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFRTSDLG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +++                D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQVMEDFRREDCGEVCCSTNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|ACB45091.1| CBF1-2 fusion protein [Solanum pimpinellifolium]
Length=216

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 123/183 (67%), Gaps = 18/183 (10%)
 Frame = -3

Query  1001  VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMa  822
             VILA + PKK AGRKKF+ETRHP+YRG+R+RN+ KWVCE+REP K+ RIWLGT+PT EMA
Sbjct  31    VILASNNPKKPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMA  90

Query  821   arahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIV  642
             ARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FRP +  EE+ 
Sbjct  91    ARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESEEVS  149

Query  641   ITTP-TSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSL  465
               +P TS         VD      MP                G L +MA+G +L P   L
Sbjct  150   GESPETSENVQESSDFVDEEALFSMP----------------GLLANMAEGLMLPPPQCL  193

Query  464   GKG  456
               G
Sbjct  194   EIG  196



>gb|AGH33881.1| DREB70 [Populus hopeiensis]
Length=254

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 125/184 (68%), Gaps = 10/184 (5%)
 Frame = -3

Query  1007  EEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPE  828
             +EV+LA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT E
Sbjct  60    DEVMLASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAE  119

Query  827   MaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEE  648
             MAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FRP+ C   
Sbjct  120   MAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGG  178

Query  647   IVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPS  468
              ++ T    E         G     M        D  + GM  G L +MA+G LL P P 
Sbjct  179   ELMRTVDEGEKAAETAAEAGEEVFYM-------DDEAVFGMP-GLLANMAEGMLL-PPPH  229

Query  467   LGKG  456
              G G
Sbjct  230   CGGG  233



>ref|XP_011076240.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Sesamum indicum]
Length=225

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 124/170 (73%), Gaps = 10/170 (6%)
 Frame = -3

Query  1163  MVVHFYY*EFVRFNVFSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAES  984
             MV  +Y   F R   F      +T++S  + C   G P          + SDEEVILA +
Sbjct  3     MVASYYTETFPRMQDF---WPATTTSSAESSCES-GSPTTTA-----TNFSDEEVILASN  53

Query  983   RPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdv  804
              PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDV
Sbjct  54    NPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTVEMAARAHDV  113

Query  803   aalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             AA+ALRG+ +A LNFADS WRLPVPAS +AKD+RKAA EAAEAFRP+  E
Sbjct  114   AAMALRGR-SACLNFADSAWRLPVPASANAKDIRKAAAEAAEAFRPQALE  162



>ref|XP_004140794.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Cucumis sativus]
 gb|KGN57337.1| hypothetical protein Csa_3G180260 [Cucumis sativus]
Length=213

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDE+ +LA S PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  27    SDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  86

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA+ALRG F A LNFADS WRLPVPAS DA+D++KAA EAAEAFRP E +
Sbjct  87    AEMAARAHDVAAIALRG-FTACLNFADSAWRLPVPASADARDIQKAAAEAAEAFRPSESD  145



>gb|KEH26600.1| dehydration-responsive element-binding protein 1B [Medicago truncatula]
Length=260

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 8/169 (5%)
 Frame = -3

Query  1106  MDYSTSNSDPNY-----CGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKET  942
             MD  T+N+  ++     C    FP  EG  G   S S+EEV LA + PKKRAGRKKFKET
Sbjct  1     MDMFTNNNSYSHPFSPTCSESSFPNSEGSQG--MSISNEEVRLAATTPKKRAGRKKFKET  58

Query  941   RHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLN  762
             RHPVYRGVR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LN
Sbjct  59    RHPVYRGVRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LN  117

Query  761   FADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEA  615
             FADS WRLP+PA+  AKD++KAA +AAEAFRP +      I T  S  A
Sbjct  118   FADSAWRLPIPATTQAKDIQKAAAQAAEAFRPDKTSITNDIDTAISTSA  166



>ref|XP_004234350.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Solanum lycopersicum]
 gb|AAS77821.1| CBF2 [Solanum lycopersicum]
Length=220

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 125/188 (66%), Gaps = 20/188 (11%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S ++E +ILA + PKK AGRKKF+ETRHPVYRG+R+RN+ KWVCE+REP K+ RIWLGT+
Sbjct  33    SPNEEVIILASNNPKKPAGRKKFRETRHPVYRGIRKRNSGKWVCEVREPNKKTRIWLGTF  92

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT EMAARAHDVAA+ALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FR +E
Sbjct  93    PTAEMAARAHDVAAIALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFRSEE  151

Query  659   CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLS  480
                E   +  TS         VD      MP                G L +MA+G +L 
Sbjct  152   VSGE---SPETSENVQESSDFVDEEALFSMP----------------GLLANMAEGLMLP  192

Query  479   PAPSLGKG  456
             P   L  G
Sbjct  193   PPQCLEIG  200



>gb|AGR40694.1| C-repeat binding factor 6 [Medicago truncatula]
Length=216

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN NKWVCE+REP  + RIWLGT
Sbjct  23    ASSPDSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTKNRIWLGT  82

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP 
Sbjct  83    FPTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFRPD  141

Query  662   ECEEEIVITTPTSVEA  615
                    I T  +V A
Sbjct  142   NTLMTSDIDTVVAVVA  157



>gb|AIY26287.1| CRT/DRE-binding factor [Mangifera indica]
Length=234

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 138/223 (62%), Gaps = 25/223 (11%)
 Frame = -3

Query  1106  MDYSTSNSDPN-YCGGYGFP------------QGEGWSGGRASHSDEEVILAESRPKKRA  966
             M++ +S SDP+ Y  G+  P             G      R   SDE+V+LA S PKKRA
Sbjct  1     MEFFSSFSDPHPYSSGFWSPGSDLPTASSPISDGNSSISRRGKFSDEDVLLAASYPKKRA  60

Query  965   GRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalR  786
             GR KF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAALALR
Sbjct  61    GRTKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTVEMAARAHDVAALALR  120

Query  785   GQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEAppp  606
             G+ A  LNFADS WRLPVP S DAKD++KAA EAAEAFRP + E  +   +   VE    
Sbjct  121   GRMAC-LNFADSAWRLPVPTSTDAKDIQKAAAEAAEAFRPTQEEGGLKQESEKMVEEE--  177

Query  605   ppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                        M        +  + GM  G L +MA+G LL P
Sbjct  178   --------RTTMSDEVFFMDEEAVFGMP-GLLANMAEGMLLPP  211



>gb|KEH26590.1| CBF/DREB1 transcription factor [Medicago truncatula]
Length=248

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN NKWVCE+REP  + RIWLGT
Sbjct  23    ASSPDSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTKNRIWLGT  82

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP 
Sbjct  83    FPTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFRPD  141

Query  662   ECEEEIVITTPTSVEA  615
                    I T  +V A
Sbjct  142   NTLMTSDIDTVVAVVA  157



>ref|XP_011029177.1| PREDICTED: dehydration-responsive element-binding protein 1E 
[Populus euphratica]
Length=228

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  32    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  91

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  92    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTTDFG  150

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              + +              P D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  151   GQEMEYFRREDRGEVCSSPNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  207



>gb|AGR40696.1| C-repeat binding factor 5 [Medicago truncatula]
Length=266

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -3

Query  1043  EGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQ  864
             + +S   AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN NKWVCE+REP  +
Sbjct  15    KDFSPFDASSPDSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTK  74

Query  863   KRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEA  684
              RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNF+DSVWRLP+PA+   KD++KAA +A
Sbjct  75    NRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFSDSVWRLPIPATSAIKDIQKAATKA  133

Query  683   AEAFRP  666
             AEAFRP
Sbjct  134   AEAFRP  139



>ref|XP_004171792.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 1C-like [Cucumis sativus]
Length=213

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDE+ +LA S PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  27    SDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  86

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA+ALRG F A LNFADS WRLPVPAS DA+D++KAA EAAEAFRP E +
Sbjct  87    AEMAARAHDVAAIALRG-FTACLNFADSAWRLPVPASADARDIQKAAAEAAEAFRPSESD  145



>ref|XP_011014147.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
Length=231

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTTDFG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              + +              P D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQEMEYFRREDRGEVCSSPNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>gb|AGY31293.1| C-repeat binding factor 2 [Populus euphratica]
Length=231

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             S+E+V+LA SRPKKRAGR+ FKETRHP++RGVR+RN +KWVCE+REP K+ RIWLGTYPT
Sbjct  35    SNEKVLLATSRPKKRAGRRIFKETRHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPT  94

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
             PEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR  +  
Sbjct  95    PEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFRTTDFG  153

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              + +              P D   +  +PS  +   D        G L +MA+G LLSP
Sbjct  154   GQEMEYFRREDRGEVCSSPNDDIRD--LPSENVGYIDEEAEFNMPGLLANMAEGLLLSP  210



>ref|XP_010058217.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Eucalyptus grandis]
Length=286

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = -3

Query  1031  GGRASHSDEE--VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKR  858
                A+ SDEE  V LA SRPK+ AGRK FKETRHPVYRGVRRRN  KWVCE+REP+K+ R
Sbjct  31    ASHAACSDEEPAVALASSRPKRPAGRKVFKETRHPVYRGVRRRNRGKWVCELREPSKKTR  90

Query  857   IWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAE  678
             +WLGTYPT EMAARAHDVAALALRG+    LNFADS WRLP+PAS +A ++R+ A+ AAE
Sbjct  91    VWLGTYPTAEMAARAHDVAALALRGRHGVCLNFADSAWRLPLPASHEAAEIRRTAMAAAE  150

Query  677   AFRPKECEEEI  645
             AFRP E EE +
Sbjct  151   AFRPAEAEEAV  161



>ref|NP_172721.1| dehydration-responsive element-binding protein 1F [Arabidopsis 
thaliana]
 sp|Q9LN86.1|DRE1F_ARATH RecName: Full=Dehydration-responsive element-binding protein 
1F; Short=Protein DREB1F [Arabidopsis thaliana]
 gb|AAF88096.1|AC025417_24 T12C24.14 [Arabidopsis thaliana]
 gb|AAT44959.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 dbj|BAF00148.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28901.1| dehydration-responsive element-binding protein 1F [Arabidopsis 
thaliana]
Length=209

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             +++++ILAE RPKKRAGR+ FKETRHPVYRG+RRRN +KWVCE+REPT Q+RIWLGTYPT
Sbjct  2     NNDDIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPT  61

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              +MAARAHDVA LALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP + E
Sbjct  62    ADMAARAHDVAVLALRGR-SACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLE  120

Query  653   EEIVI  639
               I +
Sbjct  121   SGITV  125



>ref|XP_009784265.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=203

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 117/173 (68%), Gaps = 11/173 (6%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA  S+EEV+LA +  KKRAGRKKF+ETRHPVYRGVR+RN+NKWV E+RE  K+ RIWL
Sbjct  16    NRADLSEEEVMLASNNSKKRAGRKKFQETRHPVYRGVRKRNSNKWVFEVRETNKKSRIWL  75

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP+ +MAARAHDVA +ALRG+FA  LNF DSVW+LP+P S DA D+++   +AAEAFR
Sbjct  76    GTYPSADMAARAHDVATIALRGRFAC-LNFVDSVWKLPIPTSSDANDIQRVTAKAAEAFR  134

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             P +  E +    P  +E+       +  +   MP        G LT M  G +
Sbjct  135   PSDQSERVSGEYPEMLESNKSFMDEEALF--CMP--------GLLTNMAEGLM  177



>emb|CAH10191.1| avirulence-like protein 1 [Festuca arundinacea]
Length=219

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA+ SDEEVILA + PKKRAGRKKF+ETRHPVYRGVR+RN++KWVCE+REP K+ RIWL
Sbjct  27    NRANLSDEEVILASNNPKKRAGRKKFRETRHPVYRGVRKRNSDKWVCEVREPNKKSRIWL  86

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+P+ EMAARAHDVAA+AL+G+ +A LNFADS W+LP+PAS DAKD++KAA EAAEAFR
Sbjct  87    GTFPSAEMAARAHDVAAIALKGR-SACLNFADSAWKLPIPASTDAKDIQKAAAEAAEAFR  145

Query  668   PKECE  654
               E E
Sbjct  146   SSEAE  150



>ref|XP_004244599.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Solanum lycopersicum]
Length=229

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -3

Query  998  ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaa  819
            +LA S+PKKRAGRKKFKETRHPVYRGVRRR+NNKWVCE+REP++QKRIWLGTYPTPEMAA
Sbjct  15   LLASSQPKKRAGRKKFKETRHPVYRGVRRRDNNKWVCEVREPSEQKRIWLGTYPTPEMAA  74

Query  818  rahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  672
            RAHDVAALALRG   ATLNFADS WRL VP S D ++LRKAA++AAE  
Sbjct  75   RAHDVAALALRGNL-ATLNFADSSWRLTVPISKDPEELRKAAIQAAEEL  122



>ref|XP_006417217.1| hypothetical protein EUTSA_v10009978mg [Eutrema salsugineum]
 gb|ESQ35570.1| hypothetical protein EUTSA_v10009978mg [Eutrema salsugineum]
Length=203

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             + E+ILAE RPKKRAGR+ FKETRHPVYRG+RRRN +KWVCE+REPT Q+RIWLGTYPT 
Sbjct  4     NNEIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTA  63

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             EMAARAHDVAAL+LRG+ +A LNFADS WRLP P S D   +R+ A EAAE FRP E
Sbjct  64    EMAARAHDVAALSLRGR-SACLNFADSAWRLPAPESTDPDVIRRVAAEAAEMFRPAE  119



>gb|AHL44969.1| CBF6B [Brassica rapa subsp. chinensis]
Length=206

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             +++E++LAE  PK+RAGR+ FKETRHPVYRG+RRRN +KWVCE+REP  Q+RIWLGTYPT
Sbjct  3     NNDEIMLAEMTPKRRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPIHQRRIWLGTYPT  62

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP E E
Sbjct  63    AEMAARAHDVAALALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFRPTEYE  121

Query  653   EEIVIT  636
               I + 
Sbjct  122   SGITVV  127



>gb|AIU39990.1| dehydration responsive element-binding protein [Prunus pseudocerasus]
Length=239

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDE VILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K R+WLG
Sbjct  30    ASSSDENVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCELREPNKKKSRVWLG  89

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  +NFADS WRLPVPAS+D  D+R+AA EAAE FRP
Sbjct  90    TYPTAEMAARAHDVAALAFRGKLAC-INFADSAWRLPVPASMDTMDIRRAAAEAAEGFRP  148

Query  665   KE  660
             +E
Sbjct  149   EE  150



>gb|AFJ14631.1| dehydration-responsive element-binding protein, partial [Malus 
domestica]
Length=335

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDEEVILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  131   ASFSDEEVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCEMREPNKKKSRIWLG  190

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+D+ D+R+AA EAAE FR 
Sbjct  191   TYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASIDSADIRRAAAEAAETFRS  249

Query  665   KE  660
              E
Sbjct  250   AE  251



>gb|AEB69782.1| CBF [Prunus tenella]
Length=237

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -3

Query  1004  EVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLGTYPTPE  828
             +VILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLGTYPT  
Sbjct  32    DVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCELREPNKKKSRIWLGTYPTAV  91

Query  827   MaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             MAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FRP E
Sbjct  92    MAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFRPVE  146



>gb|AAV66464.1| drought responsive element binding protein [Glycine soja]
Length=234

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 3/131 (2%)
 Frame = -3

Query  1052  PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREP  873
             P  EG  G   + SDEEV LA   PKKRAGRKKF+ETRHPVYRGVRRRN++KWVCE+REP
Sbjct  26    PASEGSRG--VAFSDEEVRLAVRHPKKRAGRKKFRETRHPVYRGVRRRNSDKWVCEVREP  83

Query  872   TKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAA  693
              K+ RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS WRLPVPA+ +AKD++KAA
Sbjct  84    NKKTRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFADSAWRLPVPATAEAKDIQKAA  142

Query  692   VEAAEAFRPKE  660
              EAA+AFRP +
Sbjct  143   AEAAQAFRPDQ  153



>ref|NP_001235507.1| CBF-like protein [Glycine max]
 gb|AAQ02703.1|AF370735_1 CBF-like protein [Glycine max]
 gb|ACA64423.1| CRT binding factor 1 [Glycine max]
 gb|ACJ39208.1| CRT/DRE binding factor [Glycine max]
 gb|ACR44232.1| drought responsive element binding protein 1 [Glycine max]
 emb|CCF23018.1| drought responsive element binding protein 1 [Glycine max]
 emb|CCF23019.1| drought responsive element binding protein 1 [Glycine max]
Length=234

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 3/131 (2%)
 Frame = -3

Query  1052  PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREP  873
             P  EG  G   + SDEEV LA   PKKRAGRKKF+ETRHPVYRGVRRRN++KWVCE+REP
Sbjct  26    PASEGSRG--VAFSDEEVRLAVRHPKKRAGRKKFRETRHPVYRGVRRRNSDKWVCEVREP  83

Query  872   TKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAA  693
              K+ RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS WRLPVPA+ +AKD++KAA
Sbjct  84    NKKTRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFADSAWRLPVPATAEAKDIQKAA  142

Query  692   VEAAEAFRPKE  660
              EAA+AFRP +
Sbjct  143   AEAAQAFRPDQ  153



>ref|NP_001280599.1| dehydration-responsive element-binding protein 1E-like [Prunus 
mume]
 ref|XP_008246208.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Prunus mume]
 gb|ADF43033.2| CBF/DREB1-like protein a [Prunus mume]
Length=231

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDE VILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP K+K RIWLG
Sbjct  30    ASSSDENVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCELREPNKKKSRIWLG  89

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  +NFADS WRLP+PAS+D  D+R+AA EAAE FRP
Sbjct  90    TYPTAEMAARAHDVAALAFRGKLAC-INFADSAWRLPLPASMDTMDIRRAAAEAAEGFRP  148

Query  665   KE  660
              E
Sbjct  149   AE  150



>emb|CCF23020.1| drought responsive element binding protein 1 [Glycine max]
Length=234

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 3/131 (2%)
 Frame = -3

Query  1052  PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREP  873
             P  EG  G   + SDEEV LA   PKKRAGRKKF+ETRHPVYRGVRRRN++KWVCE+REP
Sbjct  26    PASEGSRG--VAFSDEEVRLAVRHPKKRAGRKKFRETRHPVYRGVRRRNSDKWVCEVREP  83

Query  872   TKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAA  693
              K+ RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS WRLPVPA+ +AKD++KAA
Sbjct  84    NKKTRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFADSAWRLPVPATAEAKDIQKAA  142

Query  692   VEAAEAFRPKE  660
              EAA+AFRP +
Sbjct  143   AEAAQAFRPDQ  153



>gb|ADZ23480.1| CBF transcription factor 2 [Betula platyphylla]
Length=203

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEE+ LA   PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+R+P KQ RIWLGT+PT
Sbjct  20    SDEEIQLASRNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVRQPNKQSRIWLGTFPT  79

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
              EMAARAHDVAA+ALRG  +A LNFADS  RLPVPAS  AK++++ A EAAEAFRP E
Sbjct  80    AEMAARAHDVAAIALRGN-SACLNFADSASRLPVPASGTAKEIQRTAAEAAEAFRPTE  136



>gb|ABY78834.2| putative DRE-binding protein DREB1s [Medicago falcata]
Length=184

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 4/136 (3%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             AS  + EV LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT
Sbjct  23    ASSPNSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGT  82

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP 
Sbjct  83    FPTADMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFRP-  140

Query  662   ECEEEIVITTPTSVEA  615
               +  I+IT   +V A
Sbjct  141   --DNTIMITDIETVVA  154



>ref|XP_009759325.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana sylvestris]
Length=233

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
             G  S+SDEEV+LA + PKKRAGRK F+ETRHPVYRG+RRRN+NKWVCE+REP K+ RIWL
Sbjct  39    GTPSYSDEEVMLASNYPKKRAGRKTFRETRHPVYRGIRRRNSNKWVCEVREPNKKSRIWL  98

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+PAS  AKD++KAA EAAEAFR
Sbjct  99    GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPASSAAKDIQKAAAEAAEAFR  157

Query  668   PKECEEE  648
             P E + E
Sbjct  158   PLESDGE  164



>gb|AIQ82329.1| CBF1, partial [Populus deltoides]
 gb|AIQ82330.1| CBF1, partial [Populus deltoides]
 gb|AIQ82331.1| CBF1, partial [Populus deltoides]
 gb|AIQ82332.1| CBF1, partial [Populus deltoides]
Length=202

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 127/187 (68%), Gaps = 12/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  4     AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  63

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  64    FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  122

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                   +  T   VE        D  +         M+ D    GM  G L ++A+G LL
Sbjct  123   GSLGVELTRTGDEVEKVAGTAVGDAFY---------MDDDADF-GMP-GLLANIAEGMLL  171

Query  482   SPAPSLG  462
              P    G
Sbjct  172   PPPNCCG  178



>ref|XP_010061399.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Eucalyptus grandis]
 gb|KCW90743.1| hypothetical protein EUGRSUZ_A02818 [Eucalyptus grandis]
Length=229

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 123/179 (69%), Gaps = 17/179 (9%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA  +PKKRAGRKKF+ETRHPVYRGVRRR++ KWVCE+REP K+ RIWLGT+PT
Sbjct  41    SDEEVLLASHQPKKRAGRKKFQETRHPVYRGVRRRSSGKWVCEVREPNKKSRIWLGTFPT  100

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD+++AA +AAEAFRP E E
Sbjct  101   AEMAARAHDVAALALRGR-SACLNFADSAWRLPAPASADAKDIQQAAAQAAEAFRPAESE  159

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              E V++              D      MP                G L +MA+G LL P
Sbjct  160   AEDVMSGYEKKSPSEEGMLYDDEDVFGMP----------------GLLTNMAEGMLLPP  202



>emb|CDY57075.1| BnaCnng31550D [Brassica napus]
Length=207

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             +++E++LAE  PK+RAGR+ FKETRHPVYRG+RRRN +KWVCE+REP  Q+RIWLGTYPT
Sbjct  3     NNDEIMLAEMTPKRRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPIHQRRIWLGTYPT  62

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP E E
Sbjct  63    AEMAARAHDVAAYALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFRPTEYE  121

Query  653   EEIVI  639
               I +
Sbjct  122   SGITV  126



>gb|ABU55675.1| CBF4-like protein [Ampelopsis glandulosa var. brevipedunculata]
Length=212

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 137/216 (63%), Gaps = 18/216 (8%)
 Frame = -3

Query  1091  SNSDPNYCGGYGFPQGEGWSGGRASHSD---EEVILAESRPKKRAGRKKFKETRHPVYRG  921
             + + P Y   +     + W       SD   EE++LA + PKKRAGRKKF+ETRHPVYRG
Sbjct  2     NTTSPPYSDPHPLRYTDTWGSPNLPDSDGASEELMLASTHPKKRAGRKKFRETRHPVYRG  61

Query  920   VRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWR  741
             VRRRN+ KWVCE+REP K  RIWLGT+PT EMAARAHDVAALALRG+  A LNFADS WR
Sbjct  62    VRRRNSGKWVCEVREPNKTSRIWLGTFPTAEMAARAHDVAALALRGR-GACLNFADSAWR  120

Query  740   LPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNVLMPSP  561
             L VP+S+DAKD++KAA EAAEAFRP E +E +        E             V MP  
Sbjct  121   LQVPSSLDAKDIQKAAAEAAEAFRPMENDEAMQDERREGSE-------------VRMPEN  167

Query  560   PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  453
               +  +  + GM  G L +MA+G L+ P  S+  G+
Sbjct  168   VFIMDEDDVFGMP-GLLANMAEGLLMPPPYSVTDGY  202



>gb|AGR40683.1| C-repeat binding factor 2 [Medicago truncatula]
Length=227

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 117/152 (77%), Gaps = 8/152 (5%)
 Frame = -3

Query  1106  MDYSTSNSDPNY-----CGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKET  942
             MD  T+N+  ++     C    FP  EG  G   S S+EEV LA + PKKRAGRKKFKET
Sbjct  1     MDMFTNNNSYSHPFSPTCSESSFPNSEGSQG--MSISNEEVRLAATTPKKRAGRKKFKET  58

Query  941   RHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLN  762
             RHPVYRGVR+RN +KWVCE+REP K+ +IWLGT+PT EMAARAHDVAA+ALRG++A  LN
Sbjct  59    RHPVYRGVRKRNLDKWVCEMREPNKKTKIWLGTFPTAEMAARAHDVAAMALRGRYAC-LN  117

Query  761   FADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             F DS WRLP+PA+  AKD++KAA +AAEAFRP
Sbjct  118   FVDSAWRLPIPATTQAKDIQKAAAQAAEAFRP  149



>gb|AGR40695.1| C-repeat binding factor 6 [Medicago truncatula]
Length=216

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = -3

Query  1019  SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTY  840
             S  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN NKWVCE+REP  + RIWLGT+
Sbjct  24    SSPDSEVRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTKNRIWLGTF  83

Query  839   PTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP  
Sbjct  84    PTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFRPDN  142

Query  659   CEEEIVITTPTSVEA  615
                   I T  +V A
Sbjct  143   TLMTSDIDTVVAVVA  157



>ref|XP_002886439.1| hypothetical protein ARALYDRAFT_475045 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62698.1| hypothetical protein ARALYDRAFT_475045 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             ++++ +AE +PKKRAGRK FKETRHP+YRGVRRRN +KWVCE+REP  Q+R+WLGTYPT 
Sbjct  3     NDDITVAEMKPKKRAGRKIFKETRHPIYRGVRRRNGDKWVCEVREPIHQRRVWLGTYPTA  62

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVA LALRG+ +A LNF+DS WRLPVP S D   +R+ A EAAE FRP E   
Sbjct  63    EMAARAHDVAVLALRGR-SACLNFSDSAWRLPVPESTDPDTIRRTAAEAAEMFRPPEFST  121

Query  650   EIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLG  507
              I +  P++ E       V G    L   P +  P  ++      ++G
Sbjct  122   GITV-LPSASEFDTSDEGVAGMMMRLAEEPLMSPPRSYIDMNTNMYVG  168



>gb|AHH86061.1| CRT/DRE-binding factor 3 [Avicennia marina]
 gb|AHJ08667.1| CRT/DRE-binding factor 3 [Kandelia candel]
Length=242

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 145/225 (64%), Gaps = 17/225 (8%)
 Frame = -3

Query  1103  DYSTSNSDPNYCGGYGF---------PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKF  951
             D  T +SDP+  G   +         P  +G +   A+ SDEEV+LA S PKKRAGRKKF
Sbjct  11    DSLTHDSDPHPLGSEHWSLEFPAASSPSSDGRNAPPANFSDEEVMLASSYPKKRAGRKKF  70

Query  950   KETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAA  771
             +ETRHPVYRGVRRR++ KWVCE+REP K+ RIWLGT+ T EMAARAHDVAALALRG+ +A
Sbjct  71    RETRHPVYRGVRRRDSGKWVCEVREPNKKSRIWLGTFLTAEMAARAHDVAALALRGR-SA  129

Query  770   TLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVD  591
              LNFADS WRLP+PAS +AKD+R+AA+EAAEAFRP   E      T ++ E+        
Sbjct  130   CLNFADSAWRLPLPASAEAKDIRRAALEAAEAFRPAGLE------TVSADESRQENNNES  183

Query  590   GTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKG  456
                  +         +  + G+  G L +MA+G LL+P P L + 
Sbjct  184   KELATVSSEEMFFVDEEAVFGLP-GLLANMAEGMLLTPPPCLAES  227



>ref|XP_007210188.1| hypothetical protein PRUPE_ppa017761mg [Prunus persica]
 gb|EMJ11387.1| hypothetical protein PRUPE_ppa017761mg [Prunus persica]
 gb|AGL07693.1| CBF/DREB 4 [Prunus persica]
Length=232

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWL  849
             RAS S EEVILA S PK+RAGR+ FKETRHPVYRGVRRRNN+KWVCE+R+P  +K RIWL
Sbjct  31    RASLSVEEVILASSCPKRRAGRRVFKETRHPVYRGVRRRNNDKWVCELRDPNNKKARIWL  90

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYP  EMAARAHDVAALA RG+  A LNFADS WRLPVPAS DA ++R+ A EAAEAFR
Sbjct  91    GTYPKAEMAARAHDVAALAFRGKL-ACLNFADSAWRLPVPASNDAAEIRRVANEAAEAFR  149

Query  668   PKE  660
               E
Sbjct  150   KAE  152



>ref|XP_008238783.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
isoform X1 [Prunus mume]
 ref|XP_008238784.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
isoform X2 [Prunus mume]
Length=239

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWL  849
             R S SDE+VILA SRPKKRAGR+ FKETRHPVYRGVRRRNN+KWVCE+REP K K RIWL
Sbjct  29    RTSWSDEDVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWL  88

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS+DA D+R+AA EAAE FR
Sbjct  89    GTYPTAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASMDAMDIRRAAAEAAEGFR  147

Query  668   PKE  660
             P E
Sbjct  148   PVE  150



>gb|ABP98989.1| CBF/DREB1 transcription factor 3, partial [Betula pendula]
Length=207

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 129/195 (66%), Gaps = 13/195 (7%)
 Frame = -3

Query  1046  GEGWSGGRA-SHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPT  870
             G G S  RA  + DEEV+LA S PK+RAGRKKFKETRHPVYRGVRRRN NKWVCE+R+P 
Sbjct  1     GAGTSARRAVDNYDEEVLLASSMPKRRAGRKKFKETRHPVYRGVRRRNKNKWVCEMRKPN  60

Query  869   KQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAV  690
             ++ RIWLGTYP+ EMAARAHDVAALALRG  +A LNFADS W LPVPAS DA ++++AA 
Sbjct  61    EKTRIWLGTYPSAEMAARAHDVAALALRGS-SACLNFADSAWSLPVPASTDAGEIQRAAA  119

Query  689   EAAEAFRPKE----CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQ  522
              AAE F+P E    CEE  V+   T          V G     +    ++  D       
Sbjct  120   AAAEGFQPSEFGEDCEE--VLERCTERVDDHQEAEVRG-----VEESGVLYMDEEAVFDM  172

Query  521   GGFLGSMADGNLLSP  477
              G L +MA+G LLSP
Sbjct  173   PGLLANMAEGLLLSP  187



>ref|XP_007152343.1| hypothetical protein PHAVU_004G122000g [Phaseolus vulgaris]
 gb|ESW24337.1| hypothetical protein PHAVU_004G122000g [Phaseolus vulgaris]
Length=224

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 11/137 (8%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV LA   PKKRAGRKKF+ETRHPVYRGVRRRN++KWVCE+REP K+ RIWLGT+PT
Sbjct  31    SDEEVRLAVRHPKKRAGRKKFRETRHPVYRGVRRRNSDKWVCEVREPNKKSRIWLGTFPT  90

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP----  666
             PEMAARAHDVAA+ALRG++A  LNFADS WRLP PAS  AKD++KAA EAAEAFRP    
Sbjct  91    PEMAARAHDVAAMALRGRYAC-LNFADSRWRLPAPASASAKDIQKAAAEAAEAFRPDQTL  149

Query  665   ------KECEEEIVITT  633
                   +EC E +  TT
Sbjct  150   ENTNTRQECVEAVTKTT  166



>gb|AGR40697.1| C-repeat binding factor 5 [Medicago truncatula]
Length=267

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             AS  D EV LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT
Sbjct  23    ASSPDSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGT  82

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             +PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA EAAE FRP
Sbjct  83    FPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATAKIKDIQKAAAEAAETFRP  140



>gb|ACJ63286.1| C-repeat binding factor 1 [Ammopiptanthus mongolicus]
Length=221

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 124/161 (77%), Gaps = 9/161 (6%)
 Frame = -3

Query  1127  FNVFSSEMDYSTSNSDPNYCGGYGFPQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFK  948
             FN FS   D  T NSD        +P  +G SG R +   +EV+LA S PKKRAGRKKF+
Sbjct  4     FNHFS---DPHTGNSDIYS----SWPVSDGSSGSRPAAVSDEVLLAASHPKKRAGRKKFR  56

Query  947   ETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAAT  768
             ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT +MAARAHDVAA+ALRG+ +A 
Sbjct  57    ETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTADMAARAHDVAAIALRGR-SAC  115

Query  767   LNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP-KECEEE  648
             LNFADS WRLPVPA+ +A+D++KAA EAAEAFRP KE E +
Sbjct  116   LNFADSGWRLPVPATSEARDIQKAAAEAAEAFRPGKESETD  156



>ref|XP_008437209.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Cucumis melo]
Length=229

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 122/180 (68%), Gaps = 14/180 (8%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             +SDEEVILA +RPK+RAGR+ FKETRHPVYRGVR+RNN+KWVCE+REP K+ RIWLGTYP
Sbjct  39    NSDEEVILASNRPKRRAGRRIFKETRHPVYRGVRQRNNDKWVCELREPNKKTRIWLGTYP  98

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHD+AALALRG+ +A LNFADS WR P+PAS D   +R+AAV AA   R +EC
Sbjct  99    TAEMAARAHDIAALALRGK-SACLNFADSAWRFPIPASDDPAVIREAAVRAANEGRDEEC  157

Query  656   EEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                       S +    P   D   +  M + P++             L +MA+G LLSP
Sbjct  158   NVGREEDDGGSNQQEAYPDRTDYVDDETMSNMPML-------------LANMAEGLLLSP  204



>ref|XP_008439162.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Cucumis melo]
Length=212

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             R   SDE+ +LA S PKKRAGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLG
Sbjct  22    RPIFSDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLG  81

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAA+ALRG   A LNFADS WRLPVPAS DA+D++KAA EAAEAFRP
Sbjct  82    TFPTAEMAARAHDVAAIALRG-LTACLNFADSAWRLPVPASTDARDIQKAAAEAAEAFRP  140

Query  665   KECE  654
              E +
Sbjct  141   AESD  144



>gb|ACB45084.1| CRT binding factor 4 [Solanum commersonii]
Length=193

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 123/185 (66%), Gaps = 25/185 (14%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             + +  +ILA + PKK AGRKKF+ETRHPVYRGVR +N+ KWVCE+REP K+ RIWLGT+P
Sbjct  5     NKNSSLILASNNPKKPAGRKKFRETRHPVYRGVRMKNSGKWVCEVREPNKKTRIWLGTFP  64

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAA+ALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP   
Sbjct  65    TAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPLSS  123

Query  656   EE-----EIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADG  492
             E      E V++TP   E       +D    + MP                G + +MA+G
Sbjct  124   ESEGVSGECVVSTP---EMRENSFFMDEEELLYMP----------------GLIANMAEG  164

Query  491   NLLSP  477
              +L P
Sbjct  165   LMLPP  169



>ref|XP_011041633.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Populus euphratica]
 ref|XP_011016548.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X1 [Populus euphratica]
 gb|AGY31290.1| C-repeat binding factor 4a [Populus euphratica]
Length=248

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 124/182 (68%), Gaps = 12/182 (7%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  50    AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  109

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  110   FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  168

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                          VE       VD            M+ D    GM  G L ++A+G LL
Sbjct  169   ---------GSLGVELTRAGDEVDQVAGTAAGDVFYMDDDADF-GMP-GLLANIAEGMLL  217

Query  482   SP  477
              P
Sbjct  218   PP  219



>ref|XP_010058216.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Eucalyptus grandis]
 gb|KCW72084.1| hypothetical protein EUGRSUZ_E00529 [Eucalyptus grandis]
Length=289

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = -3

Query  1010  DEE--VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             DEE  V LA SRPK+ AGRK FKETRHPVYRGVRRRN  KWVCE+REP K+ R+WLGTYP
Sbjct  41    DEEPAVALASSRPKRPAGRKVFKETRHPVYRGVRRRNRGKWVCELREPNKKTRVWLGTYP  100

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAALALRG+    LNFADS WRLPVPAS +A ++R+ A+ AAEAFRP E 
Sbjct  101   TAEMAARAHDVAALALRGRHGVCLNFADSAWRLPVPASREAAEIRRTAMAAAEAFRPAEA  160

Query  656   EEEI  645
             EE +
Sbjct  161   EEAV  164



>gb|ABF59745.1| CBF-like transcription factor [Cocos nucifera]
Length=211

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 126/185 (68%), Gaps = 11/185 (6%)
 Frame = -3

Query  1019  SHSDEEV--ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             S SDEE    ++ + PK+RAGR KF+ETRHPVY+GVRRRN +KWVCE+REP K+ RIWLG
Sbjct  17    SASDEEAYATVSSAPPKRRAGRTKFRETRHPVYKGVRRRNADKWVCEVREPNKKSRIWLG  76

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S ++KD+++AAVEAAEAFRP
Sbjct  77    TFPTAEMAARAHDVAAIALRGR-SACLNFADSAWLCPVPRSSNSKDIQRAAVEAAEAFRP  135

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
                + E V    +  +A      + G        P  ME DG  +GMQG     MA G L
Sbjct  136   ---QTERVDAAESREDA--AMAMIAGPSLAAADDPFYME-DGLNSGMQGYL--DMASGML  187

Query  485   LSPAP  471
             + P P
Sbjct  188   MEPPP  192



>ref|XP_007209556.1| hypothetical protein PRUPE_ppa010909mg [Prunus persica]
 gb|ABR19831.1| dehydration responsive element binding protein [Prunus persica]
 gb|ADN93458.1| CBF/DREB transcription factor [Prunus persica]
 gb|EMJ10755.1| hypothetical protein PRUPE_ppa010909mg [Prunus persica]
 gb|AGL07691.1| CBF/DREB 2 [Prunus persica]
Length=230

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLG  846
             AS SDE VILA SRPKKRAGR+ FKETRHPVYRGVRRRNNNKWVCE+REP  +K RIWLG
Sbjct  30    ASSSDENVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNNKWVCELREPNNKKSRIWLG  89

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             TYPT EMAARAHDVAALA RG+ A  +NFADS WRLP+PAS+D  D+R+AA EAAE FRP
Sbjct  90    TYPTAEMAARAHDVAALAFRGKLAC-INFADSAWRLPLPASMDTMDIRRAAAEAAEGFRP  148

Query  665   KE  660
              E
Sbjct  149   AE  150



>ref|XP_009341269.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Pyrus x bretschneideri]
Length=226

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 123/184 (67%), Gaps = 22/184 (12%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEV+LA + PKK+AGRKKFKETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  32    SDEEVLLASTYPKKQAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPT  91

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE--  660
              EMAARAHDVAA+ALRG+ +A LNFADSVWRLP PAS +AKD++ AA EAAE FRP E  
Sbjct  92    AEMAARAHDVAAIALRGR-SACLNFADSVWRLPAPASANAKDIQTAAAEAAEQFRPVEES  150

Query  659   ---CEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGN  489
                C    V  +  +  +      VD      MP                G L +MA+G 
Sbjct  151   DEACGASAVAPSECTSASKQQVHFVDEEAVFGMP----------------GLLANMAEGM  194

Query  488   LLSP  477
             LL P
Sbjct  195   LLPP  198



>gb|ACH63209.1| CRT/DRE binding factor [Rheum australe]
Length=274

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 121/175 (69%), Gaps = 17/175 (10%)
 Frame = -3

Query  1001  VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMa  822
             ++LAE  PKKRAGRKKFKETRHPVYRG+R+RN +KWVCE+REP K+ RIWLGT+PT EMA
Sbjct  32    IMLAEHHPKKRAGRKKFKETRHPVYRGIRQRNFDKWVCELREPNKKTRIWLGTFPTAEMA  91

Query  821   arahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIV  642
             ARAHDVAA+ALRG+ +A LNFADS WRLPVPAS D KD+++AA EAAE FRP+   EE  
Sbjct  92    ARAHDVAAIALRGR-SACLNFADSAWRLPVPASSDTKDIQRAAAEAAELFRPQSRAEEEE  150

Query  641   ITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
              +   +          +G  + +         D  L GMQ  FL  M +G +L P
Sbjct  151   ESASATAVGE------EGNMDWM---------DKDLCGMQ-DFLADMYNGTMLPP  189



>gb|AAQ88400.1| CaCBF1B [Capsicum annuum]
 gb|AAZ22480.1| CBF1 [Capsicum annuum var. annuum]
 gb|ADM73296.1| C-repeat binding factor 3 [Capsicum frutescens]
Length=215

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 122/173 (71%), Gaps = 12/173 (7%)
 Frame = -3

Query  1028  GRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWL  849
              RA  SDEEVILA + PKK AGRKKF+ETRHPVYRGVR+RN+ KWVCE+REP K+ RIWL
Sbjct  28    NRAIFSDEEVILASNNPKKPAGRKKFRETRHPVYRGVRKRNSGKWVCEVREPNKKSRIWL  87

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLPVPAS D KD++KAA EAAEAFR
Sbjct  88    GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASSDTKDIQKAAAEAAEAFR  146

Query  668   PKECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFL  510
             P + E    I+  +S   P     +D      MP        G LT M  G +
Sbjct  147   PLKLEG---ISKESSSSTPESMFFMDEEALFCMP--------GLLTNMAEGLM  188



>ref|XP_007210989.1| hypothetical protein PRUPE_ppa021197mg [Prunus persica]
 gb|EMJ12188.1| hypothetical protein PRUPE_ppa021197mg [Prunus persica]
 gb|AGL07694.1| CBF/DREB 5 [Prunus persica]
Length=240

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWL  849
             RAS SDE+VILA SRPKKRAGR+ FKETRHPVYRGVRRRNN+KWVCE+REP K K RIWL
Sbjct  29    RASWSDEDVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWL  88

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAALA RG+ A  LNF DS WRLPVPAS+DA D+R+AA EAAE FR
Sbjct  89    GTYPTAEMAARAHDVAALAFRGKLAC-LNFPDSAWRLPVPASMDAMDIRRAAAEAAEGFR  147

Query  668   PKE  660
             P E
Sbjct  148   PVE  150



>gb|AIQ82297.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82298.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82299.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82300.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82302.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82303.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82304.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82305.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82306.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82307.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82308.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82309.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82311.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82313.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82314.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82315.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82317.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82318.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82319.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82320.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82321.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82322.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82323.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82324.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82325.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82326.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82327.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82328.1| CBF1, partial [Populus balsamifera]
Length=203

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 127/187 (68%), Gaps = 12/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  5     AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  64

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  65    FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  123

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                   +  T   VE        D  +         M+ D    GM  G L ++A+G LL
Sbjct  124   GSLGVELTRTGDEVERVAGTAAGDVFY---------MDDDADF-GMP-GLLANIAEGMLL  172

Query  482   SPAPSLG  462
              P    G
Sbjct  173   PPPNCCG  179



>ref|XP_006303182.1| hypothetical protein CARUB_v10010303mg [Capsella rubella]
 gb|EOA36080.1| hypothetical protein CARUB_v10010303mg [Capsella rubella]
Length=207

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             +++EE+ LAE RPKKRAGR  FKETRHPVYRG+RRRN +KWVCE+REPT Q+RIWLGTYP
Sbjct  2     NNNEEINLAEMRPKKRAGRTVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYP  61

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             T +MAARAHDVA L+LRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FRP E
Sbjct  62    TADMAARAHDVAVLSLRGR-SACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPAE  119



>gb|AIQ82301.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82310.1| CBF1, partial [Populus balsamifera]
 gb|AIQ82312.1| CBF1, partial [Populus balsamifera]
Length=203

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 127/187 (68%), Gaps = 12/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  5     AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  64

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  65    FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  123

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                   +  T   VE        D  +         M+ D    GM  G L ++A+G LL
Sbjct  124   GSLGVELTRTGDEVERVXGTAAGDVFY---------MDDDADF-GMP-GLLANIAEGMLL  172

Query  482   SPAPSLG  462
              P    G
Sbjct  173   PPPNCCG  179



>ref|XP_002321877.1| hypothetical protein POPTR_0015s13830g [Populus trichocarpa]
 gb|ABO48364.1| C-repeat binding facor 2 [Populus trichocarpa]
 gb|EEF06004.1| hypothetical protein POPTR_0015s13830g [Populus trichocarpa]
Length=248

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 127/187 (68%), Gaps = 12/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  50    AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  109

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  110   FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  168

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                   +  T   VE        D  +         M+ D    GM  G L ++A+G LL
Sbjct  169   GSLGVELTRTGDEVEKVAGTAAGDVFY---------MDDDADF-GMP-GLLANIAEGMLL  217

Query  482   SPAPSLG  462
              P    G
Sbjct  218   PPPNCCG  224



>ref|XP_010061546.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Eucalyptus grandis]
Length=220

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 135/213 (63%), Gaps = 23/213 (11%)
 Frame = -3

Query  1106  MDYSTSNSDPNYCGGYGF---PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRH  936
             M+  +S+S PN C  + F   P     +    + S +EV+LA   PKKRAGRKKF+ETRH
Sbjct  1     MNPFSSHSHPNSCR-FNFAEPPSDSRSATALGNFSHKEVLLASHHPKKRAGRKKFRETRH  59

Query  935   PVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFA  756
             PVYRGVR R++ KWVCE+REP K+ RIWLGT+PT EMAARAHDVAALALRG+ +A LNFA
Sbjct  60    PVYRGVRLRDSGKWVCEVREPRKKSRIWLGTFPTVEMAARAHDVAALALRGR-SACLNFA  118

Query  755   DSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEApppppPVDGTWNV  576
             DS WRLPVPAS D KD++KAA  AAEAF+P ECE+ +                +     V
Sbjct  119   DSAWRLPVPASADTKDIQKAAARAAEAFQPVECEDVM----------SEDKKKLRSEEVV  168

Query  575   LMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
             L     I    G L     G L  MA+G LLSP
Sbjct  169   LYDEEDIF---GIL-----GSLADMAEGMLLSP  193



>gb|ACF77118.1| CBF4a [Populus hopeiensis]
 gb|AHI59144.1| CBF4 [Populus tomentosa]
Length=248

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 127/187 (68%), Gaps = 12/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A  SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT
Sbjct  50    AIFSDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGT  109

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+
Sbjct  110   FPTADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPE  168

Query  662   ECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLL  483
                   +  T   VE        D  +         M+ D    GM  G L ++A+G LL
Sbjct  169   GSLGVELTRTRDEVEKVAGTAAGDVFY---------MDDDADF-GMP-GMLANIAEGMLL  217

Query  482   SPAPSLG  462
              P    G
Sbjct  218   PPPNCCG  224



>gb|ADZ23479.1| CBF transcription factor 1 [Betula platyphylla]
Length=203

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = -3

Query  1055  FPQGEGWSGGRASH-SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIR  879
             F Q    S   A H SDE ++LA   PKKRAGRKKFKETRHPVY GVRR+ + KW+CE+R
Sbjct  4     FSQYSSESESGAMHLSDEGILLASRNPKKRAGRKKFKETRHPVYWGVRRKKSGKWICEVR  63

Query  878   EPTKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRK  699
             EP KQ RIWLGT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLPVPAS  AKD+++
Sbjct  64    EPNKQSRIWLGTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPVPASGTAKDIQR  122

Query  698   AAVEAAEAFRPKE  660
              A EAAE FRP E
Sbjct  123   TAAEAAELFRPAE  135



>gb|AGR40690.1| C-repeat binding factor 8 [Medicago truncatula]
Length=215

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             + E+ LA S+PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT+PT 
Sbjct  27    ESEIRLAASKPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGTFPTA  86

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP   + 
Sbjct  87    EMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFRP---DN  142

Query  650   EIVITTPTSVEA  615
              I+IT   +V A
Sbjct  143   TIMITNIETVVA  154



>ref|XP_004511604.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Cicer arietinum]
Length=227

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 104/127 (82%), Gaps = 4/127 (3%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWLGTYP  837
             S+EEVILA +RPKKRAGRK FKETRHPVYRGVR R+NNKWVCE+R P   K RIWLGTYP
Sbjct  42    SNEEVILASTRPKKRAGRKVFKETRHPVYRGVRARDNNKWVCEMRVPNNNKSRIWLGTYP  101

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF--RPK  663
             TPEMAARAHDVAAL LRGQ +A LNFADS WRL +P + DA ++R+AA+EAA+ F     
Sbjct  102   TPEMAARAHDVAALTLRGQ-SACLNFADSAWRLRLPETTDAVEIRRAAMEAAQLFAVEDS  160

Query  662   ECEEEIV  642
             +CE++ V
Sbjct  161   QCEQQSV  167



>gb|KEH26589.1| CBF/DREB1 transcription factor [Medicago truncatula]
Length=267

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -3

Query  1043  EGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQ  864
             + +S   AS    EV LA S PKKRAGRK FKETRHPVYRGVR+RN NKWVCE+REP  +
Sbjct  16    KDFSPFDASSPGSEVRLASSNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTK  75

Query  863   KRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEA  684
              RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNF+DSVWRLP+PA+   KD++KAA +A
Sbjct  76    NRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFSDSVWRLPIPATSAIKDIQKAATKA  134

Query  683   AEAFRP  666
             AEAFRP
Sbjct  135   AEAFRP  140



>gb|ACE73694.1| DREB2 [Nicotiana tabacum]
Length=215

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 20/183 (11%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A+ SDEEV+LA + PKKRAGRKKF+ETRH  YRGVR+RN+++WVCEIR+P K+ RIWLGT
Sbjct  29    ANLSDEEVMLASNNPKKRAGRKKFRETRHATYRGVRKRNSDRWVCEIRQPNKKSRIWLGT  88

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF-RP  666
             YPT EMAARAHDVAA+ALRG+ +A LNFADSVW+L +PAS DAKD+++AA EAAEAF RP
Sbjct  89    YPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLHIPASADAKDIQRAAAEAAEAFGRP  147

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
              E EE    TTP + E+                S   M+ +        G L +MA+G +
Sbjct  148   SESEEADSGTTPETPES----------------SKLFMDEEALFC--MPGLLANMAEGLM  189

Query  485   LSP  477
             L P
Sbjct  190   LPP  192



>ref|XP_009758148.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Nicotiana sylvestris]
Length=215

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 20/183 (11%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             A+ SDEEV+LA + PKKRAGRKKF+ETRH  YRGVR+RN+++WVCEIR+P K+ RIWLGT
Sbjct  29    ANLSDEEVMLASNNPKKRAGRKKFRETRHATYRGVRKRNSDRWVCEIRQPNKKSRIWLGT  88

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF-RP  666
             YPT EMAARAHDVAA+ALRG+ +A LNFADSVW+L +PAS DAKD+++AA EAAEAF RP
Sbjct  89    YPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLHIPASADAKDIQRAAAEAAEAFGRP  147

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
              E EE    TTP + E+                S   M+ +        G L +MA+G +
Sbjct  148   SESEEADSGTTPETPES----------------SKLFMDEEALFC--MPGLLANMAEGLM  189

Query  485   LSP  477
             L P
Sbjct  190   LPP  192



>gb|AFL48190.1| C-repeat binding factor 1 [Prunus dulcis]
Length=242

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK-RIWL  849
             RAS SDE+VILA SRPKKRAGR+ FKETRHPVYRGVRRRNN+KWVCE+REP K K RIWL
Sbjct  29    RASWSDEDVILASSRPKKRAGRRVFKETRHPVYRGVRRRNNDKWVCEMREPKKTKSRIWL  88

Query  848   GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  669
             GTYPT EMAARAHDVAALA RG+ A  LNF DS WRLP+PAS+DA D+R+AA EAAE FR
Sbjct  89    GTYPTAEMAARAHDVAALAFRGKLAC-LNFPDSAWRLPLPASMDAMDIRRAAAEAAEGFR  147

Query  668   PKE  660
             P E
Sbjct  148   PVE  150



>ref|XP_009785658.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Nicotiana sylvestris]
Length=233

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 128/200 (64%), Gaps = 19/200 (10%)
 Frame = -3

Query  1022  ASHSDEEVIL-AESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             A  SDEEVIL A ++PKKRAGRKKFKETRHP+YRGVR+RNN+KWVCE+REP  QKRIWLG
Sbjct  15    AEASDEEVILLASNKPKKRAGRKKFKETRHPIYRGVRKRNNDKWVCELREPNTQKRIWLG  74

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             +YPT EMAARAHDVAALALRG   ATLNF DS WRL VP S D KDLR+AA  AAEAF P
Sbjct  75    SYPTAEMAARAHDVAALALRGHL-ATLNFVDSAWRLQVPVSKDPKDLRQAAARAAEAFWP  133

Query  665   KECEEEI----VITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLG---  507
              E E  +       T    E        + T N +     ++  + F+     G +G   
Sbjct  134   GE-ETNVSYRGATNTDNGDEEMKAATEENATTNCMQ---NVVTAENFMYSNSCGEVGMFG  189

Query  506   ------SMADGNLLSPAPSL  465
                   +M +G+L SP P L
Sbjct  190   TQEWQTNMEEGSLFSPNPCL  209



>gb|ACB45083.1| CRT binding factor 4 [Solanum tuberosum]
Length=197

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  1016  HSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             + +  +ILA + PKK AGRKKF+ETRHPVYRGVR RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  5     NKNSSLILASNNPKKPAGRKKFRETRHPVYRGVRMRNSGKWVCEVREPNKKSRIWLGTFP  64

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKEC  657
             T EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP E 
Sbjct  65    TAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRPSEE  123

Query  656   EEEIV  642
              E + 
Sbjct  124   SERVA  128



>gb|ACB45096.1| CRT binding factor 1 [Solanum tuberosum]
 gb|ACJ26752.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26753.1| AP2 domain CBF protein [Solanum tuberosum]
Length=257

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             DEE+ILA + PK+ AGRKKF+ETRHP+YRG+R RN+ KWVCE+REP K+ RIWLGT+PT 
Sbjct  26    DEEIILASNNPKRPAGRKKFRETRHPIYRGIRMRNSGKWVCEVREPNKKSRIWLGTFPTA  85

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FRP
Sbjct  86    EMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFRP  139



>gb|AGR40691.1| C-repeat binding factor 8 [Medicago truncatula]
Length=271

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             + E+ LA S+PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT+PT 
Sbjct  27    ESEIRLAASKPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGTFPTA  86

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP   + 
Sbjct  87    EMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFRP---DN  142

Query  650   EIVITTPTSVEA  615
              I+IT   +V A
Sbjct  143   TIMITNIETVVA  154



>gb|ACB45094.1| CRT binding factor 2 [Solanum commersonii]
Length=235

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = -3

Query  1013  SDEEVI-LAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             SDEEVI LA + PKK AGRKKF+ETRHPV+RG+R RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  33    SDEEVINLASNNPKKPAGRKKFRETRHPVFRGIRMRNSGKWVCEVREPNKKSRIWLGTFP  92

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FRP
Sbjct  93    TAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFRP  148



>ref|XP_009777001.1| PREDICTED: uncharacterized protein LOC104226669 [Nicotiana sylvestris]
Length=418

 Score =   157 bits (398),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 102/123 (83%), Gaps = 3/123 (2%)
 Frame = -3

Query  1034  SGGRASHSDEE--VILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQK  861
             S  R + SDEE   ILA  +PKKRAGRKKFKETRHPVYRGVRRRNN+KWVCE+REP+ QK
Sbjct  193   SSVRVAVSDEEDINILALRKPKKRAGRKKFKETRHPVYRGVRRRNNDKWVCELREPSTQK  252

Query  860   RIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAA  681
             RIWLG+YPT EMAARAHDVAALALRG   ATLNFADS WRLPVP S D KDLR AA +AA
Sbjct  253   RIWLGSYPTAEMAARAHDVAALALRGPL-ATLNFADSAWRLPVPVSKDPKDLRHAAAKAA  311

Query  680   EAF  672
             E F
Sbjct  312   EPF  314



>ref|XP_006353374.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Solanum tuberosum]
Length=236

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = -3

Query  1013  SDEEVI-LAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYP  837
             SDEEVI LA + PKK AGRKKF+ETRHPV+RG+R RN+ KWVCE+REP K+ RIWLGT+P
Sbjct  35    SDEEVINLASNNPKKPAGRKKFRETRHPVFRGIRMRNSGKWVCEVREPNKKSRIWLGTFP  94

Query  836   TPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FRP
Sbjct  95    TAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFRP  150



>gb|AFN06404.1| ethylene-responsive element binding protein, partial [Elaeis 
guineensis]
Length=212

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 124/187 (66%), Gaps = 11/187 (6%)
 Frame = -3

Query  1022  ASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGT  843
             AS  D    +  + PK+RAGR KF+ETRHPVYRGVRRRN  KWVCE+REP K+ RIWLGT
Sbjct  18    ASDEDVHATVRSANPKRRAGRTKFRETRHPVYRGVRRRNAGKWVCEVREPNKKSRIWLGT  77

Query  842   YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPK  663
             +PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S + KD+++AA+EAAEAFRP+
Sbjct  78    FPTAEMAARAHDVAAMALRGR-SACLNFADSPWLCPVPRSSNPKDIQRAAMEAAEAFRPQ  136

Query  662   ECEEEIVITTPTSVE-ApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
                     T P + +        + G  ++   + P    DG   GMQG +L  MA+G L
Sbjct  137   --------TEPNAEKRTDDAAISMAGGPSLARANEPFYMDDGLNFGMQGFYL-DMAEGLL  187

Query  485   LSPAPSL  465
             + P P L
Sbjct  188   MEPPPIL  194



>gb|ABG75914.1| dehydration responsive element binding protein 1A [Medicago truncatula]
Length=215

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             + E+ LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT+PT 
Sbjct  27    ESEIRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGTFPTA  86

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP   + 
Sbjct  87    EMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFRP---DN  142

Query  650   EIVITTPTSVEA  615
              I+IT   +V A
Sbjct  143   TIMITNIETVVA  154



>gb|AHI59143.1| CBF4 [Populus davidiana]
Length=243

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 125/179 (70%), Gaps = 12/179 (7%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  53    SDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  112

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              +MAARAHDVAALALRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+   
Sbjct  113   ADMAARAHDVAALALRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPEGSL  171

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                +  T   VE        D  +         M+ D    GM  G L ++A+G LL P
Sbjct  172   GVELTRTGDEVEKVAGTAAGDVFY---------MDDDADF-GMP-GLLANIAEGMLLPP  219



>gb|ABR23056.1| DRE-binding transcription factor swDREB1 [Ipomoea batatas]
Length=257

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  1025  RASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             +A+ SDEEV+LA + PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLG
Sbjct  48    KANLSDEEVLLASNNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLG  107

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAA+ALRG  +A LNFADS WRLP+PAS D KD++KAA EAAEAFRP
Sbjct  108   TFPTAEMAARAHDVAAIALRG-CSACLNFADSAWRLPIPASADPKDIQKAAAEAAEAFRP  166



>gb|ABF59738.1| CBF-like transcription factor [Trachycarpus fortunei]
Length=211

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 125/185 (68%), Gaps = 11/185 (6%)
 Frame = -3

Query  1019  SHSDEEV--ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLG  846
             S SDEE    ++ + PK+RAGR KF+ETRHPVY+GVRRRN +KWVCE+REP K+ RIWLG
Sbjct  17    SASDEEAYATVSSAPPKRRAGRTKFRETRHPVYKGVRRRNADKWVCEVREPNKKSRIWLG  76

Query  845   TYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRP  666
             T+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S ++KD+++AAVEAAEAFRP
Sbjct  77    TFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCPVPRSSNSKDIQRAAVEAAEAFRP  135

Query  665   KECEEEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNL  486
                + E V    +  +A      + G        P  ME DG   GMQG     MA G L
Sbjct  136   ---QTERVDAAESREDA--AMAMIAGPSLAAADDPFYME-DGLNFGMQGYL--DMASGML  187

Query  485   LSPAP  471
             + P P
Sbjct  188   MEPPP  192



>dbj|BAE17131.1| LhCBF1 [Lycopersicon hirsutum]
Length=222

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 121/180 (67%), Gaps = 23/180 (13%)
 Frame = -3

Query  998  ILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaa  819
            ILA + PK+ AGRKKF+ETRHP+YRG+R+RN+ KWVCE+REP K+ RIWLGT+PT EMAA
Sbjct  35   ILASNNPKRPAGRKKFRETRHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAA  94

Query  818  rahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIV-  642
            RAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FRP +  EE+  
Sbjct  95   RAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESEEVSG  153

Query  641  ----ITTP-TSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                 T+P TS         VD      MP                G L +MA+G +L P
Sbjct  154  ESDNSTSPETSENVQESSDFVDEEAIFFMP----------------GLLANMAEGLMLPP  197



>ref|XP_003517455.1| PREDICTED: dehydration-responsive element-binding protein 1F 
isoform 1 [Glycine max]
 gb|ACA63936.1| CBF3 protein [Glycine max]
Length=226

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 108/145 (74%), Gaps = 9/145 (6%)
 Frame = -3

Query  1127  FNVFSSEMDYSTSNSDPNYCGGYGFPQGEGW--SGGRASHSDEEVILAESRPKKRAGRKK  954
              N+F S +D+  +      CGG      E    S  R++ SDEEVILA +RPKKRAGR+ 
Sbjct  1     MNIFKSPLDHDLN------CGGIFHDSAEASYSSETRSTPSDEEVILASARPKKRAGRRV  54

Query  953   FKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTPEMaarahdvaalalRGQFA  774
             FKETRHPVYRGVRRRN NKWVCE+R P    RIWLGTYPTPEMAARAHDVAALALRG+ +
Sbjct  55    FKETRHPVYRGVRRRNKNKWVCEMRVPNNNSRIWLGTYPTPEMAARAHDVAALALRGK-S  113

Query  773   ATLNFADSVWRLPVPASVDAKDLRK  699
             A LNFADS WRL VPA+ +A+++R+
Sbjct  114   ACLNFADSRWRLTVPATTNAEEIRR  138



>gb|ACF77119.1| CBF4b [Populus hopeiensis]
Length=243

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 124/179 (69%), Gaps = 12/179 (7%)
 Frame = -3

Query  1013  SDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPT  834
             SDEEVILA   PKKRAGRKKF+ETRHPVYRGVRRRN+ KWVCE+REP K+ RIWLGT+PT
Sbjct  53    SDEEVILASRNPKKRAGRKKFRETRHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPT  112

Query  833   PEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  654
              +MAARAHDVAAL LRG+ +A LNFADS WRLP PAS DAKD++KAA EAAEAFRP+   
Sbjct  113   ADMAARAHDVAALVLRGR-SACLNFADSAWRLPTPASSDAKDIQKAAAEAAEAFRPEGSL  171

Query  653   EEIVITTPTSVEApppppPVDGTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
                +  T   VE        D  +         M+ D    GM  G L ++A+G LL P
Sbjct  172   GVELTRTGDEVEKVAGTAAGDVFY---------MDDDADF-GMP-GLLANIAEGMLLPP  219



>gb|ADU03762.1| C-repeat binding factor [Prunus persica]
Length=239

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = -3

Query  1004  EVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKR-IWLGTYPTPE  828
             +VILA S PKKRAGRK FKETRHPVYRGVRRR+NNKWVCE+R+P K+K  IWLGTYPT E
Sbjct  34    DVILASSSPKKRAGRKVFKETRHPVYRGVRRRDNNKWVCELRQPNKKKSGIWLGTYPTAE  93

Query  827   MaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             MAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FRP E
Sbjct  94    MAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASLDSMDIQRAAAEAAEGFRPVE  148



>gb|AFU54609.1| C-repeat binding factor [Prunus ferganensis]
 gb|AFU54610.1| C-repeat binding factor [Prunus persica]
Length=239

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = -3

Query  1004  EVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKR-IWLGTYPTPE  828
             +VILA S PKKRAGRK FKETRHPVYRGVRRR+NNKWVCE+R+P K+K  IWLGTYPT E
Sbjct  34    DVILASSSPKKRAGRKVFKETRHPVYRGVRRRDNNKWVCELRQPNKKKSGIWLGTYPTAE  93

Query  827   MaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             MAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FRP E
Sbjct  94    MAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFRPVE  148



>ref|XP_007209842.1| hypothetical protein PRUPE_ppa014628mg, partial [Prunus persica]
 gb|EMJ11041.1| hypothetical protein PRUPE_ppa014628mg, partial [Prunus persica]
Length=230

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = -3

Query  1004  EVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKR-IWLGTYPTPE  828
             +VILA S PKKRAGRK FKETRHPVYRGVRRR+NNKWVCE+R+P K+K  IWLGTYPT E
Sbjct  25    DVILASSSPKKRAGRKVFKETRHPVYRGVRRRDNNKWVCELRQPNKKKSGIWLGTYPTAE  84

Query  827   MaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE  660
             MAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FRP E
Sbjct  85    MAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFRPVE  139



>emb|CBZ41764.1| drought responsive element binding protein 1 [Glycine max]
Length=234

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 110/131 (84%), Gaps = 3/131 (2%)
 Frame = -3

Query  1052  PQGEGWSGGRASHSDEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREP  873
             P  EG  G   + SDEEV LA   PKKRAGRKKF+ETR PVYRGVRRRN++KWVCE+REP
Sbjct  26    PASEGSRG--VAFSDEEVRLAVRHPKKRAGRKKFRETRRPVYRGVRRRNSDKWVCEVREP  83

Query  872   TKQKRIWLGTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAA  693
              K+ RIWLGT+PTPEMAARAHDVAA+ALRG++A  LNFADS WRLPVPA+ +AKD++KAA
Sbjct  84    NKKTRIWLGTFPTPEMAARAHDVAAMALRGRYAC-LNFADSAWRLPVPATAEAKDIQKAA  142

Query  692   VEAAEAFRPKE  660
              EAA+AFRP +
Sbjct  143   AEAAQAFRPDQ  153



>gb|AFK45852.1| unknown [Medicago truncatula]
Length=271

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = -3

Query  1010  DEEVILAESRPKKRAGRKKFKETRHPVYRGVRRRNNNKWVCEIREPTKQKRIWLGTYPTP  831
             + E+ LA S PKKRAGRK FKETRHPVYRGVR+RN +KWVCE+REP  + RIWLGT+PT 
Sbjct  27    ESEIRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLDKWVCEMREPNTKTRIWLGTFPTA  86

Query  830   EMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEE  651
             EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFRP   + 
Sbjct  87    EMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFRP---DN  142

Query  650   EIVITTPTSVEA  615
              I+IT   +V A
Sbjct  143   TIMITNIETVVA  154



>ref|XP_007155567.1| hypothetical protein PHAVU_003G212800g [Phaseolus vulgaris]
 gb|ESW27561.1| hypothetical protein PHAVU_003G212800g [Phaseolus vulgaris]
Length=293

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 134/225 (60%), Gaps = 15/225 (7%)
 Frame = -3

Query  1109  EMDYSTSNSDPNYCGGYGFPQGEGWSGG--RASHSDEEV-ILAESRPKKRAGRKKFKETR  939
             +M+    +SD +  G Y     E  S     A HSDEE+  LA +RPKKRAGR+ FKETR
Sbjct  45    QMNLLKQSSDESNNGCYVCSSPETSSSNPPNAVHSDEELHALASARPKKRAGRRIFKETR  104

Query  938   HPVYRGVRRRNNNKWVCEIREPT-KQKRIWLGTYPTPEMaarahdvaalalRGQFAATLN  762
             HPVYRGVR+RNNNKWVCE+R P  K  RIWLGTYPTPEMAARAHDVAALALRG+ +A LN
Sbjct  105   HPVYRGVRQRNNNKWVCEMRVPNDKSTRIWLGTYPTPEMAARAHDVAALALRGK-SACLN  163

Query  761   FADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKE-CEEEIV---ITTPTSVEApppppPV  594
             FADS WRLP+PAS +AK++R+ A EA  A   ++ C E++    +      E       +
Sbjct  164   FADSAWRLPLPASTNAKEIRRVAGEAVVAIAAEDSCVEQLENENVNAVADCEVSSSGLSI  223

Query  593   D------GTWNVLMPSPPIMEPDGFLTGMQGGFLGSMADGNLLSP  477
             D          V      I  PD         +L SMAD  L SP
Sbjct  224   DEDGSSSKALRVFCDLDEITIPDASGFEEMHAWLQSMADKPLRSP  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2893084243094