BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24895_g3_i1 len=627 path=[11361:0-165 11527:166-326 13573:327-377
10996:378-626]

Length=627
                                                                      Score     E

gb|EYU38994.1|  hypothetical protein MIMGU_mgv1a025975mg              91.7    4e-19   
gb|AHL69786.1|  dehydration-responsive element-binding protein        87.8    2e-17   
ref|XP_009784267.1|  PREDICTED: dehydration-responsive element-bi...  78.2    3e-14   
ref|NP_001274894.1|  AP2 domain CBF protein                           77.4    6e-14   
gb|ACB45082.1|  CRT binding factor 5                                  76.6    7e-14   Solanum tuberosum [potatoes]
gb|ACU00264.1|  dehydration-responsive element-binding factor 1       76.3    1e-13   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACU00265.1|  dehydration-responsive element-binding factor 1       76.3    1e-13   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACB45092.1|  CRT binding factor 3                                  75.9    2e-13   Solanum commersonii
gb|ACU00263.1|  dehydration-responsive element-binding factor 1       75.5    2e-13   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACB45095.1|  CRT binding factor 3                                  75.1    3e-13   Solanum tuberosum [potatoes]
ref|XP_009764159.1|  PREDICTED: dehydration-responsive element-bi...  75.5    3e-13   
emb|CDP09813.1|  unnamed protein product                              75.1    4e-13   
ref|XP_006477388.1|  PREDICTED: dehydration-responsive element-bi...  75.1    4e-13   
gb|ABD90468.1|  dehydration-responsive element-binding protein 1A     74.3    5e-13   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABH08746.1|  CBF/DREB-like transcription factor 1                  73.9    1e-12   Citrus trifoliata [hardy orange]
gb|ACB45097.1|  CRT binding factor 2A                                 73.6    1e-12   Solanum tuberosum [potatoes]
gb|AIT39762.1|  C-repeat binding factor 2                             73.2    2e-12   
gb|ABO48363.1|  C-repeat binding facor 1                              72.4    2e-12   Populus trichocarpa [western balsam poplar]
gb|ACB45088.1|  CRT binding factor 2                                  72.8    2e-12   Solanum habrochaites
gb|ACB45080.1|  CRT binding factor 2                                  72.8    2e-12   Solanum habrochaites
ref|XP_011081035.1|  PREDICTED: dehydration-responsive element-bi...  72.4    3e-12   
gb|AIQ82483.1|  CBF4                                                  72.4    3e-12   
gb|AIQ82473.1|  CBF4                                                  72.0    3e-12   
gb|ABI95805.1|  C-repeat binding factor                               72.0    4e-12   Ageratina adenophora
gb|EYU19514.1|  hypothetical protein MIMGU_mgv1a026630mg              72.0    4e-12   
ref|XP_010058216.1|  PREDICTED: dehydration-responsive element-bi...  72.8    4e-12   
gb|ADE62311.1|  dehydration-responsive element-binding protein 1A     72.0    4e-12   
gb|ABN58746.1|  C-repeat binding factor                               72.0    4e-12   Ageratina adenophora
gb|ACB45078.1|  CRT binding factor 3                                  71.6    4e-12   Solanum habrochaites
gb|ACI90294.1|  C-repeat binding factor                               70.1    4e-12   Picrorhiza kurrooa
gb|AIQ82502.1|  CBF4                                                  72.0    4e-12   
ref|XP_002318846.1|  hypothetical protein POPTR_0012s13870g           72.0    4e-12   Populus trichocarpa [western balsam poplar]
gb|ACB45086.1|  CRT binding factor 3                                  71.6    4e-12   Solanum habrochaites
ref|XP_002509703.1|  Dehydration-responsive element-binding prote...  71.6    5e-12   Ricinus communis
gb|ABK95675.1|  unknown                                               72.0    5e-12   Populus trichocarpa [western balsam poplar]
gb|ACB45098.1|  CRT binding factor 2B                                 71.6    5e-12   Solanum tuberosum [potatoes]
gb|KDP25515.1|  hypothetical protein JCGZ_20671                       71.6    5e-12   
gb|ACB45091.1|  CBF1-2 fusion protein                                 71.6    5e-12   Solanum pimpinellifolium [currant tomato]
ref|XP_006358388.1|  PREDICTED: dehydration-responsive element-bi...  71.6    5e-12   
gb|ABP64695.1|  putative C-repeat binding protein 4                   71.2    7e-12   Populus trichocarpa [western balsam poplar]
gb|ADZ95598.1|  C-repeat binding facor                                71.2    7e-12   
gb|AIQ82507.1|  CBF4                                                  71.2    7e-12   
gb|AIQ82505.1|  CBF4                                                  71.2    7e-12   
gb|AIQ82504.1|  CBF4                                                  71.2    7e-12   
gb|AGY31292.1|  C-repeat binding factor 4c                            71.2    7e-12   
ref|XP_011029176.1|  PREDICTED: dehydration-responsive element-bi...  71.2    7e-12   
gb|AGH33879.1|  DREB68                                                71.2    8e-12   
gb|EYU19512.1|  hypothetical protein MIMGU_mgv1a025309mg              70.9    8e-12   
ref|XP_002299565.1|  hypothetical protein POPTR_0001s08710g           70.9    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010058217.1|  PREDICTED: dehydration-responsive element-bi...  71.6    1e-11   
gb|AHN65457.1|  dehydration-responsive element binding protein        70.9    1e-11   
gb|ABY78835.1|  putative DRE-binding protein DREB1                    70.5    1e-11   Medicago sativa [alfalfa]
gb|AHN13908.1|  dehydration-responsive element binding factor         70.9    1e-11   
gb|AIQ82363.1|  CBF2                                                  70.1    1e-11   
gb|EYU19515.1|  hypothetical protein MIMGU_mgv1a026372mg              70.5    1e-11   
gb|AHN65494.1|  dehydration-responsive element binding protein        70.9    1e-11   
gb|ACY38600.1|  DREB-like protein 1                                   70.5    1e-11   Medicago sativa subsp. x varia
gb|AHN65439.1|  dehydration-responsive element binding protein        70.9    1e-11   
gb|AHN65438.1|  dehydration-responsive element binding protein        70.9    1e-11   
gb|AHN65441.1|  dehydration-responsive element binding protein        70.9    1e-11   
gb|AIQ82333.1|  CBF2                                                  70.1    1e-11   
ref|XP_009619193.1|  PREDICTED: dehydration-responsive element-bi...  70.5    1e-11   
gb|ACB45084.1|  CRT binding factor 4                                  70.1    1e-11   Solanum commersonii
ref|XP_011030036.1|  PREDICTED: dehydration-responsive element-bi...  70.5    2e-11   
gb|EYU19513.1|  hypothetical protein MIMGU_mgv1a020585mg              70.1    2e-11   
gb|AIQ82365.1|  CBF2                                                  69.7    2e-11   
gb|KDP25514.1|  hypothetical protein JCGZ_20670                       70.1    2e-11   
ref|XP_011101172.1|  PREDICTED: dehydration-responsive element-bi...  69.7    2e-11   
ref|XP_009611618.1|  PREDICTED: dehydration-responsive element-bi...  70.1    2e-11   
ref|XP_011073844.1|  PREDICTED: dehydration-responsive element-bi...  69.3    2e-11   
gb|AIU92962.1|  C-repeat/dehydration-responsive element-binding f...  70.1    2e-11   
gb|AGR40686.1|  C-repeat binding factor 10                            69.3    2e-11   
ref|XP_002509702.1|  Dehydration-responsive element-binding prote...  69.7    3e-11   Ricinus communis
gb|ACB45083.1|  CRT binding factor 4                                  69.3    3e-11   Solanum tuberosum [potatoes]
gb|AIQ82360.1|  CBF2                                                  68.9    3e-11   
gb|AIU92955.1|  C-repeat/dehydration-responsive element-binding f...  69.7    3e-11   
dbj|BAE17131.1|  LhCBF1                                               69.3    3e-11   Solanum habrochaites
gb|ACB45079.1|  CRT binding factor 1                                  69.3    3e-11   Solanum habrochaites
gb|AHN65456.1|  dehydration-responsive element binding protein        69.7    3e-11   
ref|XP_008361312.1|  PREDICTED: dehydration-responsive element-bi...  68.9    3e-11   
gb|AIU92952.1|  C-repeat/dehydration-responsive element-binding f...  69.3    4e-11   
gb|AIU92953.1|  C-repeat/dehydration-responsive element-binding f...  69.3    4e-11   
gb|KEH26611.1|  dehydration-responsive element-binding protein, p...  68.9    4e-11   
gb|AIU92949.1|  C-repeat/dehydration-responsive element-binding f...  69.3    4e-11   
gb|AGY31291.1|  C-repeat binding factor 4b                            69.3    4e-11   
gb|ABB72792.1|  dehydration responsive element binding protein        68.9    4e-11   Medicago truncatula
gb|AIU92950.1|  C-repeat/dehydration-responsive element-binding f...  69.3    4e-11   
gb|KDO63570.1|  hypothetical protein CISIN_1g026103mg                 69.3    4e-11   
ref|XP_006440529.1|  hypothetical protein CICLE_v10021923mg           69.3    4e-11   
gb|AGR40678.1|  C-repeat binding factor 3                             68.9    4e-11   
gb|AGR40677.1|  C-repeat binding factor 3                             68.9    4e-11   
gb|AGR40690.1|  C-repeat binding factor 8                             68.9    4e-11   
gb|AGH33881.1|  DREB70                                                69.3    4e-11   
gb|AIU92957.1|  C-repeat/dehydration-responsive element-binding f...  69.3    4e-11   
gb|ABG75914.1|  dehydration responsive element binding protein 1A     68.9    4e-11   Medicago truncatula
gb|AIQ82354.1|  CBF2                                                  68.6    4e-11   
gb|AIQ82342.1|  CBF2                                                  68.6    5e-11   
gb|AIQ82361.1|  CBF2                                                  68.6    5e-11   
gb|AIU92965.1|  C-repeat/dehydration-responsive element-binding f...  69.3    5e-11   
gb|AIQ82339.1|  CBF2                                                  68.2    5e-11   
gb|AFK45852.1|  unknown                                               69.3    5e-11   
gb|AIU92946.1|  C-repeat/dehydration-responsive element-binding f...  68.9    5e-11   
gb|AGR40691.1|  C-repeat binding factor 8                             69.3    5e-11   
gb|ABF59745.1|  CBF-like transcription factor                         68.6    5e-11   Cocos nucifera
gb|AIU47308.1|  C-repeat binding factor 1                             67.8    5e-11   
ref|XP_004234350.1|  PREDICTED: dehydration-responsive element-bi...  68.6    6e-11   
ref|XP_007218312.1|  hypothetical protein PRUPE_ppa010935mg           68.6    6e-11   
gb|AIQ82376.1|  CBF3                                                  68.2    6e-11   
gb|KEH26592.1|  dehydration-responsive element-binding protein 1B     69.3    6e-11   
gb|KEH26589.1|  CBF/DREB1 transcription factor                        68.9    6e-11   
gb|AIQ82367.1|  CBF2                                                  68.2    6e-11   
gb|AGR40696.1|  C-repeat binding factor 5                             68.9    6e-11   
ref|XP_009611054.1|  PREDICTED: dehydration-responsive element-bi...  68.6    6e-11   
gb|AIQ82506.1|  CBF4                                                  68.6    7e-11   
gb|ACB45087.1|  CRT binding factor 1                                  68.2    7e-11   Solanum habrochaites
gb|AIQ82369.1|  CBF3                                                  68.2    7e-11   
ref|NP_001274919.1|  AP2 domain CBF protein                           68.2    7e-11   
gb|AIQ82400.1|  CBF3                                                  67.8    7e-11   
emb|CBJ94884.1|  CBF2 protein                                         68.2    8e-11   Populus balsamifera [balsam poplar]
gb|AIQ82399.1|  CBF3                                                  67.8    8e-11   
gb|AIQ82398.1|  CBF3                                                  67.8    8e-11   
gb|ACY79411.1|  CRT-binding factor 1                                  68.2    8e-11   Solanum habrochaites
gb|ACB45094.1|  CRT binding factor 2                                  68.2    8e-11   Solanum commersonii
gb|AGR40697.1|  C-repeat binding factor 5                             68.6    8e-11   
gb|ACE73696.1|  DREB4                                                 68.2    9e-11   Nicotiana tabacum [American tobacco]
ref|XP_006353374.1|  PREDICTED: dehydration-responsive element-bi...  68.2    9e-11   
emb|CBJ94893.1|  CBF2 protein                                         67.8    9e-11   Populus trichocarpa [western balsam poplar]
gb|ABY78834.2|  putative DRE-binding protein DREB1s                   67.4    9e-11   Medicago falcata [sickle alfalfa]
gb|ABO48365.1|  C-repeat binding facor 3                              67.8    1e-10   Populus trichocarpa [western balsam poplar]
gb|AAS77819.1|  CBF3                                                  67.4    1e-10   Solanum lycopersicum
ref|XP_011029177.1|  PREDICTED: dehydration-responsive element-bi...  67.8    1e-10   
ref|XP_011014147.1|  PREDICTED: dehydration-responsive element-bi...  67.8    1e-10   
ref|XP_002298067.2|  dehydration responsive element binding prote...  67.8    1e-10   Populus trichocarpa [western balsam poplar]
gb|AGY31293.1|  C-repeat binding factor 2                             67.8    1e-10   
gb|KEH26590.1|  CBF/DREB1 transcription factor                        67.8    1e-10   
ref|XP_008369501.1|  PREDICTED: dehydration-responsive element-bi...  67.4    1e-10   
gb|ABF59738.1|  CBF-like transcription factor                         67.0    2e-10   Trachycarpus fortunei
gb|AFN06404.1|  ethylene-responsive element binding protein           67.0    2e-10   
gb|ACB20695.1|  CBF-like protein 1                                    67.8    2e-10   Camellia sinensis [black tea]
gb|AFN93974.1|  CBF1                                                  67.4    2e-10   
gb|ABP98988.1|  CBF/DREB1 transcription factor 2                      67.0    2e-10   Betula pendula [white birch]
gb|ADF43032.1|  CBF/DREB1-like protein b                              65.9    2e-10   
gb|AGR40694.1|  C-repeat binding factor 6                             67.0    2e-10   
gb|AGR40695.1|  C-repeat binding factor 6                             67.0    2e-10   
gb|AIU92948.1|  C-repeat/dehydration-responsive element-binding f...  67.4    2e-10   
gb|AIU92963.1|  C-repeat/dehydration-responsive element-binding f...  67.4    2e-10   
gb|AFQ59977.1|  CRT/DRE binding factor 1                              66.6    3e-10   
gb|AIU92947.1|  C-repeat/dehydration-responsive element-binding f...  67.0    3e-10   
gb|ABC79626.1|  CBF1                                                  66.6    3e-10   Populus tomentosa [Chinese white poplar]
gb|EYU29844.1|  hypothetical protein MIMGU_mgv1a014021mg              66.2    3e-10   
gb|AIU92958.1|  C-repeat/dehydration-responsive element-binding f...  66.6    3e-10   
gb|AAR28672.1|  CBF-like transcription factor                         66.6    4e-10   Vitis riparia [frost grape]
gb|AHN65435.1|  dehydration-responsive element binding protein        66.2    4e-10   
gb|AHN65392.1|  dehydration-responsive element binding protein        66.2    4e-10   
gb|AHN65417.1|  dehydration-responsive element binding protein        66.2    4e-10   
gb|ABF59740.1|  CBF-like transcription factor                         65.9    4e-10   Elaeis oleifera
gb|AHN65433.1|  dehydration-responsive element binding protein        66.2    4e-10   
gb|AHN65412.1|  dehydration-responsive element binding protein        66.2    4e-10   
gb|AHL44969.1|  CBF6B                                                 65.9    4e-10   
gb|AHN13909.1|  dehydration-responsive element binding factor         66.2    4e-10   
gb|AHN65437.1|  dehydration-responsive element binding protein        66.2    5e-10   
ref|XP_008234474.1|  PREDICTED: dehydration-responsive element-bi...  66.6    5e-10   
gb|AIU92964.1|  C-repeat/dehydration-responsive element-binding f...  66.2    5e-10   
gb|AHN65388.1|  dehydration-responsive element binding protein        65.9    5e-10   
ref|XP_009148577.1|  PREDICTED: dehydration-responsive element-bi...  65.9    5e-10   
emb|CDY57075.1|  BnaCnng31550D                                        65.9    5e-10   
gb|AGN53198.1|  CBF-like protein                                      66.2    5e-10   
ref|XP_009784265.1|  PREDICTED: dehydration-responsive element-bi...  65.5    5e-10   
ref|XP_006358387.1|  PREDICTED: dehydration-responsive element-bi...  65.9    6e-10   
ref|XP_009118070.1|  PREDICTED: dehydration-responsive element-bi...  65.5    6e-10   
ref|XP_010919216.1|  PREDICTED: dehydration-responsive element-bi...  65.5    6e-10   
gb|ACI42860.1|  dehydration-responsive element-binding protein 1B     65.5    6e-10   Rosa hybrid cultivar
emb|CDY16016.1|  BnaC08g41070D                                        65.1    7e-10   
gb|ACB45096.1|  CRT binding factor 1                                  65.9    8e-10   Solanum tuberosum [potatoes]
gb|AGH33880.1|  DREB69                                                65.5    8e-10   
gb|KEH26595.1|  dehydration-responsive element-binding protein        65.1    8e-10   
ref|NP_001274856.1|  CBF2                                             65.9    8e-10   
gb|ABC79627.1|  CBF2                                                  65.5    8e-10   Populus tomentosa [Chinese white poplar]
gb|ACH63209.1|  CRT/DRE binding factor                                65.9    8e-10   Rheum australe [Himalayan rhubarb]
gb|ABF29699.1|  AP2 domain CBF protein                                65.5    8e-10   Populus suaveolens [Mongolian poplar]
gb|ADF43034.1|  CBF/DREB1-like protein b                              65.5    9e-10   
ref|XP_007209842.1|  hypothetical protein PRUPE_ppa014628mg           65.1    9e-10   
gb|ADU03762.1|  C-repeat binding factor                               65.5    9e-10   
ref|XP_010519227.1|  PREDICTED: dehydration-responsive element-bi...  65.1    9e-10   
gb|ACY79412.1|  CRT-binding factor 1                                  65.1    9e-10   Solanum lycopersicoides
gb|AFU54609.1|  C-repeat binding factor                               65.5    1e-09   
gb|AFU54606.1|  C-repeat binding factor                               65.5    1e-09   
gb|ABF59741.1|  CBF-like transcription factor 2                       64.7    1e-09   Elaeis guineensis
gb|AIU92956.1|  C-repeat/dehydration-responsive element-binding f...  65.5    1e-09   
gb|AFU54607.1|  C-repeat binding factor                               65.1    1e-09   
gb|AHN65418.1|  dehydration-responsive element binding factor pro...  65.1    1e-09   
ref|XP_008246095.1|  PREDICTED: dehydration-responsive element-bi...  65.1    1e-09   
gb|ABU55659.1|  CBF1-like protein                                     65.1    1e-09   Ampelopsis glandulosa var. brevipedunculata [Amur peppervine]
gb|ABU55657.1|  CBF1-like protein                                     65.1    1e-09   Vitis aestivalis
gb|AAR28671.1|  CBF-like transcription factor                         65.1    1e-09   Vitis riparia [frost grape]
gb|ABP98987.1|  CBF/DREB1 transcription factor 1                      64.3    1e-09   Betula pendula [white birch]
gb|AIL00487.1|  C-repeat binding factor 1                             65.1    1e-09   
gb|ADY17818.1|  CBF1 transcription factor                             65.1    1e-09   
gb|AIL00479.1|  C-repeat binding factor 1                             65.1    1e-09   
gb|ADZ23479.1|  CBF transcription factor 1                            64.3    1e-09   
ref|XP_010933895.1|  PREDICTED: dehydration-responsive element-bi...  64.3    2e-09   
ref|XP_009609482.1|  PREDICTED: dehydration-responsive element-bi...  64.3    2e-09   
ref|XP_009759407.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  63.5    2e-09   
ref|XP_007210188.1|  hypothetical protein PRUPE_ppa017761mg           64.3    2e-09   
ref|XP_009586780.1|  PREDICTED: dehydration-responsive element-bi...  64.3    2e-09   
gb|ABX80062.1|  CRT/DRE binding factor 1                              63.9    2e-09   Medicago truncatula
gb|ABF59746.1|  CBF-like transcription factor 1                       63.9    2e-09   Rhapidophyllum hystrix [blue palmetto]
ref|XP_006391789.1|  hypothetical protein EUTSA_v10023865mg           63.5    2e-09   
ref|XP_004496025.1|  PREDICTED: dehydration-responsive element-bi...  63.9    2e-09   
gb|ABF59744.1|  CBF-like transcription factor                         63.9    2e-09   Dypsis lutescens
gb|ABI74671.1|  C-repeat binding factor 1                             63.9    2e-09   Solanum tuberosum [potatoes]
ref|XP_003611157.1|  Dehydration-responsive element-binding prote...  63.9    2e-09   
gb|AIL00500.1|  C-repeat binding factor 1                             64.3    3e-09   
ref|XP_004511604.1|  PREDICTED: dehydration-responsive element-bi...  63.9    3e-09   
ref|NP_001234123.1|  CBF1 protein                                     63.5    3e-09   
gb|AEK94313.1|  C-repeat binding factor 4                             63.2    4e-09   
gb|AIL00480.1|  C-repeat binding factor 1                             63.9    4e-09   
ref|XP_006340376.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  63.5    4e-09   
gb|AAQ88399.1|  CaCBF1A                                               62.4    4e-09   Capsicum annuum
gb|AIL00501.1|  C-repeat binding factor 1                             63.5    5e-09   
gb|AIL00513.1|  C-repeat binding factor 1                             63.5    5e-09   
ref|XP_006358389.1|  PREDICTED: dehydration-responsive element-bi...  63.5    5e-09   
gb|KCW90755.1|  hypothetical protein EUGRSUZ_A02832                   62.4    6e-09   
ref|XP_010317563.1|  PREDICTED: CBF1 protein isoform X1               62.8    6e-09   
ref|XP_009759409.1|  PREDICTED: dehydration-responsive element-bi...  62.8    6e-09   
ref|NP_176491.1|  ERF/AP2 transcription factor DDF2                   62.0    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008807522.1|  PREDICTED: dehydration-responsive element-bi...  62.4    7e-09   
gb|AIL00558.1|  C-repeat binding factor 1                             62.8    8e-09   
gb|AIL00538.1|  C-repeat binding factor 1                             62.8    8e-09   
gb|AIL00495.1|  C-repeat binding factor 1                             62.8    8e-09   
gb|AIL00491.1|  C-repeat binding factor 1                             62.8    8e-09   
ref|XP_006477722.1|  PREDICTED: dehydration-responsive element-bi...  61.2    8e-09   
ref|XP_002886439.1|  hypothetical protein ARALYDRAFT_475045           61.6    9e-09   
ref|XP_010061546.1|  PREDICTED: dehydration-responsive element-bi...  62.4    9e-09   
ref|XP_006301487.1|  hypothetical protein CARUB_v10021910mg           61.6    9e-09   
gb|ABU55656.1|  CBF1-like protein                                     62.8    9e-09   Vitis amurensis
gb|AIL00557.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00542.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00539.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00537.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00559.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00533.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00526.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00525.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00521.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|AIL00534.1|  C-repeat binding factor 1                             62.8    1e-08   
gb|ACB45093.1|  CRT binding factor 1                                  62.0    1e-08   Solanum commersonii
ref|XP_006440812.1|  hypothetical protein CICLE_v10022680mg           60.8    1e-08   
ref|XP_010324621.1|  PREDICTED: dehydration-responsive element-bi...  62.4    1e-08   
gb|ACJ26754.1|  AP2 domain CBF protein                                62.0    1e-08   Solanum tuberosum [potatoes]
gb|ABU55675.1|  CBF4-like protein                                     61.6    1e-08   Ampelopsis glandulosa var. brevipedunculata [Amur peppervine]
ref|XP_009110634.1|  PREDICTED: dehydration-responsive element-bi...  61.6    1e-08   
ref|XP_006491857.1|  PREDICTED: dehydration-responsive element-bi...  61.6    1e-08   
gb|ABF61217.1|  CBF/DREB1 transcription factor                        62.4    1e-08   Vitis amurensis
gb|AIL00475.1|  C-repeat binding factor 1                             62.4    1e-08   
gb|AIL00514.1|  C-repeat binding factor 1                             62.4    1e-08   
gb|AEB69782.1|  CBF                                                   62.0    1e-08   
ref|NP_172721.1|  dehydration-responsive element-binding protein 1F   61.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABF59739.1|  CBF-like transcription factor                         61.6    2e-08   Ravenea rivularis
gb|ABF59736.1|  CBF-like transcription factor                         61.2    2e-08   Sabal palmetto [cabbage palm]
ref|XP_004140794.1|  PREDICTED: dehydration-responsive element-bi...  61.2    2e-08   
ref|XP_004298771.1|  PREDICTED: dehydration-responsive element-bi...  62.0    2e-08   
gb|ABF59737.1|  CBF-like transcription factor                         61.2    2e-08   Sabal minor [bush palmetto]
gb|AFV93473.1|  CBF transcription factor                              61.2    2e-08   
ref|XP_007152343.1|  hypothetical protein PHAVU_004G122000g           61.6    2e-08   
ref|XP_008807523.1|  PREDICTED: dehydration-responsive element-bi...  61.2    2e-08   
gb|AIL00523.1|  C-repeat binding factor 1                             62.0    2e-08   
gb|ADF43031.1|  CBF/DREB1-like protein a                              59.7    2e-08   
ref|XP_004171792.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  61.2    2e-08   
gb|AIL00536.1|  C-repeat binding factor 1                             61.6    2e-08   
gb|AIL00506.1|  C-repeat binding factor 1                             61.6    2e-08   
gb|AIL00502.1|  C-repeat binding factor 1                             61.6    2e-08   
gb|ABO93604.1|  DREBa                                                 60.8    2e-08   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006417217.1|  hypothetical protein EUTSA_v10009978mg           60.8    2e-08   
ref|XP_009758148.1|  PREDICTED: dehydration-responsive element-bi...  60.8    3e-08   
gb|ACE73694.1|  DREB2                                                 60.8    3e-08   Nicotiana tabacum [American tobacco]
emb|CCF23020.1|  drought responsive element binding protein 1         61.2    3e-08   
gb|AAR28673.1|  CBF-like transcription factor                         61.2    3e-08   Vitis vinifera
gb|AAV66464.1|  drought responsive element binding protein            61.2    3e-08   Glycine soja [wild soybean]
ref|NP_001235507.1|  CBF-like protein                                 61.2    3e-08   
ref|XP_004244599.1|  PREDICTED: dehydration-responsive element-bi...  60.8    3e-08   
ref|XP_007040121.1|  AP2/ERF domain-containing transcription fact...  61.2    3e-08   
emb|CBZ41764.1|  drought responsive element binding protein 1         61.2    3e-08   
gb|AHZ90672.1|  CBF/DREB1 transcription factor 1                      60.8    3e-08   
ref|XP_002532187.1|  CBF-like transcription factor, putative          61.2    3e-08   
gb|KFK43527.1|  hypothetical protein AALP_AA1G137500                  60.5    3e-08   
ref|XP_010278524.1|  PREDICTED: dehydration-responsive element-bi...  60.8    4e-08   
ref|NP_001267504.1|  uncharacterized protein LOC100819565             60.8    4e-08   
ref|XP_003611158.1|  Dehydration-responsive element-binding prote...  60.8    4e-08   
ref|XP_003611155.1|  Dehydration-responsive element-binding prote...  60.5    4e-08   
ref|XP_006303182.1|  hypothetical protein CARUB_v10010303mg           60.5    4e-08   
ref|XP_010418309.1|  PREDICTED: dehydration-responsive element-bi...  60.1    4e-08   
dbj|BAD43714.1|  putative transcription factor DREB1A                 59.7    4e-08   
ref|XP_010473531.1|  PREDICTED: dehydration-responsive element-bi...  59.7    5e-08   
ref|XP_010430380.1|  PREDICTED: dehydration-responsive element-bi...  59.7    5e-08   
emb|CDY31270.1|  BnaC08g15650D                                        60.1    5e-08   
ref|XP_010061399.1|  PREDICTED: dehydration-responsive element-bi...  60.5    5e-08   
gb|AIL00510.1|  C-repeat binding factor 1                             60.5    6e-08   
ref|XP_011076240.1|  PREDICTED: dehydration-responsive element-bi...  60.1    6e-08   
gb|KDO65655.1|  hypothetical protein CISIN_1g029015mg                 59.7    6e-08   
gb|AEM97873.1|  AP2 domain class transcription factor                 59.7    8e-08   
gb|AGR40688.1|  C-repeat binding factor 9                             59.3    9e-08   
gb|KCW90745.1|  hypothetical protein EUGRSUZ_A02821                   58.5    9e-08   
ref|XP_009777001.1|  PREDICTED: uncharacterized protein LOC104226669  60.8    1e-07   
gb|ADZ23480.1|  CBF transcription factor 2                            59.3    1e-07   
ref|XP_007155567.1|  hypothetical protein PHAVU_003G212800g           60.5    1e-07   
gb|AGR40689.1|  C-repeat binding factor 9                             58.9    1e-07   
gb|AIL00520.1|  C-repeat binding factor 1                             59.7    1e-07   
gb|AIL00823.1|  C-repeat binding factor 4                             59.3    1e-07   
gb|AIL00515.1|  C-repeat binding factor 1                             59.7    1e-07   
gb|AGR40674.1|  C-repeat binding factor 14                            59.3    1e-07   
gb|AIL00508.1|  C-repeat binding factor 1                             59.7    1e-07   
ref|XP_010255545.1|  PREDICTED: dehydration-responsive element-bi...  59.3    1e-07   
gb|ABU55664.1|  CBF1-like protein                                     58.9    1e-07   
ref|XP_008803257.1|  PREDICTED: dehydration-responsive element-bi...  58.9    1e-07   
gb|AIL00787.1|  C-repeat binding factor 4                             58.9    1e-07   
gb|AIL00764.1|  C-repeat binding factor 4                             58.9    2e-07   
ref|XP_008439162.1|  PREDICTED: dehydration-responsive element-bi...  58.9    2e-07   
ref|XP_010061439.1|  PREDICTED: dehydration-responsive element-bi...  58.5    2e-07   
gb|AIL00783.1|  C-repeat binding factor 4                             58.9    2e-07   
gb|AIL00822.1|  C-repeat binding factor 4                             58.9    2e-07   
gb|AAW58104.1|  CBF-like transcription factor                         58.9    2e-07   
ref|XP_002280097.1|  PREDICTED: dehydration-responsive element-bi...  58.9    2e-07   
gb|ABU55661.1|  CBF1-like protein                                     58.5    2e-07   
ref|XP_002276153.1|  PREDICTED: dehydration-responsive element-bi...  58.9    2e-07   
gb|AIY26287.1|  CRT/DRE-binding factor                                58.9    2e-07   
gb|AIL00509.1|  C-repeat binding factor 1                             58.9    2e-07   
gb|AEF79999.1|  DREB transcription factor                             58.5    2e-07   
ref|XP_010940896.1|  PREDICTED: dehydration-responsive element-bi...  58.9    2e-07   
gb|AIL00519.1|  C-repeat binding factor 1                             58.9    2e-07   
gb|AGR40692.1|  C-repeat binding factor 7                             58.9    2e-07   
ref|XP_009411456.1|  PREDICTED: dehydration-responsive element-bi...  58.2    2e-07   
gb|KEH26591.1|  dehydration-responsive element-binding protein 1B     58.9    2e-07   
gb|ADY17814.1|  CBF4 transcription factor                             58.5    2e-07   
gb|ABU55660.1|  CBF1-like protein                                     57.8    2e-07   
gb|ABU55658.1|  CBF1-like protein                                     58.9    2e-07   
gb|EYU19516.1|  hypothetical protein MIMGU_mgv1a020838mg              58.5    2e-07   
gb|ACF94686.1|  dehydration-responsive element-binding factor 1/C...  58.5    3e-07   
gb|AIL00524.1|  C-repeat binding factor 1                             58.9    3e-07   
gb|ABU55668.1|  CBF1-like protein                                     57.8    3e-07   
gb|ABU55663.1|  CBF1-like protein                                     57.8    3e-07   
gb|AAQ88400.1|  CaCBF1B                                               58.2    3e-07   
gb|AHL44967.1|  CBF5                                                  57.4    3e-07   
gb|AEM37860.1|  CBF4                                                  56.6    3e-07   
ref|XP_004308117.1|  PREDICTED: dehydration-responsive element-bi...  58.2    4e-07   
gb|ABU55678.1|  CBF4-like protein                                     57.4    4e-07   
gb|AIL00794.1|  C-repeat binding factor 4                             57.8    4e-07   
ref|XP_004971403.1|  PREDICTED: dehydration-responsive element-bi...  57.8    4e-07   
gb|AFU81298.1|  C-repeat binding factor 1                             57.4    4e-07   
ref|XP_009112988.1|  PREDICTED: dehydration-responsive element-bi...  57.0    4e-07   
gb|AGR40685.1|  C-repeat binding factor 2a                            57.4    4e-07   
gb|ACF15446.1|  C-repeat binding factor 1c                            57.8    5e-07   
gb|AGR40693.1|  C-repeat binding factor 7                             57.8    5e-07   
ref|XP_003592322.1|  Dehydration-responsive element binding protein   57.0    5e-07   
gb|ADU03763.1|  C-repeat binding factor transcriptional activator     56.6    5e-07   
gb|AHH86060.1|  CRT/DRE-binding factor 2                              57.4    6e-07   
ref|XP_009791610.1|  PREDICTED: dehydration-responsive element-bi...  57.8    6e-07   
gb|ABX80063.1|  CRT/DRE binding factor 2                              57.4    6e-07   
gb|ADL74429.1|  CRT/DRE binding factor 4                              57.0    6e-07   
gb|AAY43213.1|  CRT/DRE binding factor 1                              57.4    6e-07   
ref|XP_002892697.1|  hypothetical protein ARALYDRAFT_471409           57.0    6e-07   
ref|XP_008437209.1|  PREDICTED: dehydration-responsive element-bi...  57.4    7e-07   
gb|KEH26600.1|  dehydration-responsive element-binding protein 1B     57.8    7e-07   
ref|XP_008238783.1|  PREDICTED: dehydration-responsive element-bi...  57.4    7e-07   
gb|ACF15447.1|  C-repeat binding factor 1d                            56.6    8e-07   
gb|ABU55673.1|  CBF4-like protein                                     56.2    8e-07   
gb|ABP98989.1|  CBF/DREB1 transcription factor 3                      56.6    8e-07   
gb|ABU55680.1|  CBF4-like protein                                     56.2    8e-07   
ref|XP_004511603.1|  PREDICTED: dehydration-responsive element-bi...  57.4    8e-07   
gb|AIL00632.1|  C-repeat binding factor 2                             57.4    8e-07   
ref|XP_004515794.1|  PREDICTED: dehydration-responsive element-bi...  56.6    9e-07   
gb|AFA50331.1|  dehydration-responsive element-binding protein 1      56.6    1e-06   
gb|ADF43035.2|  CBF/DREB1-like protein c                              57.0    1e-06   
gb|AIL00786.1|  C-repeat binding factor 4                             56.6    1e-06   
gb|ABU55679.1|  CBF4-like protein                                     55.8    1e-06   
gb|AFA50332.1|  dehydration-responsive element-binding protein 2      56.6    1e-06   
gb|ACJ63287.1|  C-repeat binding factor 1                             55.8    1e-06   
gb|ABS11982.1|  DREB-like transcription factor                        55.8    1e-06   
gb|AIL00579.1|  C-repeat binding factor 2                             57.0    1e-06   
ref|XP_009614214.1|  PREDICTED: dehydration-responsive element-bi...  56.6    1e-06   
emb|CBI34750.3|  unnamed protein product                              56.2    1e-06   
gb|ADE41100.1|  AP2 domain class transcription factor                 56.6    1e-06   
ref|XP_008364557.1|  PREDICTED: dehydration-responsive element-bi...  56.6    1e-06   
gb|AFB83707.1|  CBF1                                                  56.6    1e-06   
dbj|BAN51850.2|  putative C-repeat binding factor 2                   56.6    1e-06   
dbj|BAC20184.1|  dehydration responsive element binding protein 1...  56.6    1e-06   
ref|XP_009593083.1|  PREDICTED: dehydration-responsive element-bi...  56.6    1e-06   
ref|XP_010934429.1|  PREDICTED: dehydration-responsive element-bi...  56.6    1e-06   
gb|KDP22330.1|  hypothetical protein JCGZ_26161                       56.2    2e-06   
gb|ABD65473.1|  DREB1-like transcription factor                       56.2    2e-06   
ref|XP_009759325.1|  PREDICTED: dehydration-responsive element-bi...  56.2    2e-06   
ref|XP_009341269.1|  PREDICTED: dehydration-responsive element-bi...  56.2    2e-06   
gb|AAP83936.3|  putative dehydration responsive element binding p...  56.2    2e-06   
ref|XP_009781787.1|  PREDICTED: dehydration-responsive element-bi...  56.2    2e-06   
gb|AAQ98869.2|  putative dehydration responsive element binding p...  56.2    2e-06   
gb|ADE41123.1|  AP2 domain class transcription factor                 56.2    2e-06   
ref|XP_008377096.1|  PREDICTED: dehydration-responsive element-bi...  56.2    2e-06   
gb|ABV22882.2|  putative DRE-binding protein DREB1                    56.2    2e-06   
gb|AAG43549.1|AF211531_1  Avr9/Cf-9 rapidly elicited protein 111B     56.2    2e-06   
gb|AEM37861.1|  CBF1                                                  55.5    2e-06   
gb|AIQ82329.1|  CBF1                                                  55.8    2e-06   
emb|CAH10191.1|  avirulence-like protein 1                            56.2    2e-06   
gb|ABF61218.1|  CBF/DREB2 transcription factor                        56.6    2e-06   
ref|XP_009344261.1|  PREDICTED: dehydration-responsive element-bi...  55.1    2e-06   
gb|AHJ08666.1|  CRT/DRE-binding factor 1                              55.8    2e-06   
gb|AAR88363.1|  DREB-like protein 1                                   55.8    2e-06   
gb|AHI59143.1|  CBF4                                                  56.2    2e-06   
gb|AIQ82297.1|  CBF1                                                  55.8    2e-06   
ref|XP_010693509.1|  PREDICTED: dehydration-responsive element-bi...  55.8    2e-06   
gb|AIQ82301.1|  CBF1                                                  55.8    2e-06   
gb|AIL00630.1|  C-repeat binding factor 2                             56.2    2e-06   
ref|XP_002321877.1|  hypothetical protein POPTR_0015s13830g           56.2    2e-06   
gb|AIL00619.1|  C-repeat binding factor 2                             56.2    2e-06   
gb|ACF77118.1|  CBF4a                                                 56.2    2e-06   
gb|AIL00569.1|  C-repeat binding factor 2                             56.2    2e-06   
gb|AIL00570.1|  C-repeat binding factor 2                             56.2    2e-06   
ref|XP_011041633.1|  PREDICTED: dehydration-responsive element-bi...  56.2    2e-06   
gb|AGR40683.1|  C-repeat binding factor 2                             55.8    2e-06   
gb|KCW90750.1|  hypothetical protein EUGRSUZ_A02826                   55.8    2e-06   
ref|XP_010061486.1|  PREDICTED: dehydration-responsive element-bi...  55.8    2e-06   
gb|ACF77119.1|  CBF4b                                                 56.2    2e-06   
gb|AGR40681.1|  C-repeat binding factor 11                            56.6    2e-06   
gb|ADY17812.1|  CBF2 transcription factor                             56.2    2e-06   
gb|AIL00642.1|  C-repeat binding factor 2                             56.2    2e-06   
gb|AGR40682.1|  C-repeat binding factor 11                            56.2    2e-06   
gb|EYU25052.1|  hypothetical protein MIMGU_mgv1a012186mg              56.2    2e-06   
gb|AIL00577.1|  C-repeat binding factor 2                             56.2    3e-06   
gb|AGR40680.1|  C-repeat binding factor 11                            56.2    3e-06   
ref|XP_011016549.1|  PREDICTED: dehydration-responsive element-bi...  55.8    3e-06   
ref|XP_006364144.1|  PREDICTED: dehydration-responsive element-bi...  55.5    3e-06   
gb|AIU92967.1|  C-repeat/dehydration-responsive element-binding f...  55.8    3e-06   
gb|AIL00640.1|  C-repeat binding factor 2                             55.8    3e-06   
ref|XP_004252643.1|  PREDICTED: dehydration-responsive element-bi...  55.5    3e-06   
gb|ACZ37076.1|  CRT/DRE binding factor                                55.5    3e-06   
ref|XP_010106004.1|  Dehydration-responsive element-binding prote...  55.8    3e-06   
gb|AIL00633.1|  C-repeat binding factor 2                             55.8    3e-06   
gb|ACZ37079.1|  CRT/DRE binding factor                                55.5    3e-06   
gb|ABV27118.1|  C-repeat binding factor 2                             55.5    3e-06   
gb|ACZ37080.1|  CRT/DRE binding factor                                55.5    3e-06   
gb|AIL00561.1|  C-repeat binding factor 2                             55.8    3e-06   
emb|CAN75246.1|  hypothetical protein VITISV_027054                   55.8    3e-06   
gb|AIL00597.1|  C-repeat binding factor 2                             55.8    3e-06   
gb|ACZ37077.1|  CRT/DRE binding factor                                55.5    3e-06   
gb|ABV27138.1|  C-repeat binding factor 3                             55.5    3e-06   
gb|ABU55672.1|  CBF4-like protein                                     54.7    3e-06   
gb|ACZ37078.1|  CRT/DRE binding factor                                55.1    3e-06   
ref|XP_006421846.1|  hypothetical protein CICLE_v10007068mg           55.1    3e-06   
gb|ABV65907.2|  CRT/DRE-binding factor 1                              55.1    3e-06   
gb|AGR40679.1|  C-repeat binding factor 12                            55.5    3e-06   
ref|XP_009344259.1|  PREDICTED: dehydration-responsive element-bi...  55.5    3e-06   
ref|XP_009339654.1|  PREDICTED: dehydration-responsive element-bi...  55.5    4e-06   
ref|XP_009344260.1|  PREDICTED: dehydration-responsive element-bi...  55.5    4e-06   
ref|XP_009377921.1|  PREDICTED: dehydration-responsive element-bi...  55.5    4e-06   
gb|AIL00580.1|  C-repeat binding factor 2                             55.5    4e-06   
gb|ABU55676.1|  CBF4-like protein                                     54.3    4e-06   
gb|ABU55677.1|  CBF4-like protein                                     54.3    4e-06   
gb|ABR23056.1|  DRE-binding transcription factor swDREB1              55.5    4e-06   
gb|AGL07696.1|  CBF/DREB 4                                            55.5    4e-06   
gb|AIL00808.1|  C-repeat binding factor 4                             55.1    4e-06   
ref|NP_001287934.1|  dehydration-responsive element-binding prote...  55.1    4e-06   
gb|AIU39990.1|  dehydration responsive element-binding protein        55.1    5e-06   
gb|AIL00574.1|  C-repeat binding factor 2                             55.5    5e-06   
ref|XP_002270637.1|  PREDICTED: dehydration-responsive element-bi...  55.5    5e-06   
gb|AIL00647.1|  C-repeat binding factor 2                             55.5    5e-06   
gb|AIL00645.1|  C-repeat binding factor 2                             55.1    5e-06   
gb|AGL07697.1|  CBF/DREB 3                                            55.1    5e-06   
gb|AAR28674.1|  CBF-like transcription factor                         55.1    5e-06   
gb|AAT39973.1|  Dehydration-responsive element-binding protein 1B...  54.7    5e-06   
gb|AIL00629.1|  C-repeat binding factor 2                             55.1    5e-06   
gb|AIL00614.1|  C-repeat binding factor 2                             55.1    5e-06   
gb|AIL00604.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AIL00637.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AIL00620.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AIL00634.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AAV80415.1|  putative transcription factor CBF2                    54.3    6e-06   
gb|AIL00568.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AIL00567.1|  C-repeat binding factor 2                             55.1    6e-06   
gb|AIL00581.1|  C-repeat binding factor 2                             55.1    7e-06   
gb|EPS68879.1|  hypothetical protein M569_05891                       54.3    7e-06   
gb|AIL00566.1|  C-repeat binding factor 2                             55.1    7e-06   
ref|NP_567719.1|  dehydration-responsive element-binding protein 1C   54.3    7e-06   
gb|AIL00612.1|  C-repeat binding factor 2                             54.7    7e-06   
gb|ACU00273.1|  dehydration-responsive element-binding factor 1       54.3    7e-06   
gb|AAC99371.1|  CRT/DRE binding factor 2                              54.3    8e-06   
ref|XP_009623988.1|  PREDICTED: dehydration-responsive element-bi...  54.3    8e-06   
gb|AIL00589.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|ABV27100.1|  C-repeat binding factor 2                             54.3    8e-06   
gb|AIL00651.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|AIL00587.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|AIL00644.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|AIL00608.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|ACI15606.1|  DRE/CRT-binding factor 2                              54.3    8e-06   
gb|AIL00591.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|AIL00610.1|  C-repeat binding factor 2                             54.7    8e-06   
gb|AFJ14631.1|  dehydration-responsive element-binding protein        55.1    9e-06   
gb|ABU55667.1|  CBF1-like protein                                     53.1    9e-06   
gb|AHI59150.1|  DREB1A                                                54.3    1e-05   
gb|AIU92971.1|  C-repeat/dehydration-responsive element-binding f...  54.3    1e-05   
ref|XP_004496614.1|  PREDICTED: dehydration-responsive element-bi...  53.5    1e-05   
ref|XP_010940400.1|  PREDICTED: dehydration-responsive element-bi...  53.5    1e-05   



>gb|EYU38994.1| hypothetical protein MIMGU_mgv1a025975mg [Erythranthe guttata]
Length=207

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ AA LNFADSVWRLPVPAS DA+DLRKAAVEAAEAFR
Sbjct  68   GTYPTPEMAARAHDVAALALRGK-AACLNFADSVWRLPVPASKDARDLRKAAVEAAEAFR  126

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P E  EE       S E               +S      D +   ++   +  +A+G L
Sbjct  127  PPESGEEFCSEQRRSEEVAADSTNGGGNVAGGVS------DLYDVVLEDLDMERLAEGVL  180

Query  267  LSPAPSLGKGF  235
            LSP P LG  F
Sbjct  181  LSPPPCLGWRF  191



>gb|AHL69786.1| dehydration-responsive element-binding protein [Camellia sinensis]
Length=250

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 85/144 (59%), Gaps = 17/144 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALAL+GQ A  LNFADSVW+LPVP S DAKD+R AAVEAAEAFR
Sbjct  95   GTYPTAEMAARAHDVAALALKGQLAC-LNFADSVWKLPVPVSKDAKDIRSAAVEAAEAFR  153

Query  447  PKE--C--------EEEIV---ITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGM  307
            P +  C        EE+I+   ++                 NV  +     E    +  M
Sbjct  154  PSDHLCNDNTGSRVEEKILSDGVSGTKVCHDGASSSNGTRDNVCHMDEE--EEKDAIFDM  211

Query  306  QGGFLGSMADGNLLSPAPSLGKGF  235
            QG  LG MADG LLSP P +G  F
Sbjct  212  QGLILG-MADGPLLSPPPCVGARF  234



>ref|XP_009784267.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=220

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA+ALRG+ +A LNFADSVW+LPVPAS DAKD+++AAVEAAEAFR
Sbjct  87   GTYPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLPVPASADAKDIQRAAVEAAEAFR  145

Query  447  PKECE  433
            P E E
Sbjct  146  PSESE  150



>ref|NP_001274894.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26758.1| AP2 domain CBF protein [Solanum tuberosum]
Length=218

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+FR
Sbjct  90   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFR  148

Query  447  PKECEEEIVITT  412
            P + EEE V+TT
Sbjct  149  PLKSEEESVVTT  160



>gb|ACB45082.1| CRT binding factor 5 [Solanum tuberosum]
Length=189

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA+ALRG  +A LNFADS WRLP PAS D KD++KAA EAAE+FR
Sbjct  61   GTYPTAEMAARAHDVAAIALRGG-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFR  119

Query  447  PKECEEEIVITT  412
            P + EEE V++T
Sbjct  120  PLKSEEESVVST  131



>gb|ACU00264.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 18/128 (14%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR
Sbjct  75   GTYPTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSTNVKDIQKAAVKAAEAFR  133

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 +++ +   +              N +  +  I   D  + GMQ GF   MA+G +
Sbjct  134  --YVNDDVTLAEES--------------NQVKENHVIYMDDDVVFGMQ-GFFADMAEGMM  176

Query  267  LSPAPSLG  244
            L P  S+G
Sbjct  177  LPPPKSIG  184



>gb|ACU00265.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 18/128 (14%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV AAEAFR
Sbjct  75   GTYPTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSTNVKDIQKAAVNAAEAFR  133

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 +++ +   +              N +  +  I   D  + GMQ GF   MA+G +
Sbjct  134  --SVNDDVALAEES--------------NQVKDNHVIYMDDDVVFGMQ-GFFADMAEGMM  176

Query  267  LSPAPSLG  244
            L P  S+G
Sbjct  177  LPPPKSIG  184



>gb|ACB45092.1| CRT binding factor 3 [Solanum commersonii]
Length=217

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAA++FR
Sbjct  89   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAKSFR  147

Query  447  PKECEEEIVITT  412
            P + EEE V+TT
Sbjct  148  PLKSEEESVVTT  159



>gb|ACU00263.1| dehydration-responsive element-binding factor 1 [Chrysanthemum 
x morifolium]
Length=203

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 18/128 (14%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVA LA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR
Sbjct  75   GTYPTADMAARAHDVAVLAMRGR-SACLNFADSLWRLPIPKSSNVKDIQKAAVKAAEAFR  133

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 +++ +   +              N +  +  I   D  + GMQ GF   MA+G +
Sbjct  134  --SVNDDVALAEES--------------NQVKENHVIYMDDDVVFGMQ-GFFADMAEGLM  176

Query  267  LSPAPSLG  244
            L P  S+G
Sbjct  177  LPPPKSIG  184



>gb|ACB45095.1| CRT binding factor 3 [Solanum tuberosum]
Length=217

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+FR
Sbjct  89   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFR  147

Query  447  PKECEEEIVITT  412
            P + EEE V+ T
Sbjct  148  PLKSEEESVVIT  159



>ref|XP_009764159.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Nicotiana sylvestris]
Length=247

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 77/143 (54%), Gaps = 13/143 (9%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG  +ATLNFADS+WRLPV  S D KDLR+AAV+AAEAFR
Sbjct  87   GTYPTPEMAARAHDVAALALRGN-SATLNFADSLWRLPVIVSKDPKDLRQAAVKAAEAFR  145

Query  447  P-------KECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQG----  301
                        EE+        +        +   V  +    ME +       G    
Sbjct  146  QDPELVRVDYMNEEVNSNEEVKCQENFVNGNGNDMGVKEVKMKNMEIENIFCSNWGENSE  205

Query  300  -GFLGSMADGNLLSPAPSLGKGF  235
              +   MA+G L SP P LG  F
Sbjct  206  ESWQEKMAEGLLFSPTPRLGNCF  228



>emb|CDP09813.1| unnamed protein product [Coffea canephora]
Length=259

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 79/156 (51%), Gaps = 26/156 (17%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARA+DVAALALRG  A  LNFADSVWRLPVP S DAKD+RKAA EAAE FR
Sbjct  87   GTYPTAEMAARAYDVAALALRGHLAC-LNFADSVWRLPVPESRDAKDIRKAAAEAAEMFR  145

Query  447  PK-ECE------------------------EEIVITTPTSVEapppppaddPWNVLSLSP  343
             + EC+                        EEI   T  + E       +        S 
Sbjct  146  SQEECDNTTSEASASGSGSESGDHHHDRVGEEIGDITHDNNEVSSFDHGEALQKNGEEST  205

Query  342  PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
              M  D        G +  MA+G LLSP   LG G+
Sbjct  206  SSMFMDDEALFDVHGLMAHMAEGLLLSPPHCLGDGY  241



>ref|XP_006477388.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Citrus sinensis]
Length=243

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 81/125 (65%), Gaps = 5/125 (4%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94   GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P++ E E        +E       +   N L L   ++  D        G L  MA+G L
Sbjct  153  PRDDELEESNIHHVKLEEVQKTMQE---NTL-LPENVLYMDEHAVFDMPGLLADMAEGLL  208

Query  267  LSPAP  253
            LSP P
Sbjct  209  LSPPP  213



>gb|ABD90468.1| dehydration-responsive element-binding protein 1A [Chrysanthemum 
x morifolium]
Length=203

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 78/128 (61%), Gaps = 18/128 (14%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVA LA+RG+ +  LNFADS+WRLPVP S + KD++KAAV+AAEAFR
Sbjct  75   GTYPTADMAARAHDVAVLAMRGR-SVCLNFADSLWRLPVPKSSNVKDIQKAAVKAAEAFR  133

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P    +++ +   +              N +  +  I   D  +  MQ GF   MA+G +
Sbjct  134  P--VNDDVALAEES--------------NQVKENHVIYMDDDVVFEMQ-GFFADMAEGMM  176

Query  267  LSPAPSLG  244
            L P  S+G
Sbjct  177  LPPPKSIG  184



>gb|ABH08746.1| CBF/DREB-like transcription factor 1 [Citrus trifoliata]
Length=243

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 81/125 (65%), Gaps = 5/125 (4%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94   GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P++ E E        +E       +   N L L   ++  D        G L  MA+G L
Sbjct  153  PRDDELEESNIHHVKLEEVQKTMQE---NTL-LPENVLYMDEQAVFDMPGLLADMAEGLL  208

Query  267  LSPAP  253
            LSP P
Sbjct  209  LSPPP  213



>gb|ACB45097.1| CRT binding factor 2A [Solanum tuberosum]
Length=234

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 13/129 (10%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FR
Sbjct  92   GTFPTAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFR  150

Query  447  PKECEEE----IVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMA  280
            P E EE       ITTP + E       +   N        M+ +        G + +MA
Sbjct  151  PSESEEVSGECSNITTPETPEKALSMNEEAQVNSF-----FMDEEALF--YMPGLIANMA  203

Query  279  DGNLLSPAP  253
            +G L+ P P
Sbjct  204  EG-LMLPLP  211



>gb|AIT39762.1| C-repeat binding factor 2 [Ageratina adenophora]
Length=218

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 76/123 (62%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMA++AH+VA LA+RG+ +A LNFA+SVWRLP+P S + KD++KAAV+AAEAFR
Sbjct  91   GTYPTAEMASQAHNVAVLAIRGR-SACLNFANSVWRLPIPESSNVKDIQKAAVKAAEAFR  149

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P E +  ++               +   NV  +       D  +  MQ GFL  MA+G +
Sbjct  150  PTETDVAVI-----------EESNELTGNVFCVD------DESIFEMQ-GFLADMAEGMM  191

Query  267  LSP  259
            L P
Sbjct  192  LPP  194



>gb|ABO48363.1| C-repeat binding facor 1 [Populus trichocarpa]
Length=192

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  51   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  109

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  110  PEGCVGGELMRTGDEGEKAAETTAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  162

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  163  LPP-PHCGGG  171



>gb|ACB45088.1| CRT binding factor 2 [Solanum habrochaites]
Length=223

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 80/130 (62%), Gaps = 15/130 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  89   GTFPTVEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  147

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  148  PLKESEEVSGESPETSE-----------NVQESSYFVDEEALFFM---PGLLANMAEGLM  193

Query  267  LSPAPSLGKG  238
            L P   L  G
Sbjct  194  LPPPQCLEIG  203



>gb|ACB45080.1| CRT binding factor 2 [Solanum habrochaites]
Length=223

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 79/130 (61%), Gaps = 15/130 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDV ALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  89   GTFPTVEMAARAHDVTALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  147

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  148  PLKESEEVSGESPETSE-----------NVQESSYFVDEEALFF---MPGLLANMAEGLM  193

Query  267  LSPAPSLGKG  238
            L P   L  G
Sbjct  194  LPPPQCLEIG  203



>ref|XP_011081035.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Sesamum indicum]
Length=209

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 83/135 (61%), Gaps = 20/135 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            G+YPTPEMAARAHDVAALALRGQ A  LNFADSVWRLP+PAS +AKDLRKAA EAAEAFR
Sbjct  75   GSYPTPEMAARAHDVAALALRGQMAC-LNFADSVWRLPIPASKEAKDLRKAAAEAAEAFR  133

Query  447  PKE----CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMA  280
            P+     C+E+    T T  +                SP +   +G L       +  +A
Sbjct  134  PRATEEVCQEQRKEETSTDNDGEKKA-----------SPDLC--NGILYDELS--IARLA  178

Query  279  DGNLLSPAPSLGKGF  235
            +G LLSP P LG  F
Sbjct  179  EGVLLSPPPCLGWRF  193



>gb|AIQ82483.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82484.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82485.1| CBF4, partial [Populus balsamifera]
Length=231

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|AIQ82473.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82474.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82475.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82476.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82477.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82478.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82479.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82480.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82481.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82482.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82486.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82487.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82488.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82489.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82490.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82491.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82492.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82493.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82494.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82495.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82496.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82497.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82498.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82499.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82500.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82501.1| CBF4, partial [Populus balsamifera]
 gb|AIQ82503.1| CBF4, partial [Populus balsamifera]
Length=231

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|ABI95805.1| C-repeat binding factor [Ageratina adenophora]
Length=219

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR
Sbjct  92   GTYPTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFR  150

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P E +  ++               +   NV  +       D  +  MQ GFL  MA+G +
Sbjct  151  PTETDVAVI-----------EESNELTGNVFCVD------DESIFEMQ-GFLADMAEGMM  192

Query  267  LSP  259
            L P
Sbjct  193  LPP  195



>gb|EYU19514.1| hypothetical protein MIMGU_mgv1a026630mg [Erythranthe guttata]
Length=229

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 80/138 (58%), Gaps = 27/138 (20%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFR
Sbjct  92   GTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFR  150

Query  447  PK-------ECEEEIVITTPTSVEapppppaddPWNVLSLSPPIME--PDGFLTGMQGGF  295
            P+       +  EE  +                  N  + SP  M    +  + GM  G 
Sbjct  151  PQSSSDSGGDAREETAVAA----------------NNYTASPENMYFMDEEMMFGMH-GL  193

Query  294  LGSMADGNLLSPAPSLGK  241
            + +MA+G ++ P P   +
Sbjct  194  VDNMAEGLMMMPPPHHHQ  211



>ref|XP_010058216.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Eucalyptus grandis]
 gb|KCW72084.1| hypothetical protein EUGRSUZ_E00529 [Eucalyptus grandis]
Length=289

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALALRG+    LNFADS WRLPVPAS +A ++R+ A+ AAEAFR
Sbjct  97   GTYPTAEMAARAHDVAALALRGRHGVCLNFADSAWRLPVPASREAAEIRRTAMAAAEAFR  156

Query  447  PKECEEEI  424
            P E EE +
Sbjct  157  PAEAEEAV  164



>gb|ADE62311.1| dehydration-responsive element-binding protein 1A [Ageratina 
adenophora]
Length=219

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR
Sbjct  92   GTYPTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFR  150

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P E +  ++               +   NV  +       D  +  MQ GFL  MA+G +
Sbjct  151  PTETDVAVI-----------EESNELTGNVFCVD------DESIFEMQ-GFLADMAEGMM  192

Query  267  LSP  259
            L P
Sbjct  193  LPP  195



>gb|ABN58746.1| C-repeat binding factor [Ageratina adenophora]
Length=219

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVAALA+RG+ +A LNFADS+WRLP+P S + KD++KAAV+AAEAFR
Sbjct  92   GTYPTADMAARAHDVAALAMRGR-SACLNFADSLWRLPIPESSNVKDIQKAAVKAAEAFR  150

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P E +  ++               +   NV  +       D  +  MQ GFL  MA+G +
Sbjct  151  PTETDVAVI-----------EESNELTGNVFCVD------DESIFEMQ-GFLADMAEGMM  192

Query  267  LSP  259
            L P
Sbjct  193  LPP  195



>gb|ACB45078.1| CRT binding factor 3 [Solanum habrochaites]
Length=203

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+FR
Sbjct  76   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFR  134

Query  447  PKECEEEIVITTPTSV  400
            P + EEE  +    S 
Sbjct  135  PLKSEEEESVVKDQST  150



>gb|ACI90294.1| C-repeat binding factor [Picrorhiza kurrooa]
Length=105

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 55/98 (56%), Gaps = 7/98 (7%)
 Frame = -1

Query  555  AATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECEEEIVITTPTSVEapppppa  376
            +A LNFADS WRLPVPAS DAKD+++AAVEAAEAFRP+      V     S        A
Sbjct  14   SACLNFADSSWRLPVPASSDAKDIQRAAVEAAEAFRPQ------VEPITCSASVASQEEA  67

Query  375  ddPWNVLSLSPPIMEPDGFLTGMQ-GGFLGSMADGNLL  265
                NV S        D  L G++  G L +MA+G LL
Sbjct  68   TSAANVASRQNVFFMDDEALFGIEMHGLLVNMAEGMLL  105



>gb|AIQ82502.1| CBF4, partial [Populus balsamifera]
Length=246

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S+D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSMDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>ref|XP_002318846.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
 gb|EEE97066.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
Length=255

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAETTAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|ACB45086.1| CRT binding factor 3 [Solanum habrochaites]
Length=203

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP PAS D KD++KAA EAAE+FR
Sbjct  76   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPASSDTKDIQKAAAEAAESFR  134

Query  447  PKECEEEIVITTPTSV  400
            P + EEE  +    S 
Sbjct  135  PLKSEEEESVVKDQST  150



>ref|XP_002509703.1| Dehydration-responsive element-binding protein 1F, putative [Ricinus 
communis]
 gb|EEF51090.1| Dehydration-responsive element-binding protein 1F, putative [Ricinus 
communis]
Length=230

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D  D+R+AA EAAE FR
Sbjct  86   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSTDPNDIRRAAHEAAELFR  144

Query  447  PKE  439
            P+E
Sbjct  145  PQE  147



>gb|ABK95675.1| unknown [Populus trichocarpa]
Length=255

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAGTTAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|ACB45098.1| CRT binding factor 2B [Solanum tuberosum]
Length=226

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 9/83 (11%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  84   GTFPTVEMAARAHDVAALALRGRRSACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  143

Query  447  PK------ECEEEIVITTPTSVE  397
            P+      EC      TTP ++E
Sbjct  144  PESEEVSGECSSS---TTPETLE  163



>gb|KDP25515.1| hypothetical protein JCGZ_20671 [Jatropha curcas]
Length=230

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVPAS DAK++R+AA +AAE FR
Sbjct  88   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPASRDAKEIRRAASQAAEMFR  146

Query  447  PKECEEEIVIT  415
             +E  +++ IT
Sbjct  147  REES-DDVQIT  156



>gb|ACB45091.1| CBF1-2 fusion protein [Solanum pimpinellifolium]
Length=216

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 15/130 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  82   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  140

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  141  PLKESEEVSGESPETSE-----------NVQESSDFVDEEALF---SMPGLLANMAEGLM  186

Query  267  LSPAPSLGKG  238
            L P   L  G
Sbjct  187  LPPPQCLEIG  196



>ref|XP_006358388.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Solanum tuberosum]
Length=238

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 83/143 (58%), Gaps = 14/143 (10%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG  A TLNFADS WRLPVPAS D KD+R+AAV AA+AF 
Sbjct  79   GTYPTPEMAARAHDVAALALRGNLA-TLNFADSRWRLPVPASKDPKDIRQAAVIAAQAF-  136

Query  447  PKECEEEIV---ITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQG--------  301
             ++ E + +   + + T+ E       +   +  S     M+ +  L+   G        
Sbjct  137  SQDTEVDYMNEEVNSNTTDEIDIARVNNGSSSDFSAKELSMDMENILSCNGGEDNYMLET  196

Query  300  -GFLGSMADGNLLSPAPSLGKGF  235
             G+   MA+  L SP P LG  F
Sbjct  197  EGWREKMAEELLFSPTPRLGSCF  219



>gb|ABP64695.1| putative C-repeat binding protein 4 [Populus trichocarpa]
Length=209

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKECEEEIVI  418
            P+E  E  V 
Sbjct  137  PQEFGENDVF  146



>gb|ADZ95598.1| C-repeat binding facor [Fraxinus americana]
Length=224

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 78/137 (57%), Gaps = 19/137 (14%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA RGQ A  LNFADSVW LPVP S D KD++KAA+EAAE FR
Sbjct  83   GTYPTAEMAARAHDVAALAFRGQLAC-LNFADSVWCLPVPVSKDVKDIQKAALEAAELFR  141

Query  447  PKE------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGS  286
            P E       +E ++ +T  S             N  +L      PD  ++ M    + +
Sbjct  142  PPEEGGGTILQENVMDSTGVS-----------GGNSTTLDTTKTLPDCDVSYMNEDSVTN  190

Query  285  MADGNLLSPAPSLGKGF  235
            M  G L+SP PSL    
Sbjct  191  MG-GVLMSPPPSLDHSL  206



>gb|AIQ82507.1| CBF4, partial [Populus deltoides]
Length=228

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|AIQ82505.1| CBF4, partial [Populus deltoides]
Length=228

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|AIQ82504.1| CBF4, partial [Populus deltoides]
Length=228

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|AGY31292.1| C-repeat binding factor 4c [Populus euphratica]
Length=223

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>ref|XP_011029176.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
 ref|XP_011014145.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
Length=240

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|AGH33879.1| DREB68 [Populus hopeiensis]
Length=255

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|EYU19512.1| hypothetical protein MIMGU_mgv1a025309mg [Erythranthe guttata]
Length=229

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFR
Sbjct  92   GTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFR  150

Query  447  PK  442
            P+
Sbjct  151  PQ  152



>ref|XP_002299565.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
 gb|EEE84370.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
Length=213

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>ref|XP_010058217.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Eucalyptus grandis]
Length=286

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALALRG+    LNFADS WRLP+PAS +A ++R+ A+ AAEAFR
Sbjct  94   GTYPTAEMAARAHDVAALALRGRHGVCLNFADSAWRLPLPASHEAAEIRRTAMAAAEAFR  153

Query  447  PKECEEEI  424
            P E EE +
Sbjct  154  PAEAEEAV  161



>gb|AHN65457.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|ABY78835.1| putative DRE-binding protein DREB1 [Medicago sativa]
Length=216

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG++A  LNFADS+WRLP+PAS   KD++KAA +AAEAFR
Sbjct  81   GTFPTPEMAARAHDVAAMALRGRYAC-LNFADSMWRLPIPASSSIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|AHN13908.1| dehydration-responsive element binding factor [Populus nigra]
 gb|AHN65443.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65450.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65452.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65454.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65469.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65472.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65473.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65474.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65478.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65479.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65480.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65481.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65492.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65493.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65496.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|AIQ82363.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGSFR  101

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  102  PEGCVGGELMRTRDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  154

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  155  LPP-PHCGGG  163



>gb|EYU19515.1| hypothetical protein MIMGU_mgv1a026372mg [Erythranthe guttata]
Length=227

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFR
Sbjct  87   GTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFR  145

Query  447  PK  442
            P+
Sbjct  146  PQ  147



>gb|AHN65494.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65498.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65499.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65500.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65501.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65502.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|ACY38600.1| DREB-like protein 1 [Medicago sativa subsp. x varia]
Length=216

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG++A  LNFADS+WRLP+PAS   KD++KAA +AAEAFR
Sbjct  81   GTFPTPEMAARAHDVAAVALRGRYAC-LNFADSMWRLPIPASSSIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|AHN65439.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65444.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65445.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65446.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65455.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65471.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65482.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65484.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65485.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65486.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65488.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65491.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|AHN65438.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65440.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65442.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65447.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65448.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65449.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65451.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65453.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65458.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65459.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65460.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65461.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65462.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65463.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65464.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65465.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65466.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65467.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65468.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65470.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65475.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65476.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65477.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65483.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65487.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65489.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65490.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65495.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65497.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|AHN65441.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>gb|AIQ82333.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82334.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82335.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82336.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82337.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82338.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82340.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82341.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82343.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82344.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82345.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82346.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82347.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82348.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82351.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82353.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82356.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82357.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82358.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82359.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82362.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82364.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGSFR  101

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  102  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  154

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  155  LPP-PHCGGG  163



>ref|XP_009619193.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Nicotiana tomentosiformis]
Length=256

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHD+AALALRG  +ATLNFADS+WRLPV  S D KDLR+AAV+AAEAFR
Sbjct  94   GTYPTPEMAARAHDIAALALRGN-SATLNFADSLWRLPVIVSKDPKDLRQAAVKAAEAFR  152



>gb|ACB45084.1| CRT binding factor 4 [Solanum commersonii]
Length=193

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  61   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  119

Query  447  PKECEE-----EIVITTPTSVE  397
            P   E      E V++TP   E
Sbjct  120  PLSSESEGVSGECVVSTPEMRE  141



>ref|XP_011030036.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Populus euphratica]
Length=251

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  111  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  169

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +          + GM  G L +MA+G L
Sbjct  170  PEGCVGGELMRTVDEGEKAADTAAEAGEEVFYMDEEA------IFGMP-GLLANMAEGML  222

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  223  L-PPPHCGGG  231



>gb|EYU19513.1| hypothetical protein MIMGU_mgv1a020585mg [Erythranthe guttata]
Length=221

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DAKD++K A EAAEAFR
Sbjct  89   GTFPTAEMAARAHDVAALALRGR-SACLNFADSSWRLPVPASADAKDIQKTAAEAAEAFR  147

Query  447  PKE  439
            P +
Sbjct  148  PSD  150



>gb|AIQ82365.1| CBF2, partial [Populus deltoides]
 gb|AIQ82366.1| CBF2, partial [Populus deltoides]
 gb|AIQ82368.1| CBF2, partial [Populus deltoides]
Length=182

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  41   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  99

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  100  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  152

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  153  LPP-PHCGGG  161



>gb|KDP25514.1| hypothetical protein JCGZ_20670 [Jatropha curcas]
Length=227

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 75/123 (61%), Gaps = 10/123 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S +A+D+R+AA EAAE FR
Sbjct  87   GTYPTPEMAARAHDVAALALRGK-SACLNFADSSWRLPVPVSKEAQDIRRAAHEAAEMFR  145

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
              E E+        S E           N +S    I E   F      G L +MA+G L
Sbjct  146  SGETEK---CGVEYSGEVSSRNSELKQENDVSY---IDEEAVF---DMPGLLANMAEGPL  196

Query  267  LSP  259
            LSP
Sbjct  197  LSP  199



>ref|XP_011101172.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Sesamum indicum]
Length=203

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG+ +A LNFADS WRLPVPASVDAKD+RKAA +AAEAFR
Sbjct  83   GTFPTPEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASVDAKDIRKAAADAAEAFR  141

Query  447  PKECEEEIVITTP  409
            P+  E    + +P
Sbjct  142  PQSSEPSAAVASP  154



>ref|XP_009611618.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611619.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
isoform X2 [Nicotiana tomentosiformis]
Length=232

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 5/74 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA++LRG+ +A LNFADS WRLP+P S  AKD++KAAVEAAEAFR
Sbjct  97   GTFPTAEMAARAHDVAAISLRGR-SACLNFADSAWRLPIPTSAAAKDIQKAAVEAAEAFR  155

Query  447  PKECE----EEIVI  418
            P E      +EI++
Sbjct  156  PVESHGENFKEIIV  169



>ref|XP_011073844.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Sesamum indicum]
Length=188

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            G  PT EMAARAHDVAALALRGQ A  LNFADSVWRLPVPAS D KD+RKAA++AAEAF+
Sbjct  77   GGVPTAEMAARAHDVAALALRGQMA-CLNFADSVWRLPVPASNDPKDIRKAAMQAAEAFQ  135

Query  447  PKECEE  430
            P   EE
Sbjct  136  PGAAEE  141



>gb|AIU92962.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A     V  +       D  + GM  G L +MA+G L
Sbjct  173  PRGCVGGELMRTGNVGEKAAETAAGAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGDG  234



>gb|AGR40686.1| C-repeat binding factor 10 [Medicago truncatula]
Length=198

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+ T EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PAS +AKD+++AA EAAEAFR
Sbjct  60   GTFATAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPASAEAKDIQRAAGEAAEAFR  118

Query  447  PKECEEEIVITT  412
            P +     VI T
Sbjct  119  PDKTLMTTVIDT  130



>ref|XP_002509702.1| Dehydration-responsive element-binding protein 1A, putative [Ricinus 
communis]
 gb|EEF51089.1| Dehydration-responsive element-binding protein 1A, putative [Ricinus 
communis]
Length=234

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNF+DS WRLP+P+S  A+++R+ A EAAE+FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFSDSAWRLPIPSSTSAREIRRIAAEAAESFR  153

Query  447  PKE  439
            P+E
Sbjct  154  PQE  156



>gb|ACB45083.1| CRT binding factor 4 [Solanum tuberosum]
Length=197

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  61   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  119

Query  447  PKECEEEIV  421
            P E  E + 
Sbjct  120  PSEESERVA  128



>gb|AIQ82360.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD+ KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIXKAAAEAAGSFR  101

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  102  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  154

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  155  LPP-PHCGGG  163



>gb|AIU92955.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A     V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGNVREKAAETAAGAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGDG  234



>dbj|BAE17131.1| LhCBF1 [Lycopersicon hirsutum]
Length=222

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  85   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  143

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+      S E+      +   NV   S  + E   F      G L +MA+G +
Sbjct  144  PLKESEEV------SGESDNSTSPETSENVQESSDFVDEEAIFF---MPGLLANMAEGLM  194

Query  267  LSP  259
            L P
Sbjct  195  LPP  197



>gb|ACB45079.1| CRT binding factor 1 [Solanum habrochaites]
Length=222

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  85   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  143

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+      S E+      +   NV   S  + E   F      G L +MA+G +
Sbjct  144  PLKESEEV------SGESDNSTSPETSENVQESSDFVDEEAIFF---MPGLLANMAEGLM  194

Query  267  LSP  259
            L P
Sbjct  195  LPP  197



>gb|AHN65456.1| dehydration-responsive element binding protein [Populus nigra]
Length=251

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D++D+ +AA EAAE FR
Sbjct  78   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSQDITRAANEAAELFR  136

Query  447  PKE  439
            P+E
Sbjct  137  PQE  139



>ref|XP_008361312.1| PREDICTED: dehydration-responsive element-binding protein 1A-like, 
partial [Malus domestica]
Length=211

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAAR HDVAALA RG+ A  LNFADS WRLPVPAS D+ D+R+AA EAAE FR
Sbjct  65   GTYPTAEMAARVHDVAALAFRGRLAC-LNFADSAWRLPVPASFDSVDVRRAAEEAAETFR  123

Query  447  PKE  439
            P E
Sbjct  124  PAE  126



>gb|AIU92952.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|AIU92953.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|KEH26611.1| dehydration-responsive element-binding protein, putative [Medicago 
truncatula]
Length=227

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADS WRLP PA+  AKD++KAA EAAEAFR
Sbjct  84   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWRLPKPATTQAKDIQKAATEAAEAFR  142

Query  447  P  445
            P
Sbjct  143  P  143



>gb|AIU92949.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|AGY31291.1| C-repeat binding factor 4b [Populus euphratica]
Length=252

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD+++AA EAA  FR
Sbjct  111  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQRAAAEAAGGFR  169

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       +  + GM  G L +MA+G L
Sbjct  170  PEGCVGGELMRTVDEGEKAADTAAEAGEEVFYMD------EEAVFGMP-GLLANMAEGML  222

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  223  L-PPPHCGGG  231



>gb|ABB72792.1| dehydration responsive element binding protein [Medicago truncatula]
 gb|ABX80064.1| CRT/DRE binding factor 3 [Medicago truncatula]
 gb|AGR40676.1| C-repeat binding factor 3 [Medicago truncatula]
Length=227

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADS WRLP PA+  AKD++KAA EAAEAFR
Sbjct  84   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWRLPKPATTQAKDIQKAATEAAEAFR  142

Query  447  P  445
            P
Sbjct  143  P  143



>gb|AIU92950.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92954.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92966.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|KDO63570.1| hypothetical protein CISIN_1g026103mg [Citrus sinensis]
Length=243

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94   GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  447  PKECEEE  427
            P++ E E
Sbjct  153  PRDDELE  159



>ref|XP_006440529.1| hypothetical protein CICLE_v10021923mg [Citrus clementina]
 gb|ESR53769.1| hypothetical protein CICLE_v10021923mg [Citrus clementina]
Length=243

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP+PEMAARAHDVAALALRG+ +A LNFADSVWRLPVPAS DAKD+RKAA EAAEAFR
Sbjct  94   GTYPSPEMAARAHDVAALALRGK-SACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFR  152

Query  447  PKECEEE  427
            P++ E E
Sbjct  153  PRDDELE  159



>gb|AGR40678.1| C-repeat binding factor 3 [Medicago truncatula]
Length=229

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADS WRLP PA+  AKD++KAA EAAEAFR
Sbjct  84   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWRLPKPATTQAKDIQKAATEAAEAFR  142

Query  447  P  445
            P
Sbjct  143  P  143



>gb|AGR40677.1| C-repeat binding factor 3 [Medicago truncatula]
Length=227

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADS WRLP PA+  AKD++KAA EAAEAFR
Sbjct  84   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSAWRLPKPATTQAKDIQKAATEAAEAFR  142

Query  447  P  445
            P
Sbjct  143  P  143



>gb|AGR40690.1| C-repeat binding factor 8 [Medicago truncatula]
Length=215

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITNIETV  152



>gb|AGH33881.1| DREB70 [Populus hopeiensis]
Length=254

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  113  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  171

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  172  PEGCVGGELMRTVDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  224

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  225  L-PPPHCGGG  233



>gb|AIU92957.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A     V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGNVGEKAAETAAGAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGDG  234



>gb|ABG75914.1| dehydration responsive element binding protein 1A [Medicago truncatula]
Length=215

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITNIETV  152



>gb|AIQ82354.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82355.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGSFR  101

Query  447  PKEC  436
            P+ C
Sbjct  102  PEGC  105



>gb|AIQ82342.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82349.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82350.1| CBF2, partial [Populus balsamifera]
 gb|AIQ82352.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGSFR  101

Query  447  PKEC  436
            P+ C
Sbjct  102  PEGC  105



>gb|AIQ82361.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EA  +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAXGSFR  101

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  102  PEGCVGGELMRTGDEGEKAAETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  154

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  155  LPP-PHCGGG  163



>gb|AIU92965.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A     V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGNVGEKAAETAAGAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGDG  234



>gb|AIQ82339.1| CBF2, partial [Populus balsamifera]
Length=184

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA +FR
Sbjct  43   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGSFR  101

Query  447  PKEC  436
            P+ C
Sbjct  102  PEGC  105



>gb|AFK45852.1| unknown [Medicago truncatula]
Length=271

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITNIETV  152



>gb|AIU92946.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92968.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+ C    ++ T    E      A     V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGCVGGELMRTGNVGEKAAETAAGAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGDG  234



>gb|AGR40691.1| C-repeat binding factor 8 [Medicago truncatula]
Length=271

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITNIETV  152



>gb|ABF59745.1| CBF-like transcription factor [Cocos nucifera]
Length=211

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S ++KD+++AAVEAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWLCPVPRSSNSKDIQRAAVEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+       +    S E         P    +  P  ME DG  +GMQG     MA G L
Sbjct  135  PQTER----VDAAESREDAAMAMIAGPSLAAADDPFYME-DGLNSGMQGYL--DMASGML  187

Query  267  LSPAP  253
            + P P
Sbjct  188  MEPPP  192



>gb|AIU47308.1| C-repeat binding factor 1, partial [Camellia sinensis]
Length=151

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALR + A  +NFADSVWRLPVPAS+D KD++KAA EAAE FR
Sbjct  10   GTFPTAEMAARAHDVAAIALRNRMA-CVNFADSVWRLPVPASLDPKDIQKAAAEAAEMFR  68

Query  447  PKECEEE  427
            P   EE+
Sbjct  69   PPLLEEK  75



>ref|XP_004234350.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Solanum lycopersicum]
 gb|AAS77821.1| CBF2 [Solanum lycopersicum]
Length=220

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 79/130 (61%), Gaps = 19/130 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FR
Sbjct  90   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFR  148

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  149  ----SEEVSGESPETSE-----------NVQESSDFVDEEALF---SMPGLLANMAEGLM  190

Query  267  LSPAPSLGKG  238
            L P   L  G
Sbjct  191  LPPPQCLEIG  200



>ref|XP_007218312.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|EMJ19511.1| hypothetical protein PRUPE_ppa010935mg [Prunus persica]
 gb|AGL07695.1| CBF/DREB 6 [Prunus persica]
 gb|AGS13699.1| C-repeat binding factor [Prunus persica]
Length=229

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 75/123 (61%), Gaps = 11/123 (9%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ LRG+ +A LNFADS WRLPVPAS +AKD++  A EAAEAFR
Sbjct  95   GTFPTAEMAARAHDVAAIKLRGR-SACLNFADSAWRLPVPASANAKDIQTTASEAAEAFR  153

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P   E  + ++  ++V A             S S  +   D        G L +MA+G L
Sbjct  154  PP-AEGSVEVSGASAVAASESK---------SASEQVFYMDEEAVFGMPGLLANMAEGML  203

Query  267  LSP  259
            LSP
Sbjct  204  LSP  206



>gb|AIQ82376.1| CBF3, partial [Populus balsamifera]
Length=198

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  65   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  123

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSL-SPPIMEPDGFLTGMQGGFLGSMADGN  271
              +   +++       E      +    ++  L S  +   D        G L SMA+G 
Sbjct  124  TSDLGGQVM--EDXRREDRGEVCSSTNDDIRDLPSENVGYIDEEAEFNMPGLLASMAEGL  181

Query  270  LLSP  259
            LLSP
Sbjct  182  LLSP  185



>gb|KEH26592.1| dehydration-responsive element-binding protein 1B [Medicago truncatula]
Length=271

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITNIETV  152



>gb|KEH26589.1| CBF/DREB1 transcription factor [Medicago truncatula]
Length=267

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG++A  LNF+DSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTPEMAARAHDVAAMALRGRYAC-LNFSDSVWRLPIPATSAIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|AIQ82367.1| CBF2, partial [Populus deltoides]
Length=182

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  41   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  99

Query  447  PKEC  436
            P+ C
Sbjct  100  PEGC  103



>gb|AGR40696.1| C-repeat binding factor 5 [Medicago truncatula]
Length=266

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG++A  LNF+DSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  80   GTFPTPEMAARAHDVAAMALRGRYAC-LNFSDSVWRLPIPATSAIKDIQKAATKAAEAFR  138

Query  447  P  445
            P
Sbjct  139  P  139



>ref|XP_009611054.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Nicotiana tomentosiformis]
Length=232

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+P S  AKD++KAAVEAAEAFR
Sbjct  97   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPTSAAAKDIQKAAVEAAEAFR  155

Query  447  P  445
            P
Sbjct  156  P  156



>gb|AIQ82506.1| CBF4, partial [Populus deltoides]
Length=228

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVP S D+KD+ +AA EAAE FR
Sbjct  95   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPVSKDSKDITRAANEAAELFR  153

Query  447  PKE  439
             +E
Sbjct  154  XQE  156



>gb|ACB45087.1| CRT binding factor 1 [Solanum habrochaites]
Length=219

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  82   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  140

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  E++      S E+      +   NV   S  + E   F      G L +MA+G +
Sbjct  141  PLKESEQV------SGESDNSTSPETSENVQESSDFVDEEAIFF---MPGLLANMAEGLM  191

Query  267  LSP  259
            L P
Sbjct  192  LPP  194



>gb|AIQ82369.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82370.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82371.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82372.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82373.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82374.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82375.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82377.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82378.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82379.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82380.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82381.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82382.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82383.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82384.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82385.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82386.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82387.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82388.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82389.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82390.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82391.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82392.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82393.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82394.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82395.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82396.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82397.1| CBF3, partial [Populus balsamifera]
Length=198

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  65   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  123



>ref|NP_001274919.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26757.1| AP2 domain CBF protein [Solanum tuberosum]
Length=227

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 16/133 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAA AHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  88   GTFPTVEMAAIAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  146

Query  447  PKECEEEI---VITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMAD  277
            P+   EE+     TTP ++E       +        S   M+ +        G + +MA+
Sbjct  147  PE--SEEVSGECSTTPETLENTFFMKEE--------SSLFMDEEALF--YMPGLIANMAE  194

Query  276  GNLLSPAPSLGKG  238
            G +L P   L  G
Sbjct  195  GLMLPPPQCLEIG  207



>gb|AIQ82400.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  63   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  121



>emb|CBJ94884.1| CBF2 protein [Populus balsamifera]
Length=208

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  83   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  141



>gb|AIQ82399.1| CBF3, partial [Populus deltoides]
 gb|AIQ82401.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  63   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  121



>gb|AIQ82398.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  63   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  121



>gb|ACY79411.1| CRT-binding factor 1 [Solanum habrochaites]
Length=222

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  85   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  143

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P +  EE+      S E+      +   NV   +  + E   F      G L +MA+G +
Sbjct  144  PLKESEEV------SGESDNSTSPETSKNVQENNDFVDEEAIFF---MPGLLANMAEGLM  194

Query  267  LSP  259
            L P
Sbjct  195  LPP  197



>gb|ACB45094.1| CRT binding factor 2 [Solanum commersonii]
Length=235

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FR
Sbjct  89   GTFPTAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFR  147

Query  447  P  445
            P
Sbjct  148  P  148



>gb|AGR40697.1| C-repeat binding factor 5 [Medicago truncatula]
Length=267

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA EAAE FR
Sbjct  81   GTFPTAEMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATAKIKDIQKAAAEAAETFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|ACE73696.1| DREB4 [Nicotiana tabacum]
Length=232

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP+P S  AKD++KA VEAAE FR
Sbjct  97   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPIPTSAAAKDIQKATVEAAETFR  155

Query  447  PKECEEE  427
            P E   E
Sbjct  156  PVESHRE  162



>ref|XP_006353374.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Solanum tuberosum]
Length=236

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADSVWRLP+PAS ++KD++KAA EAAE FR
Sbjct  91   GTFPTAEMAARAHDVAALALRGR-SACLNFADSVWRLPIPASSNSKDIQKAAAEAAEIFR  149

Query  447  P  445
            P
Sbjct  150  P  150



>emb|CBJ94893.1| CBF2 protein [Populus trichocarpa]
Length=211

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  82   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  140



>gb|ABY78834.2| putative DRE-binding protein DREB1s [Medicago falcata]
Length=184

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 4/76 (5%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT +MAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTADMAARAHDVAAMALRGRYAC-LNFADSVWRLPIPATSSIKDIQKAATKAAEAFR  139

Query  447  PKECEEEIVITTPTSV  400
            P   +  I+IT   +V
Sbjct  140  P---DNTIMITDIETV  152



>gb|ABO48365.1| C-repeat binding facor 3 [Populus trichocarpa]
Length=231

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  148



>gb|AAS77819.1| CBF3 [Solanum lycopersicum]
 gb|ACB45090.1| CRT binding factor 3 [Solanum pimpinellifolium]
Length=205

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP P S D KD++KAA +AAE FR
Sbjct  78   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPDSSDTKDIQKAAAQAAEIFR  136

Query  447  PKECEEEIVITTPTSV  400
            P + EEE  +    S 
Sbjct  137  PLKSEEEESVVKDQST  152



>ref|XP_011029177.1| PREDICTED: dehydration-responsive element-binding protein 1E 
[Populus euphratica]
Length=228

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  87   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  145



>ref|XP_011014147.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
Length=231

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  148



>ref|XP_002298067.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
 gb|EEE82872.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
Length=231

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  148



>gb|AGY31293.1| C-repeat binding factor 2 [Populus euphratica]
Length=231

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLPVP S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPVPISNEAKDIRRAASEAAELFR  148



>gb|KEH26590.1| CBF/DREB1 transcription factor [Medicago truncatula]
Length=248

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>ref|XP_008369501.1| PREDICTED: dehydration-responsive element-binding protein 1A-like, 
partial [Malus domestica]
Length=211

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAAR HDVAALA RG+ A  LNFAD  WRLPVPAS D+ D+R+AA EAAE FR
Sbjct  65   GTYPTAEMAARVHDVAALAFRGRLAC-LNFADXAWRLPVPASXDSVDVRRAAEEAAETFR  123

Query  447  PKE  439
            P E
Sbjct  124  PAE  126



>gb|ABF59738.1| CBF-like transcription factor [Trachycarpus fortunei]
Length=211

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 77/125 (62%), Gaps = 8/125 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S ++KD+++AAVEAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCPVPRSSNSKDIQRAAVEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P   + E V    +  +A     A    ++ +   P    DG   GMQG     MA G L
Sbjct  135  P---QTERVDAAESREDAAMAMIAGP--SLAAADDPFYMEDGLNFGMQGYL--DMASGML  187

Query  267  LSPAP  253
            + P P
Sbjct  188  MEPPP  192



>gb|AFN06404.1| ethylene-responsive element binding protein, partial [Elaeis 
guineensis]
Length=212

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S + KD+++AA+EAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSPWLCPVPRSSNPKDIQRAAMEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPW--NVLSLSPPIMEPDGFLTGMQGGFLGSMADG  274
            P+        T P + +             ++   + P    DG   GMQG +L  MA+G
Sbjct  135  PQ--------TEPNAEKRTDDAAISMAGGPSLARANEPFYMDDGLNFGMQGFYL-DMAEG  185

Query  273  NLLSPAPSL  247
             L+ P P L
Sbjct  186  LLMEPPPIL  194



>gb|ACB20695.1| CBF-like protein 1 [Camellia sinensis]
Length=259

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALR + A  +NFADSVWRLPVPAS+D KD++KAA EAAE FR
Sbjct  102  GTFPTAEMAARAHDVAAIALRNRMA-CVNFADSVWRLPVPASLDPKDIQKAAAEAAEMFR  160

Query  447  PKECEEE  427
            P   EE+
Sbjct  161  PPLLEEK  167



>gb|AFN93974.1| CBF1 [Camellia sinensis]
Length=259

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALR + A  +NFADSVWRLPVPAS+D KD++KAA EAAE FR
Sbjct  102  GTFPTAEMAARAHDVAAIALRNRMA-CVNFADSVWRLPVPASLDPKDIQKAAAEAAEMFR  160

Query  447  PKECEEE  427
            P   EE+
Sbjct  161  PPLLEEK  167



>gb|ABP98988.1| CBF/DREB1 transcription factor 2 [Betula pendula]
Length=202

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLP+PAS  AKD+++ AVEAAEAFR
Sbjct  74   GTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPLPASGTAKDIQRTAVEAAEAFR  132

Query  447  PKE  439
            P E
Sbjct  133  PTE  135



>gb|ADF43032.1| CBF/DREB1-like protein b [Prunus mume]
Length=132

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  29   GTYPTAEMAARAHDVAALAFKGKLA-CLNFADSGWRLPVAASMDSTDIQRAAAEAAEGFR  87

Query  447  PKE  439
            P E
Sbjct  88   PVE  90



>gb|AGR40694.1| C-repeat binding factor 6 [Medicago truncatula]
Length=216

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|AGR40695.1| C-repeat binding factor 6 [Medicago truncatula]
Length=216

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG++A  LNFADSVWRLP+PA+   KD++KAA +AAEAFR
Sbjct  81   GTFPTAEMAARAHDVAAIALRGRYAC-LNFADSVWRLPIPATSAIKDIQKAATKAAEAFR  139

Query  447  P  445
            P
Sbjct  140  P  140



>gb|AIU92948.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+      ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGRVGGELLRTGDEGEKAVETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|AIU92963.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+      ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGRVGGELMRTGDEGEKAVETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|AFQ59977.1| CRT/DRE binding factor 1 [Morus alba var. multicaulis]
Length=230

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +  LNFADS WRLPVPAS D KD++KAA EAAEAFR
Sbjct  96   GTFPTAEMAARAHDVAAIALRGR-STCLNFADSAWRLPVPASPDPKDIQKAASEAAEAFR  154

Query  447  PKECEEE  427
            P +  E+
Sbjct  155  PVDMAED  161



>gb|AIU92947.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92951.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92959.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92960.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92961.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92969.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92970.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+      ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGRVGGELMRTGDEGEKAVETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|ABC79626.1| CBF1 [Populus tomentosa]
Length=231

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSL-SPPIMEPDGFLTGMQGGFLGSMADGN  271
              +   +++    T  E      +    ++  L S  +   D        G L +MA+G 
Sbjct  149  TSDLGGQVMEDHTT--ENRGEVCSSTNDDIRDLPSENVSYIDEEAEFNLPGLLANMAEGL  206

Query  270  LLSP  259
            LLSP
Sbjct  207  LLSP  210



>gb|EYU29844.1| hypothetical protein MIMGU_mgv1a014021mg [Erythranthe guttata]
Length=203

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 1/54 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVE  466
            GTYPT EMAARAHDVAALALRGQ AA LNFADSVWRLPVPAS D KD+RKAAVE
Sbjct  64   GTYPTAEMAARAHDVAALALRGQ-AACLNFADSVWRLPVPASTDPKDIRKAAVE  116



>gb|AIU92958.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+      ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGRVGGELMRTGDEGEKAVETAAEAGEEVFYMD------DEAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHRGGG  234



>gb|AAR28672.1| CBF-like transcription factor [Vitis riparia]
Length=251

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 90/161 (56%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF+DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFSDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AHN65435.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65436.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|AHN65392.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65393.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65394.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65395.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65396.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65397.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|AHN65417.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|ABF59740.1| CBF-like transcription factor [Elaeis oleifera]
 gb|ABF59742.1| CBF-like transcription factor 1 [Elaeis guineensis]
Length=212

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S + KD+++AA+EAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSPWLCPVPRSSNPKDIQRAAMEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPW--NVLSLSPPIMEPDGFLTGMQGGFLGSMADG  274
            P+        T P + ++            ++ +   P    DG   GMQG +L  MA G
Sbjct  135  PQ--------TEPNADKSREDAAMSMAGGPSLATADDPFYMEDGLNFGMQGYYL-DMAAG  185

Query  273  NLLSPAPSL  247
             L+ P P L
Sbjct  186  LLMEPPPIL  194



>gb|AHN65433.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|AHN65412.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|AHL44969.1| CBF6B [Brassica rapa subsp. chinensis]
Length=206

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFR  116

Query  447  PKECEEEIVI  418
            P E E  I +
Sbjct  117  PTEYESGITV  126



>gb|AHN13909.1| dehydration-responsive element binding factor [Populus nigra]
 gb|AHN65373.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65374.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65375.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65376.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65377.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65378.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65379.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65380.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65381.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65382.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65383.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65384.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65385.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65386.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65387.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65389.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65390.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65391.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65398.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65399.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65400.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65401.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65402.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65403.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65404.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65405.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65406.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65407.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65408.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65409.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65410.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65411.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65413.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65414.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65415.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65416.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65419.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65420.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65421.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65422.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65423.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65424.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65425.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65426.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65427.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65428.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65429.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65430.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65431.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65432.1| dehydration-responsive element binding protein [Populus nigra]
 gb|AHN65434.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>gb|AHN65437.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>ref|XP_008234474.1| PREDICTED: dehydration-responsive element-binding protein 1B 
[Prunus mume]
Length=268

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 74/124 (60%), Gaps = 13/124 (10%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLPVPAS +AKD++  A EAAEAFR
Sbjct  134  GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASANAKDIQTTASEAAEAFR  192

Query  447  -PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGN  271
             P E  +E+   +  +                S S  +   D        G L +MA+G 
Sbjct  193  PPAEGSDEVSGASAVAPS-----------ECASASEQVFYMDEEAVFGMPGLLANMAEGM  241

Query  270  LLSP  259
            LLSP
Sbjct  242  LLSP  245



>gb|AIU92964.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+      ++ T    E      A+    V  +       D  + GM  G L +MA+G L
Sbjct  173  PEGRVGGELMRTGDEGEKAVETAAEAGDEVFYMD------DVAVFGMP-GLLANMAEGML  225

Query  267  LSPAPSLGKG  238
            L P P  G G
Sbjct  226  L-PPPHCGGG  234



>gb|AHN65388.1| dehydration-responsive element binding protein [Populus nigra]
Length=231

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAASEAAELFR  148



>ref|XP_009148577.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Brassica rapa]
Length=206

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAAFALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFR  116

Query  447  PKECEEEIVI  418
            P E E  I +
Sbjct  117  PTEYESGITV  126



>emb|CDY57075.1| BnaCnng31550D [Brassica napus]
Length=207

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAAYALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFR  116

Query  447  PKECEEEIVI  418
            P E E  I +
Sbjct  117  PTEYESGITV  126



>gb|AGN53198.1| CBF-like protein [Camellia sinensis]
Length=239

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 16/125 (13%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ A  LNFADSVW+LP+PAS+   D++KAA EAAEAFR
Sbjct  100  GTFPTAEMAARAHDVAAIALRGRLAC-LNFADSVWKLPIPASLKPTDIQKAATEAAEAFR  158

Query  447  PKECEEEIV--ITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADG  274
            P     E+   +T P +V A             ++   I+  D        GFL +M++G
Sbjct  159  PSLQYLEVSGDVTKPENVPA-------------TMPEKILYVDEEAVFGMPGFLANMSEG  205

Query  273  NLLSP  259
             +L P
Sbjct  206  LMLPP  210



>ref|XP_009784265.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=203

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP+ +MAARAHDVA +ALRG+FA  LNF DSVW+LP+P S DA D+++   +AAEAFR
Sbjct  76   GTYPSADMAARAHDVATIALRGRFAC-LNFVDSVWKLPIPTSSDANDIQRVTAKAAEAFR  134

Query  447  PKECEEEIVITTPTSVE  397
            P +  E +    P  +E
Sbjct  135  PSDQSERVSGEYPEMLE  151



>ref|XP_006358387.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Solanum tuberosum]
Length=244

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  451
            GTY TPEMAARAHDVAALALRG  A TLNFADS WRLPVPAS D KD+R+AAV AA+AF
Sbjct  78   GTYSTPEMAARAHDVAALALRGNLA-TLNFADSRWRLPVPASKDPKDIRQAAVIAAQAF  135



>ref|XP_009118070.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Brassica rapa]
 gb|AHL44968.1| CBF6A [Brassica rapa subsp. chinensis]
 emb|CDY26574.1| BnaA09g47030D [Brassica napus]
Length=205

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAAFALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFR  116

Query  447  PKECEEEIVI  418
            P E E  I +
Sbjct  117  PTEFESGITV  126



>ref|XP_010919216.1| PREDICTED: dehydration-responsive element-binding protein 1G 
[Elaeis guineensis]
Length=212

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S + KD+++AA+EAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSPWLCPVPRSSNPKDIQRAAMEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPW--NVLSLSPPIMEPDGFLTGMQGGFLGSMADG  274
            P+        T P + ++            ++ +   P    DG   GMQG +L  MA G
Sbjct  135  PQ--------TEPDADKSREDATMSMAGGPSLATADDPFYMEDGLNFGMQGYYL-DMAAG  185

Query  273  NLLSPAPSL  247
             L+ P P L
Sbjct  186  LLMEPPPIL  194



>gb|ACI42860.1| dehydration-responsive element-binding protein 1B [Rosa hybrid 
cultivar]
Length=231

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 15/123 (12%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA++LRG+ +A LNFADS WRLPVPAS  AKD++ AA +AAEAFR
Sbjct  100  GTFPTAEMAARAHDVAAISLRGR-SACLNFADSAWRLPVPASTSAKDIQTAAAQAAEAFR  158

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P   E E+V  + T+ EA              L P     +  + GM  G L +MA+G L
Sbjct  159  PTGEESEVVSGSVTATEA-------------ELEPVFCMDEEDVFGMP-GLLANMAEGML  204

Query  267  LSP  259
            LSP
Sbjct  205  LSP  207



>emb|CDY16016.1| BnaC08g41070D [Brassica napus]
Length=201

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA ALRG+ +A LNFADS WRLPVP S D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAAFALRGR-SACLNFADSAWRLPVPESTDPDVIRRVAAEAAEMFR  116

Query  447  PKECEEEIVI  418
            P E E  I +
Sbjct  117  PTEFESGITV  126



>gb|ACB45096.1| CRT binding factor 1 [Solanum tuberosum]
 gb|ACJ26752.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26753.1| AP2 domain CBF protein [Solanum tuberosum]
Length=257

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  80   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  138

Query  447  P  445
            P
Sbjct  139  P  139



>gb|AGH33880.1| DREB69 [Populus hopeiensis]
Length=231

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFR  148



>gb|KEH26595.1| dehydration-responsive element-binding protein [Medicago truncatula]
Length=198

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+ T EMAARAHDVAA+ALRG++A  LNFADS W+LP+PAS +AKD+++AA EAAEAFR
Sbjct  60   GTFATAEMAARAHDVAAIALRGRYAC-LNFADSAWKLPIPASAEAKDIQRAAGEAAEAFR  118

Query  447  P  445
            P
Sbjct  119  P  119



>ref|NP_001274856.1| CBF2 [Solanum tuberosum]
 gb|ABI94367.1| CBF2 [Solanum tuberosum]
Length=257

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  80   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  138

Query  447  P  445
            P
Sbjct  139  P  139



>gb|ABC79627.1| CBF2 [Populus tomentosa]
Length=231

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFR  148



>gb|ACH63209.1| CRT/DRE binding factor [Rheum australe]
Length=274

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLPVPAS D KD+++AA EAAE FR
Sbjct  83   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPVPASSDTKDIQRAAAEAAELFR  141

Query  447  PK  442
            P+
Sbjct  142  PQ  143



>gb|ABF29699.1| AP2 domain CBF protein [Populus suaveolens]
Length=231

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNFADS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFADSAWRLPAPISNEAKDIRRAAGEAAELFR  148



>gb|ADF43034.1| CBF/DREB1-like protein b [Prunus mume]
Length=237

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  85   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSTDIQRAAAEAAEGFR  143

Query  447  PKE  439
            P E
Sbjct  144  PVE  146



>ref|XP_007209842.1| hypothetical protein PRUPE_ppa014628mg, partial [Prunus persica]
 gb|EMJ11041.1| hypothetical protein PRUPE_ppa014628mg, partial [Prunus persica]
Length=230

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  78   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFR  136

Query  447  PKE  439
            P E
Sbjct  137  PVE  139



>gb|ADU03762.1| C-repeat binding factor [Prunus persica]
Length=239

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  87   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASLDSMDIQRAAAEAAEGFR  145

Query  447  PKE  439
            P E
Sbjct  146  PVE  148



>ref|XP_010519227.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Tarenaya hassleriana]
Length=212

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAA+ALRG+  A LNFADS WR+ +P S   KD+++AAVEAAEA  
Sbjct  80   GTFPTPEMAARAHDVAAIALRGRSGACLNFADSSWRVRIPDSASTKDIQRAAVEAAEALH  139

Query  447  PKECEEE  427
            P+  E E
Sbjct  140  PETAEPE  146



>gb|ACY79412.1| CRT-binding factor 1 [Solanum lycopersicoides]
Length=228

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  86   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAEAAEIFR  144

Query  447  P  445
            P
Sbjct  145  P  145



>gb|AFU54609.1| C-repeat binding factor [Prunus ferganensis]
 gb|AFU54610.1| C-repeat binding factor [Prunus persica]
Length=239

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  87   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFR  145

Query  447  PKE  439
            P E
Sbjct  146  PVE  148



>gb|AFU54606.1| C-repeat binding factor [Prunus mira]
Length=239

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  87   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFR  145

Query  447  PKE  439
            P E
Sbjct  146  PVE  148



>gb|ABF59741.1| CBF-like transcription factor 2 [Elaeis guineensis]
 gb|ABF59743.1| CBF-like transcription factor [Attalea bassleriana]
 gb|ABF59747.1| CBF-like transcription factor 2 [Rhapidophyllum hystrix]
 gb|ABF59749.1| CBF-like transcription factor 2 [Rhapidophyllum hystrix]
Length=209

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 76/131 (58%), Gaps = 22/131 (17%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP+S + KD++KAAV AAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCPVPSSSNPKDIQKAAVLAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLT------GMQGGFLGS  286
            P+              E+      +D    +S  P +   D F T      GMQG     
Sbjct  135  PR-------------TESDATESREDAAMAMSAGPSVAADDPFFTEDRLDFGMQGYL--D  179

Query  285  MADGNLLSPAP  253
            MA+G L+ P P
Sbjct  180  MAEGLLIDPPP  190



>gb|AIU92956.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS +AKD++KAA EAA  FR
Sbjct  114  GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASSEAKDIQKAAAEAAGGFR  172

Query  447  PK  442
            P+
Sbjct  173  PE  174



>gb|AFU54607.1| C-repeat binding factor [Prunus davidiana]
 gb|AFU54608.1| C-repeat binding factor [Prunus davidiana]
Length=239

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  87   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFR  145

Query  447  PKE  439
            P E
Sbjct  146  PVE  148



>gb|AHN65418.1| dehydration-responsive element binding factor protein [Populus 
nigra]
Length=231

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALA RG+ +A LNF+DS WRLP P S +AKD+R+AA EAAE FR
Sbjct  90   GTYPTPEMAARAHDVAALAFRGK-SACLNFSDSAWRLPAPISNEAKDIRRAASEAAELFR  148



>ref|XP_008246095.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Prunus mume]
Length=237

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAALA +G+ A  LNFADS WRLPV AS+D+ D+++AA EAAE FR
Sbjct  85   GTYPTAEMAARAHDVAALAFKGKLAC-LNFADSGWRLPVAASMDSMDIQRAAAEAAEGFR  143

Query  447  PKE  439
            P E
Sbjct  144  PVE  146



>gb|ABU55659.1| CBF1-like protein [Ampelopsis glandulosa var. brevipedunculata]
Length=247

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  75   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  133

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  134  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  190

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  191  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  229



>gb|ABU55657.1| CBF1-like protein [Vitis aestivalis]
Length=247

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  75   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  133

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  134  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  190

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  191  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  229



>gb|AAR28671.1| CBF-like transcription factor [Vitis riparia]
 gb|AIL00472.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00473.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00474.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00476.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00477.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00478.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00481.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00482.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00483.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00484.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00485.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00486.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00489.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00490.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00494.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00496.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00497.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00498.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00499.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|ABP98987.1| CBF/DREB1 transcription factor 1 [Betula pendula]
Length=202

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLPVPAS  AKD+++ A EAAE FR
Sbjct  74   GTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPVPASGTAKDIQRTAAEAAEEFR  132

Query  447  PKE  439
            P E
Sbjct  133  PAE  135



>gb|AIL00487.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00488.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00493.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|ADY17818.1| CBF1 transcription factor [Vitis amurensis]
 gb|AER27641.1| AP2/ERF protein [Vitis amurensis]
Length=251

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00479.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|ADZ23479.1| CBF transcription factor 1 [Betula platyphylla]
Length=203

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG  +A LNFADS WRLPVPAS  AKD+++ A EAAE FR
Sbjct  74   GTFPTAEMAARAHDVAAIALRGN-SACLNFADSAWRLPVPASGTAKDIQRTAAEAAELFR  132

Query  447  PKE  439
            P E
Sbjct  133  PAE  135



>ref|XP_010933895.1| PREDICTED: dehydration-responsive element-binding protein 1G-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010933896.1| PREDICTED: dehydration-responsive element-binding protein 1G-like 
isoform X2 [Elaeis guineensis]
 ref|XP_010933897.1| PREDICTED: dehydration-responsive element-binding protein 1G-like 
isoform X3 [Elaeis guineensis]
 gb|AGH08950.1| ethylene responsive transcription factor [Elaeis guineensis]
Length=210

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 9/125 (7%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP+S + KD++KAAVEAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCPVPSSSNPKDIQKAAVEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P   E ++     T              +V +   P    D    GMQG     MA+G L
Sbjct  135  PP-TESDV-----TKSREDAAMAMTAGPSVPAADDPFYMDDRLDFGMQGYL--DMAEGLL  186

Query  267  LSPAP  253
            + P P
Sbjct  187  IDPPP  191



>ref|XP_009609482.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana tomentosiformis]
Length=217

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 77/127 (61%), Gaps = 22/127 (17%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP  EMAARAHDVAA+ALR + +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87   GTYPIAEMAARAHDVAAIALRSR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  447  PKECE----EEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMA  280
            P E E    E    TTP ++E                    M+ +        GFL SMA
Sbjct  146  PSESETISGESCAGTTPETLENDKF---------------FMDEEALFC--MPGFLASMA  188

Query  279  DGNLLSP  259
            +G +L P
Sbjct  189  EGLMLPP  195



>ref|XP_009759407.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 1B-like [Nicotiana sylvestris]
Length=178

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -1

Query  621  YPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            YPT EMAARAHDVA +ALRG+ +A LNFA+SVW+LP+P S DAKD+++AAVEAAEAFR
Sbjct  53   YPTAEMAARAHDVAVIALRGR-SACLNFAESVWKLPIPISSDAKDIQRAAVEAAEAFR  109



>ref|XP_007210188.1| hypothetical protein PRUPE_ppa017761mg [Prunus persica]
 gb|EMJ11387.1| hypothetical protein PRUPE_ppa017761mg [Prunus persica]
 gb|AGL07693.1| CBF/DREB 4 [Prunus persica]
Length=232

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP  EMAARAHDVAALA RG+ A  LNFADS WRLPVPAS DA ++R+ A EAAEAFR
Sbjct  91   GTYPKAEMAARAHDVAALAFRGKLAC-LNFADSAWRLPVPASNDAAEIRRVANEAAEAFR  149

Query  447  PKE  439
              E
Sbjct  150  KAE  152



>ref|XP_009586780.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009586781.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
isoform X2 [Nicotiana tomentosiformis]
Length=217

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 77/127 (61%), Gaps = 22/127 (17%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP  EMAARAHDVAA+ALRG+ +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87   GTYPIAEMAARAHDVAAIALRGR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  447  PKECE----EEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMA  280
            P E E    E    TTP ++E                    M+ +        G L SMA
Sbjct  146  PSESEAISGESCAGTTPETLENDKF---------------FMDEEALFC--MPGLLASMA  188

Query  279  DGNLLSP  259
            +G +L P
Sbjct  189  EGLMLPP  195



>gb|ABX80062.1| CRT/DRE binding factor 1 [Medicago truncatula]
Length=205

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 8/126 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAA AHDVAAL L+G+ +A LNFADS WRL +P S DA ++R+AA+EAA+ F 
Sbjct  82   GTYPTPEMAAHAHDVAALTLKGK-SACLNFADSAWRLTLPESNDAVEIRRAAMEAAKVFA  140

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
             +E   +      +  +A      +   NVL +  P++  +     M    L S+A+  L
Sbjct  141  IEENHNQ-----RSDRDAVDMNMENSKKNVLEVQVPVLSSE--FEDMHHNLLLSIANEPL  193

Query  267  LSPAPS  250
             S  PS
Sbjct  194  RSNPPS  199



>gb|ABF59746.1| CBF-like transcription factor 1 [Rhapidophyllum hystrix]
 gb|ABF59748.1| CBF-like transcription factor 1 [Rhapidophyllum hystrix]
Length=211

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W  PVP S + KD+++AAV+AAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCPVPGSSNPKDIQRAAVDAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+       +    S E         P    +  P  ME DG   GMQG     MA G L
Sbjct  135  PQTER----VDAAESREDAAMAMIARPSLAAADGPFYME-DGLNFGMQGYL--DMAAGML  187

Query  267  LSPAP  253
            + P P
Sbjct  188  MEPPP  192



>ref|XP_006391789.1| hypothetical protein EUTSA_v10023865mg [Eutrema salsugineum]
 gb|ABS71026.1| putative C-repeat binding factor [Eutrema halophilum]
 gb|ESQ29075.1| hypothetical protein EUTSA_v10023865mg [Eutrema salsugineum]
Length=180

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVA LALRG+  A LNF+DS WRLP P S+D   +R+ A EAAE FR
Sbjct  58   GTYPTAEMAARAHDVAVLALRGR-TACLNFSDSAWRLPAPESIDPDTIRRTAAEAAEIFR  116

Query  447  PKECEEEIVI  418
            P E  +EI +
Sbjct  117  PPEFGDEITV  126



>ref|XP_004496025.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Cicer arietinum]
Length=226

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF-  451
            GTYPTPEMAARAHDVAAL LRG+ +A LNFADS WRL +P + DA ++R+AA+EAA+ F 
Sbjct  93   GTYPTPEMAARAHDVAALTLRGK-SACLNFADSAWRLRLPETTDAVEIRRAAMEAAQLFV  151

Query  450  -RPKECEEEIV  421
               K+CE++ V
Sbjct  152  VEDKQCEQQSV  162



>gb|ABF59744.1| CBF-like transcription factor [Dypsis lutescens]
Length=212

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 74/127 (58%), Gaps = 8/127 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS W   VP S   KD+++AA+EAAEAFR
Sbjct  76   GTFPTAEMAARAHDVAAMALRGR-SACLNFADSAWLCSVPRSTSPKDIQRAAMEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P+  E +   +T                ++ S   P    DG   GMQG     MA+G L
Sbjct  135  PR-TEPDAAKSTREDAGTSMAAGP----SLASADDPFYMEDGLNFGMQGYL--DMAEGLL  187

Query  267  LSPAPSL  247
            + P P L
Sbjct  188  MEPPPIL  194



>gb|ABI74671.1| C-repeat binding factor 1 [Solanum tuberosum]
 gb|ACJ26755.1| AP2 domain CBF protein [Solanum tuberosum]
 gb|ACJ26756.1| AP2 domain CBF protein [Solanum tuberosum]
Length=225

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++KD++KAA EAAE FR
Sbjct  81   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSKDIQKAAAEAAEIFR  139



>ref|XP_003611157.1| Dehydration-responsive element-binding protein 1F [Medicago truncatula]
 gb|AES94115.1| dehydration-responsive element-binding protein [Medicago truncatula]
 gb|AFK45314.1| unknown [Medicago truncatula]
Length=226

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 75/126 (60%), Gaps = 8/126 (6%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAAL L+G+ +A LNFADS WRL +P S DA ++R+AA+EAA+ F 
Sbjct  82   GTYPTPEMAARAHDVAALTLKGK-SACLNFADSAWRLTLPESNDAVEIRRAAMEAAKMFA  140

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
             +E   +      +  +A      +   NVL +  P++  +     M    L S+A+  L
Sbjct  141  IEENHNQ-----RSDRDAVDMNMENSKKNVLEVQVPVLSSE--FEDMHHNLLLSIANEPL  193

Query  267  LSPAPS  250
             S  PS
Sbjct  194  RSNPPS  199



>gb|AIL00500.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                     + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVAXSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>ref|XP_004511604.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Cicer arietinum]
Length=227

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 3/71 (4%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF-  451
            GTYPTPEMAARAHDVAAL LRGQ +A LNFADS WRL +P + DA ++R+AA+EAA+ F 
Sbjct  98   GTYPTPEMAARAHDVAALTLRGQ-SACLNFADSAWRLRLPETTDAVEIRRAAMEAAQLFA  156

Query  450  -RPKECEEEIV  421
                +CE++ V
Sbjct  157  VEDSQCEQQSV  167



>ref|NP_001234123.1| CBF1 protein [Solanum lycopersicum]
 gb|AAK57551.1| putative transcriptional activator CBF1 [Solanum lycopersicum]
 gb|AAS77820.1| CBF1 [Solanum lycopersicum]
Length=210

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 75/123 (61%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNF+DS WRLP+PAS ++KD++KAA +A E FR
Sbjct  82   GTFPTAEMAARAHDVAALALRGR-SACLNFSDSAWRLPIPASSNSKDIQKAAAQAVEIFR  140

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  141  ----SEEVSGESPETSE-----------NVQESSDFVDEEAIFF---MPGLLANMAEGLM  182

Query  267  LSP  259
            L P
Sbjct  183  LPP  185



>gb|AEK94313.1| C-repeat binding factor 4, partial [Fragaria x ananassa]
Length=198

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 77/130 (59%), Gaps = 14/130 (11%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+  A LNFADS WRLPVPAS  AKD++ AA EAAEAFR
Sbjct  76   GTFPTTEMAARAHDVAAIALRGR-NACLNFADSAWRLPVPASNSAKDIQTAAAEAAEAFR  134

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
            P   E E+V     +VE              S  P     +  + GM  G L +MA+G L
Sbjct  135  PNRGESEVVSKATEAVEEE------------SEQPVFYMDEEDVFGMP-GLLANMAEGML  181

Query  267  LSPAPSLGKG  238
            L P    G G
Sbjct  182  LPPPHYNGYG  191



>gb|AIL00480.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA++A +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALKATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>ref|XP_006340376.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 1B-like [Solanum tuberosum]
Length=231

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 6/74 (8%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+P  EMAARAHDVA +AL+G+ +A LNFADS WRLPVPAS  AKD++KAA EA E FR
Sbjct  87   GTFPNAEMAARAHDVAVMALKGR-SACLNFADSAWRLPVPASATAKDIQKAAAEATETFR  145

Query  447  -----PKECEEEIV  421
                  +E  EE+V
Sbjct  146  ASESLERENSEEVV  159



>gb|AAQ88399.1| CaCBF1A [Capsicum annuum]
Length=156

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  555  AATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFRPKECE  433
            +A LNFADS WRLP+PAS ++KD++KAA EA E+FRP E E
Sbjct  17   SACLNFADSTWRLPIPASSNSKDIQKAAAEAVESFRPSESE  57



>gb|AIL00501.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00511.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00512.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P    +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPXFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00513.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P    +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPXFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>ref|XP_006358389.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Solanum tuberosum]
Length=249

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 82/161 (51%), Gaps = 37/161 (23%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG  A TLNFADS WRL VP S D ++LR+AA++AAEAF 
Sbjct  78   GTYPTPEMAARAHDVAALALRGNLA-TLNFADSSWRLAVPVSKDPEELRQAAMKAAEAFL  136

Query  447  PK--------------------ECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP  328
                                  +C+E IV+   +  +       +   N+ +     ME 
Sbjct  137  QDTESVEINYMNHEEINYSEGVKCQENIVVGGASGSDNNNLVGNEVN-NIQN-----MEM  190

Query  327  DGFLT-----GMQGGFLGS-----MADGNLLSPAPSLGKGF  235
            D  L      G      GS     M++G+L SP P L   F
Sbjct  191  DSILCYNNNWGGNNEIEGSSWQEKMSEGHLFSPTPHLDSYF  231



>gb|KCW90755.1| hypothetical protein EUGRSUZ_A02832, partial [Eucalyptus grandis]
Length=195

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS D KD++KAA  AAEAF+
Sbjct  64   GTFPTVEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASADTKDIQKAAARAAEAFQ  122

Query  447  PKECEE  430
            P ECE+
Sbjct  123  PVECED  128



>ref|XP_010317563.1| PREDICTED: CBF1 protein isoform X1 [Solanum lycopersicum]
Length=206

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 72/123 (59%), Gaps = 19/123 (15%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAA+ALRG+ +A LNFADS WRLP P S D KD++KAA +A E FR
Sbjct  78   GTFPTAEMAARAHDVAAIALRGR-SACLNFADSAWRLPTPDSSDTKDIQKAAAQAVEIFR  136

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQGGFLGSMADGNL  268
                 EE+   +P + E           NV   S  + E   F      G L +MA+G +
Sbjct  137  ----SEEVSGESPETSE-----------NVQESSDFVDEEAIFF---MPGLLANMAEGLM  178

Query  267  LSP  259
            L P
Sbjct  179  LPP  181



>ref|XP_009759409.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Nicotiana sylvestris]
Length=210

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVAA+ALRG+ +A LNFADSVW+LP+PAS DAKD+++AA EAAEAFR
Sbjct  87   GTYPTAEMAARAHDVAAIALRGR-SACLNFADSVWKLPIPASTDAKDIQRAAAEAAEAFR  145

Query  447  PKECE  433
            P E E
Sbjct  146  PSESE  150



>ref|NP_176491.1| ERF/AP2 transcription factor DDF2 [Arabidopsis thaliana]
 ref|NP_001077764.1| ERF/AP2 transcription factor DDF2 [Arabidopsis thaliana]
 sp|Q9SGJ6.1|DRE1E_ARATH RecName: Full=Dehydration-responsive element-binding protein 
1E; Short=Protein DREB1E [Arabidopsis thaliana]
 gb|AAF75816.1|AC011000_19 Contains similarity to transcriptional activator CBF1 from Arabidopsis 
thaliana gb|U77378 and contains an AP2 PF|00847 domain 
[Arabidopsis thaliana]
 gb|AAG51606.1|AC010795_10 transcription factor DREB1A, putative; 19375-18830 [Arabidopsis 
thaliana]
 gb|AAT44908.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAX49366.1| At1g63030 [Arabidopsis thaliana]
 gb|ABF83632.1| At1g63030 [Arabidopsis thaliana]
 gb|AEE34043.1| ERF/AP2 transcription factor DDF2 [Arabidopsis thaliana]
 gb|AEE34044.1| ERF/AP2 transcription factor DDF2 [Arabidopsis thaliana]
Length=181

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT +MAARAHDVA LALRG+ +A LNF+DS WRLPVPAS D   +R+ A EAAE FR
Sbjct  57   GTYPTADMAARAHDVAVLALRGR-SACLNFSDSAWRLPVPASTDPDTIRRTAAEAAEMFR  115

Query  447  PKE  439
            P E
Sbjct  116  PPE  118



>ref|XP_008807522.1| PREDICTED: dehydration-responsive element-binding protein 1F-like 
[Phoenix dactylifera]
Length=207

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 72/136 (53%), Gaps = 35/136 (26%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTY TPEMAARAHD+AA+ALRGQ AA LNF DS W LP PAS  A+D+R+AA +AAE FR
Sbjct  86   GTYATPEMAARAHDIAAMALRGQ-AALLNFPDSAWTLPPPASSSAEDIRRAASKAAEMFR  144

Query  447  PKECEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEPDGFLTGMQG-----GFLGSM  283
            P                             +SL  P  +P       +      G L  M
Sbjct  145  P----------------------------TVSLPAPQAQPAAVFVDEEALFNKPGLLDDM  176

Query  282  ADGNLLSPAPSLGKGF  235
            A G +L+P P++ KGF
Sbjct  177  ARGLMLTP-PAMQKGF  191



>gb|AIL00558.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00538.1| C-repeat binding factor 1 [Vitis rubra]
 gb|AIL00540.1| C-repeat binding factor 1 [Vitis palmata]
Length=251

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLTSALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00495.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+ A +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALXATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00491.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00492.1| C-repeat binding factor 1 [Vitis riparia]
Length=251

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+ A +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALXATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSP---------  343
            P                   + + V+ T  +VE+P          VL +SP         
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  342  -----PIMEPDGFLTGMQGGFLGSMADGNLLSPAPSLGKGF  235
                 P+   +  +  MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTPVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>ref|XP_006477722.1| PREDICTED: dehydration-responsive element-binding protein 1A-like 
[Citrus sinensis]
Length=152

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DA D+RKAA EAAEAFR
Sbjct  23   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPASADADDIRKAAAEAAEAFR  81

Query  447  PKECEEE  427
                +E+
Sbjct  82   LSHDDED  88



>ref|XP_002886439.1| hypothetical protein ARALYDRAFT_475045 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62698.1| hypothetical protein ARALYDRAFT_475045 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPT EMAARAHDVA LALRG+ +A LNF+DS WRLPVP S D   +R+ A EAAE FR
Sbjct  57   GTYPTAEMAARAHDVAVLALRGR-SACLNFSDSAWRLPVPESTDPDTIRRTAAEAAEMFR  115

Query  447  PKECEEEIVI  418
            P E    I +
Sbjct  116  PPEFSTGITV  125



>ref|XP_010061546.1| PREDICTED: dehydration-responsive element-binding protein 1B-like 
[Eucalyptus grandis]
Length=220

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLPVPAS D KD++KAA  AAEAF+
Sbjct  89   GTFPTVEMAARAHDVAALALRGR-SACLNFADSAWRLPVPASADTKDIQKAAARAAEAFQ  147

Query  447  PKECEE  430
            P ECE+
Sbjct  148  PVECED  153



>ref|XP_006301487.1| hypothetical protein CARUB_v10021910mg [Capsella rubella]
 gb|EOA34385.1| hypothetical protein CARUB_v10021910mg [Capsella rubella]
Length=184

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYP  EMAARAHDVA LALRG+ +A LNF+DSVWRLPVP S D   +R+ A EAAE FR
Sbjct  57   GTYPAAEMAARAHDVAVLALRGR-SACLNFSDSVWRLPVPESTDPDTIRRTAAEAAEMFR  115

Query  447  PKECEEEIVI  418
            P E    I +
Sbjct  116  PPEFSTGITV  125



>gb|ABU55656.1| CBF1-like protein [Vitis amurensis]
Length=247

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 88/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  75   GTFPTPEMAARAHDVAALALRGHFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  133

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  134  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  190

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  191  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  229



>gb|AIL00557.1| C-repeat binding factor 1 [Vitis aestivalis]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00542.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00543.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00544.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00545.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00546.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00547.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00548.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00549.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00550.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00551.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00552.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00553.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00554.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00555.1| C-repeat binding factor 1 [Vitis labrusca]
 gb|AIL00556.1| C-repeat binding factor 1 [Vitis labrusca]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00539.1| C-repeat binding factor 1 [Vitis palmata]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLXSALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00537.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00559.1| C-repeat binding factor 1 [Vitis labrusca]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00533.1| C-repeat binding factor 1 [Vitis cinerea]
 gb|AIL00535.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00526.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00527.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00528.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00529.1| C-repeat binding factor 1 [Vitis riparia]
 gb|AIL00530.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00531.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00525.1| C-repeat binding factor 1 [Vitis vinifera]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00521.1| C-repeat binding factor 1 [Vitis vinifera]
 gb|AIL00522.1| C-repeat binding factor 1 [Vitis aestivalis]
 gb|AIL00541.1| C-repeat binding factor 1 [Vitis aestivalis]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|AIL00534.1| C-repeat binding factor 1 [Vitis cinerea]
Length=251

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PTPEMAARAHDVAALALRG+FA +LNF DS WRLP P S  A+D++ AA+EA +AF 
Sbjct  79   GTFPTPEMAARAHDVAALALRGRFA-SLNFPDSAWRLPRPKSSSAEDIQVAALEATKAFN  137

Query  447  PKE----------------CEEEIVITTPTSVEapppppaddPWNVLSLSPPIMEP----  328
            P                   + + V+ T  +VE+P          VL +SP   +     
Sbjct  138  PTAPSSSSLASALDNMSGVADSKKVLETSPNVESPKLKSQRM---VLEVSPVDTKRSEKV  194

Query  327  -DGFLT---------GMQGGFLGSMADGNLLSPAPSLGKGF  235
             DG  T          MQ G + SMA+G LL+P P++ KGF
Sbjct  195  GDGSTTVFMDEEAMFNMQ-GLINSMAEGLLLTP-PAMCKGF  233



>gb|ACB45093.1| CRT binding factor 1 [Solanum commersonii]
 gb|ACJ26751.1| AP2 domain CBF protein [Solanum commersonii]
Length=224

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++ D++KAA EAAE FR
Sbjct  81   GTFPTAEMAARAHDVAALALRGR-SACLNFADSTWRLPIPASSNSNDIQKAAAEAAEIFR  139



>ref|XP_006440812.1| hypothetical protein CICLE_v10022680mg [Citrus clementina]
 gb|ESR54052.1| hypothetical protein CICLE_v10022680mg [Citrus clementina]
Length=151

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GTYPTPEMAARAHDVAALALRG+ +A LNFADS WRLPVPAS DA D+RKAA EAAEAFR
Sbjct  23   GTYPTPEMAARAHDVAALALRGK-SACLNFADSAWRLPVPASADADDVRKAAAEAAEAFR  81

Query  447  PKECEEE  427
                +E+
Sbjct  82   LSHDDED  88



>ref|XP_010324621.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Solanum lycopersicum]
Length=244

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAF  451
            GTY TPEMAARAHDVAALALRG  A TLNFADS W LPVPAS D KD+R+AAV AA+AF
Sbjct  78   GTYSTPEMAARAHDVAALALRGNLA-TLNFADSRWGLPVPASKDPKDIRQAAVMAAQAF  135



>gb|ACJ26754.1| AP2 domain CBF protein [Solanum tuberosum]
Length=228

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = -1

Query  627  GTYPTPEMaarahdvaalalRGQFAATLNFADSVWRLPVPASVDAKDLRKAAVEAAEAFR  448
            GT+PT EMAARAHDVAALALRG+ +A LNFADS WRLP+PAS ++ D++KAA EAAE FR
Sbjct  82   GTFPTAEMAARAHDVAALALRGR-SACLNFADSAWRLPIPASSNSNDIQKAAAEAAEIFR  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 839185611728