BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24883_g3_i1 len=1456 path=[3746:0-889 10538:890-1124 4636:1125-1159
672:1160-1197 4694:1198-1455]

Length=1456
                                                                      Score     E

ref|XP_004135273.1|  PREDICTED: uncharacterized protein LOC101222057    117   6e-27   
ref|XP_008446162.1|  PREDICTED: uncharacterized protein LOC103488970    116   2e-26   
ref|XP_009606428.1|  PREDICTED: uncharacterized protein LOC104100805    114   9e-26   
ref|XP_006380005.1|  hypothetical protein POPTR_0008s19040g             110   2e-24   
ref|XP_007044801.1|  Octicosapeptide/Phox/Bem1p family protein is...    107   2e-23   
ref|XP_011034074.1|  PREDICTED: uncharacterized protein LOC105132333    105   1e-22   
emb|CAN80873.1|  hypothetical protein VITISV_004539                     102   7e-22   Vitis vinifera
emb|CBI18643.3|  unnamed protein product                                102   1e-21   
ref|XP_011086639.1|  PREDICTED: uncharacterized protein LOC105168308    102   3e-21   
ref|XP_010100405.1|  hypothetical protein L484_027716                   100   4e-21   
emb|CDP13224.1|  unnamed protein product                                101   5e-21   
gb|KHN14532.1|  hypothetical protein glysoja_027141                   99.8    2e-20   
ref|XP_002312673.2|  octicosapeptide/Phox/Bem1p domain-containing...  99.0    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009791882.1|  PREDICTED: uncharacterized protein LOC104239050  99.4    3e-20   
gb|KDP26661.1|  hypothetical protein JCGZ_17819                       97.4    8e-20   
ref|XP_010248639.1|  PREDICTED: uncharacterized protein LOC104591494  97.1    2e-19   
ref|XP_004309978.1|  PREDICTED: uncharacterized protein LOC101302228  96.7    2e-19   
ref|XP_006438264.1|  hypothetical protein CICLE_v10032769mg           96.3    2e-19   
ref|XP_011045257.1|  PREDICTED: uncharacterized protein LOC105140217  95.9    4e-19   
ref|XP_008221912.1|  PREDICTED: uncharacterized protein LOC103321846  95.9    5e-19   
ref|XP_009800609.1|  PREDICTED: uncharacterized protein LOC104246493  95.9    7e-19   
gb|EPS67466.1|  hypothetical protein M569_07308                       92.8    8e-19   
ref|XP_002315668.2|  hypothetical protein POPTR_0010s05640g           95.1    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010044567.1|  PREDICTED: uncharacterized protein LOC104433...  94.7    9e-19   
gb|KCW86656.1|  hypothetical protein EUGRSUZ_B03284                   95.1    1e-18   
ref|XP_004239130.1|  PREDICTED: uncharacterized protein LOC101267...  94.0    1e-18   
ref|XP_010320935.1|  PREDICTED: uncharacterized protein LOC101267...  94.7    1e-18   
ref|XP_007223945.1|  hypothetical protein PRUPE_ppa011128mg           94.0    2e-18   
ref|XP_010646760.1|  PREDICTED: uncharacterized protein LOC100242...  89.0    7e-17   
ref|XP_002271639.2|  PREDICTED: uncharacterized protein LOC100242...  89.0    7e-17   Vitis vinifera
ref|XP_006357601.1|  PREDICTED: uncharacterized protein LOC102581671  89.7    8e-17   
ref|XP_010044569.1|  PREDICTED: uncharacterized protein LOC104433...  87.4    2e-16   
ref|XP_010251065.1|  PREDICTED: uncharacterized protein LOC104593...  87.8    3e-16   
ref|XP_010251064.1|  PREDICTED: uncharacterized protein LOC104593...  87.8    3e-16   
ref|XP_007158399.1|  hypothetical protein PHAVU_002G149800g           86.3    1e-15   
ref|XP_010552677.1|  PREDICTED: uncharacterized protein LOC104822988  85.1    1e-15   
ref|XP_008466906.1|  PREDICTED: uncharacterized protein LOC103504254  84.0    2e-15   
gb|EYU30635.1|  hypothetical protein MIMGU_mgv1a014466mg              84.7    2e-15   
ref|XP_010682446.1|  PREDICTED: uncharacterized protein LOC104897290  84.0    4e-15   
ref|XP_004142964.1|  PREDICTED: uncharacterized protein LOC101207008  83.6    6e-15   
ref|XP_006438263.1|  hypothetical protein CICLE_v10032769mg           81.3    2e-14   
gb|KHN00396.1|  hypothetical protein glysoja_000064                   82.4    2e-14   
gb|EYU22530.1|  hypothetical protein MIMGU_mgv1a011936mg              82.0    4e-14   
ref|XP_009152051.1|  PREDICTED: uncharacterized protein LOC103875294  80.9    5e-14   
ref|XP_008796584.1|  PREDICTED: uncharacterized protein LOC103711999  80.9    6e-14   
gb|KFK41478.1|  hypothetical protein AALP_AA2G136000                  80.1    7e-14   
ref|XP_003530626.1|  PREDICTED: uncharacterized protein LOC100786933  79.7    1e-13   
emb|CDX83621.1|  BnaC07g23610D                                        79.0    2e-13   
ref|XP_006395550.1|  hypothetical protein EUTSA_v10004963mg           79.3    2e-13   
ref|XP_009129503.1|  PREDICTED: uncharacterized protein LOC103854316  79.0    2e-13   
ref|XP_009359215.1|  PREDICTED: cell wall integrity and stress re...  79.3    2e-13   
ref|NP_001276270.1|  uncharacterized protein LOC100810685             79.3    3e-13   
ref|XP_004241543.1|  PREDICTED: uncharacterized protein LOC101267816  78.6    3e-13   
ref|XP_003517495.1|  PREDICTED: uncharacterized protein LOC100810685  79.0    3e-13   
ref|XP_008778142.1|  PREDICTED: uncharacterized protein LOC103697973  78.6    3e-13   
ref|XP_003613117.1|  hypothetical protein MTR_5g032960                79.0    4e-13   
gb|KHN35453.1|  hypothetical protein glysoja_043777                   76.6    5e-13   
ref|XP_010528101.1|  PREDICTED: uncharacterized protein LOC104805284  77.8    5e-13   
ref|XP_008340105.1|  PREDICTED: uncharacterized protein LOC103403065  78.2    6e-13   
ref|XP_008389723.1|  PREDICTED: cell wall integrity and stress re...  77.8    8e-13   
emb|CDY28543.1|  BnaC02g36170D                                        76.6    1e-12   
emb|CDY48987.1|  BnaA02g28090D                                        76.6    1e-12   
ref|XP_004489778.1|  PREDICTED: uncharacterized protein LOC101505933  77.4    1e-12   
ref|XP_009383548.1|  PREDICTED: uncharacterized protein LOC103971280  77.4    1e-12   
emb|CAN71778.1|  hypothetical protein VITISV_019814                   76.6    2e-12   Vitis vinifera
ref|XP_002280847.1|  PREDICTED: uncharacterized protein LOC100255423  76.6    2e-12   Vitis vinifera
ref|NP_001030772.1|  PB1_UP2 domain-containing protein                76.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347429.1|  PREDICTED: uncharacterized protein LOC102585593  75.9    2e-12   
ref|XP_009379964.1|  PREDICTED: uncharacterized protein LOC103968458  76.3    2e-12   
ref|XP_009628666.1|  PREDICTED: uncharacterized protein LOC104118984  75.9    2e-12   
ref|XP_010425367.1|  PREDICTED: uncharacterized protein LOC104710453  75.9    3e-12   
ref|XP_010912990.1|  PREDICTED: uncharacterized protein LOC105038788  76.3    3e-12   
ref|XP_006292751.1|  hypothetical protein CARUB_v10018998mg           75.9    3e-12   
gb|KDO69494.1|  hypothetical protein CISIN_1g029397mg                 75.5    3e-12   
ref|XP_004138082.1|  PREDICTED: uncharacterized protein LOC101222072  75.5    3e-12   
ref|XP_009774752.1|  PREDICTED: uncharacterized protein LOC104224728  75.5    3e-12   
ref|XP_008464503.1|  PREDICTED: uncharacterized protein LOC103502365  75.5    3e-12   
ref|XP_010909406.1|  PREDICTED: uncharacterized protein LOC105035522  75.5    4e-12   
ref|XP_006439915.1|  hypothetical protein CICLE_v10021546mg           76.3    4e-12   
ref|XP_006390857.1|  hypothetical protein EUTSA_v10019187mg           75.1    4e-12   
ref|XP_009403623.1|  PREDICTED: uncharacterized protein LOC103987138  76.3    6e-12   
ref|XP_007036379.1|  Octicosapeptide/Phox/Bem1p family protein        75.5    6e-12   
ref|XP_010514296.1|  PREDICTED: uncharacterized protein LOC104790282  74.3    8e-12   
ref|XP_006476876.1|  PREDICTED: uncharacterized protein LOC102620638  74.3    8e-12   
ref|XP_010550697.1|  PREDICTED: uncharacterized protein LOC104821490  75.1    9e-12   
gb|ACJ85885.1|  unknown                                               74.7    9e-12   Medicago truncatula
ref|XP_010502578.1|  PREDICTED: uncharacterized protein LOC104779862  73.9    1e-11   
emb|CDP12740.1|  unnamed protein product                              74.3    1e-11   
ref|XP_004501879.1|  PREDICTED: uncharacterized protein LOC101511...  73.6    1e-11   
ref|XP_006404283.1|  hypothetical protein EUTSA_v10010747mg           73.2    2e-11   
emb|CDY66304.1|  BnaA07g38840D                                        72.8    2e-11   
emb|CDY61217.1|  BnaC06g43650D                                        72.4    2e-11   
ref|XP_004236261.1|  PREDICTED: uncharacterized protein LOC101266...  72.8    2e-11   
ref|XP_009105733.1|  PREDICTED: uncharacterized protein LOC103831599  72.4    3e-11   
ref|XP_004236260.1|  PREDICTED: uncharacterized protein LOC101266...  72.8    3e-11   
emb|CDY20093.1|  BnaA01g29090D                                        72.8    3e-11   
ref|XP_009613737.1|  PREDICTED: uncharacterized protein LOC104106...  72.4    3e-11   
ref|XP_008339068.1|  PREDICTED: uncharacterized protein LOC103402106  72.8    3e-11   
ref|XP_006344466.1|  PREDICTED: uncharacterized protein LOC102580...  72.0    4e-11   
ref|XP_006344465.1|  PREDICTED: uncharacterized protein LOC102580...  72.4    4e-11   
ref|NP_189282.1|  PB1_UP2 domain-containing protein                   72.0    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613736.1|  PREDICTED: uncharacterized protein LOC104106...  72.0    5e-11   
ref|XP_006852324.1|  hypothetical protein AMTR_s00049p00204490        72.0    5e-11   
ref|XP_009393766.1|  PREDICTED: uncharacterized protein LOC103979368  72.0    5e-11   
ref|XP_002875889.1|  octicosapeptide/Phox/Bem1p domain-containing...  71.6    6e-11   
ref|XP_010519536.1|  PREDICTED: uncharacterized protein LOC104798966  71.6    6e-11   
dbj|BAB01831.1|  unnamed protein product                              72.0    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009793857.1|  PREDICTED: uncharacterized protein LOC104240682  71.6    6e-11   
gb|KEH31785.1|  PB1 domain protein                                    71.2    8e-11   
ref|XP_006291924.1|  hypothetical protein CARUB_v10018110mg           70.9    9e-11   
emb|CDX84387.1|  BnaC03g51130D                                        71.2    9e-11   
ref|XP_002876977.1|  hypothetical protein ARALYDRAFT_484412           70.9    1e-10   
emb|CDY41501.1|  BnaA06g22540D                                        70.5    1e-10   
ref|XP_009150371.1|  PREDICTED: uncharacterized protein LOC103873733  71.2    1e-10   
gb|ABK24411.1|  unknown                                               71.6    1e-10   Picea sitchensis
ref|XP_004979214.1|  PREDICTED: uncharacterized protein LOC101779687  70.9    2e-10   
ref|XP_007138022.1|  hypothetical protein PHAVU_009G174600g           70.5    2e-10   
ref|XP_008239324.1|  PREDICTED: uncharacterized protein LOC103337931  70.5    2e-10   
ref|XP_009333949.1|  PREDICTED: uncharacterized protein LOC103926795  70.9    2e-10   
ref|XP_010415750.1|  PREDICTED: uncharacterized protein LOC104701706  70.1    2e-10   
ref|XP_010471064.1|  PREDICTED: uncharacterized protein LOC104750903  70.1    2e-10   
ref|XP_007209584.1|  hypothetical protein PRUPE_ppa011220mg           70.5    2e-10   
ref|XP_008380529.1|  PREDICTED: bromodomain-containing protein 4B...  70.5    2e-10   
ref|XP_003527000.1|  PREDICTED: uncharacterized protein LOC100797123  69.7    3e-10   
dbj|BAH19742.1|  AT3G26510                                            69.7    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31034.1|  hypothetical protein JCGZ_11410                       69.3    3e-10   
ref|XP_011071942.1|  PREDICTED: uncharacterized protein LOC105157271  69.3    4e-10   
ref|XP_010427847.1|  PREDICTED: uncharacterized protein LOC104712615  68.9    4e-10   
ref|XP_002887319.1|  hypothetical protein ARALYDRAFT_894881           68.9    4e-10   
gb|EEC76732.1|  hypothetical protein OsI_14765                        69.3    5e-10   Oryza sativa Indica Group [Indian rice]
gb|KFK34129.1|  hypothetical protein AALP_AA5G105000                  68.9    5e-10   
gb|AAX96259.1|  PB1 domain, putative                                  69.3    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_190407.1|  Octicosapeptide/Phox/Bem1p family protein           68.6    5e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EAY92969.1|  hypothetical protein OsI_14763                        68.9    6e-10   Oryza sativa Indica Group [Indian rice]
gb|AES71442.2|  PB1 domain protein                                    68.6    8e-10   
ref|XP_002864838.1|  predicted protein                                68.2    8e-10   
ref|XP_002321629.1|  octicosapeptide/Phox/Bem1p domain-containing...  68.2    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011046225.1|  PREDICTED: uncharacterized protein LOC105140885  68.2    9e-10   
gb|EMS46138.1|  hypothetical protein TRIUR3_21026                     68.2    9e-10   
ref|XP_003601191.1|  hypothetical protein MTR_3g077030                68.9    9e-10   
ref|XP_010515139.1|  PREDICTED: uncharacterized protein LOC104791038  67.8    1e-09   
ref|XP_010045524.1|  PREDICTED: uncharacterized protein LOC104434250  67.8    1e-09   
ref|NP_177221.1|  octicosapeptide/Phox/Bem1p (PB1) domain-contain...  67.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002450710.1|  hypothetical protein SORBIDRAFT_05g012960        67.8    2e-09   Sorghum bicolor [broomcorn]
ref|XP_009149832.1|  PREDICTED: uncharacterized protein LOC103873161  67.0    2e-09   
ref|XP_006394311.1|  hypothetical protein EUTSA_v10004971mg           67.0    2e-09   
ref|NP_001067822.1|  Os11g0444700                                     67.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDY48161.1|  BnaA06g16720D                                        66.6    3e-09   
emb|CDY39571.1|  BnaCnng09400D                                        66.6    3e-09   
ref|XP_006662873.1|  PREDICTED: uncharacterized protein LOC102718029  67.0    3e-09   
dbj|BAJ98172.1|  predicted protein                                    66.6    3e-09   
ref|XP_006302894.1|  hypothetical protein CARUB_v10021024mg           66.2    3e-09   
ref|XP_010459891.1|  PREDICTED: uncharacterized protein LOC104740863  66.2    4e-09   
ref|XP_009348481.1|  PREDICTED: uncharacterized protein LOC103940131  65.9    4e-09   
ref|XP_002981765.1|  hypothetical protein SELMODRAFT_59129            63.9    6e-09   
ref|XP_010484035.1|  PREDICTED: uncharacterized protein LOC104762...  65.9    6e-09   
ref|XP_010678864.1|  PREDICTED: uncharacterized protein LOC104894347  65.9    6e-09   
ref|XP_006281149.1|  hypothetical protein CARUB_v10027182mg           65.5    7e-09   
emb|CDY48129.1|  BnaCnng15710D                                        65.5    7e-09   
ref|XP_002511328.1|  ATP binding protein, putative                    65.5    7e-09   Ricinus communis
ref|XP_003522400.1|  PREDICTED: uncharacterized protein LOC100810563  65.5    8e-09   
ref|XP_010426312.1|  PREDICTED: uncharacterized protein LOC104711318  65.1    9e-09   
gb|KFK25760.1|  hypothetical protein AALP_AA8G156000                  64.7    1e-08   
ref|XP_007155477.1|  hypothetical protein PHAVU_003G204600g           65.1    1e-08   
ref|XP_010503454.1|  PREDICTED: uncharacterized protein LOC104780636  64.7    1e-08   
ref|XP_009362945.1|  PREDICTED: uncharacterized protein LOC103952957  65.1    1e-08   
ref|XP_011101288.1|  PREDICTED: uncharacterized protein LOC105179375  64.7    1e-08   
ref|NP_201118.1|  octicosapeptide/Phox/Bem1p domain-containing pr...  64.7    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549597.2|  PREDICTED: uncharacterized protein LOC100815502  65.1    2e-08   
ref|XP_004308815.1|  PREDICTED: uncharacterized protein LOC101305707  64.3    2e-08   
ref|NP_001067823.1|  Os11g0444900                                     62.4    3e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY72321.1|  BnaAnng40670D                                        63.2    3e-08   
ref|XP_011047807.1|  PREDICTED: uncharacterized protein LOC105142057  63.2    3e-08   
ref|XP_008392895.1|  PREDICTED: uncharacterized protein LOC103455081  63.5    4e-08   
ref|XP_004515869.1|  PREDICTED: uncharacterized protein LOC101504255  63.2    5e-08   
ref|XP_008375507.1|  PREDICTED: uncharacterized protein LOC103438742  62.0    5e-08   
ref|XP_002993953.1|  hypothetical protein SELMODRAFT_137907           62.4    6e-08   
ref|XP_010037518.1|  PREDICTED: uncharacterized protein LOC104426...  62.4    6e-08   
ref|NP_001148216.1|  octicosapeptide/Phox/Bem1p                       62.8    7e-08   Zea mays [maize]
gb|AFW60724.1|  octicosapeptide/Phox/Bem1p                            62.8    7e-08   
gb|KCW49228.1|  hypothetical protein EUGRSUZ_K02802                   63.2    8e-08   
ref|XP_002318066.2|  hypothetical protein POPTR_0012s08690g           63.2    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010037519.1|  PREDICTED: uncharacterized protein LOC104426...  61.2    1e-07   
gb|AFW60723.1|  hypothetical protein ZEAMMB73_447142                  61.2    1e-07   
ref|XP_009112066.1|  PREDICTED: uncharacterized protein LOC103837458  62.0    1e-07   
gb|ABK25040.1|  unknown                                               62.8    2e-07   Picea sitchensis
gb|EYU22177.1|  hypothetical protein MIMGU_mgv1a013453mg              61.6    2e-07   
gb|EYU33942.1|  hypothetical protein MIMGU_mgv1a011605mg              62.0    2e-07   
ref|XP_001770904.1|  predicted protein                                59.7    2e-07   
ref|XP_006467921.1|  PREDICTED: uncharacterized protein LOC102609...  63.2    2e-07   
ref|XP_006467922.1|  PREDICTED: uncharacterized protein LOC102609...  63.2    2e-07   
emb|CBI14960.3|  unnamed protein product                              59.3    3e-07   
ref|XP_006449189.1|  hypothetical protein CICLE_v10015301mg           63.2    3e-07   
ref|XP_006467920.1|  PREDICTED: uncharacterized protein LOC102609...  63.2    3e-07   
ref|XP_001764223.1|  predicted protein                                59.3    3e-07   
ref|XP_003576068.1|  PREDICTED: uncharacterized protein LOC100829124  60.8    3e-07   
gb|ABR16614.1|  unknown                                               63.2    3e-07   Picea sitchensis
ref|XP_006858576.1|  hypothetical protein AMTR_s00071p00184320        62.0    3e-07   
gb|ACN40698.1|  unknown                                               63.2    3e-07   Picea sitchensis
ref|XP_004299138.1|  PREDICTED: uncharacterized protein LOC101311572  60.1    4e-07   
ref|XP_002521124.1|  serine/threonine protein kinase, putative        63.2    5e-07   Ricinus communis
gb|EPS67511.1|  hypothetical protein M569_07264                       60.5    5e-07   
gb|KFK39161.1|  hypothetical protein AALP_AA3G208200                  62.4    6e-07   
gb|EYU21843.1|  hypothetical protein MIMGU_mgv11b015635mg             59.3    6e-07   
ref|XP_010265683.1|  PREDICTED: uncharacterized protein LOC104603364  61.2    6e-07   
ref|XP_008225868.1|  PREDICTED: uncharacterized protein LOC103325479  62.4    6e-07   
emb|CDY62874.1|  BnaCnng41080D                                        61.6    7e-07   
ref|XP_008224921.1|  PREDICTED: uncharacterized protein LOC103324618  61.6    8e-07   
ref|XP_007211679.1|  hypothetical protein PRUPE_ppa005876mg           61.6    8e-07   
ref|XP_009391167.1|  PREDICTED: uncharacterized protein LOC103977399  62.0    8e-07   
gb|ACJ54183.1|  PB1 domain-containing protein                         60.1    8e-07   Nicotiana benthamiana
ref|XP_010443452.1|  PREDICTED: uncharacterized protein LOC104726317  62.0    8e-07   
gb|EPS60327.1|  hypothetical protein M569_14476                       58.9    8e-07   
ref|XP_009114662.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.2    9e-07   
ref|XP_008240220.1|  PREDICTED: probable serine/threonine-protein...  61.6    1e-06   
ref|XP_002524705.1|  ATP binding protein, putative                    60.8    1e-06   Ricinus communis
gb|KDP20867.1|  hypothetical protein JCGZ_21338                       60.8    1e-06   
ref|XP_010506585.1|  PREDICTED: uncharacterized protein LOC104783169  61.2    1e-06   
ref|XP_009775146.1|  PREDICTED: uncharacterized protein LOC104225...  61.6    1e-06   
gb|KCW78751.1|  hypothetical protein EUGRSUZ_C00189                   61.2    1e-06   
ref|XP_009406614.1|  PREDICTED: uncharacterized protein LOC103989486  61.2    1e-06   
gb|EPS71406.1|  hypothetical protein M569_03356                       57.4    1e-06   
ref|XP_010465911.1|  PREDICTED: uncharacterized protein LOC104746...  61.2    1e-06   
ref|XP_010465909.1|  PREDICTED: uncharacterized protein LOC104746...  61.2    1e-06   
ref|XP_010942162.1|  PREDICTED: uncharacterized protein LOC105060...  61.2    1e-06   
ref|XP_002285601.1|  PREDICTED: uncharacterized protein LOC100255721  60.8    1e-06   Vitis vinifera
ref|XP_010050238.1|  PREDICTED: uncharacterized protein LOC104438755  61.2    1e-06   
ref|XP_007213731.1|  hypothetical protein PRUPE_ppa000294mg           61.2    2e-06   
ref|XP_010942161.1|  PREDICTED: uncharacterized protein LOC105060...  61.2    2e-06   
ref|XP_010942160.1|  PREDICTED: uncharacterized protein LOC105060...  61.2    2e-06   
ref|XP_006448664.1|  hypothetical protein CICLE_v10014052mg           61.2    2e-06   
ref|XP_008802012.1|  PREDICTED: uncharacterized protein LOC103715...  61.2    2e-06   
ref|XP_006448663.1|  hypothetical protein CICLE_v10014052mg           61.2    2e-06   
gb|KDO77316.1|  hypothetical protein CISIN_1g000726mg                 61.2    2e-06   
ref|XP_010279374.1|  PREDICTED: uncharacterized protein LOC104613306  60.8    2e-06   
ref|XP_008802013.1|  PREDICTED: uncharacterized protein LOC103715...  61.2    2e-06   
gb|KDO77311.1|  hypothetical protein CISIN_1g000726mg                 61.2    2e-06   
ref|XP_006468516.1|  PREDICTED: uncharacterized protein LOC102618...  61.2    2e-06   
ref|XP_007210168.1|  hypothetical protein PRUPE_ppa020379mg           60.8    2e-06   
ref|XP_006848834.1|  hypothetical protein AMTR_s00026p00186490        61.2    2e-06   
ref|XP_009775144.1|  PREDICTED: uncharacterized protein LOC104225...  61.2    2e-06   
gb|KDO77312.1|  hypothetical protein CISIN_1g000726mg                 61.2    2e-06   
ref|XP_006448662.1|  hypothetical protein CICLE_v10014052mg           61.2    2e-06   
gb|KDO42187.1|  hypothetical protein CISIN_1g0470552mg                57.8    2e-06   
ref|XP_010483289.1|  PREDICTED: uncharacterized protein LOC104761846  60.8    2e-06   
ref|XP_010052416.1|  PREDICTED: uncharacterized protein LOC104441106  60.1    2e-06   
ref|XP_006448394.1|  hypothetical protein CICLE_v10014450mg           60.8    2e-06   
emb|CDY46377.1|  BnaA09g19910D                                        60.1    2e-06   
gb|KDO77315.1|  hypothetical protein CISIN_1g000726mg                 60.8    2e-06   
gb|KDO77314.1|  hypothetical protein CISIN_1g000726mg                 60.8    2e-06   
ref|XP_006448661.1|  hypothetical protein CICLE_v10014052mg           60.8    2e-06   
ref|XP_007025841.1|  Octicosapeptide/Phox/Bem1p family protein, p...  60.1    2e-06   
ref|XP_006468758.1|  PREDICTED: nuclear factor of activated T-cel...  60.5    2e-06   
ref|XP_010452530.1|  PREDICTED: uncharacterized protein LOC104734615  60.8    2e-06   
gb|KDO76882.1|  hypothetical protein CISIN_1g039674mg                 58.5    2e-06   
ref|XP_004514065.1|  PREDICTED: uncharacterized protein LOC101492...  60.8    2e-06   
ref|XP_009114247.1|  PREDICTED: uncharacterized protein LOC103839501  60.5    2e-06   
ref|XP_004514063.1|  PREDICTED: uncharacterized protein LOC101492...  60.8    2e-06   
ref|XP_011047901.1|  PREDICTED: uncharacterized protein LOC105142119  59.7    2e-06   
ref|XP_008237118.1|  PREDICTED: uncharacterized protein LOC103335862  59.3    2e-06   
ref|XP_010277896.1|  PREDICTED: uncharacterized protein LOC104612242  60.1    3e-06   
gb|KDP20333.1|  hypothetical protein JCGZ_06419                       60.5    3e-06   
ref|XP_009622731.1|  PREDICTED: uncharacterized protein LOC104114077  60.1    3e-06   
ref|XP_008789506.1|  PREDICTED: uncharacterized protein LOC103706...  60.5    3e-06   
ref|XP_009340315.1|  PREDICTED: uncharacterized protein LOC103932433  60.5    3e-06   
ref|XP_009145918.1|  PREDICTED: uncharacterized protein LOC103869592  60.1    3e-06   
ref|XP_009353980.1|  PREDICTED: uncharacterized protein LOC103945170  60.5    3e-06   
emb|CDY25942.1|  BnaC09g20450D                                        60.1    3e-06   
ref|XP_003540143.1|  PREDICTED: uncharacterized protein LOC100799...  58.5    3e-06   
ref|XP_002875063.1|  hypothetical protein ARALYDRAFT_346618           60.1    3e-06   
ref|XP_008789512.1|  PREDICTED: uncharacterized protein LOC103706...  60.5    3e-06   
emb|CDX92217.1|  BnaA05g21900D                                        60.1    3e-06   
ref|XP_009419962.1|  PREDICTED: uncharacterized protein LOC103999820  60.5    3e-06   
ref|XP_010538213.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  59.7    3e-06   
ref|XP_002864520.1|  kinase family protein                            60.1    3e-06   
ref|XP_003548349.1|  PREDICTED: uncharacterized protein LOC100800353  58.5    3e-06   
ref|XP_006297111.1|  hypothetical protein CARUB_v10013114mg           60.1    3e-06   
ref|XP_006398504.1|  hypothetical protein EUTSA_v10000795mg           60.1    3e-06   
ref|NP_200569.1|  octicosapeptide/Phox/Bem1p domain-containing pr...  60.1    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109694.1|  Serine/threonine-protein kinase                  60.1    3e-06   
emb|CDY17690.1|  BnaA06g35090D                                        60.1    3e-06   
ref|XP_011078294.1|  PREDICTED: uncharacterized protein LOC105162071  60.1    3e-06   
ref|XP_010244780.1|  PREDICTED: uncharacterized protein LOC104588...  60.1    3e-06   
dbj|BAF00951.1|  hypothetical protein                                 59.7    3e-06   
ref|XP_004488774.1|  PREDICTED: uncharacterized protein LOC101510...  60.1    3e-06   
ref|XP_010244779.1|  PREDICTED: uncharacterized protein LOC104588...  60.1    4e-06   
ref|NP_188451.1|  Octicosapeptide/Phox/Bem1p family protein           59.7    4e-06   
ref|XP_009101363.1|  PREDICTED: trithorax group protein osa           59.7    4e-06   
gb|EYU43819.1|  hypothetical protein MIMGU_mgv1a001273mg              60.1    4e-06   
ref|XP_010259777.1|  PREDICTED: uncharacterized protein LOC104599103  60.1    4e-06   
gb|AFG55723.1|  hypothetical protein UMN_3645_01                      55.8    4e-06   
ref|XP_004149094.1|  PREDICTED: uncharacterized protein LOC101215475  60.1    4e-06   
ref|XP_004488775.1|  PREDICTED: uncharacterized protein LOC101510...  60.1    4e-06   
ref|XP_004169890.1|  PREDICTED: uncharacterized protein LOC101228819  60.1    4e-06   
ref|XP_006401189.1|  hypothetical protein EUTSA_v10012514mg           60.1    4e-06   
ref|XP_011096900.1|  PREDICTED: uncharacterized protein LOC105175953  60.1    4e-06   
ref|XP_008784813.1|  PREDICTED: uncharacterized protein LOC103703...  60.1    4e-06   
emb|CDY41073.1|  BnaA09g18520D                                        59.7    4e-06   
ref|XP_006600710.1|  PREDICTED: uncharacterized protein LOC100819...  60.1    4e-06   
ref|XP_008784812.1|  PREDICTED: uncharacterized protein LOC103703...  60.1    4e-06   
ref|XP_009112878.1|  PREDICTED: uncharacterized protein LOC103838200  59.7    4e-06   
emb|CDY66514.1|  BnaAnng22390D                                        59.7    4e-06   
ref|XP_002883121.1|  octicosapeptide/Phox/Bem1p domain-containing...  59.7    4e-06   
ref|XP_010101700.1|  hypothetical protein L484_017330                 59.7    4e-06   
ref|XP_002283405.1|  PREDICTED: RNA polymerase II degradation fac...  59.7    4e-06   
ref|XP_006600711.1|  PREDICTED: uncharacterized protein LOC100819...  59.7    4e-06   
dbj|BAH57208.1|  AT2G01190                                            59.3    4e-06   
ref|XP_008371906.1|  PREDICTED: uncharacterized protein LOC103435299  59.7    5e-06   
ref|XP_006600709.1|  PREDICTED: uncharacterized protein LOC100819...  59.7    5e-06   
gb|KDO45443.1|  hypothetical protein CISIN_1g043197mg                 59.3    5e-06   
emb|CAN82042.1|  hypothetical protein VITISV_033523                   59.3    5e-06   
ref|XP_004963052.1|  PREDICTED: uncharacterized protein LOC101783...  59.7    5e-06   
gb|KGN61099.1|  hypothetical protein Csa_2G049880                     59.7    5e-06   
ref|XP_010549192.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.3    5e-06   
ref|XP_002877531.1|  kinase family protein                            59.7    5e-06   
ref|XP_009759731.1|  PREDICTED: uncharacterized protein LOC104212213  58.9    5e-06   
ref|XP_006451711.1|  hypothetical protein CICLE_v10007669mg           59.3    5e-06   
emb|CDY68695.1|  BnaC01g43910D                                        59.3    5e-06   
ref|XP_007138447.1|  hypothetical protein PHAVU_009G209700g           59.7    5e-06   
ref|XP_006485825.1|  PREDICTED: polyhomeotic-proximal chromatin p...  59.3    5e-06   
ref|XP_010940662.1|  PREDICTED: uncharacterized protein LOC105059139  59.7    5e-06   
ref|XP_008353248.1|  PREDICTED: uncharacterized protein LOC103416803  59.7    5e-06   
ref|XP_006282217.1|  hypothetical protein CARUB_v10028490mg           59.7    5e-06   
ref|NP_565256.1|  Octicosapeptide/Phox/Bem1p family protein           59.3    5e-06   
ref|XP_004153045.1|  PREDICTED: uncharacterized protein LOC101213632  59.7    5e-06   
gb|KFK33340.1|  hypothetical protein AALP_AA5G001400                  59.3    5e-06   
gb|AAM62991.1|  unknown                                               59.3    5e-06   
ref|XP_008440401.1|  PREDICTED: uncharacterized protein LOC103484857  59.7    5e-06   
ref|XP_009336046.1|  PREDICTED: uncharacterized protein LOC103928684  59.7    5e-06   
ref|XP_006453708.1|  hypothetical protein CICLE_v10007243mg           59.7    5e-06   
ref|XP_010487737.1|  PREDICTED: protein hairless-like                 59.3    5e-06   
ref|XP_004161963.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.7    5e-06   
ref|XP_006360437.1|  PREDICTED: activating signal cointegrator 1 ...  59.3    5e-06   
ref|XP_004296739.1|  PREDICTED: uncharacterized protein LOC101299949  59.3    5e-06   
ref|XP_002962982.1|  hypothetical protein SELMODRAFT_29542            54.7    5e-06   
ref|XP_004292384.1|  PREDICTED: uncharacterized protein LOC101312898  59.7    6e-06   
ref|XP_009373372.1|  PREDICTED: uncharacterized protein LOC103962396  59.3    6e-06   
ref|XP_004145126.1|  PREDICTED: uncharacterized protein LOC101217445  59.7    6e-06   
ref|XP_010684018.1|  PREDICTED: uncharacterized protein LOC104898621  55.8    6e-06   
ref|XP_007049832.1|  Serine/threonine protein kinase, putative is...  59.3    6e-06   
ref|XP_006856635.1|  hypothetical protein AMTR_s00046p00232890        58.9    6e-06   
gb|KDO65873.1|  hypothetical protein CISIN_1g0402572mg                59.3    6e-06   
ref|XP_010456927.1|  PREDICTED: uncharacterized protein LOC104738450  56.2    6e-06   
ref|XP_007201002.1|  hypothetical protein PRUPE_ppa005256mg           58.9    6e-06   
ref|XP_008452191.1|  PREDICTED: uncharacterized protein LOC103493...  59.3    6e-06   
ref|XP_009612728.1|  PREDICTED: uncharacterized protein LOC104105985  58.5    6e-06   
ref|XP_007049833.1|  Serine/threonine protein kinase, putative is...  59.3    6e-06   
gb|KCW79014.1|  hypothetical protein EUGRSUZ_C00436                   59.3    6e-06   
ref|XP_008452165.1|  PREDICTED: uncharacterized protein LOC103493...  59.3    6e-06   
ref|XP_008358465.1|  PREDICTED: uncharacterized protein LOC103422203  59.3    6e-06   
ref|XP_009779438.1|  PREDICTED: uncharacterized protein LOC104228647  58.5    6e-06   
gb|KDP42451.1|  hypothetical protein JCGZ_00248                       58.5    6e-06   
gb|EYU34923.1|  hypothetical protein MIMGU_mgv1a000438mg              59.3    6e-06   
ref|XP_006290658.1|  hypothetical protein CARUB_v10016750mg           59.3    6e-06   
ref|XP_007034455.1|  PB1 domain-containing protein tyrosine kinas...  59.3    6e-06   
ref|XP_006350306.1|  PREDICTED: uncharacterized protein LOC102589...  59.3    6e-06   
ref|XP_010269543.1|  PREDICTED: leucine-rich repeat extensin-like...  58.9    6e-06   
ref|XP_007049831.1|  Serine/threonine protein kinase, putative is...  59.3    6e-06   
ref|XP_007144170.1|  hypothetical protein PHAVU_007G134500g           59.3    6e-06   
ref|XP_006406633.1|  hypothetical protein EUTSA_v10020240mg           58.9    6e-06   
ref|XP_007159236.1|  hypothetical protein PHAVU_002G220700g           58.5    6e-06   
emb|CDP11270.1|  unnamed protein product                              59.3    6e-06   
ref|XP_006287750.1|  hypothetical protein CARUB_v10000961mg           58.5    6e-06   
emb|CDP00673.1|  unnamed protein product                              58.9    6e-06   
ref|XP_002965360.1|  hypothetical protein SELMODRAFT_82990            56.2    6e-06   
ref|XP_004243022.1|  PREDICTED: uncharacterized protein LOC101257085  59.3    6e-06   
ref|XP_009348222.1|  PREDICTED: uncharacterized protein LOC103939...  59.3    6e-06   
gb|KHN01001.1|  Putative serine/threonine-protein kinase              59.3    7e-06   
ref|XP_003555491.1|  PREDICTED: uncharacterized protein LOC100807361  59.3    7e-06   
ref|XP_009348221.1|  PREDICTED: uncharacterized protein LOC103939...  59.3    7e-06   
ref|XP_010509668.1|  PREDICTED: dual specificity protein kinase s...  59.3    7e-06   
ref|XP_006473943.1|  PREDICTED: uncharacterized protein LOC102617273  59.3    7e-06   
ref|XP_009348802.1|  PREDICTED: uncharacterized protein LOC103940...  59.3    7e-06   
ref|XP_009348801.1|  PREDICTED: uncharacterized protein LOC103940...  59.3    7e-06   
ref|XP_006443652.1|  hypothetical protein CICLE_v10018522mg           59.3    7e-06   
ref|XP_010509665.1|  PREDICTED: probable serine/threonine-protein...  59.3    7e-06   
ref|XP_007226382.1|  hypothetical protein PRUPE_ppa022958mg           57.8    7e-06   
ref|XP_010265709.1|  PREDICTED: uncharacterized protein LOC104603386  59.3    7e-06   
ref|XP_002977206.1|  hypothetical protein SELMODRAFT_106233           55.8    7e-06   
ref|XP_008661676.1|  PREDICTED: uncharacterized protein LOC103640528  58.9    7e-06   
ref|XP_010505003.1|  PREDICTED: mitosis inhibitor protein kinase ...  59.3    7e-06   
ref|XP_010513833.1|  PREDICTED: leucine-rich repeat extensin-like...  58.9    7e-06   
ref|XP_003535465.1|  PREDICTED: uncharacterized protein LOC100810711  59.3    7e-06   
ref|XP_003608344.1|  hypothetical protein MTR_4g092850                58.5    7e-06   
ref|XP_004496074.1|  PREDICTED: uncharacterized protein LOC101508027  58.9    7e-06   
gb|EMT26207.1|  Serine/threonine-protein kinase CTR1                  58.9    7e-06   
ref|XP_010502072.1|  PREDICTED: uncharacterized protein LOC104779418  58.9    7e-06   
ref|XP_008368183.1|  PREDICTED: probable LIM domain-containing se...  57.4    8e-06   
tpg|DAA47336.1|  TPA: putative protein kinase superfamily protein     58.9    8e-06   
emb|CDY24442.1|  BnaC05g35120D                                        58.5    8e-06   
ref|XP_009117770.1|  PREDICTED: serine/threonine-protein kinase S...  58.9    8e-06   
ref|XP_006858577.1|  hypothetical protein AMTR_s00071p00184460        55.5    8e-06   
dbj|BAF01565.1|  hypothetical protein                                 58.9    8e-06   
ref|XP_003591632.1|  Mitogen-activated protein kinase kinase kina...  58.9    8e-06   
gb|EMS55060.1|  Serine/threonine-protein kinase CTR1                  58.9    8e-06   
ref|XP_004497039.1|  PREDICTED: putative uncharacterized protein ...  58.9    8e-06   
emb|CDX81758.1|  BnaC08g38430D                                        58.9    8e-06   
emb|CDY40994.1|  BnaA02g27840D                                        58.5    8e-06   
ref|NP_178075.1|  protein kinase superfamily protein with octicos...  58.9    8e-06   
ref|XP_006420601.1|  hypothetical protein CICLE_v10006663mg           58.9    8e-06   
gb|KDO38008.1|  hypothetical protein CISIN_1g001103mg                 58.9    9e-06   
ref|XP_010688501.1|  PREDICTED: uncharacterized protein LOC104902423  58.9    9e-06   
ref|XP_006364988.1|  PREDICTED: uncharacterized protein LOC102601916  58.2    9e-06   
gb|EPS64182.1|  hypothetical protein M569_10597                       57.8    9e-06   
ref|XP_008345859.1|  PREDICTED: uncharacterized protein LOC103408822  58.2    9e-06   
ref|XP_006489800.1|  PREDICTED: uncharacterized protein LOC102607...  58.9    9e-06   
emb|CDO98400.1|  unnamed protein product                              58.5    9e-06   
ref|XP_010229394.1|  PREDICTED: uncharacterized protein LOC100839142  58.9    9e-06   
ref|XP_004162462.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.9    9e-06   
ref|XP_006293574.1|  hypothetical protein CARUB_v10022521mg           58.9    9e-06   
ref|XP_006293575.1|  hypothetical protein CARUB_v10022521mg           58.9    9e-06   
ref|XP_009355321.1|  PREDICTED: uncharacterized protein LOC103946363  57.8    9e-06   
ref|XP_009413048.1|  PREDICTED: uncharacterized protein LOC103994442  58.9    9e-06   
ref|XP_009382063.1|  PREDICTED: serine/threonine-protein kinase B...  58.9    9e-06   
ref|XP_006389516.1|  hypothetical protein POPTR_0022s00520g           57.4    1e-05   
emb|CDY52846.1|  BnaA09g56380D                                        58.5    1e-05   
ref|XP_010456928.1|  PREDICTED: mediator of RNA polymerase II tra...  58.5    1e-05   
ref|XP_009598648.1|  PREDICTED: uncharacterized protein LOC104094419  58.2    1e-05   
ref|XP_008452248.1|  PREDICTED: homeobox protein abdominal-A          57.8    1e-05   
ref|XP_002263275.2|  PREDICTED: uncharacterized protein LOC100257434  57.8    1e-05   
ref|XP_010527767.1|  PREDICTED: uncharacterized protein LOC104805056  58.5    1e-05   
ref|XP_002298807.2|  hypothetical protein POPTR_0001s29250g           58.2    1e-05   
ref|XP_004146735.1|  PREDICTED: uncharacterized protein LOC101203826  58.5    1e-05   
ref|XP_006402209.1|  hypothetical protein EUTSA_v10014259mg           57.4    1e-05   
ref|XP_003532922.1|  PREDICTED: uncharacterized protein LOC100799639  58.5    1e-05   
ref|XP_008339004.1|  PREDICTED: uncharacterized protein LOC103402033  58.2    1e-05   
ref|XP_010516676.1|  PREDICTED: probable serine/threonine-protein...  58.5    1e-05   
ref|XP_008218717.1|  PREDICTED: uncharacterized protein LOC103319010  57.8    1e-05   
ref|XP_009775048.1|  PREDICTED: uncharacterized protein LOC104224999  57.8    1e-05   
gb|KGN65213.1|  hypothetical protein Csa_1G265130                     58.5    1e-05   
ref|XP_006385040.1|  octicosapeptide/Phox/Bem1p domain-containing...  57.4    1e-05   
gb|AES90541.2|  octicosapeptide/phox/Bem1p (PB1) domain protein       58.2    1e-05   
ref|XP_009373902.1|  PREDICTED: uncharacterized protein LOC103962829  57.8    1e-05   
ref|XP_006598216.1|  PREDICTED: uncharacterized protein LOC100801...  58.5    1e-05   
ref|XP_006396628.1|  hypothetical protein EUTSA_v10028630mg           58.2    1e-05   
gb|KHN48883.1|  Serine/threonine-protein kinase CTR1                  58.5    1e-05   
emb|CBI29698.3|  unnamed protein product                              57.8    1e-05   
emb|CDX91540.1|  BnaC02g16200D                                        57.0    1e-05   
ref|XP_002308377.2|  hypothetical protein POPTR_0006s20460g           58.5    1e-05   
ref|XP_006597948.1|  PREDICTED: uncharacterized protein LOC100776...  58.5    1e-05   
ref|XP_006489801.1|  PREDICTED: uncharacterized protein LOC102607...  58.5    1e-05   
dbj|BAE98505.1|  hypothetical protein                                 57.8    1e-05   
gb|KHG09464.1|  Serine/threonine-protein kinase CTR1                  58.5    1e-05   
ref|XP_007199684.1|  hypothetical protein PRUPE_ppa000397mg           58.5    1e-05   
ref|NP_567290.1|  Octicosapeptide/Phox/Bem1p family protein           57.8    1e-05   
ref|XP_002308376.2|  hypothetical protein POPTR_0006s20460g           58.5    1e-05   
emb|CDO97621.1|  unnamed protein product                              57.4    1e-05   
ref|XP_003543123.1|  PREDICTED: uncharacterized protein LOC100801566  57.8    1e-05   
ref|XP_008235517.1|  PREDICTED: uncharacterized protein LOC103334343  58.5    1e-05   
ref|XP_011086143.1|  PREDICTED: uncharacterized protein LOC105167945  57.8    1e-05   
ref|XP_010497706.1|  PREDICTED: uncharacterized protein LOC104775151  55.1    1e-05   
ref|XP_007227067.1|  hypothetical protein PRUPE_ppa000590mg           58.5    1e-05   
ref|XP_002967580.1|  hypothetical protein SELMODRAFT_19585            53.9    1e-05   
gb|KDO62450.1|  hypothetical protein CISIN_1g001449mg                 58.2    1e-05   
emb|CAB81057.1|  putative protein                                     57.8    1e-05   
ref|XP_008223662.1|  PREDICTED: uncharacterized protein LOC103323443  58.2    1e-05   
ref|XP_011033492.1|  PREDICTED: uncharacterized protein LOC105131...  58.5    1e-05   
ref|XP_004485634.1|  PREDICTED: uncharacterized protein LOC101503649  57.8    1e-05   
ref|XP_009408040.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  58.5    1e-05   
ref|XP_009144519.1|  PREDICTED: uncharacterized protein LOC103868172  57.8    1e-05   
emb|CDP13566.1|  unnamed protein product                              58.2    1e-05   
ref|XP_009133009.1|  PREDICTED: uncharacterized protein LOC103857556  58.2    1e-05   
ref|XP_003610160.1|  Protein kinase-like protein                      58.2    1e-05   
emb|CDX91230.1|  BnaC02g26410D                                        57.8    1e-05   
ref|XP_010916468.1|  PREDICTED: leucine-rich repeat extensin-like...  58.2    1e-05   
ref|XP_007148567.1|  hypothetical protein PHAVU_006G219400g           56.6    1e-05   
ref|XP_011033491.1|  PREDICTED: uncharacterized protein LOC105131...  58.2    1e-05   
ref|XP_010047189.1|  PREDICTED: uncharacterized protein LOC104436151  58.2    1e-05   
emb|CAN60811.1|  hypothetical protein VITISV_036659                   58.2    1e-05   
ref|XP_011033488.1|  PREDICTED: uncharacterized protein LOC105131...  58.2    1e-05   
ref|XP_011030231.1|  PREDICTED: uncharacterized protein LOC105129736  57.8    1e-05   
ref|XP_010244681.1|  PREDICTED: uncharacterized protein LOC104588442  57.8    1e-05   
emb|CDX84624.1|  BnaA03g16060D                                        58.2    1e-05   
ref|XP_004238032.1|  PREDICTED: uncharacterized protein LOC101265728  57.8    1e-05   
ref|XP_011001162.1|  PREDICTED: uncharacterized protein LOC105108528  57.4    1e-05   
ref|XP_008813761.1|  PREDICTED: leucine-rich repeat extensin-like...  57.8    1e-05   
ref|XP_010265363.1|  PREDICTED: uncharacterized protein LOC104603124  57.0    1e-05   
ref|XP_010068040.1|  PREDICTED: uncharacterized protein LOC104454854  57.0    1e-05   
emb|CDX79590.1|  BnaC03g19260D                                        58.2    1e-05   
ref|XP_010533214.1|  PREDICTED: uncharacterized protein LOC104809031  57.0    1e-05   
ref|XP_002872737.1|  hypothetical protein ARALYDRAFT_490165           57.4    1e-05   
ref|XP_010687763.1|  PREDICTED: uncharacterized protein LOC104901835  58.2    1e-05   
ref|XP_008339405.1|  PREDICTED: uncharacterized protein LOC103402428  57.0    1e-05   
ref|XP_002305645.1|  octicosapeptide/Phox/Bem1p domain-containing...  57.4    1e-05   
ref|XP_008383292.1|  PREDICTED: uncharacterized protein LOC103446011  58.2    2e-05   
gb|KHF99645.1|  Serine/threonine-protein kinase CTR1                  58.2    2e-05   
ref|XP_010431694.1|  PREDICTED: uncharacterized protein LOC104716043  57.4    2e-05   
ref|XP_010530672.1|  PREDICTED: uncharacterized protein LOC104807191  57.4    2e-05   
ref|XP_008443901.1|  PREDICTED: uncharacterized protein LOC103487...  58.2    2e-05   
ref|XP_008443903.1|  PREDICTED: uncharacterized protein LOC103487...  58.2    2e-05   
ref|XP_002325164.2|  hypothetical protein POPTR_0018s12220g           58.2    2e-05   
gb|KDO62448.1|  hypothetical protein CISIN_1g001449mg                 57.8    2e-05   
gb|KFK32222.1|  hypothetical protein AALP_AA6G213700                  57.4    2e-05   
ref|XP_010068039.1|  PREDICTED: uncharacterized protein LOC104454853  57.0    2e-05   
ref|XP_010656819.1|  PREDICTED: uncharacterized protein LOC100266...  57.8    2e-05   
ref|XP_011010485.1|  PREDICTED: uncharacterized protein LOC105115...  57.8    2e-05   
gb|KDP35167.1|  hypothetical protein JCGZ_10701                       57.8    2e-05   
ref|XP_009629666.1|  PREDICTED: uncharacterized protein LOC104119...  57.8    2e-05   
ref|XP_002865764.1|  octicosapeptide/Phox/Bem1p domain-containing...  56.6    2e-05   
ref|XP_004135079.1|  PREDICTED: uncharacterized protein LOC101215574  57.8    2e-05   



>ref|XP_004135273.1| PREDICTED: uncharacterized protein LOC101222057 [Cucumis sativus]
 ref|XP_004155369.1| PREDICTED: uncharacterized protein LOC101224076 [Cucumis sativus]
 gb|KGN51755.1| hypothetical protein Csa_5G598630 [Cucumis sativus]
Length=209

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 6/154 (4%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRA  730
             +ELL+KLG++ G  VSLRCQLP+EDLDALVSITSDEDLANLIEEYDR  S    +KIRA
Sbjct  58   FSELLLKLGQLCGTCVSLRCQLPSEDLDALVSITSDEDLANLIEEYDRAASPPSFLKIRA  117

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLS PKS KK      S +SSS+S+   SP    ++PR +++      +HQ+      S 
Sbjct  118  FLSLPKSVKKNPLSSSSASSSSSSSKPSSPITAISSPR-ISTQVPDYCVHQIPTPVRFSY  176

Query  549  SYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             ++K   + P C++HL  GN  HIYLIH+GN+WQ
Sbjct  177  RWKKSQSKVPHCSYHL-QGNPSHIYLIHNGNHWQ  209


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  1267  AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             A    T +IKFLCSYGGKILPR+PDGKLRY GGETRVL+VDR
Sbjct  13    AKSDKTATIKFLCSYGGKILPRYPDGKLRYIGGETRVLAVDR  54



>ref|XP_008446162.1| PREDICTED: uncharacterized protein LOC103488970 [Cucumis melo]
Length=209

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 6/154 (4%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIRA  730
             +ELL KLG++ G  VSLRCQLP+EDLDALVSITSDEDLANLIEEYDR      S+KIRA
Sbjct  58   FSELLSKLGQLCGTCVSLRCQLPSEDLDALVSITSDEDLANLIEEYDRAASPPSSLKIRA  117

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLS PKS KK      S +SSS+S+   SP    ++PR +++      +HQ+      S 
Sbjct  118  FLSLPKSVKKNPLSSSSASSSSSSSKPSSPITAISSPR-ISTQVPDYCVHQIPTPVRFSY  176

Query  549  SYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             ++K   + P C++HL  GN  HIYLIH+GN+WQ
Sbjct  177  RWKKSQSKVPHCSYHL-QGNPSHIYLIHNGNHWQ  209


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T +IKFLCSYGGKILPR+PDGKLRY GGETRVL+VDR
Sbjct  18    TATIKFLCSYGGKILPRYPDGKLRYIGGETRVLAVDR  54



>ref|XP_009606428.1| PREDICTED: uncharacterized protein LOC104100805 [Nicotiana tomentosiformis]
Length=226

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 102/180 (57%), Gaps = 27/180 (15%)
 Frame = -2

Query  906  CGVITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIK  739
            C    EL+VKLGEM GASVSLRCQLP+EDLDALVSIT DEDLANLIEEYD       S+K
Sbjct  47   CISFAELMVKLGEMCGASVSLRCQLPSEDLDALVSITCDEDLANLIEEYDHAATPSSSLK  106

Query  738  IRAFlsppkstkkgsppplstassstsnssmsprlPCTAPR--FLASSRGGKGIHQMSKL  565
            IRAFL PPKSTK     P  + SS++S ++       T+P   F ++S     I   SK 
Sbjct  107  IRAFLLPPKSTKLKLVSPPPSISSTSSTNTTISNHDATSPESSFCSTSASTSTILNSSKY  166

Query  564  SVMSPSY---------------------EKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                 SY                     EK  G+ PQ  +H    N+GHIYLIHHG++WQ
Sbjct  167  KNCPRSYKETSYSCVRHTRTRSLPLMCHEKVAGKIPQYVYHGHGNNSGHIYLIHHGHHWQ  226


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = -1

Query  1270  MAGPSSTKS---IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS       +KFLCSYGGKI+PRH DGKLRYYGGETRVLSV R
Sbjct  1     MVGPSINSRNVPLKFLCSYGGKIIPRHTDGKLRYYGGETRVLSVHR  46



>ref|XP_006380005.1| hypothetical protein POPTR_0008s19040g [Populus trichocarpa]
 gb|ERP57802.1| hypothetical protein POPTR_0008s19040g [Populus trichocarpa]
Length=213

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 99/164 (60%), Gaps = 24/164 (15%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKI  736
              ELL+KLG++ G SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR G      S+KI
Sbjct  60   FAELLLKLGDLCGTSVSLRCQLPKEDLDALVSITSDEDLANLIEEYDRAGAATPTASLKI  119

Query  735  RAFlsppkstkkgsppplstassstsnss-------msprlPCTAPRFLASSRGGKGIHQ  577
            RAFLS PK     S    S++SSS+S SS        +     T PR           HQ
Sbjct  120  RAFLSLPKKIYSSSSKSSSSSSSSSSPSSPSNSYGGATIASTSTTPRCY--------YHQ  171

Query  576  MSKLSVMSPSYEKRGGRPPQCAHHLGA-GNTGHIYLIHHGNYWQ  448
            MSK    S   +K+   PPQ  +   A GN GHIYL+H+GN+WQ
Sbjct  172  MSKPVAFSS--KKKTPPPPQYQYGYHAHGNPGHIYLVHNGNHWQ  213


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  1300  FVSPKSEETDM---AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              V P  + T +   A  S+  +IKFLCSYGGKI+PR PDGKLRY GGETRV+ VDR
Sbjct  1     MVGPSLDTTKLHLKAPSSAPATIKFLCSYGGKIIPRFPDGKLRYQGGETRVIGVDR  56



>ref|XP_007044801.1| Octicosapeptide/Phox/Bem1p family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007044802.1| Octicosapeptide/Phox/Bem1p family protein isoform 1 [Theobroma 
cacao]
 gb|EOY00633.1| Octicosapeptide/Phox/Bem1p family protein isoform 1 [Theobroma 
cacao]
 gb|EOY00634.1| Octicosapeptide/Phox/Bem1p family protein isoform 1 [Theobroma 
cacao]
Length=186

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 101/156 (65%), Gaps = 20/156 (13%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIRA  730
             +ELL+K+GEM G +VSLRCQLP EDLDALVSIT DEDLANLIEEYDR      S+KIRA
Sbjct  45   FSELLLKMGEMCGTAVSLRCQLPTEDLDALVSITCDEDLANLIEEYDRVASPPSSLKIRA  104

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLS PKSTKK   P  S+ASSS S+SS       + PRF         I Q+S   V  P
Sbjct  105  FLSLPKSTKKPISPSSSSASSSKSSSS-------STPRF-------SCIRQISGPPVAFP  150

Query  549  -SYEKRGGRP-PQCAHHLGAGNTGHIYLIHHGNYWQ  448
               EK  G+  P   +H+  GN  HIYLIH+GN+WQ
Sbjct  151  LCSEKSAGKSIPYYGYHVHHGNPSHIYLIHNGNHWQ  186


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 2/43 (5%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GP+ T  IKFLCSYGGKILPR+PDGKLRY+GGETRVL+VDR
Sbjct  1     MVGPNPT--IKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDR  41



>ref|XP_011034074.1| PREDICTED: uncharacterized protein LOC105132333 [Populus euphratica]
 ref|XP_011034075.1| PREDICTED: uncharacterized protein LOC105132333 [Populus euphratica]
 ref|XP_011034076.1| PREDICTED: uncharacterized protein LOC105132333 [Populus euphratica]
Length=213

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 96/164 (59%), Gaps = 24/164 (15%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKI  736
              ELL+KLGE+ G SVSLR QLP EDLDALVSITSDEDL NLIEEYDR G      S+KI
Sbjct  60   FAELLLKLGELCGTSVSLRFQLPKEDLDALVSITSDEDLVNLIEEYDRAGAATPTASLKI  119

Query  735  RAFlsppkstkkgsppplstassstsnss-------msprlPCTAPRFLASSRGGKGIHQ  577
            RAFLS PK     S    S++SSS+S+S         +     T PR           HQ
Sbjct  120  RAFLSLPKKIYSSSSKSSSSSSSSSSSSPPSNSYGGATIASTSTTPRCY--------YHQ  171

Query  576  MSKLSVMSPSYEKRGGRPPQCAHHLGA-GNTGHIYLIHHGNYWQ  448
            MSK    S   +K    PPQ  +   A GN GHIYL+H+GN+WQ
Sbjct  172  MSKPVAFSS--KKNTPPPPQYQYGYHAHGNPGHIYLVHNGNHWQ  213


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 3/56 (5%)
 Frame = -1

Query  1300  FVSPKSEETDM---AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              V P  + T +   A  S+T +IKFLCSYGGKI+PR PDGKLRY GGETRV+ VDR
Sbjct  1     MVGPSLDATKLHLKAPASATATIKFLCSYGGKIIPRFPDGKLRYQGGETRVIGVDR  56



>emb|CAN80873.1| hypothetical protein VITISV_004539 [Vitis vinifera]
Length=185

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 98/154 (64%), Gaps = 17/154 (11%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC----GSIKIRA  730
              ELLVKLGE+ G SV LRCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KIRA
Sbjct  45   FAELLVKLGELCGKSVCLRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRA  104

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLSPPKS KK SPPP S +SS  S +        +A RF   +      HQ+S       
Sbjct  105  FLSPPKSIKKISPPPSSASSSQLSVA--------SASRFTMPAAVDXCHHQISP----QV  152

Query  549  SYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             ++K   + P   +H+  GN  H+YLIH+GN+WQ
Sbjct  153  PFQKSSRKVPHYGYHV-HGNPSHVYLIHNGNHWQ  185


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S ++IKFLCSYGGKILPR+PDGKLRY+GGETRVL+VDR
Sbjct  3     TSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDR  41



>emb|CBI18643.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 98/154 (64%), Gaps = 17/154 (11%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC----GSIKIRA  730
              ELLVKLGE+ G SV LRCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KIRA
Sbjct  45   FAELLVKLGELCGKSVCLRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRA  104

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLSPPKS KK SPPP S +SS  S +        +A RF   +      HQ+S       
Sbjct  105  FLSPPKSIKKISPPPSSASSSQLSVA--------SASRFTMPAAVDLCHHQISP----QV  152

Query  549  SYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             ++K   + P   +H+  GN  H+YLIH+GN+WQ
Sbjct  153  PFQKSSRKVPHYGYHV-HGNPSHVYLIHNGNHWQ  185


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S ++IKFLCSYGGKILPR+PDGKLRY+GGETRVL+VDR
Sbjct  3     TSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDR  41



>ref|XP_011086639.1| PREDICTED: uncharacterized protein LOC105168308 [Sesamum indicum]
Length=216

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 100/168 (60%), Gaps = 22/168 (13%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKI  736
              ELLVK+GEM G+SVSLRCQLP EDLDALVSITSDEDL NLIEEYDR        S+KI
Sbjct  53   FAELLVKMGEMCGSSVSLRCQLPTEDLDALVSITSDEDLDNLIEEYDRAATSAPSSSLKI  112

Query  735  RAFlsppkstkkgsppplstassstsnssmsprlPCTA---PRFLASSRGGKGIHQMSKL  565
            RAFLS PK+ KK SPPP S  S  +  S     L   A   PR+  S+   +   + S+ 
Sbjct  113  RAFLSAPKTIKKVSPPPSSAVSCCSDGSPPKSLLYSGAGVPPRYPTSAAYRRCYRRPSR-  171

Query  564  SVMSPSYEKRGGR-----PPQCAH----HLGAGNTGHIYLIHHGNYWQ  448
                P+Y   G +     P Q A+    H   GN GH YLIH+GN+WQ
Sbjct  172  ---PPAYPIVGAKSAGKIPHQYAYAYQCHNVHGNGGHAYLIHNGNHWQ  216


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -1

Query  1249  KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             K IKFLCSYGG+ILPR+PDGKLRY+GGETRVLSVD
Sbjct  14    KPIKFLCSYGGRILPRYPDGKLRYHGGETRVLSVD  48



>ref|XP_010100405.1| hypothetical protein L484_027716 [Morus notabilis]
 gb|EXB82539.1| hypothetical protein L484_027716 [Morus notabilis]
Length=201

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 96/154 (62%), Gaps = 9/154 (6%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRA  730
              EL++KL E+ GASVSLRCQLP EDLDALVSIT +EDL NLIEEYDR  S    +KIRA
Sbjct  53   FAELMLKLSELCGASVSLRCQLPTEDLDALVSITCEEDLVNLIEEYDRTASPPSALKIRA  112

Query  729  FlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSP  550
            FLSPPKS KK SPPP S +SSS+  ++        AP F    R  + I         + 
Sbjct  113  FLSPPKSIKKISPPPSSASSSSSHGTAPISTPRSPAPAFCDHHRCLRQIAPQMAFQKSAA  172

Query  549  SYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            +     G+ P  A+H   G  GHIYLIH+GN+WQ
Sbjct  173  A----AGKVPYYAYH-ANGTPGHIYLIHNGNHWQ  201


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = -1

Query  1270  MAGPSS------TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GP+S        +IKFLCSYGGKILPR+PDGKLRY GGETRVL+VDR
Sbjct  1     MVGPNSLDKIKPITTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVDR  49



>emb|CDP13224.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 102/178 (57%), Gaps = 28/178 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG---------S  745
             +EL++KLGEM GASVSLRCQLP ED+DALVSITSDEDLANLIEEYD            +
Sbjct  60   FSELVMKLGEMCGASVSLRCQLPTEDMDALVSITSDEDLANLIEEYDLAAVSASPTTNNA  119

Query  744  IKIRAFlsppkstkkgsppplstassstsnssmsprlPCT-AP----------RFLASSR  598
            +KIRAFLS P         P  + +S +++S+ +     + AP          R + S+ 
Sbjct  120  LKIRAFLSTPYKPTTKKSSPSHSIASFSTSSNEATSPVYSPAPAASPSLISFRRPIKSAA  179

Query  597  GGKGIHQ-MSKLSVMSP----SYEKRG--GRPPQCAHHLGAGN-TGHIYLIHHGNYWQ  448
              + +HQ MS+ +V  P    +YEK    G P     + G G  + H+YLI HGN+WQ
Sbjct  180  TDRCVHQIMSRPAVAYPHPLMTYEKAAAKGLPHHQYVYCGPGKASSHVYLIQHGNHWQ  237


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SS  +IKFLCSYGGKILPR+PDGKLRY GGETRVL+V+R
Sbjct  18    SSPTTIKFLCSYGGKILPRYPDGKLRYNGGETRVLAVER  56



>gb|KHN14532.1| hypothetical protein glysoja_027141 [Glycine soja]
Length=212

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 99/168 (59%), Gaps = 23/168 (14%)
 Frame = -2

Query  891  ELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAFlspp  715
            +LL+KL E+ GASV  LRCQLP+EDLDALVSITSDEDLANLIEEY+R  S+KIRAFLSPP
Sbjct  42   QLLLKLEELCGASVRHLRCQLPSEDLDALVSITSDEDLANLIEEYNRVSSLKIRAFLSPP  101

Query  714  kstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKG-------------IHQM  574
               +  +    + + S++ +SS +     ++  +  +  G  G             +HQM
Sbjct  102  TPPRSPNKFSTAPSKSASISSSSASSSSSSSSYYSPTGSGESGRRYRAPALVSDCCVHQM  161

Query  573  SKLSVMSPSYE--KRGGR----PPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            S+        E  K  GR    P    HH   GN GH+YLIH+GN+WQ
Sbjct  162  SQPPAYPVGMEKSKSSGRNVPLPRYGYHH---GNGGHVYLIHNGNHWQ  206



>ref|XP_002312673.2| octicosapeptide/Phox/Bem1p domain-containing family protein [Populus 
trichocarpa]
 gb|EEE90040.2| octicosapeptide/Phox/Bem1p domain-containing family protein [Populus 
trichocarpa]
Length=191

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 89/156 (57%), Gaps = 30/156 (19%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKI  736
              ELL+KLG++ G SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR G      S+KI
Sbjct  60   FAELLLKLGDLCGTSVSLRCQLPKEDLDALVSITSDEDLANLIEEYDRAGAATPTASLKI  119

Query  735  RAFlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVM  556
            RAFLS PK     S    S++SSS+S                +S     G     K +  
Sbjct  120  RAFLSLPKKIYSSSSKSSSSSSSSSSP---------------SSPSNSYGAFSSKKKTPP  164

Query  555  SPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             P Y        Q  +H   GN GHIYL+H+GN+WQ
Sbjct  165  PPQY--------QYGYH-AHGNPGHIYLVHNGNHWQ  191


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  1300  FVSPKSEETDM---AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              V P  + T +   A  S+  +IKFLCSYGGKI+PR PDGKLRY GGETRV+ VDR
Sbjct  1     MVGPSLDTTKLHLKAPSSAPATIKFLCSYGGKIIPRFPDGKLRYQGGETRVIGVDR  56



>ref|XP_009791882.1| PREDICTED: uncharacterized protein LOC104239050 [Nicotiana sylvestris]
Length=233

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 107/177 (60%), Gaps = 30/177 (17%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKIRA  730
            EL+VKL EM GA  +LRCQLP EDLDALVSITSDEDL NLIEEYDR        S+KIRA
Sbjct  58   ELMVKLREMCGAMSTLRCQLPTEDLDALVSITSDEDLVNLIEEYDRAATASPSSSLKIRA  117

Query  729  Flsppkstkkgsppplstassstsns--------smsprlPCTA-----PRFLASS--RG  595
            FLSPPKSTKK    P STASSS++ +        + SP+  CT      P  + SS  RG
Sbjct  118  FLSPPKSTKKVVSSPSSTASSSSTTTNTTSSNCDANSPKSFCTTAAASPPTTVTSSWYRG  177

Query  594  GKGIHQMSKLSVMSPS-------YEKRGGRPPQCAHHLGAGNT-GHIYLIHHGNYWQ  448
                ++M     M+         Y+K  G+ PQ  +H G GNT  HIYLIHHGN+ Q
Sbjct  178  QVNYNEMCVRQTMAKPQMVVPLCYQKAAGKLPQHTYH-GLGNTSSHIYLIHHGNHRQ  233


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + +IKFL SYGGKILPRHPDGKLRYYGG TRVLSV R
Sbjct  16    STNIKFLSSYGGKILPRHPDGKLRYYGGYTRVLSVHR  52



>gb|KDP26661.1| hypothetical protein JCGZ_17819 [Jatropha curcas]
Length=201

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAFlsp  718
             +ELL+KLGE+ G  VSLRCQLP EDLDALVSITSDEDLANLIEEYDR    KIRAFLS 
Sbjct  59   FSELLLKLGELSGTRVSLRCQLPKEDLDALVSITSDEDLANLIEEYDRAAIPKIRAFLSM  118

Query  717  pkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSPSYEK  538
            PK        P ST +SS+S+S  +           AS+   +  HQ+SK  V    Y  
Sbjct  119  PKKISPPPSSPSSTTTSSSSSSPSNSYAATIGST--ASTSKPRCYHQISKPVV----YPV  172

Query  537  RGGRPPQCAHHLGA-GNTGHIYLIHHGNYWQ  448
            +   PP  A++ G  GN+ +  ++H+GN+WQ
Sbjct  173  KKILPP--AYYYGYHGNSSYACMVHNGNHWQ  201


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             IKFLCSYGGKI+PR+PDGKLRY+GGETRVL+VDR
Sbjct  22    IKFLCSYGGKIIPRYPDGKLRYHGGETRVLAVDR  55



>ref|XP_010248639.1| PREDICTED: uncharacterized protein LOC104591494 [Nelumbo nucifera]
Length=226

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 105/172 (61%), Gaps = 29/172 (17%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---------  745
             +ELLVKLGE+ G+SVSLRCQLP EDLDALVS+TSDEDLANLIEEYDR  +         
Sbjct  62   FSELLVKLGELCGSSVSLRCQLPNEDLDALVSVTSDEDLANLIEEYDRASTNRDRGASSR  121

Query  744  --IKIRAFlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGG-------  592
              +KIRAFLSPPKS K+ SPPP +++S+++S  +        A + L S  G        
Sbjct  122  PHLKIRAFLSPPKSIKQISPPPSASSSTTSSFEAR------AASKSLNSVAGSYSPTPTM  175

Query  591  ---KGIHQMSKLSVMSPSY-EKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
               + +H +    +  P Y EK  G+     +H   GN G IYL+H+GN+WQ
Sbjct  176  VIDRCVHHICNTPLGFPVYLEKPVGKHHYYCYH-AQGNHGGIYLVHNGNHWQ  226


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++K+LCSYGGKILPR PDGKLRY GGETRVL+VDR
Sbjct  24    TVKYLCSYGGKILPRFPDGKLRYVGGETRVLAVDR  58



>ref|XP_004309978.1| PREDICTED: uncharacterized protein LOC101302228 [Fragaria vesca 
subsp. vesca]
Length=201

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 8/155 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRA  730
             +ELL+KLGE+ G +V LRCQLP EDLDAL+SI  DEDLANLIEEYDR  +    +KIRA
Sbjct  50   FSELLLKLGELCGTTVGLRCQLPTEDLDALISIKCDEDLANLIEEYDRAAAAATPLKIRA  109

Query  729  FlsppkstkkgsppplstassstsnssmsprlPC-TAPRFLASSRGGKGIHQMSKLSVMS  553
            FLS P +    SPP  S +SS +S+S+ S      + PRF       + + Q+S     +
Sbjct  110  FLSLPVNKTTSSPPSSSASSSKSSSSNHSTTCASGSTPRFSLPLPAERCLRQVSH---SA  166

Query  552  PSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            P      G+ P C ++    N   +YL+H+GN+WQ
Sbjct  167  PFQRAPAGKAPHCDNYHTHRNPSRLYLVHNGNHWQ  201


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = -1

Query  1270  MAGPSS--TK-SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS+  TK ++KFLCSY GKILPR+PDGKLRY GGETRVL+V R
Sbjct  1     MVGPSADPTKLALKFLCSYSGKILPRYPDGKLRYLGGETRVLAVHR  46



>ref|XP_006438264.1| hypothetical protein CICLE_v10032769mg [Citrus clementina]
 ref|XP_006483946.1| PREDICTED: uncharacterized protein LOC102614073 isoform X1 [Citrus 
sinensis]
 ref|XP_006483947.1| PREDICTED: uncharacterized protein LOC102614073 isoform X2 [Citrus 
sinensis]
 gb|ESR51504.1| hypothetical protein CICLE_v10032769mg [Citrus clementina]
 gb|KDO82230.1| hypothetical protein CISIN_1g028739mg [Citrus sinensis]
 gb|KDO82231.1| hypothetical protein CISIN_1g028739mg [Citrus sinensis]
 gb|KDO82232.1| hypothetical protein CISIN_1g028739mg [Citrus sinensis]
Length=204

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 91/162 (56%), Gaps = 18/162 (11%)
 Frame = -2

Query  897  ITELLVKLGEMYGA--SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKI  736
             TELL+KLGEM GA  SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR      S+KI
Sbjct  49   FTELLLKLGEMCGATVSVSLRCQLPTEDLDALVSITSDEDLANLIEEYDRVASPPSSLKI  108

Query  735  RAFlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVM  556
            RAFLS PK     +    S++SS++S+   S     +              H  +   V 
Sbjct  109  RAFLSLPKKISSPTSSSSSSSSSASSSPKSSTTTAPSTSVTRCHC------HVPAAAPVA  162

Query  555  SPSYEKRGGRPPQCAHH------LGAGNTGHIYLIHHGNYWQ  448
            SP   K+       AHH         GN   IYLIH+GNYWQ
Sbjct  163  SPLCLKKSAAKHITAHHPPHYGYYAHGNPSRIYLIHNGNYWQ  204


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 2/45 (4%)
 Frame = -1

Query  1270  MAGPS--STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MAGPS  +T +IKFLCSYGGKILPR+PDGKLRY+GGETR+LSV R
Sbjct  1     MAGPSLDTTTTIKFLCSYGGKILPRYPDGKLRYHGGETRMLSVHR  45



>ref|XP_011045257.1| PREDICTED: uncharacterized protein LOC105140217 [Populus euphratica]
Length=215

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 89/158 (56%), Gaps = 17/158 (11%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC-------GSIK  739
              ELL+KLGE+ G SV+LRCQLP EDLDALVSITS EDLANLIEEYDR         S+K
Sbjct  60   FAELLLKLGELCGTSVNLRCQLPKEDLDALVSITSGEDLANLIEEYDRAAGAATPTASLK  119

Query  738  IRAFlsppkstkkgsppplstassstsns-smsprlPCTAPRFLASSRGGKGIHQMSKLS  562
            IRAFLS PK     S    S++SSS+ +    +     TAP            HQ+SK  
Sbjct  120  IRAFLSLPKKISSSSSSSSSSSSSSSCSYGGPTIASTSTAPWCYH--------HQISKPV  171

Query  561  VMSPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
              S           Q  +H   GN  H+YL+H+GN+WQ
Sbjct  172  AFSVRKTPPAPHQYQYGYH-AHGNPSHVYLVHNGNHWQ  208


 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+T +IKFLCSYGGKI+PR PDGKLRY+GGETRVL V+R
Sbjct  18    SATPTIKFLCSYGGKIIPRFPDGKLRYHGGETRVLGVER  56



>ref|XP_008221912.1| PREDICTED: uncharacterized protein LOC103321846 [Prunus mume]
Length=222

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 99/175 (57%), Gaps = 28/175 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV--SLRCQLPAEDLDALVSITSDEDLANLIEEYDRC---------  751
             +ELL+KLGE+ G SV  SLRCQLPAEDLD LVSI SDEDLANLIEEYDR          
Sbjct  51   FSELLLKLGELCGPSVTVSLRCQLPAEDLDTLVSIKSDEDLANLIEEYDRAAASASPPPF  110

Query  750  GSIKIRAFlsppkstkkgsppplstassstsnssmsprlPC-----------TAPRF-LA  607
             ++KIRAFLS        +P    ++S+S S +S S                + PRF +A
Sbjct  111  ANLKIRAFLSLVPPKPYKTPSSTQSSSASASTTSSSGTSSSSNYYYSAAASGSTPRFPMA  170

Query  606  SSRGGKGIHQMSKLSVMSPSYEKRGGRPPQCAH--HLGAGNTGHIYLIHHGNYWQ  448
            S+   + + Q+S+ +     ++K   + P CA+  H     +  +YLIH+GN+WQ
Sbjct  171  STPVDRCVRQISQTTT---PFQKSAAKVPHCANICHAHGSPSSRLYLIHNGNHWQ  222


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             P+   +IKFLCSYGGKILPR+PDGKLRY GGETRVL+V R
Sbjct  8     PTKPSTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVHR  47



>ref|XP_009800609.1| PREDICTED: uncharacterized protein LOC104246493 [Nicotiana sylvestris]
Length=262

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  906  CGVITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
            C    EL+VKLGEM GASVSLRCQLP EDLDALVSIT DEDLANLIEEYD   ++KIRAF
Sbjct  47   CISFAELMVKLGEMCGASVSLRCQLPNEDLDALVSITCDEDLANLIEEYDHASTLKIRAF  106


 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = -1

Query  1270  MAGPSSTKS---IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS       +KFLCSYGGKI+PRH DGKLRYYGGETRVLSV R
Sbjct  1     MVGPSINSRNVPLKFLCSYGGKIIPRHTDGKLRYYGGETRVLSVHR  46



>gb|EPS67466.1| hypothetical protein M569_07308, partial [Genlisea aurea]
Length=121

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
              EL VKL EM G  VSLRCQLPAEDLDALVS+TSDEDLANLIEEYDR  S+KIRAF
Sbjct  41   FAELSVKLAEMCGTPVSLRCQLPAEDLDALVSVTSDEDLANLIEEYDRASSLKIRAF  97


 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T+++KFLCSYGG+ILPR+PDGKLRY+GGETRVLSV R
Sbjct  1     TENLKFLCSYGGRILPRYPDGKLRYHGGETRVLSVGR  37



>ref|XP_002315668.2| hypothetical protein POPTR_0010s05640g [Populus trichocarpa]
 gb|EEF01839.2| hypothetical protein POPTR_0010s05640g [Populus trichocarpa]
Length=216

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 92/160 (58%), Gaps = 20/160 (13%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC-------GSIK  739
              ELL+KLGE+ G SV+LRCQLP EDLDALVSITS EDLANLIEEYDR         S+K
Sbjct  60   FAELLLKLGELRGTSVNLRCQLPKEDLDALVSITSGEDLANLIEEYDRAAGAATPTASLK  119

Query  738  IRAFlsppkstkkgsppplstassstsnss--msprlPCTAPRFLASSRGGKGIHQMSKL  565
            IRAFLS PK     S    S++SSS+S S    +     TAP            HQ+SK 
Sbjct  120  IRAFLSFPKKISSSSSSSSSSSSSSSSCSYGGPTIGSTSTAPWCYH--------HQISKP  171

Query  564  SVMSPSYEKRGGRPPQCAHHLGA-GNTGHIYLIHHGNYWQ  448
                 S  K    P Q  +   A GN  H+YL+H+GN+WQ
Sbjct  172  VAF--SVRKTPPAPHQYEYGYHAHGNPSHVYLVHNGNHWQ  209


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+T +IKFLCSYGGKI+PR PDGKLRY+GGETRVL V+R
Sbjct  18    SATPTIKFLCSYGGKIIPRFPDGKLRYHGGETRVLGVER  56



>ref|XP_010044567.1| PREDICTED: uncharacterized protein LOC104433500 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010044568.1| PREDICTED: uncharacterized protein LOC104433500 isoform X1 [Eucalyptus 
grandis]
Length=210

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 97/170 (57%), Gaps = 28/170 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC--GSIKIRAFl  724
             +EL+ K+GE+ GA+VSLRCQLP EDLDAL+SITSDEDL NL+EEYDR    S+KIRAFL
Sbjct  49   FSELMSKMGELCGAAVSLRCQLPTEDLDALISITSDEDLVNLVEEYDRSPPSSLKIRAFL  108

Query  723  sppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQM----------  574
              PK  KK SPPP    SS TS+SS S     T     ++ R  K +HQ           
Sbjct  109  FLPKPGKKTSPPPSLAFSSRTSSSSSSSLSAATV-TVGSTPRFSKCVHQYMEKPKPVGFP  167

Query  573  --------SKLSVMSPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                    +   +M  SY    G       H   GN GH++LIH+GN+WQ
Sbjct  168  LCKGKSAGNNRMMMMMSYHHYQG-------HCAYGNPGHVHLIHNGNHWQ  210


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = -1

Query  1270  MAGP--SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GP  ++  +IKFLCSYGGKILPRHPDGKLRY GGETRVL+VDR
Sbjct  1     MVGPPAAAATTIKFLCSYGGKILPRHPDGKLRYVGGETRVLAVDR  45



>gb|KCW86656.1| hypothetical protein EUGRSUZ_B03284, partial [Eucalyptus grandis]
Length=240

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 99/170 (58%), Gaps = 28/170 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC--GSIKIRAFl  724
             +EL+ K+GE+ GA+VSLRCQLP EDLDAL+SITSDEDL NL+EEYDR    S+KIRAFL
Sbjct  79   FSELMSKMGELCGAAVSLRCQLPTEDLDALISITSDEDLVNLVEEYDRSPPSSLKIRAFL  138

Query  723  sppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQM----------  574
              PK  KK SPPP    SS TS+SS S     T     ++ R  K +HQ           
Sbjct  139  FLPKPGKKTSPPPSLAFSSRTSSSSSSSLSAATV-TVGSTPRFSKCVHQYMEKPKPVGFP  197

Query  573  --------SKLSVMSPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                    +   +M  SY    G    CA+    GN GH++LIH+GN+WQ
Sbjct  198  LCKGKSAGNNRMMMMMSYHHYQG---HCAY----GNPGHVHLIHNGNHWQ  240


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  1276  TDMAGP--SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
               M GP  ++  +IKFLCSYGGKILPRHPDGKLRY GGETRVL+VDR
Sbjct  29    ASMVGPPAAAATTIKFLCSYGGKILPRHPDGKLRYVGGETRVLAVDR  75



>ref|XP_004239130.1| PREDICTED: uncharacterized protein LOC101267605 isoform X2 [Solanum 
lycopersicum]
Length=202

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI----KIRA  730
             TELLVKLGEM G+SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR   I    K+RA
Sbjct  50   FTELLVKLGEMCGSSVSLRCQLPNEDLDALVSITSDEDLANLIEEYDRVSKISSFLKMRA  109

Query  729  F  727
            F
Sbjct  110  F  110


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGGKI+PR  DGKLRYYGGETRVLSVDR
Sbjct  13    LKFLCSYGGKIIPRQTDGKLRYYGGETRVLSVDR  46



>ref|XP_010320935.1| PREDICTED: uncharacterized protein LOC101267605 isoform X1 [Solanum 
lycopersicum]
Length=236

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 51/61 (84%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI----KIRA  730
             TELLVKLGEM G+SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR   I    K+RA
Sbjct  50   FTELLVKLGEMCGSSVSLRCQLPNEDLDALVSITSDEDLANLIEEYDRVSKISSFLKMRA  109

Query  729  F  727
            F
Sbjct  110  F  110


 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGGKI+PR  DGKLRYYGGETRVLSVDR
Sbjct  13    LKFLCSYGGKIIPRQTDGKLRYYGGETRVLSVDR  46



>ref|XP_007223945.1| hypothetical protein PRUPE_ppa011128mg [Prunus persica]
 gb|EMJ25144.1| hypothetical protein PRUPE_ppa011128mg [Prunus persica]
Length=222

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 98/175 (56%), Gaps = 28/175 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV--SLRCQLPAEDLDALVSITSDEDLANLIEEYDRC---------  751
             +ELL+KLGE+ G SV  SLRCQLP EDLDALVSI SDEDLANLIEEYDR          
Sbjct  51   FSELLLKLGELCGPSVTVSLRCQLPTEDLDALVSIKSDEDLANLIEEYDRAAASASPPPF  110

Query  750  GSIKIRAFlsppkstkkgsppplstassstsnssmsprlPC-----------TAPRF-LA  607
             ++KIRAFLS        +P    ++S+S S +S S                + PRF + 
Sbjct  111  ANLKIRAFLSLVPPKPHKTPSSTPSSSASASTTSSSGTSSSSNYYYSAAASGSTPRFPMV  170

Query  606  SSRGGKGIHQMSKLSVMSPSYEKRGGRPPQCAH--HLGAGNTGHIYLIHHGNYWQ  448
            S+   + + Q+S+ +     ++K   + P CA+  H     +  +YLIH+GN+WQ
Sbjct  171  STPVDRCVRQISQATT---PFQKSAAKVPHCANICHAHGSPSSRLYLIHNGNHWQ  222


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             P+   +IKFLCSYGGKILPR+PDGKLRY GGETRVL+V R
Sbjct  8     PTKPSTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVHR  47



>ref|XP_010646760.1| PREDICTED: uncharacterized protein LOC100242640 isoform X2 [Vitis 
vinifera]
Length=187

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC----GSIKIRA  730
              ELLVKLGE+ G SV LRCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KIRA
Sbjct  55   FAELLVKLGELCGKSVCLRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRA  114

Query  729  F  727
            F
Sbjct  115  F  115


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S ++IKFLCSYGGKILPR+PDGKLRY+GGETRVL+VDR
Sbjct  13    TSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDR  51



>ref|XP_002271639.2| PREDICTED: uncharacterized protein LOC100242640 isoform X1 [Vitis 
vinifera]
Length=188

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 49/61 (80%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC----GSIKIRA  730
              ELLVKLGE+ G SV LRCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KIRA
Sbjct  55   FAELLVKLGELCGKSVCLRCQLPTEDLDALVSVTSDEDLANLIEEYDRVASPPASLKIRA  114

Query  729  F  727
            F
Sbjct  115  F  115


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S ++IKFLCSYGGKILPR+PDGKLRY+GGETRVL+VDR
Sbjct  13    TSNQTIKFLCSYGGKILPRYPDGKLRYHGGETRVLAVDR  51



>ref|XP_006357601.1| PREDICTED: uncharacterized protein LOC102581671 [Solanum tuberosum]
Length=235

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI----KIRAF  727
            ELL+KLGEM G++VSLRCQLP EDLDALVSITSDEDL NLIEEYD   +I    KIRAF
Sbjct  52   ELLLKLGEMSGSTVSLRCQLPNEDLDALVSITSDEDLVNLIEEYDHVSTISSFLKIRAF  110


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = -1

Query  1270  MAGPSSTKS---IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M  PS+      +KFLCSYGGKI+PR  DGKLRYYGGETRVLSVDR
Sbjct  1     MVSPSNNSHNFPLKFLCSYGGKIMPRQTDGKLRYYGGETRVLSVDR  46



>ref|XP_010044569.1| PREDICTED: uncharacterized protein LOC104433500 isoform X2 [Eucalyptus 
grandis]
Length=175

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC--GSIKIRAF  727
             +EL+ K+GE+ GA+VSLRCQLP EDLDAL+SITSDEDL NL+EEYDR    S+KIRAF
Sbjct  49   FSELMSKMGELCGAAVSLRCQLPTEDLDALISITSDEDLVNLVEEYDRSPPSSLKIRAF  107


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = -1

Query  1270  MAGP--SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GP  ++  +IKFLCSYGGKILPRHPDGKLRY GGETRVL+VDR
Sbjct  1     MVGPPAAAATTIKFLCSYGGKILPRHPDGKLRYVGGETRVLAVDR  45



>ref|XP_010251065.1| PREDICTED: uncharacterized protein LOC104593086 isoform X2 [Nelumbo 
nucifera]
Length=200

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 50/67 (75%), Gaps = 12/67 (18%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------------  748
            ELLVKLGE+ G+SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR              
Sbjct  61   ELLVKLGELCGSSVSLRCQLPTEDLDALVSITSDEDLANLIEEYDRANMSRDRETSSAPP  120

Query  747  SIKIRAF  727
             +KIRAF
Sbjct  121  QLKIRAF  127


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -1

Query  1282  EETDMAGPSST--KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  D+A  ++    ++KFLCSYGGKILPR+PDGKLRY GG+TRVL+VDR
Sbjct  7     QSNDVAAKTANINNTVKFLCSYGGKILPRYPDGKLRYVGGDTRVLAVDR  55



>ref|XP_010251064.1| PREDICTED: uncharacterized protein LOC104593086 isoform X1 [Nelumbo 
nucifera]
Length=223

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 50/69 (72%), Gaps = 12/69 (17%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----------  748
              ELLVKLGE+ G+SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR            
Sbjct  59   FAELLVKLGELCGSSVSLRCQLPTEDLDALVSITSDEDLANLIEEYDRANMSRDRETSSA  118

Query  747  --SIKIRAF  727
               +KIRAF
Sbjct  119  PPQLKIRAF  127


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -1

Query  1282  EETDMAGPSST--KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  D+A  ++    ++KFLCSYGGKILPR+PDGKLRY GG+TRVL+VDR
Sbjct  7     QSNDVAAKTANINNTVKFLCSYGGKILPRYPDGKLRYVGGDTRVLAVDR  55



>ref|XP_007158399.1| hypothetical protein PHAVU_002G149800g [Phaseolus vulgaris]
 gb|ESW30393.1| hypothetical protein PHAVU_002G149800g [Phaseolus vulgaris]
Length=213

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 93/152 (61%), Gaps = 17/152 (11%)
 Frame = -2

Query  861  GASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAFlsppkstkkgsppp  685
            GASV  LRCQLP+EDLDAL+SITSDEDLANLIEEYDR  S+KIRAFLSPP+ST   S  P
Sbjct  65   GASVRHLRCQLPSEDLDALISITSDEDLANLIEEYDRLSSLKIRAFLSPPRSTNNASISP  124

Query  684  lstassstsnssmsprlPCTAPRFLASSRGGKG--------IHQMSKLSVMSPSYEKR--  535
              +AS S+S++S S        +   + R  +         +HQMS       + EK   
Sbjct  125  SKSASLSSSSASSSSSSSSYCSQTGRAGRSDRTSAPVVDRCVHQMSPAQAYRVAVEKSKP  184

Query  534  GGRP---PQCAHHLGAGNTGHIYLIHHGNYWQ  448
             GR    P+  +H   G+ G +YL+H+GN+WQ
Sbjct  185  SGRNIPLPRYGYH---GSGGQVYLVHNGNHWQ  213


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -1

Query  1288  KSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S +     P ST  IKFLCSYGG+ILPR+PDGKLRY GG TRVL+VDR
Sbjct  3     RSAQPASKPPQST--IKFLCSYGGRILPRYPDGKLRYLGGHTRVLAVDR  49



>ref|XP_010552677.1| PREDICTED: uncharacterized protein LOC104822988 [Tarenaya hassleriana]
Length=161

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-KIRAFlspp  715
            EL+ KLG M G + SLRCQLPAEDLDAL+++TSDEDLANL++EYD+  S  KIRAFLSP 
Sbjct  47   ELMTKLGVMCGMATSLRCQLPAEDLDALITVTSDEDLANLMDEYDKASSAPKIRAFLSPI  106

Query  714  kstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSPSYEKR  535
            KS                                 A  RGGK +  + + +    SY   
Sbjct  107  KSADGKKTSA-------------------------AKQRGGKCVLCLGRWAERMRSY---  138

Query  534  GGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
             GR   C           +YLIH+GN+WQ
Sbjct  139  -GRDAHCHR-----EPTLLYLIHNGNHWQ  161


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             P+   ++KFLCSYGG+ILPR+PDG  RY+GG TRVLS+ R
Sbjct  2     PNPPATVKFLCSYGGRILPRYPDGNFRYHGGNTRVLSLPR  41



>ref|XP_008466906.1| PREDICTED: uncharacterized protein LOC103504254, partial [Cucumis 
melo]
Length=144

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 49/62 (79%), Gaps = 6/62 (10%)
 Frame = -2

Query  894  TELLVKLGEMYGASVS--LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIR  733
            TELL+K GE+ G S+S   RCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KIR
Sbjct  12   TELLLKFGELCGTSISVTFRCQLPREDLDALVSVTSDEDLANLIEEYDRAASPSSSLKIR  71

Query  732  AF  727
            AF
Sbjct  72   AF  73



>gb|EYU30635.1| hypothetical protein MIMGU_mgv1a014466mg [Erythranthe guttata]
Length=188

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD-----RCGSIKIR  733
             +ELL K+GE+ G++V+LRCQLPAEDLDALVS+TSDEDLA+LIEEYD         IKIR
Sbjct  42   FSELLAKMGEICGSTVNLRCQLPAEDLDALVSVTSDEDLAHLIEEYDCAAAAAAAPIKIR  101

Query  732  AFlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMS  553
            AFLS PK+  K SPP    + S      M PR P +A R    S     +       V+S
Sbjct  102  AFLSAPKTINKVSPPKSPYSYSVGGGGGMPPRCPTSAGRRCLRS----AVRPAPAYPVLS  157

Query  552  PSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                K GGR P   ++  + N   ++LIH+GN WQ
Sbjct  158  ---GKIGGRIPN-QYNSVSRNGCLVHLIHNGNQWQ  188


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
              + IKFLCSYGG+ILPR+PDGKLRY GGETRVLSVD
Sbjct  2     VRPIKFLCSYGGRILPRYPDGKLRYNGGETRVLSVD  37



>ref|XP_010682446.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682447.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682448.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682449.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682450.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682451.1| PREDICTED: uncharacterized protein LOC104897290 [Beta vulgaris 
subsp. vulgaris]
Length=198

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC---GSIKIRAF  727
             +EL+VK+GE+ G SVSL+CQLP EDLDAL++I S+EDLANLIEEYDR     S+K+RAF
Sbjct  56   FSELMVKMGEVCGTSVSLKCQLPTEDLDALITIKSEEDLANLIEEYDRVDSSSSMKVRAF  115


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+  +IKFLCSYGGKI+PRHPDGKLRY+GG TRVL++ R
Sbjct  14    STNNTIKFLCSYGGKIVPRHPDGKLRYHGGHTRVLALHR  52



>ref|XP_004142964.1| PREDICTED: uncharacterized protein LOC101207008 [Cucumis sativus]
 ref|XP_004161059.1| PREDICTED: uncharacterized LOC101207008 [Cucumis sativus]
 gb|KGN62323.1| hypothetical protein Csa_2G349080 [Cucumis sativus]
Length=189

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS--VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKI  736
             +ELL+K GE+ G S  VS RCQLP EDLDALVS+TSDEDLANLIEEYDR      S+KI
Sbjct  56   FSELLLKFGELCGTSTSVSFRCQLPREDLDALVSVTSDEDLANLIEEYDRAASPSSSMKI  115

Query  735  RAF  727
            RAF
Sbjct  116  RAF  118


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T +IKFLCSYGGKILPR+PDGKLRY+GGETR+LSV+R
Sbjct  16    TPTIKFLCSYGGKILPRYPDGKLRYHGGETRLLSVNR  52



>ref|XP_006438263.1| hypothetical protein CICLE_v10032769mg [Citrus clementina]
 gb|ESR51503.1| hypothetical protein CICLE_v10032769mg [Citrus clementina]
 gb|KDO82233.1| hypothetical protein CISIN_1g028739mg [Citrus sinensis]
Length=146

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 81/146 (55%), Gaps = 16/146 (11%)
 Frame = -2

Query  855  SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIRAFlsppkstkkgspp  688
            SVSLRCQLP EDLDALVSITSDEDLANLIEEYDR      S+KIRAFLS PK     +  
Sbjct  7    SVSLRCQLPTEDLDALVSITSDEDLANLIEEYDRVASPPSSLKIRAFLSLPKKISSPTSS  66

Query  687  plstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSPSYEKRGGRPPQCAH  508
              S++SS++S+   S           ++S      H  +   V SP   K+       AH
Sbjct  67   SSSSSSSASSSPKSSTT------TAPSTSVTRCHCHVPAAAPVASPLCLKKSAAKHITAH  120

Query  507  H------LGAGNTGHIYLIHHGNYWQ  448
            H         GN   IYLIH+GNYWQ
Sbjct  121  HPPHYGYYAHGNPSRIYLIHNGNYWQ  146



>gb|KHN00396.1| hypothetical protein glysoja_000064 [Glycine soja]
Length=207

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 86/148 (58%), Gaps = 15/148 (10%)
 Frame = -2

Query  861  GASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAFlsppkstkkgsppp  685
            GASV  LRCQLP+EDLDALVSITSDEDLANLIEEYDR  S+KIRAFLSPP   +  +   
Sbjct  65   GASVRHLRCQLPSEDLDALVSITSDEDLANLIEEYDRVSSLKIRAFLSPPTPPRSPNKFS  124

Query  684  lstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSV-------MSPSYE--KRG  532
             + + S++ +SS +     ++  +  +  G  G    +   V       MSP  E  K  
Sbjct  125  TAPSKSASISSSSASSSSSSSSYYSPTGSGESGRRYRAPALVSDCCVHQMSPGVEKSKSS  184

Query  531  GRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            GR      +      GH+Y+IH+GN+WQ
Sbjct  185  GRNIPLPRY-----GGHVYMIHNGNHWQ  207


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = -1

Query  1270  MAGPSSTKS------IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GP+ T S      +KFLCSYGGKIL R+PDGKLRY GG T VL+VDR
Sbjct  1     MFGPTQTASQPPKSTLKFLCSYGGKILLRYPDGKLRYLGGHTCVLAVDR  49



>gb|EYU22530.1| hypothetical protein MIMGU_mgv1a011936mg [Erythranthe guttata]
Length=266

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 49/69 (71%), Gaps = 12/69 (17%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR------------  754
             TEL+ KL EM G +VSLRCQLP EDLDAL+SITSDEDLANL+EEYDR            
Sbjct  90   FTELMAKLVEMCGTTVSLRCQLPMEDLDALISITSDEDLANLVEEYDRAAAAAAAAPPSP  149

Query  753  CGSIKIRAF  727
              S+KIRAF
Sbjct  150  PSSLKIRAF  158


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 7/53 (13%)
 Frame = -1

Query  1279  ETDMAGPS-------STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             E  M GPS       + K IKFLCSYGG+ILPR+PDGKLRY+GG+TRVLSVDR
Sbjct  34    EESMVGPSLNSQNLTTLKPIKFLCSYGGRILPRYPDGKLRYHGGDTRVLSVDR  86



>ref|XP_009152051.1| PREDICTED: uncharacterized protein LOC103875294 [Brassica rapa]
 emb|CDY13638.1| BnaA06g32850D [Brassica napus]
Length=181

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC-GSIKIRAF  727
             +EL  K+ EM+G++V++RCQLP EDLDALVSIT DEDLANLIEEYD    S+K+R F
Sbjct  44   FSELASKMAEMFGSAVTIRCQLPTEDLDALVSITCDEDLANLIEEYDLVSSSMKVRVF  101


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IK LCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  3     TNSTIKLLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  40



>ref|XP_008796584.1| PREDICTED: uncharacterized protein LOC103711999 [Phoenix dactylifera]
 ref|XP_008796585.1| PREDICTED: uncharacterized protein LOC103711999 [Phoenix dactylifera]
Length=218

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 79/161 (49%), Gaps = 22/161 (14%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
             +EL  KLGEM G  +V+LRCQLP EDLDALVS+TSDEDLANLIEEY     DR   +KI
Sbjct  69   FSELQGKLGEMCGWGAVNLRCQLPTEDLDALVSVTSDEDLANLIEEYDLASRDRLLPLKI  128

Query  735  RAFlsppkstkkgsppplstassstsnssmsprlPC-----TAPRFLASSRGGKGIHQMS  571
            RAFL PP +     P       SS +     P   C     +AP  L+S           
Sbjct  129  RAFLFPPPTKTPSPPSTPPMRKSSAAARPPLPADRCLLHQISAPSRLSSRPPPAAAAGNP  188

Query  570  KLSVMSPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            +       +    G P             H +L+HHGNYWQ
Sbjct  189  RFRHHHHHHHHHQGNP-----------RPHRFLVHHGNYWQ  218


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +IKFLCSYGGKILPR+PDGKLRY GG TRVL+VDR
Sbjct  31    TIKFLCSYGGKILPRYPDGKLRYVGGHTRVLAVDR  65



>gb|KFK41478.1| hypothetical protein AALP_AA2G136000 [Arabis alpina]
Length=175

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD---RCGSIKIRAF  727
             TELL KL ++YG+SV+ RCQLP +DLDALV++T+DEDL N++EEYD      S+KIRAF
Sbjct  48   FTELLRKLSDIYGSSVNFRCQLPTDDLDALVTVTTDEDLKNIMEEYDIDTTAQSLKIRAF  107


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGGKI+PRHPDGKLRY GG TRVLSV R
Sbjct  10    TVKFLCSYGGKIIPRHPDGKLRYQGGHTRVLSVPR  44



>ref|XP_003530626.1| PREDICTED: uncharacterized protein LOC100786933 [Glycine max]
Length=182

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 20/152 (13%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYD-RCGSIKIRAFl  724
             +E++VKL E+ GA V+ LRCQLP EDLDALVSIT DEDL NL+EEYD    S+KIRAFL
Sbjct  49   FSEVMVKLEELCGAHVTHLRCQLPTEDLDALVSITCDEDLNNLVEEYDGAVSSLKIRAFL  108

Query  723  sppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSPSY  544
                +  K S    S+ SSS+S+ S   R    AP  LA         + S +S+ SP Y
Sbjct  109  CSSPAPSKSSSTTSSSCSSSSSSPSSCCRTAMAAPPQLA---------KKSYVSLSSPRY  159

Query  543  EKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                      +H    GN G +YL+  GN+W 
Sbjct  160  Y---------SHPRVQGNRGVVYLVPSGNHWH  182


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = -1

Query  1270  MAGPSST--KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS +   ++KFLCSYGGKILPR PD KLRY+GG TRVL++ R
Sbjct  1     MVGPSPSHGNNLKFLCSYGGKILPRFPDSKLRYFGGHTRVLALPR  45



>emb|CDX83621.1| BnaC07g23610D [Brassica napus]
Length=181

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC-GSIKIRAF  727
             +EL  K+ EM G++V++RCQLP EDLDALVSIT DEDLANLIEEYD    S+KIR F
Sbjct  44   FSELASKMAEMCGSAVTIRCQLPTEDLDALVSITCDEDLANLIEEYDLVSSSVKIRVF  101


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  3     TNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  40



>ref|XP_006395550.1| hypothetical protein EUTSA_v10004963mg [Eutrema salsugineum]
 gb|ESQ32836.1| hypothetical protein EUTSA_v10004963mg [Eutrema salsugineum]
Length=190

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL  K+ EM G++V++RCQLP EDLDALVS+TSDEDLANLIEEYD   S     +KIR
Sbjct  47   FSELASKMAEMCGSTVTIRCQLPTEDLDALVSVTSDEDLANLIEEYDLVSSSSPSPMKIR  106

Query  732  AF  727
             F
Sbjct  107  VF  108


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
               +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  7     NSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>ref|XP_009129503.1| PREDICTED: uncharacterized protein LOC103854316 [Brassica rapa]
Length=179

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRAF  727
             +EL  K+ EM G++V++RCQLP EDLDALVS+TSDEDLANLIEEYD   S   +KIR F
Sbjct  44   FSELASKMTEMCGSTVTIRCQLPTEDLDALVSVTSDEDLANLIEEYDLVSSSSPMKIRVF  103


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  3     TNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  40



>ref|XP_009359215.1| PREDICTED: cell wall integrity and stress response component 
1-like [Pyrus x bretschneideri]
Length=232

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 97/182 (53%), Gaps = 32/182 (18%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV---SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKI  736
             +EL  KL E+ G SV   SLRCQLP EDLDALVSI SDEDL NLIEEYDR  S   +KI
Sbjct  51   FSELSSKLTELCGPSVTAVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAASSANLKI  110

Query  735  RAFlsppkstkkgsppplstassstsnssmsp------------rlPCTAPRF--LASSR  598
            RAFLS   + +        ++SS+++ S+ S                 + PRF   +SS 
Sbjct  111  RAFLSLIPAGRTPKSVSSPSSSSASAASTTSSSSSSSSSNNYFGAASGSTPRFPLPSSSP  170

Query  597  GGKGIHQMS-KLSVMSPSYEKRGGRPPQCAHHLGA----------GNTG-HIYLIHHGNY  454
              + + QM  + S  +  +++   + P CA+   A          G TG  +YL+H+GN+
Sbjct  171  VDRCLRQMPLQPSPSTVPFQRSPSKVPHCANIYHACHGHRNNNPTGTTGSRLYLVHNGNH  230

Query  453  WQ  448
            WQ
Sbjct  231  WQ  232


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = -1

Query  1270  MAGPS----STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MAGPS       +IK LCSYGGKILPR+PDGKLRY GGETRVL+V R
Sbjct  1     MAGPSPDLTKVTNIKLLCSYGGKILPRYPDGKLRYLGGETRVLAVPR  47



>ref|NP_001276270.1| uncharacterized protein LOC100810685 [Glycine max]
 gb|ACU20270.1| unknown [Glycine max]
Length=231

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = -2

Query  861  GASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
            GASV  LRCQLP+EDLDALVSITSDEDLANLIEEYDR  S+KIRAF
Sbjct  65   GASVRHLRCQLPSEDLDALVSITSDEDLANLIEEYDRVSSLKIRAF  110


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGGKILPR+PDGKLRY GG TR+L+VDR
Sbjct  15    TLKFLCSYGGKILPRYPDGKLRYLGGHTRILAVDR  49



>ref|XP_004241543.1| PREDICTED: uncharacterized protein LOC101267816 [Solanum lycopersicum]
Length=193

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
              EL+VK GE+YG+S+ L+C++P EDLD LVSIT DEDLAN+IEEYDR  +     +KIR
Sbjct  45   FAELMVKFGELYGSSMRLKCKMPTEDLDVLVSITCDEDLANVIEEYDRVSAMTNTEMKIR  104

Query  732  AF  727
            A 
Sbjct  105  AL  106


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              ST+ +KFL SYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  3     QSTQIVKFLYSYGGRILPRPSDGTLRYIGGFTRVLSVDR  41



>ref|XP_003517495.1| PREDICTED: uncharacterized protein LOC100810685 [Glycine max]
Length=231

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 1/46 (2%)
 Frame = -2

Query  861  GASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
            GASV  LRCQLP+EDLDALVSITSDEDLANLIEEYDR  S+KIRAF
Sbjct  65   GASVRHLRCQLPSEDLDALVSITSDEDLANLIEEYDRVSSLKIRAF  110


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGGKILPR+PDGKLRY GG TR+L+VDR
Sbjct  15    TLKFLCSYGGKILPRYPDGKLRYLGGHTRILAVDR  49



>ref|XP_008778142.1| PREDICTED: uncharacterized protein LOC103697973 [Phoenix dactylifera]
Length=207

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
             +EL  KL EM G  +VSLRCQLP EDLDALVSITSDEDLANL+EEY     DR G +KI
Sbjct  72   FSELRGKLEEMCGWGAVSLRCQLPTEDLDALVSITSDEDLANLLEEYDLASRDRVGPLKI  131

Query  735  RAF  727
            RAF
Sbjct  132  RAF  134


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  1282  EETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++  +   +   +IKFLCSYGGKILPR+PDGKLRY GG TRVL++DR
Sbjct  22    DDVSVKSAAGGSTIKFLCSYGGKILPRYPDGKLRYVGGHTRVLAIDR  68



>ref|XP_003613117.1| hypothetical protein MTR_5g032960 [Medicago truncatula]
 gb|AES96075.1| PB1 domain protein [Medicago truncatula]
Length=223

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 89/153 (58%), Gaps = 20/153 (13%)
 Frame = -2

Query  846  LRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAFlsppkstkkgspppls  679
            LRCQLPAEDLDALVSITSDEDL NLIEEYDR  S    +KI+AF+SPP+S+ K S PPL 
Sbjct  71   LRCQLPAEDLDALVSITSDEDLINLIEEYDRTASPQSQLKIKAFISPPRSSNKASKPPLP  130

Query  678  tassstsnssmsprlPCTAPRFLASSRGG--------------KGIHQMSKLSVMSPSYE  541
            + S S S SS S     ++     S  GG              + +H MS+ +V   + E
Sbjct  131  SLSKSASVSSSSSASSTSSSSSYCSVNGGGSSQKYTTEQPVVYRCVHHMSQQTVNHGNME  190

Query  540  KRGGR--PPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            +  GR  P   + +    NT   YLIH+GN+WQ
Sbjct  191  RSSGRNVPLPRSGYQSQRNTDQNYLIHNGNHWQ  223


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++ A  S   +IKFLCSYGGKILPR+PDGKLRY GG  RVLSVDR
Sbjct  5     SEPASGSPKSTIKFLCSYGGKILPRYPDGKLRYLGGHNRVLSVDR  49



>gb|KHN35453.1| hypothetical protein glysoja_043777 [Glycine soja]
Length=130

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 83/148 (56%), Gaps = 20/148 (14%)
 Frame = -2

Query  885  LVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYD-RCGSIKIRAFlsppk  712
            +VKL E+ GA V+ LRCQLP EDLDALVSIT DEDL NL+EEYD    S+KIRAFL    
Sbjct  1    MVKLEELCGAHVTHLRCQLPTEDLDALVSITCDEDLNNLVEEYDGAVSSLKIRAFLCSSP  60

Query  711  stkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVMSPSYEKRG  532
            +  K S    S+ SSS+S+ S   R    AP  LA         + S +S+ SP Y    
Sbjct  61   APSKSSSTTSSSCSSSSSSPSSCCRTAMAAPPQLA---------KKSYVSLSSPRYY---  108

Query  531  GRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
                  +H    GN G +YL+  GN+W 
Sbjct  109  ------SHPRVQGNRGVVYLVPSGNHWH  130



>ref|XP_010528101.1| PREDICTED: uncharacterized protein LOC104805284 [Tarenaya hassleriana]
Length=195

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 8/65 (12%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS--------I  742
             +EL  ++ EM G+ V LRCQLP EDLDAL+S+TSDEDLANL+EEYDR  +        +
Sbjct  47   FSELTARMAEMCGSPVILRCQLPNEDLDALISVTSDEDLANLVEEYDRVTAAAPASLSPL  106

Query  741  KIRAF  727
            KIRAF
Sbjct  107  KIRAF  111


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T ++KFLCSYGGKILPRHPDGKLRY+GG TRVL+V+R
Sbjct  7     TATVKFLCSYGGKILPRHPDGKLRYHGGHTRVLAVNR  43



>ref|XP_008340105.1| PREDICTED: uncharacterized protein LOC103403065 [Malus domestica]
Length=232

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 97/182 (53%), Gaps = 32/182 (18%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV---SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKI  736
             +EL  KL E+ G SV   SLRCQLP EDLDALVSI SDEDL NLIEEYDR  S   +KI
Sbjct  51   FSELSSKLTELCGPSVTAVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAASSANLKI  110

Query  735  RAFlsppkstkkgsppplstassstsnssmsp------------rlPCTAPRF--LASSR  598
            RAFLS   + +        ++SS+++ S+ S                 + PRF   +S+ 
Sbjct  111  RAFLSLIPTGRTPKSISSPSSSSASAASTTSSSGTSSSSNNYFGAASGSTPRFPLPSSTL  170

Query  597  GGKGIHQMS-KLSVMSPSYEKRGGRPPQCAHHLGA----------GNTG-HIYLIHHGNY  454
              + + QM  + S  +  +++   + P CA+   A          G TG  +YL+H+GN+
Sbjct  171  VDRCLRQMPLQPSPSTVPFQRPPSKVPHCANIYHARHGHRNNNPTGTTGSRLYLVHNGNH  230

Query  453  WQ  448
            WQ
Sbjct  231  WQ  232


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 4/47 (9%)
 Frame = -1

Query  1270  MAGPSS--TK--SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MA PS   TK  +IK LCS+GGKILPR+PDGKLRY GGETRVL+V R
Sbjct  1     MAEPSPDLTKVINIKLLCSHGGKILPRYPDGKLRYLGGETRVLAVPR  47



>ref|XP_008389723.1| PREDICTED: cell wall integrity and stress response component 
1-like [Malus domestica]
Length=232

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 95/182 (52%), Gaps = 32/182 (18%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV---SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKI  736
             +EL  KL E+ G SV   SLRCQLP EDLDALVSI SDEDL NLIEEYDR  S   +KI
Sbjct  51   FSELSSKLTELCGPSVTAVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAASSANMKI  110

Query  735  RAFlsppkstkkgsppplstassstsnssms------------prlPCTAPRF--LASSR  598
            RAFLS   + +        + SS+++ S+ S                 + PRF   +S+ 
Sbjct  111  RAFLSLIPTARTPKSISSPSTSSASAASTTSSSGNSSSSNNYFSAASGSTPRFPMPSSTP  170

Query  597  GGKGIHQM-SKLSVMSPSYEKRGGRPPQCAH----------HLGAGNTG-HIYLIHHGNY  454
              + + QM  + S  +  +++   + P CA+          +  A  TG   YL+H+GN+
Sbjct  171  VDRCLRQMPPQPSPSTVPFQRPPSKVPHCANIYHARQGHGSNKPASTTGSRPYLVHNGNH  230

Query  453  WQ  448
            WQ
Sbjct  231  WQ  232


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = -1

Query  1270  MAGPS----STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS       +IKFLCSYGGKILPR+PDGKLRY GGETRVL+V R
Sbjct  1     MVGPSPDLTKVTTIKFLCSYGGKILPRYPDGKLRYLGGETRVLAVPR  47



>emb|CDY28543.1| BnaC02g36170D [Brassica napus]
Length=176

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRAF  727
             +EL  K+ EM G++V++RCQLP EDLDA VS+TSDEDLANLIEEYD   S   +KIR F
Sbjct  44   FSELASKMAEMCGSTVTIRCQLPTEDLDAPVSVTSDEDLANLIEEYDLVSSSSPMKIRVF  103


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  3     TNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  40



>emb|CDY48987.1| BnaA02g28090D [Brassica napus]
Length=179

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRAF  727
             +EL  K+ EM  ++V++RCQLP EDLDALVS+TSDEDLANLIEEYD   S   +KIR F
Sbjct  44   FSELASKMAEMCRSTVTIRCQLPTEDLDALVSVTSDEDLANLIEEYDLVSSSSPMKIRVF  103


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  3     TNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  40



>ref|XP_004489778.1| PREDICTED: uncharacterized protein LOC101505933 [Cicer arietinum]
Length=227

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIR  733
             +ELL KL E+  +SV+ LRCQLPAEDLDALVSITSDEDLANLIEEYDR       +KI+
Sbjct  53   FSELLSKLEELCASSVTHLRCQLPAEDLDALVSITSDEDLANLIEEYDRTSLPQLPLKIK  112

Query  732  AF  727
             F
Sbjct  113  VF  114


 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = -1

Query  1270  MAGPSSTKS------IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M GPS   S      IKF CSYGGKILPR+PDGKLRY GG TRVLSVDR
Sbjct  1     MFGPSQPASDTPNSTIKFFCSYGGKILPRYPDGKLRYLGGHTRVLSVDR  49



>ref|XP_009383548.1| PREDICTED: uncharacterized protein LOC103971280 [Musa acuminata 
subsp. malaccensis]
Length=218

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
             +EL VKL E+ G  +VSLRCQLP EDLDAL+S+TSDEDLANL+EEY     DR   +KI
Sbjct  74   FSELQVKLSELCGWGAVSLRCQLPTEDLDALISVTSDEDLANLVEEYDIASRDRPSPLKI  133

Query  735  RAF  727
            RAF
Sbjct  134  RAF  136


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T++IKFLCSYGGKILPR+PDGKLRY GG TR+L+VDR
Sbjct  34    TRAIKFLCSYGGKILPRYPDGKLRYVGGHTRLLAVDR  70



>emb|CAN71778.1| hypothetical protein VITISV_019814 [Vitis vinifera]
Length=208

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS--IKIRAF  727
            EL+VKLGE+ G+SV+LRCQLP EDLD LV++TSDE+LAN+I+EY R  S   KIRA 
Sbjct  52   ELMVKLGELCGSSVTLRCQLPKEDLDVLVTVTSDEELANVIDEYHRASSSCSKIRAV  108


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S + IKFL SYGGKILPR  DGKLRY GG TRVL+VDR
Sbjct  8     ASNRIIKFLYSYGGKILPRRIDGKLRYVGGHTRVLAVDR  46



>ref|XP_002280847.1| PREDICTED: uncharacterized protein LOC100255423 [Vitis vinifera]
Length=208

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS--IKIRA  730
            EL+VKLGE+ G+SV+LRCQLP EDLD LV++TSDE+LAN+I+EY R  S   KIRA
Sbjct  52   ELMVKLGELCGSSVTLRCQLPKEDLDVLVTVTSDEELANVIDEYHRASSSCSKIRA  107


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S + IKFL SYGGKILPR  DGKLRY GG TRVL+VDR
Sbjct  8     ASNRIIKFLYSYGGKILPRRIDGKLRYVGGHTRVLAVDR  46



>ref|NP_001030772.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 dbj|BAF01203.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77172.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
Length=218

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 8/66 (12%)
 Frame = -2

Query  900  VITELLVKLGEMYGA-----SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---  745
            V+TEL  K+ EM G      +V++RCQLP EDLDALVSITSDEDL NLIEEYD   S   
Sbjct  68   VLTELASKMAEMCGGVGGSITVTIRCQLPTEDLDALVSITSDEDLVNLIEEYDLVSSSSP  127

Query  744  IKIRAF  727
            +KIR F
Sbjct  128  MKIRVF  133



>ref|XP_006347429.1| PREDICTED: uncharacterized protein LOC102585593 [Solanum tuberosum]
Length=173

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
            + EL+VK GE+ G+S+ L+C+LP EDLD LVSIT DEDLAN+IEEYDR  +     IKI+
Sbjct  45   VAELMVKFGELCGSSMHLKCKLPTEDLDVLVSITCDEDLANVIEEYDRVSAMTNTEIKIK  104

Query  732  AF  727
            A 
Sbjct  105  AL  106


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S + +KFL SYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  4     SRQIVKFLYSYGGRILPRRSDGTLRYIGGFTRVLSVDR  41



>ref|XP_009379964.1| PREDICTED: uncharacterized protein LOC103968458 [Musa acuminata 
subsp. malaccensis]
Length=206

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 7/64 (11%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD------RCGSIK  739
             +EL VKL E+ G  +VSLRCQLP ED+DALVS+TSDEDLANL+EEYD      R   +K
Sbjct  63   FSELQVKLRELCGWGAVSLRCQLPTEDMDALVSVTSDEDLANLVEEYDLASRDRRSSPLK  122

Query  738  IRAF  727
            IRAF
Sbjct  123  IRAF  126


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             T+ +K LCSYGGKILPR PDG+LRY  G TRV++V R
Sbjct  23    TEPVKLLCSYGGKILPRRPDGRLRYVSGHTRVVAVRR  59



>ref|XP_009628666.1| PREDICTED: uncharacterized protein LOC104118984 [Nicotiana tomentosiformis]
Length=187

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL+VK GE+ G+S+SLRC+LP EDLD LVSIT DEDLA++IEEY R  +     IKIR
Sbjct  51   FSELMVKFGELSGSSMSLRCKLPIEDLDVLVSITCDEDLADVIEEYGRVSALTNQEIKIR  110

Query  732  AF  727
            A 
Sbjct  111  AL  112


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ST+++KFL SYGGKILPR  DGKLRY GG TRVLS+DR
Sbjct  10    STQTLKFLYSYGGKILPRRSDGKLRYIGGFTRVLSIDR  47



>ref|XP_010425367.1| PREDICTED: uncharacterized protein LOC104710453 [Camelina sativa]
Length=199

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRA  730
             +EL  K+ EM G++ V++RCQLP EDLDALVSITSDEDLANLIEEYD   S   +KIR 
Sbjct  47   FSELASKMAEMCGSTTVTIRCQLPTEDLDALVSITSDEDLANLIEEYDLVSSSSPMKIRV  106

Query  729  F  727
            F
Sbjct  107  F  107


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M   SS  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVTSSSNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>ref|XP_010912990.1| PREDICTED: uncharacterized protein LOC105038788 [Elaeis guineensis]
Length=221

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
             +EL  K+GEM G  +V+LRCQLP EDLDALVS+TSDEDLANLIEEY     DR   +KI
Sbjct  68   FSELQGKMGEMCGWGAVNLRCQLPTEDLDALVSVTSDEDLANLIEEYDLASRDRLLPLKI  127

Query  735  RAF  727
            RAF
Sbjct  128  RAF  130


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             P+   +IKFLCSYGGKILPR+PDGKLRY GG TRVL+VDR
Sbjct  25    PAVGGTIKFLCSYGGKILPRYPDGKLRYVGGHTRVLAVDR  64



>ref|XP_006292751.1| hypothetical protein CARUB_v10018998mg [Capsella rubella]
 gb|EOA25649.1| hypothetical protein CARUB_v10018998mg [Capsella rubella]
Length=194

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS--VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIR  733
             +EL  K+ EM G S  V++RCQLP EDLDALVSITSDEDLANLIEEYD   S   +KIR
Sbjct  43   FSELASKMAEMCGGSTTVTIRCQLPTEDLDALVSITSDEDLANLIEEYDLVSSSSPMKIR  102

Query  732  AF  727
             F
Sbjct  103  VF  104


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  2     TNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  39



>gb|KDO69494.1| hypothetical protein CISIN_1g029397mg [Citrus sinensis]
Length=194

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-SIKIRAF  727
              EL+VKLGE  G SV+LRCQLP  DL+ L+SI SD+DLANLIEEYDR   S KIRA 
Sbjct  52   FAELMVKLGEFCGYSVTLRCQLPNGDLETLISIKSDDDLANLIEEYDRAAPSSKIRAI  109


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              +++KFLCSYGGKILPR  DG+LRY GG TRVLSV+R
Sbjct  12    AETLKFLCSYGGKILPRSMDGQLRYVGGLTRVLSVER  48



>ref|XP_004138082.1| PREDICTED: uncharacterized protein LOC101222072 [Cucumis sativus]
 ref|XP_004172046.1| PREDICTED: uncharacterized LOC101222072 [Cucumis sativus]
 gb|KGN63525.1| hypothetical protein Csa_1G002940 [Cucumis sativus]
Length=202

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL+VKLGE  G+SV+L+CQLP  DL+ L+S+ SDEDLAN++EEYDR  S     +KIR
Sbjct  50   FSELMVKLGEFCGSSVTLKCQLPGGDLETLISVRSDEDLANIVEEYDRASSSLSHPLKIR  109

Query  732  AF  727
            A 
Sbjct  110  AI  111


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++ ++KFLCSYGGKILPR  DGKLRY GG TRVL+V+R
Sbjct  9     TSGTLKFLCSYGGKILPRQTDGKLRYVGGLTRVLAVER  46



>ref|XP_009774752.1| PREDICTED: uncharacterized protein LOC104224728 [Nicotiana sylvestris]
Length=187

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL+VK GE+ G+S+ LRC+LP EDLD LVSIT DEDLAN+IEEY R  +     IKIR
Sbjct  51   FSELMVKFGELCGSSMRLRCKLPTEDLDVLVSITCDEDLANVIEEYGRVSALTNQEIKIR  110

Query  732  AF  727
            A 
Sbjct  111  AL  112


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             ST+++K L SYGGKILPR  DGKLRY GG TRVLS+D
Sbjct  10    STQTLKLLYSYGGKILPRRSDGKLRYIGGFTRVLSID  46



>ref|XP_008464503.1| PREDICTED: uncharacterized protein LOC103502365 [Cucumis melo]
Length=202

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL+VKLGE  G+SV+L+CQLP  DL+ L+S+ SDEDLAN++EEYDR  S     +KIR
Sbjct  50   FSELMVKLGEFCGSSVTLKCQLPGGDLETLISVRSDEDLANIVEEYDRASSSLSHPLKIR  109

Query  732  AF  727
            A 
Sbjct  110  AI  111


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+ ++KFLCSYGGKILPR  DGKLRY GG TRVL+V+R
Sbjct  9     SSGTLKFLCSYGGKILPRQTDGKLRYVGGLTRVLAVER  46



>ref|XP_010909406.1| PREDICTED: uncharacterized protein LOC105035522 [Elaeis guineensis]
Length=214

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 47/63 (75%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
             +EL  KL EM G  +VSLRCQLP EDLDALVS+TSDEDLANL+EEY     DR   +KI
Sbjct  71   FSELQGKLEEMCGWGAVSLRCQLPTEDLDALVSVTSDEDLANLLEEYDLASRDRADPLKI  130

Query  735  RAF  727
            RAF
Sbjct  131  RAF  133


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +IKFLCSYGGKILPR+PDGKLRY GG TRVL+VDR
Sbjct  33    TIKFLCSYGGKILPRYPDGKLRYVGGHTRVLAVDR  67



>ref|XP_006439915.1| hypothetical protein CICLE_v10021546mg [Citrus clementina]
 gb|ESR53155.1| hypothetical protein CICLE_v10021546mg [Citrus clementina]
Length=282

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-SIKIRAF  727
              EL+VKLGE  G SV+LRCQLP  DL+ L+SI SD+DLANLIEEYDR   S KIRA 
Sbjct  140  FAELMVKLGEFCGYSVTLRCQLPNGDLETLISIKSDDDLANLIEEYDRAAPSSKIRAI  197


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              +++KFLCSYGGKILPR  DG+LRY GG TRVLSV+R
Sbjct  100   AETLKFLCSYGGKILPRSMDGQLRYVGGLTRVLSVER  136



>ref|XP_006390857.1| hypothetical protein EUTSA_v10019187mg [Eutrema salsugineum]
 gb|ESQ28143.1| hypothetical protein EUTSA_v10019187mg [Eutrema salsugineum]
Length=188

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYD---RCGSIKIRA  730
             TEL  KLGE+ G +V SLRCQLP EDLDAL+++TSDEDL NL+EEYD      S+KIRA
Sbjct  48   FTELARKLGEICGITVISLRCQLPTEDLDALINVTSDEDLKNLMEEYDLDTTAPSLKIRA  107

Query  729  F  727
            F
Sbjct  108  F  108


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGG+I+PR PDGKLRY+GG TRVLSV R
Sbjct  10    TVKFLCSYGGRIIPRFPDGKLRYHGGNTRVLSVPR  44



>ref|XP_009403623.1| PREDICTED: uncharacterized protein LOC103987138 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403624.1| PREDICTED: uncharacterized protein LOC103987138 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             +EL  K+ EM G  +VSLRCQLP EDLDALVS+ SDEDLAN++EEYD  G  KIRAF
Sbjct  140  FSELQEKMREMCGWVAVSLRCQLPTEDLDALVSVKSDEDLANIMEEYDLAGREKIRAF  197


 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +IKFLCSYGGKILPR+PDGKLRY GG+TRVL+VDR
Sbjct  99    TAATIKFLCSYGGKILPRYPDGKLRYIGGDTRVLAVDR  136



>ref|XP_007036379.1| Octicosapeptide/Phox/Bem1p family protein [Theobroma cacao]
 gb|EOY20880.1| Octicosapeptide/Phox/Bem1p family protein [Theobroma cacao]
Length=248

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             TEL+VKL E  G SV+LRCQLP  DLD L+SI SDEDL N+IEEYD     KIRA
Sbjct  111  FTELMVKLVEFCGYSVTLRCQLPNGDLDTLISIKSDEDLRNIIEEYDGAAPSKIRA  166


 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  1267  AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +G  S++++KFLCSYGGKILPR  DGKLRY GG TRVLSVDR
Sbjct  66    SGKKSSETVKFLCSYGGKILPRSSDGKLRYVGGLTRVLSVDR  107



>ref|XP_010514296.1| PREDICTED: uncharacterized protein LOC104790282 [Camelina sativa]
Length=199

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRA  730
             +EL  K+ EM G++ V++RCQLP EDLDALVSITSDEDL NLIEEYD   S   +KIR 
Sbjct  47   FSELASKMAEMCGSTTVTIRCQLPTEDLDALVSITSDEDLTNLIEEYDLVSSSSPMKIRV  106

Query  729  F  727
            F
Sbjct  107  F  107


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M   SS  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVTSSSNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>ref|XP_006476876.1| PREDICTED: uncharacterized protein LOC102620638 [Citrus sinensis]
Length=195

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-SIKIRAF  727
              EL+VKLGE  G SV+LRCQLP  DL+ L+SI SD+DLANLIEEYDR   S KI+A 
Sbjct  52   FAELMVKLGEFCGYSVTLRCQLPNGDLETLISIKSDDDLANLIEEYDRAAPSSKIKAI  109


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S +++KFLCSYGG+ILPR  DG+LRY GG TRVLSV+R
Sbjct  10    NSAETLKFLCSYGGRILPRSMDGQLRYVGGLTRVLSVER  48



>ref|XP_010550697.1| PREDICTED: uncharacterized protein LOC104821490 [Tarenaya hassleriana]
Length=263

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
              EL+VKLGE  G SV L+CQLP  DL+ L+S+ SDEDL+N+IEEYDR    KIRA
Sbjct  129  FAELMVKLGEFCGYSVDLKCQLPNGDLETLISVKSDEDLSNIIEEYDRVSGRKIRA  184


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 7/67 (10%)
 Frame = -1

Query  1321  HIVLP-FSFVSPKSEETD----MAGPS--STKSIKFLCSYGGKILPRHPDGKLRYYGGET  1163
             H++LP      PK E ++    +AG +  S+ S+KFLCSYGGKILPR PDGKLRY GG T
Sbjct  59    HLLLPPLIGKKPKPEASETLKMVAGTTKNSSGSLKFLCSYGGKILPRSPDGKLRYAGGLT  118

Query  1162  RVLSVDR  1142
             RVLSVDR
Sbjct  119   RVLSVDR  125



>gb|ACJ85885.1| unknown [Medicago truncatula]
 gb|AFK42985.1| unknown [Medicago truncatula]
Length=222

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 88/153 (58%), Gaps = 22/153 (14%)
 Frame = -2

Query  846  LRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAFlsppkstkkgspppls  679
            LRCQLPAEDLDALVSITSDEDL NLIEEYDR  S    +KI+AF+SPP+S+ K S PPLS
Sbjct  71   LRCQLPAEDLDALVSITSDEDLINLIEEYDRTASPQSQLKIKAFISPPRSSNKASKPPLS  130

Query  678  tassstsnssmsprlPCTAPRFLASSRGG--------------KGIHQMSKLSVMSPSYE  541
            + S S S SS S     ++     S  GG              + +H MS+ +V   + E
Sbjct  131  SLSKSASVSSSSSASSTSSSSSYCSVNGGGSSQKYTTEQPVVYRCVHHMSQQTVNHGNME  190

Query  540  KRGGRP---PQCAHHLGAGNTGHIYLIHHGNYW  451
            +  GR    P+  +     NT   YLIH+GN W
Sbjct  191  RSSGRNVLLPRSGYQ-SQRNTDQNYLIHNGNRW  222


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  1267  AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             A  S   +IKFLCSYGGKILPR+PDGKLRY GG  RVLSVDR
Sbjct  8     ASGSPKSTIKFLCSYGGKILPRYPDGKLRYLGGHNRVLSVDR  49



>ref|XP_010502578.1| PREDICTED: uncharacterized protein LOC104779862 [Camelina sativa]
Length=199

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIRA  730
             +EL  K+ EM G++ V++RCQLP EDLDALVSITSDEDL NLIEEYD   S   +KIR 
Sbjct  47   FSELASKMAEMCGSTTVTIRCQLPTEDLDALVSITSDEDLTNLIEEYDLLSSSSPMKIRV  106

Query  729  F  727
            F
Sbjct  107  F  107


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M   SS  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVTSSSNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>emb|CDP12740.1| unnamed protein product [Coffea canephora]
Length=234

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKIR  733
             +ELLVK GE+ G SV+L+C+LP+EDLD L+SI SDE+L N+I+EYDR        +KIR
Sbjct  52   FSELLVKFGELTGTSVNLKCKLPSEDLDVLISIKSDEELRNVIDEYDRASEFSHLELKIR  111

Query  732  AF  727
            A 
Sbjct  112  AI  113


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  1267  AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + P+S KS+KFL SY G+ILPR  DG LRY GG TR+LSVDR
Sbjct  7     SSPNSRKSVKFLYSYNGQILPRPSDGVLRYVGGHTRILSVDR  48



>ref|XP_004501879.1| PREDICTED: uncharacterized protein LOC101511445 isoform X1 [Cicer 
arietinum]
Length=199

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKIR  733
             +EL+VKLGE+ G+SV+LRCQLP  DL+ L+SIT+DEDLAN+I+EY+R        +KIR
Sbjct  46   FSELMVKLGELCGSSVTLRCQLPKGDLETLISITNDEDLANIIDEYERASLKLTHPLKIR  105

Query  732  AF  727
            A 
Sbjct  106  AI  107


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  1249  KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             KSIK LCSYGGKILPR  DG+LRY GG TRVL+VDR
Sbjct  7     KSIKLLCSYGGKILPRSTDGELRYVGGHTRVLAVDR  42



>ref|XP_006404283.1| hypothetical protein EUTSA_v10010747mg [Eutrema salsugineum]
 gb|ESQ45736.1| hypothetical protein EUTSA_v10010747mg [Eutrema salsugineum]
Length=188

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL+VKL E  G SV L+CQLP  DL+ L+S+ SDEDLAN++EEYDR    KIRA 
Sbjct  54   FTELMVKLEEFCGYSVDLKCQLPNGDLETLISVKSDEDLANIVEEYDRVHGGKIRAI  110


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV+
Sbjct  16    SLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSVN  49



>emb|CDY66304.1| BnaA07g38840D [Brassica napus]
Length=166

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRAF  727
              EL VKLGE+ G  V SLRCQLP +DLDALV+++SDEDLANL+EEYD   + +KIR F
Sbjct  41   FAELAVKLGEVCGMKVISLRCQLPTDDLDALVTVSSDEDLANLMEEYDLAATALKIRVF  99


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGG+I+PR+PD KLRY+GG TRVLSV R
Sbjct  3     TVKFLCSYGGRIIPRYPDNKLRYHGGHTRVLSVKR  37



>emb|CDY61217.1| BnaC06g43650D [Brassica napus]
Length=166

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRAF  727
              EL VKLGE+ G  VS LRCQLPA+DLD LV+++SDEDLANL+EEYD   + +KIR F
Sbjct  41   FAELAVKLGEVCGMKVSSLRCQLPADDLDGLVTVSSDEDLANLMEEYDLAATALKIRVF  99


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGG+I+PR+PD KLRY+GG TRVLSV R
Sbjct  3     TVKFLCSYGGRIIPRYPDNKLRYHGGHTRVLSVQR  37



>ref|XP_004236261.1| PREDICTED: uncharacterized protein LOC101266924 isoform X2 [Solanum 
lycopersicum]
Length=189

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
             +EL+VK GE  G+S+SL+C+LP EDLD LVSIT DEDL N+I+EYDR  ++     KIR
Sbjct  48   FSELMVKFGESCGSSMSLKCKLPTEDLDVLVSITCDEDLMNVIQEYDRVSALTNQEMKIR  107

Query  732  A  730
            A
Sbjct  108  A  108


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + T+ IKFL SYGG+I+PR  DGKLRY GG TRVLSV++
Sbjct  6     NGTQVIKFLYSYGGRIVPRRSDGKLRYIGGFTRVLSVEK  44



>ref|XP_009105733.1| PREDICTED: uncharacterized protein LOC103831599 [Brassica rapa]
Length=166

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 2/57 (4%)
 Frame = -2

Query  891  ELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRAF  727
            EL VKLGE+ G  V SLRCQLP +DLDALV+++SDEDLANL+EEYD   + +KIR F
Sbjct  43   ELAVKLGEVCGMKVISLRCQLPTDDLDALVTVSSDEDLANLMEEYDLAATALKIRVF  99


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGG+I+PR+PD KL  +GG TRVLSV R
Sbjct  3     TVKFLCSYGGRIIPRYPDNKLLCHGGHTRVLSVKR  37



>ref|XP_004236260.1| PREDICTED: uncharacterized protein LOC101266924 isoform X1 [Solanum 
lycopersicum]
Length=199

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
             +EL+VK GE  G+S+SL+C+LP EDLD LVSIT DEDL N+I+EYDR  ++     KIR
Sbjct  48   FSELMVKFGESCGSSMSLKCKLPTEDLDVLVSITCDEDLMNVIQEYDRVSALTNQEMKIR  107

Query  732  A  730
            A
Sbjct  108  A  108


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + T+ IKFL SYGG+I+PR  DGKLRY GG TRVLSV++
Sbjct  6     NGTQVIKFLYSYGGRIVPRRSDGKLRYIGGFTRVLSVEK  44



>emb|CDY20093.1| BnaA01g29090D [Brassica napus]
Length=194

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRAF  727
              EL VKLGE+ G  V SLRCQLP +DLDALV+++SDEDLANL+EEYD   + +KIR F
Sbjct  69   FAELAVKLGEVCGMKVISLRCQLPTDDLDALVTVSSDEDLANLMEEYDLAATALKIRVF  127


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  1234  LCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             LCSYGG+I+PR+PD KLRY+GG TRVLSV R
Sbjct  35    LCSYGGRIIPRYPDNKLRYHGGHTRVLSVKR  65



>ref|XP_009613737.1| PREDICTED: uncharacterized protein LOC104106811 isoform X2 [Nicotiana 
tomentosiformis]
Length=175

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
              EL+VK GE+ G+S++L+C+LP+EDLD LVSIT DEDL N+I+EY+R  ++     KIR
Sbjct  44   FAELMVKFGELCGSSMNLKCKLPSEDLDVLVSITCDEDLMNMIQEYERVSALTNREMKIR  103

Query  732  A  730
            A
Sbjct  104  A  104


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +ST +IKFL SYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  2     NSTHAIKFLYSYGGRILPRPSDGNLRYVGGFTRVLSVDR  40



>ref|XP_008339068.1| PREDICTED: uncharacterized protein LOC103402106 [Malus domestica]
Length=231

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV---SLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKI  736
             +EL  KL E+ G SV   SLRCQLP EDLDALVSI SDEDL NLIEEYDR  S   +KI
Sbjct  44   FSELSSKLTELCGPSVTAVSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAASSANMKI  103

Query  735  RAF  727
            RA 
Sbjct  104  RAL  106


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 11/47 (23%)
 Frame = -1

Query  1270  MAGPS----STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MAGPS       +IKFLCSYGGKILP       RY GGETRVL+V R
Sbjct  1     MAGPSPDLTMVTTIKFLCSYGGKILP-------RYLGGETRVLAVPR  40



>ref|XP_006344466.1| PREDICTED: uncharacterized protein LOC102580365 isoform X2 [Solanum 
tuberosum]
Length=188

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
              EL+VK GE  G+S+SL+C+LP EDLD LVSIT DEDL N+I+EYDR  ++     KIR
Sbjct  47   FAELMVKFGESCGSSMSLKCKLPTEDLDVLVSITCDEDLMNVIQEYDRVSALTNQEMKIR  106

Query  732  A  730
            A
Sbjct  107  A  107


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M   + ++ IKFL SYGG+I+PR  DGKLRY GG TRVLSVD+
Sbjct  1     MNSMNGSQVIKFLYSYGGRIVPRRSDGKLRYIGGFTRVLSVDK  43



>ref|XP_006344465.1| PREDICTED: uncharacterized protein LOC102580365 isoform X1 [Solanum 
tuberosum]
Length=198

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
              EL+VK GE  G+S+SL+C+LP EDLD LVSIT DEDL N+I+EYDR  ++     KIR
Sbjct  47   FAELMVKFGESCGSSMSLKCKLPTEDLDVLVSITCDEDLMNVIQEYDRVSALTNQEMKIR  106

Query  732  A  730
            A
Sbjct  107  A  107


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M   + ++ IKFL SYGG+I+PR  DGKLRY GG TRVLSVD+
Sbjct  1     MNSMNGSQVIKFLYSYGGRIVPRRSDGKLRYIGGFTRVLSVDK  43



>ref|NP_189282.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 ref|NP_850632.2| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 ref|NP_974366.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 ref|NP_974365.2| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 gb|AAT41768.1| At3g26510 [Arabidopsis thaliana]
 gb|AAT70464.1| At3g26510 [Arabidopsis thaliana]
 dbj|BAD93795.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19628.1| AT3G26510 [Arabidopsis thaliana]
 dbj|BAH19747.1| AT3G26510 [Arabidopsis thaliana]
 dbj|BAH19856.1| AT3G26510 [Arabidopsis thaliana]
 gb|AEE77168.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77169.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77170.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
 gb|AEE77171.1| PB1_UP2 domain-containing protein [Arabidopsis thaliana]
Length=196

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 8/65 (12%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-----SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---I  742
             +EL  K+ EM G      +V++RCQLP EDLDALVSITSDEDL NLIEEYD   S   +
Sbjct  47   FSELASKMAEMCGGVGGSITVTIRCQLPTEDLDALVSITSDEDLVNLIEEYDLVSSSSPM  106

Query  741  KIRAF  727
            KIR F
Sbjct  107  KIRVF  111


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M    +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVTSPTNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>ref|XP_009613736.1| PREDICTED: uncharacterized protein LOC104106811 isoform X1 [Nicotiana 
tomentosiformis]
Length=195

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
              EL+VK GE+ G+S++L+C+LP+EDLD LVSIT DEDL N+I+EY+R  ++     KIR
Sbjct  44   FAELMVKFGELCGSSMNLKCKLPSEDLDVLVSITCDEDLMNMIQEYERVSALTNREMKIR  103

Query  732  A  730
            A
Sbjct  104  A  104


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +ST +IKFL SYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  2     NSTHAIKFLYSYGGRILPRPSDGNLRYVGGFTRVLSVDR  40



>ref|XP_006852324.1| hypothetical protein AMTR_s00049p00204490 [Amborella trichopoda]
 gb|ERN13791.1| hypothetical protein AMTR_s00049p00204490 [Amborella trichopoda]
Length=204

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 81/156 (52%), Gaps = 12/156 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKI  736
             ++L+ KL +  G  +++LRCQLP EDLDALVS+TSDEDLA++IEEYDR       S+K+
Sbjct  55   FSDLMEKLRKFCGEVAITLRCQLPTEDLDALVSVTSDEDLAHVIEEYDRVNRERGSSLKV  114

Query  735  RAFlsppkstkkgsppplstassstsnssmsprlPCTAPRFLASSRGGKGIHQMSKLSVM  556
            RAFLSPPK          S+ +        S R       F+              L + 
Sbjct  115  RAFLSPPKPKTPVILKQQSSIAGKPHFPGESYRCVHLPANFIGRLIVPVAGKSSEALVMA  174

Query  555  SPSYEKRGGRPPQCAHHLGAGNTGHIYLIHHGNYWQ  448
            +PS +  G     C    G  N  + YL+H+GNYWQ
Sbjct  175  APSVQYYG-----CLTK-GNRNPRNQYLVHNGNYWQ  204


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S   ++KFLCSYGG+I PRHPDGKLRY GG TRVL+VDR
Sbjct  13    SGINTVKFLCSYGGRIQPRHPDGKLRYVGGFTRVLAVDR  51



>ref|XP_009393766.1| PREDICTED: uncharacterized protein LOC103979368 [Musa acuminata 
subsp. malaccensis]
Length=213

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             +EL  K+ E+ G  +VS+RCQLP EDLDALVS+ SDEDL N++EEYD  G  KIRAF
Sbjct  72   FSELREKMRELCGWGAVSVRCQLPTEDLDALVSVKSDEDLTNVVEEYDLAGREKIRAF  129


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
               S+KFLCSYGG+ILPR+PDGKLRY GG+TRVLSVDR
Sbjct  32    AASVKFLCSYGGRILPRYPDGKLRYVGGDTRVLSVDR  68



>ref|XP_002875889.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52148.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=179

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL++KL E  G SV L+CQLP  DL+ L+S+ SDEDLAN++EEYDR    KIRA 
Sbjct  51   FTELMMKLEEFCGYSVELKCQLPNGDLETLISVKSDEDLANMVEEYDRVYGGKIRAI  107


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             +  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV
Sbjct  10    TKNSLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSV  45



>ref|XP_010519536.1| PREDICTED: uncharacterized protein LOC104798966 [Tarenaya hassleriana]
Length=182

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL+VKLGE  G SV L+CQLP  DL+ L+SI SD+DLAN+IEEY+R    KIRA
Sbjct  52   ELMVKLGEFCGYSVDLKCQLPNGDLETLISIKSDDDLANIIEEYNRVFGGKIRA  105


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = -1

Query  1270  MAGPSSTKS---IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MA  ++T S   IKFLCSYGGKILPR  DG+LRY GG TRV+SVDR
Sbjct  1     MAAENATNSGATIKFLCSYGGKILPRSIDGRLRYVGGLTRVISVDR  46



>dbj|BAB01831.1| unnamed protein product [Arabidopsis thaliana]
Length=215

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 8/65 (12%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-----SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---I  742
             +EL  K+ EM G      +V++RCQLP EDLDALVSITSDEDL NLIEEYD   S   +
Sbjct  66   FSELASKMAEMCGGVGGSITVTIRCQLPTEDLDALVSITSDEDLVNLIEEYDLVSSSSPM  125

Query  741  KIRAF  727
            KIR F
Sbjct  126  KIRVF  130


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  1282  EETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +E DM    +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  16    QEKDMVTSPTNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  62



>ref|XP_009793857.1| PREDICTED: uncharacterized protein LOC104240682 [Nicotiana sylvestris]
Length=199

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
              EL+VK GE+ G+S++L+C+LP+EDLD LVSIT DEDL N+I+EY+R  ++     KIR
Sbjct  47   FAELMVKFGELCGSSMNLKCKLPSEDLDVLVSITCDEDLMNVIQEYERVSALTNQEMKIR  106

Query  732  A  730
            A
Sbjct  107  A  107


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M    ST +IKFL SYGG+ILPR  DGKLRY GG TRVLSVDR
Sbjct  1     MNSMKSTHAIKFLYSYGGRILPRPSDGKLRYVGGFTRVLSVDR  43



>gb|KEH31785.1| PB1 domain protein [Medicago truncatula]
Length=178

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL+VKL E+ G+SV+L+C LP  DL+ L+SITSDEDL N+IEEYDR  S     +KIR
Sbjct  46   FSELMVKLVELCGSSVTLKCPLPNGDLETLISITSDEDLKNIIEEYDRASSSLIHPLKIR  105

Query  732  A  730
            A
Sbjct  106  A  106


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  1249  KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
              +IKFL SYGGKILPR  DGKLRY GG TRVL++
Sbjct  7     NTIKFLFSYGGKILPRLTDGKLRYTGGHTRVLAL  40



>ref|XP_006291924.1| hypothetical protein CARUB_v10018110mg [Capsella rubella]
 gb|EOA24822.1| hypothetical protein CARUB_v10018110mg [Capsella rubella]
Length=176

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL+VKL E  G +V L+CQLP  DL+ L+SI +DEDLAN++EEYDR    KIRA 
Sbjct  48   FTELMVKLEEFCGYAVELKCQLPNGDLETLISIRTDEDLANIVEEYDRLHGGKIRAI  104


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             ++  S+KFLCSYGG+ILPR  DG LRY+GG TRVLSV
Sbjct  6     TNNTSLKFLCSYGGRILPRSLDGNLRYFGGFTRVLSV  42



>emb|CDX84387.1| BnaC03g51130D [Brassica napus]
Length=196

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL+ KL E  G SV LRCQLP  DL+ L+S+ SDEDLAN++EEYDR    KIRA
Sbjct  54   ELMKKLFEFCGYSVDLRCQLPNGDLETLISVKSDEDLANIVEEYDRVSGAKIRA  107


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D+   +S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV R
Sbjct  4     VDVKEKNSGSSLKFLCSYGGRILPRSTDGKLRYVGGHTRVLSVHR  48



>ref|XP_002876977.1| hypothetical protein ARALYDRAFT_484412 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53236.1| hypothetical protein ARALYDRAFT_484412 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 45/68 (66%), Gaps = 11/68 (16%)
 Frame = -2

Query  897  ITELLVKLGEM--------YGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-  745
             +EL  K+ EM           +V++RCQLP EDLDALVSITSDEDLANLIEEYD   S 
Sbjct  47   FSELASKMAEMCGGGGGGGGSTTVTIRCQLPMEDLDALVSITSDEDLANLIEEYDLVASS  106

Query  744  --IKIRAF  727
              +KIR F
Sbjct  107  SPMKIRVF  114


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M    +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVASPTNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>emb|CDY41501.1| BnaA06g22540D [Brassica napus]
Length=189

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL+ KL E  G SV LRCQLP  DL+ L+S+ SDEDLAN++EEYDR    KIRA
Sbjct  54   ELMKKLFEFCGYSVDLRCQLPNGDLETLISVKSDEDLANIVEEYDRVSGAKIRA  107


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D+   +S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV R
Sbjct  4     VDVNEKNSGSSLKFLCSYGGRILPRSTDGKLRYVGGHTRVLSVHR  48



>ref|XP_009150371.1| PREDICTED: uncharacterized protein LOC103873733 [Brassica rapa]
Length=247

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL+ KL E  G SV LRCQLP  DL+ L+S+ SDEDLAN++EEYDR    KIRA
Sbjct  107  ELVKKLFEFCGYSVDLRCQLPNGDLETLISVKSDEDLANIVEEYDRVSGAKIRA  160


 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D+   +S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV R
Sbjct  57    VDVNEKNSGSSLKFLCSYGGRILPRSTDGKLRYVGGHTRVLSVHR  101



>gb|ABK24411.1| unknown [Picea sitchensis]
Length=285

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIR  733
              +L+ K+ +++G+S V L+CQLP+EDLDALVS+ SDEDL N++EEYDR G+     K+R
Sbjct  69   FADLIAKMSKVFGSSAVLLKCQLPSEDLDALVSVKSDEDLENMLEEYDRVGAREGLSKVR  128

Query  732  AF  727
            AF
Sbjct  129  AF  130


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLC YGG+ILPR  DGKLRY GG TRV++  R
Sbjct  32    VKFLCRYGGRILPRPGDGKLRYAGGNTRVVAASR  65



>ref|XP_004979214.1| PREDICTED: uncharacterized protein LOC101779687 [Setaria italica]
Length=239

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 5/60 (8%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIRAF  727
            EL  KL E+ G  V LRCQLP EDLDAL+S+TSD+DLANL+EEYD         +KIRAF
Sbjct  84   ELQRKLRELCGWEVCLRCQLPTEDLDALISVTSDDDLANLLEEYDVASKDCLQPLKIRAF  143


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+KFLCSYGG+ILPRH DG LRY GG+ RVLSVDR
Sbjct  44    SVKFLCSYGGRILPRHTDGALRYVGGDNRVLSVDR  78



>ref|XP_007138022.1| hypothetical protein PHAVU_009G174600g [Phaseolus vulgaris]
 gb|ESW10016.1| hypothetical protein PHAVU_009G174600g [Phaseolus vulgaris]
Length=201

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = -2

Query  900  VITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKI  736
              +EL+VKL +  G+SV LRCQLP  DL+ L+SIT+DEDL+N+IEEYDR        +KI
Sbjct  45   FFSELMVKLSQFCGSSVILRCQLPKGDLETLISITNDEDLSNIIEEYDRASLKLAHPMKI  104

Query  735  RA  730
            RA
Sbjct  105  RA  106


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++SIK LCSYGGKI PR  DG+LRY GG TRVL+V R
Sbjct  6     SQSIKLLCSYGGKIRPRTTDGELRYVGGHTRVLNVHR  42



>ref|XP_008239324.1| PREDICTED: uncharacterized protein LOC103337931 [Prunus mume]
Length=219

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRA  730
              EL+VKL E  G SV LRCQLP  DL+ L+S+ SDE+LAN+IEEYDR  S    +KIRA
Sbjct  47   FAELMVKLAEFCGYSVDLRCQLPDGDLETLISVKSDEELANIIEEYDRASSSSRPLKIRA  106

Query  729  F  727
             
Sbjct  107  I  107


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             + K +K LCSYGGKILPRH DG LRY GG TRVL+VD
Sbjct  6     TKKPLKLLCSYGGKILPRHTDGNLRYVGGLTRVLAVD  42



>ref|XP_009333949.1| PREDICTED: uncharacterized protein LOC103926795 [Pyrus x bretschneideri]
Length=243

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 4/62 (6%)
 Frame = -2

Query  900  VITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIR  733
              TEL+VKL E+ G SV LRC LP  DL+ L+S+ SDEDLAN+IEEY R      S+KIR
Sbjct  46   TYTELMVKLAELCGYSVELRCPLPNGDLETLISVKSDEDLANIIEEYGRASSPPHSLKIR  105

Query  732  AF  727
            A 
Sbjct  106  AI  107


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             + + +K LCSYGGKILPRH DG LRY GG  RVLSVD
Sbjct  6     APEPLKLLCSYGGKILPRHSDGTLRYVGGHNRVLSVD  42



>ref|XP_010415750.1| PREDICTED: uncharacterized protein LOC104701706 [Camelina sativa]
Length=181

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             PS++ ++KFLCSYGG+I PR+PDGKLRY+GG+TRVLSV R
Sbjct  3     PSTSTTVKFLCSYGGRITPRYPDGKLRYHGGDTRVLSVTR  42


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG--SIKIRAF  727
             TEL  K+  + G +VS LRCQLP +DLDALV++TSDEDL NL+EEYD      IKIR F
Sbjct  46   FTELASKISAVCGMTVSTLRCQLPTDDLDALVTVTSDEDLNNLMEEYDLASMTPIKIRVF  105



>ref|XP_010471064.1| PREDICTED: uncharacterized protein LOC104750903 [Camelina sativa]
Length=177

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             PS++ ++KFLCSYGG+I PR+PDGKLRY+GG+TRVLSV R
Sbjct  3     PSTSTTVKFLCSYGGRITPRYPDGKLRYHGGDTRVLSVTR  42


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG--SIKIRAF  727
             TEL  K+  + G +VS LRCQLP +DLDALV++TSDEDL NL+EEYD      +KIR F
Sbjct  46   FTELASKISAVCGMTVSTLRCQLPTDDLDALVTVTSDEDLNNLMEEYDLASMTPVKIRVF  105



>ref|XP_007209584.1| hypothetical protein PRUPE_ppa011220mg [Prunus persica]
 gb|EMJ10783.1| hypothetical protein PRUPE_ppa011220mg [Prunus persica]
Length=219

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRA  730
              EL+VKL E  G SV LRCQLP  DL+ L+S+ SDE+LAN+IEEYDR  S    +KIRA
Sbjct  47   FAELMVKLAEFCGYSVDLRCQLPDGDLETLISVKSDEELANIIEEYDRASSSSRPLKIRA  106

Query  729  F  727
             
Sbjct  107  I  107


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             + +++K LCSYGGKILPRH DG LRY GG TRVL+VD
Sbjct  6     TKETLKLLCSYGGKILPRHTDGNLRYVGGLTRVLAVD  42



>ref|XP_008380529.1| PREDICTED: bromodomain-containing protein 4B-like [Malus domestica]
Length=249

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 4/60 (7%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIRAF  727
            TEL+VKL E+ G SV LRC LP  DL+ L+S+ SDEDLAN+IEEY R      S+KIRA 
Sbjct  48   TELMVKLAELCGYSVELRCPLPNGDLETLISVKSDEDLANIIEEYGRASSPPHSLKIRAI  107


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             +K LCSYGGKILPRH DG LRY GG  RVLSVD
Sbjct  10    LKLLCSYGGKILPRHSDGTLRYVGGHNRVLSVD  42



>ref|XP_003527000.1| PREDICTED: uncharacterized protein LOC100797123 [Glycine max]
Length=186

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKI  736
             +EL+VKL E  G+SV LRCQLP  DL+ L+SIT+DEDLA++IEEYDR  S+K+
Sbjct  46   FSELMVKLSEFCGSSVILRCQLPKGDLETLISITNDEDLASIIEEYDR-ASLKL  98


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1249  KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++IK LCSYGGKILPR  DG+LRY GG TRVL+V R
Sbjct  7     QTIKLLCSYGGKILPRATDGELRYAGGHTRVLTVAR  42



>dbj|BAH19742.1| AT3G26510 [Arabidopsis thaliana]
Length=196

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 8/65 (12%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-----SVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---I  742
             +EL  K+ EM G      +V++RCQLP EDLDALVSITSDED  NLIEEYD   S   +
Sbjct  47   FSELASKMAEMCGGVGGSITVTIRCQLPTEDLDALVSITSDEDPVNLIEEYDLVSSSSPM  106

Query  741  KIRAF  727
            KIR F
Sbjct  107  KIRVF  111


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             M    +  +IKFLCSYGGKILPR+PDGKLRY GG TRVL+V R
Sbjct  1     MVTSPTNSTIKFLCSYGGKILPRYPDGKLRYNGGHTRVLAVPR  43



>gb|KDP31034.1| hypothetical protein JCGZ_11410 [Jatropha curcas]
Length=183

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD-RCGSIKIRAF  727
              EL+VKLGE  G SV LRCQLP  DL+ LVSI SDE+LA LIEEY  RC   KIRA 
Sbjct  51   FAELMVKLGEFCGNSVELRCQLPNGDLETLVSIKSDEELAFLIEEYHRRCPGSKIRAI  108


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  1273  DMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             D     ST++IKFLCSY GKILPR  DGKLRY GG TRVL+VDR
Sbjct  4     DSESKRSTETIKFLCSYSGKILPRSIDGKLRYVGGLTRVLAVDR  47



>ref|XP_011071942.1| PREDICTED: uncharacterized protein LOC105157271 [Sesamum indicum]
Length=189

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 1/55 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRA  730
            EL+VK GE  G+SVSL+C+LP+EDLD LVS+ SDEDL +++EEY+R     KIRA
Sbjct  48   ELMVKFGESSGSSVSLKCKLPSEDLDVLVSVKSDEDLRSVMEEYERESPDAKIRA  102


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
               +IKFL SYGGKI+PR  DGKLRY GG TRVLSVDR
Sbjct  6     NSTIKFLYSYGGKIVPRSSDGKLRYVGGYTRVLSVDR  42



>ref|XP_010427847.1| PREDICTED: uncharacterized protein LOC104712615 [Camelina sativa]
Length=179

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  1261  PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             PS + ++KFLCSYGG+I PR+PDGKLRY+GG+TRVLSV R
Sbjct  3     PSKSTTVKFLCSYGGRITPRYPDGKLRYHGGDTRVLSVTR  42


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG--SIKIRAF  727
             TEL  K+  + G +VS LRCQLP +DLDALV++TSDEDL NL+EEYD      +KIR F
Sbjct  46   FTELASKISAVCGMTVSTLRCQLPTDDLDALVTVTSDEDLNNLMEEYDLASMTPVKIRVF  105



>ref|XP_002887319.1| hypothetical protein ARALYDRAFT_894881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63578.1| hypothetical protein ARALYDRAFT_894881 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS--IKIRAF  727
             TEL  KLGE+ G +VS LRCQLP +DLDALV+++SDEDL NL+EEYD   +  +KI  F
Sbjct  45   FTELTKKLGEICGIAVSSLRCQLPTDDLDALVTVSSDEDLKNLMEEYDIATTTHVKIHVF  104


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSY G+I PR+PDGKLRY GG TRVLSV R
Sbjct  7     TVKFLCSYDGRITPRYPDGKLRYQGGHTRVLSVPR  41



>gb|EEC76732.1| hypothetical protein OsI_14765 [Oryza sativa Indica Group]
Length=216

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
              EL  KL EM G  +V LRCQLP EDLDALVS+T D+DLANL+EEY     DR   +KI
Sbjct  79   FHELQRKLREMCGWEAVCLRCQLPTEDLDALVSVTGDDDLANLLEEYDAASRDRLQPLKI  138

Query  735  RAF  727
            RAF
Sbjct  139  RAF  141


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGG+ILPRH DG LRY GG+ RV+SVDR
Sbjct  42    VKFLCSYGGRILPRHADGALRYVGGDNRVVSVDR  75



>gb|KFK34129.1| hypothetical protein AALP_AA5G105000 [Arabis alpina]
Length=182

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
              EL+VKL E  G SV L+CQLP  DL+ L+S+ SDEDL N++EEYDR    KIRA 
Sbjct  44   FAELMVKLEEFCGYSVELKCQLPNGDLETLISVKSDEDLTNIVEEYDRLHGGKIRAI  100


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++    KFLCSYGGKILPR  DG LRY GG TRVLSVDR
Sbjct  2     ATNHKTKFLCSYGGKILPRSIDGNLRYVGGFTRVLSVDR  40



>gb|AAX96259.1| PB1 domain, putative [Oryza sativa Japonica Group]
 gb|ABA93295.1| PB1 domain containing protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ29667.1| hypothetical protein OsJ_13729 [Oryza sativa Japonica Group]
 dbj|BAH01706.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 44/63 (70%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
              EL  KL EM G  +V LRCQLP EDLDALVS+T D+DLANL+EEY     DR   +KI
Sbjct  79   FHELQRKLREMCGWEAVCLRCQLPTEDLDALVSVTGDDDLANLLEEYDAASRDRLQPLKI  138

Query  735  RAF  727
            RAF
Sbjct  139  RAF  141


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGG+ILPRH DG LRY GG+ RV+SVDR
Sbjct  42    VKFLCSYGGRILPRHADGALRYVGGDNRVVSVDR  75



>ref|NP_190407.1| Octicosapeptide/Phox/Bem1p family protein [Arabidopsis thaliana]
 emb|CAB41174.1| putative protein [Arabidopsis thaliana]
 gb|AAT41790.1| At3g48240 [Arabidopsis thaliana]
 gb|AAU29476.1| At3g48240 [Arabidopsis thaliana]
 gb|AEE78390.1| Octicosapeptide/Phox/Bem1p family protein [Arabidopsis thaliana]
Length=180

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL +KL E  G SV L+CQLP  DL+ L+S+ SDEDL N++EEYDR    KIRA 
Sbjct  51   FTELTMKLEEFCGYSVELKCQLPNGDLETLISVKSDEDLVNIVEEYDRVYGGKIRAI  107


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             +  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV
Sbjct  10    TKNSLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSV  45



>gb|EAY92969.1| hypothetical protein OsI_14763 [Oryza sativa Indica Group]
Length=224

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = -2

Query  891  ELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRA  730
            EL  KL EM G  +V LRCQLP EDLDALVS+T D+DLANL+EEY     DR   +KIRA
Sbjct  79   ELQRKLREMCGWEAVCLRCQLPTEDLDALVSVTGDDDLANLLEEYDAASRDRLQPLKIRA  138

Query  729  F  727
            F
Sbjct  139  F  139


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGG+ILPRH DG LRY GG+ RV+SVDR
Sbjct  40    VKFLCSYGGRILPRHADGVLRYVGGDNRVVSVDR  73



>gb|AES71442.2| PB1 domain protein [Medicago truncatula]
Length=204

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKIR  733
             +EL+VKL E+ G+SV+LRCQLP  DL+ L+SIT+DEDL N+I+EY+R        +KI+
Sbjct  46   FSELMVKLEELCGSSVTLRCQLPNGDLETLISITNDEDLTNIIDEYERASLKLTHPLKIK  105

Query  732  AF  727
            A 
Sbjct  106  AI  107



>ref|XP_002864838.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41097.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+ KL E  G SV LRCQLP  DL+ L+S+ S+E+LAN++EEYDR    KIRA
Sbjct  52   FSELMKKLYEFCGYSVDLRCQLPNGDLETLISVKSEEELANIVEEYDRISGAKIRA  107


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D    +S  S+KFLCSYGG+I PR  DGKLRY GG TRVLSVDR
Sbjct  4     VDYTEKNSGSSLKFLCSYGGRIFPRSTDGKLRYVGGHTRVLSVDR  48



>ref|XP_002321629.1| octicosapeptide/Phox/Bem1p domain-containing family protein [Populus 
trichocarpa]
 gb|EEF05756.1| octicosapeptide/Phox/Bem1p domain-containing family protein [Populus 
trichocarpa]
Length=175

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRAF  727
            EL+VKLGE  G SV LRC LP  DL+ L+S+ SDE+L NLI EYDR C   KIRA 
Sbjct  52   ELMVKLGEFCGFSVELRCPLPNGDLETLISVKSDEELTNLITEYDRSCPGSKIRAI  107


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +++KFLCSY GK+LPR  DG LRY GG TRVL+VDR
Sbjct  8     AKAETLKFLCSYSGKLLPRSSDGVLRYVGGMTRVLAVDR  46



>ref|XP_011046225.1| PREDICTED: uncharacterized protein LOC105140885 [Populus euphratica]
Length=177

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRA  730
            EL+VKLGE  G SV LRC LP  DL+ L+S+ SDE+L NLI EYDR C   KIRA
Sbjct  52   ELMVKLGEFCGFSVELRCPLPNGDLETLISVKSDEELTNLITEYDRSCPGSKIRA  106


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  +++KFLCSY GK+LPR  DG LRY GG TRVL+VDR
Sbjct  8     TKAETLKFLCSYSGKLLPRSSDGVLRYVGGMTRVLAVDR  46



>gb|EMS46138.1| hypothetical protein TRIUR3_21026 [Triticum urartu]
Length=201

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = -1

Query  1306  FSFVSPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             F  V P S      G ++  S+KFLCSYGG ILPRHPDG LRY GG  RVLSVDR
Sbjct  26    FCVVKPGS-----PGAAAEGSVKFLCSYGGMILPRHPDGALRYVGGNNRVLSVDR  75


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKI  736
              EL  KL +M G  ++SLRCQLP EDLDALVS+T+++DL +L+EEY     DR   +KI
Sbjct  79   FHELQRKLTDMCGWEALSLRCQLPTEDLDALVSVTTNDDLGHLLEEYDAASRDRLQPLKI  138

Query  735  RAF  727
            RAF
Sbjct  139  RAF  141



>ref|XP_003601191.1| hypothetical protein MTR_3g077030 [Medicago truncatula]
Length=257

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
             +EL+VKL E+ G+SV+LRCQLP  DL+ L+SIT+DEDL N+I+EY+R 
Sbjct  46   FSELMVKLEELCGSSVTLRCQLPNGDLETLISITNDEDLTNIIDEYERA  94



>ref|XP_010515139.1| PREDICTED: uncharacterized protein LOC104791038 [Camelina sativa]
Length=186

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL+VKL E  G +V L+CQLP  DL+ L+SI SDEDL N++E YDR    KIRA 
Sbjct  54   FTELMVKLEEFCGYAVELKCQLPNGDLETLISIKSDEDLVNIVEVYDRVHGGKIRAI  110


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             +KFLCSY G+ILPR  DGKLRY GG TRVLSV
Sbjct  17    LKFLCSYSGRILPRSIDGKLRYVGGFTRVLSV  48



>ref|XP_010045524.1| PREDICTED: uncharacterized protein LOC104434250 [Eucalyptus grandis]
 gb|KCW83291.1| hypothetical protein EUGRSUZ_B00226 [Eucalyptus grandis]
Length=221

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SS  ++KFLCSYGGKILPR PDGKLRY GG TR+L+VDR
Sbjct  15    SSAAALKFLCSYGGKILPRRPDGKLRYVGGVTRILAVDR  53


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  894  TELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYD  757
             EL+ KL E  G+ V+ L+C+LP  DL+ LVS+ SDEDLANLIEEYD
Sbjct  58   AELMAKLAEFCGSPVAALKCKLPGGDLETLVSVKSDEDLANLIEEYD  104



>ref|NP_177221.1| octicosapeptide/Phox/Bem1p (PB1) domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG52322.1|AC011663_1 unknown protein; 68334-67702 [Arabidopsis thaliana]
 gb|AAG52477.1|AC010796_16 unknown protein; 86168-86800 [Arabidopsis thaliana]
 gb|ABR46202.1| At1g70640 [Arabidopsis thaliana]
 gb|AEE35093.1| octicosapeptide/Phox/Bem1p (PB1) domain-containing protein [Arabidopsis 
thaliana]
Length=174

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASV-SLRCQLPAEDLDALVSITSDEDLANLIEEYDRC--GSIKIRAF  727
             TEL  KLGE+ G +V SLRCQLP +DLDALV++ SDEDL NL+EEYD      +KI  F
Sbjct  45   FTELKKKLGEICGIAVTSLRCQLPTDDLDALVTVRSDEDLKNLMEEYDLAITAQVKIHVF  104


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +T ++KFLCSYGG+I PR+PDGKLRY GG+TRVLSV R
Sbjct  4     NTTTVKFLCSYGGRITPRYPDGKLRYQGGDTRVLSVTR  41



>ref|XP_002450710.1| hypothetical protein SORBIDRAFT_05g012960 [Sorghum bicolor]
 gb|EES09698.1| hypothetical protein SORBIDRAFT_05g012960 [Sorghum bicolor]
Length=236

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 5/60 (8%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRAF  727
            +L  K+ E+ G    LRCQLP EDLDAL+S+T D+DLANL++EY     DR  S+KIRAF
Sbjct  81   DLQRKMRELCGWEAYLRCQLPTEDLDALISVTCDDDLANLLQEYDEASKDRLQSLKIRAF  140


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+KFLCSYGG+ILPRH DG LRY GG+ RVLSVDR
Sbjct  41    SVKFLCSYGGRILPRHTDGTLRYVGGDNRVLSVDR  75



>ref|XP_009149832.1| PREDICTED: uncharacterized protein LOC103873161 [Brassica rapa]
Length=183

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+VKL E  G +V L+CQLP  DL+ L+S+ SDEDL N++EEY+R    KIRA
Sbjct  48   FSELMVKLEEFCGYAVDLKCQLPDGDLETLISVKSDEDLTNIVEEYNRVYGGKIRA  103


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             S  ++KFLCSYGG+ILPR  DGKLRY GG TRVLSV
Sbjct  7     SESNLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSV  42



>ref|XP_006394311.1| hypothetical protein EUTSA_v10004971mg [Eutrema salsugineum]
 gb|ESQ31597.1| hypothetical protein EUTSA_v10004971mg [Eutrema salsugineum]
Length=189

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D    SS  S+KFLCSYGG+ILPR+ DGKLRY GG TRVLSVDR
Sbjct  4     VDYNEKSSGSSLKFLCSYGGRILPRYTDGKLRYVGGHTRVLSVDR  48


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
              EL+ KL E  G SV LRCQLP  DL+ L+S+ S+EDLA ++EEYDR    KIRA
Sbjct  52   FQELMKKLFEFCGYSVDLRCQLPNGDLETLISVKSEEDLAIIVEEYDRVSGAKIRA  107



>ref|NP_001067822.1| Os11g0444700 [Oryza sativa Japonica Group]
 gb|AAX96261.1| PB1 domain, putative [Oryza sativa Japonica Group]
 gb|ABA93293.1| PB1 domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28185.1| Os11g0444700 [Oryza sativa Japonica Group]
 gb|EAZ29666.1| hypothetical protein OsJ_13728 [Oryza sativa Japonica Group]
 dbj|BAG89974.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96971.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 6/61 (10%)
 Frame = -2

Query  891  ELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRA  730
            EL  KL EM G  +V LRCQLP EDLDALVS+  D+DLANL+EEY     DR   +KIRA
Sbjct  79   ELQRKLREMCGWEAVCLRCQLPTEDLDALVSVNGDDDLANLLEEYDAASRDRLQPLKIRA  138

Query  729  F  727
            F
Sbjct  139  F  139


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGG+ILPRH DG LRY GG+ RV+SVDR
Sbjct  40    VKFLCSYGGRILPRHADGALRYVGGDNRVVSVDR  73



>emb|CDY48161.1| BnaA06g16720D [Brassica napus]
Length=183

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+VKL E  G +V L+CQLP  DL+ L+S+ SDEDL N++EEY+R    KIRA
Sbjct  48   FSELMVKLEEFCGYAVDLKCQLPDGDLETLISVKSDEDLTNIVEEYNRVYGGKIRA  103


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV
Sbjct  7     SESSLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSV  42



>emb|CDY39571.1| BnaCnng09400D [Brassica napus]
Length=183

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+VKL E  G +V L+CQLP  DL+ L+S+ SDEDL N++EEY+R    KIRA
Sbjct  48   FSELMVKLEEFCGYAVDLKCQLPDGDLETLISVKSDEDLTNIVEEYNRVYGGKIRA  103


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSV
Sbjct  7     SESSLKFLCSYGGRILPRSIDGKLRYVGGFTRVLSV  42



>ref|XP_006662873.1| PREDICTED: uncharacterized protein LOC102718029 [Oryza brachyantha]
Length=229

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  1273  DMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + A  ++  S+KFLCSYGGKILPRH DG LRY GG+ RV+SVDR
Sbjct  32    NTANAAAEGSVKFLCSYGGKILPRHGDGALRYVGGDNRVVSVDR  75


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = -2

Query  891  ELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRA  730
            EL  KL EM G  +V +RCQLP EDLDAL+S+T+D+DL NL++EY     DR   +KIRA
Sbjct  81   ELQRKLREMCGWEAVCVRCQLPTEDLDALISVTTDDDLTNLLDEYDAASRDRLQPLKIRA  140

Query  729  F  727
            F
Sbjct  141  F  141



>dbj|BAJ98172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=201

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = -1

Query  1264  GPSSTK-SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             GP + + S+KFLCSYGG ILPRHPDG LRY GG  RVLSVDR
Sbjct  35    GPGAAEGSVKFLCSYGGMILPRHPDGALRYVGGNNRVLSVDR  76


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = -2

Query  891  ELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRA  730
            EL  KL +M G  ++SLRCQLP EDLDALVS+T+++DL +L+EEY     DR   +KIRA
Sbjct  82   ELQRKLTDMCGWEAMSLRCQLPTEDLDALVSVTTNDDLGHLLEEYDAASRDRLQPLKIRA  141

Query  729  F  727
            F
Sbjct  142  F  142



>ref|XP_006302894.1| hypothetical protein CARUB_v10021024mg [Capsella rubella]
 gb|EOA35792.1| hypothetical protein CARUB_v10021024mg [Capsella rubella]
Length=179

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVS-LRCQLPAEDLDALVSITSDEDLANLIEEYDRCG--SIKIRAF  727
             TEL  K+ ++ G  V+ LRCQLP +DLDALV++TSDEDL NL+EEYD      +KIR F
Sbjct  45   FTELASKISDVCGMVVTTLRCQLPTDDLDALVTVTSDEDLTNLMEEYDLASMTPVKIRVF  104


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++KFLCSYGG+I PR+PDGKLRY+GG+TRVLSV R
Sbjct  7     TVKFLCSYGGRITPRYPDGKLRYHGGDTRVLSVSR  41



>ref|XP_010459891.1| PREDICTED: uncharacterized protein LOC104740863 [Camelina sativa]
Length=197

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+ KL E  G SV LRCQLP  DL+ L+S+ S+E+L+N++EEYDR    KIRA
Sbjct  54   FSELMKKLFEFCGYSVDLRCQLPNGDLETLISVKSEEELSNIVEEYDRLTGAKIRA  109


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S + ++KFLCSYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  12    SGSSNLKFLCSYGGRILPRSTDGNLRYVGGHTRVLSVDR  50



>ref|XP_009348481.1| PREDICTED: uncharacterized protein LOC103940131 [Pyrus x bretschneideri]
Length=161

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = -2

Query  852  VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS---IKIR  733
            VSLRCQLP EDLDALVSI SDEDL NLIEEYDR  S   +KIR
Sbjct  66   VSLRCQLPTEDLDALVSIKSDEDLVNLIEEYDRAASSANLKIR  108



>ref|XP_002981765.1| hypothetical protein SELMODRAFT_59129, partial [Selaginella moellendorffii]
 gb|EFJ17247.1| hypothetical protein SELMODRAFT_59129, partial [Selaginella moellendorffii]
Length=86

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
            EL++K+ + YG  +SL+ QLP EDLDAL+S+++DEDL N++EEYDR 
Sbjct  40   ELMLKMKKHYGEDLSLKYQLPNEDLDALISVSTDEDLQNMMEEYDRL  86


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +K +CS+GG+ILPR  DGKLRY GGETR++S+ R
Sbjct  1     VKLMCSFGGRILPRPSDGKLRYVGGETRIVSLKR  34



>ref|XP_010484035.1| PREDICTED: uncharacterized protein LOC104762450 isoform X1 [Camelina 
sativa]
 ref|XP_010484037.1| PREDICTED: uncharacterized protein LOC104762450 isoform X2 [Camelina 
sativa]
Length=201

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+ KL E  G SV LRCQLP  DL+ L+S+ S+E+L+N++EEYDR    KIRA
Sbjct  53   FSELMKKLFEFCGYSVDLRCQLPNGDLETLISVKSEEELSNIVEEYDRLTGSKIRA  108


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S  ++KFLCSYGG+ILPR  DG LRY GG TRVLSVDR
Sbjct  11    NSGSNLKFLCSYGGRILPRSTDGNLRYVGGHTRVLSVDR  49



>ref|XP_010678864.1| PREDICTED: uncharacterized protein LOC104894347 [Beta vulgaris 
subsp. vulgaris]
Length=204

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIR  733
             +EL+ KL  + G +V+LRCQLP EDLD LV++ SD+DLAN+IEEY++   I     KIR
Sbjct  50   FSELMSKLENLCGYAVNLRCQLPGEDLDVLVTMKSDDDLANIIEEYEKASLISGKEKKIR  109

Query  732  AF  727
            A 
Sbjct  110  AI  111


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++ +IKFL SYGGKILPR  DG LRY GG TRV+ V R
Sbjct  9     TSNTIKFLYSYGGKILPRPIDGCLRYVGGLTRVICVHR  46



>ref|XP_006281149.1| hypothetical protein CARUB_v10027182mg [Capsella rubella]
 gb|EOA14047.1| hypothetical protein CARUB_v10027182mg [Capsella rubella]
Length=193

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
             +EL+ KL E  G +V LRCQLP  DL+ L+S+ S+E+L+N++EEYDR    KIRA
Sbjct  52   FSELMKKLFEFCGYAVDLRCQLPNGDLETLISVKSEEELSNIVEEYDRLTGAKIRA  107


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D    +S  ++KFLCSYGG+ILPR  DGKLRY GG TRVLSVDR
Sbjct  4     VDYNEKNSGSNLKFLCSYGGRILPRSTDGKLRYVGGHTRVLSVDR  48



>emb|CDY48129.1| BnaCnng15710D [Brassica napus]
Length=191

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D     S  S+KFLCSYGGKILPR  DGKLRY GG TRVLSVDR
Sbjct  5     VDANEKKSGSSLKFLCSYGGKILPRSTDGKLRYVGGHTRVLSVDR  49


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL  KL E  G SV LRCQLP  DL+ L+S+ SDE+LAN++E Y+R    KI+A
Sbjct  55   ELTKKLFEFCGYSVDLRCQLPNGDLETLISVKSDEELANIVELYNRVSGSKIKA  108



>ref|XP_002511328.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51930.1| ATP binding protein, putative [Ricinus communis]
Length=181

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRA  730
              EL+VKLGE  G SV LRCQLP  DL+ L+SI S+E+L  LIEEY+R C   KIRA
Sbjct  50   FAELMVKLGEFCGYSVELRCQLPNGDLETLISIKSEEELRFLIEEYNRNCRGSKIRA  106


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S   ++KFLCSYGGKI+PR  DG LRY GG TRVL+VDR
Sbjct  8     SKRSTLKFLCSYGGKIVPRSIDGSLRYVGGLTRVLAVDR  46



>ref|XP_003522400.1| PREDICTED: uncharacterized protein LOC100810563 [Glycine max]
Length=194

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
            EL+VKL    G+SV LRCQLP  DL+ L+SIT+DEDLA++IEEYDR
Sbjct  48   ELMVKLRVFCGSSVILRCQLPKGDLETLISITNDEDLASIIEEYDR  93


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              ++IK LCSYGGKILPR  DG+LRY GG TRVL+VDR
Sbjct  6     AQTIKLLCSYGGKILPRATDGELRYVGGHTRVLTVDR  42



>ref|XP_010426312.1| PREDICTED: uncharacterized protein LOC104711318 [Camelina sativa]
Length=184

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
            EL+VKL E  G +V L+CQLP  DL+ L+SI SDEDL N++E YDR    KIRA 
Sbjct  55   ELMVKLEEFCGYAVELKCQLPNGDLETLISIRSDEDLLNIVEVYDRVHGGKIRAI  109


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             +  ++KFLCSY G+ILPR  DGKLRY GG TRVLSV
Sbjct  12    NNNTLKFLCSYSGRILPRSIDGKLRYVGGFTRVLSV  47



>gb|KFK25760.1| hypothetical protein AALP_AA8G156000 [Arabis alpina]
Length=184

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL+ KL +  G +V L+CQLP  DL+ L++I S+ED++N++EEYDR  ++KIRA
Sbjct  54   ELMKKLVDFCGYTVDLKCQLPNGDLETLITIKSEEDVSNIVEEYDRVSNLKIRA  107


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D    ++  S+KFLCSYGGKILPR  DGKLRY GG TRVLSV R
Sbjct  4     ADYTEKNNGSSLKFLCSYGGKILPRSTDGKLRYVGGHTRVLSVHR  48



>ref|XP_007155477.1| hypothetical protein PHAVU_003G204600g [Phaseolus vulgaris]
 gb|ESW27471.1| hypothetical protein PHAVU_003G204600g [Phaseolus vulgaris]
Length=232

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +E++VK+ E+ G+  +LRC LP  DLD L+S+ +DEDLAN+IE YDR  S     +KIR
Sbjct  48   FSEMMVKISELCGSPATLRCPLPNGDLDTLISVKNDEDLANIIEVYDRASSFLPHRLKIR  107

Query  732  AF  727
            A 
Sbjct  108  AI  109


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  1252  TKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
               +IKFLCSYGGKILPR  DG LRYYGG TRVL++
Sbjct  8     NNTIKFLCSYGGKILPRRTDGILRYYGGHTRVLAL  42



>ref|XP_010503454.1| PREDICTED: uncharacterized protein LOC104780636 [Camelina sativa]
Length=178

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRAF  727
             TEL+ KL E  G +V L+CQLP  DL+ L+SI SDEDL N++E YDR    KIRA 
Sbjct  48   FTELMSKLEEFCGYAVELKCQLPNGDLETLISIRSDEDLLNIVEVYDRVHGGKIRAI  104


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             +A   +  ++KFLCSY G+ILPR  DGKLRY GG TRVLSV
Sbjct  2     VAISENNNTLKFLCSYSGRILPRSIDGKLRYVGGFTRVLSV  42



>ref|XP_009362945.1| PREDICTED: uncharacterized protein LOC103952957 [Pyrus x bretschneideri]
Length=229

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAF  727
            TEL+ KL E  G SV L+C LP  DL+ L+++ SDEDL N+IEEYDR  S    +KIRA 
Sbjct  48   TELMEKLKEFCGYSVELKCPLPNGDLETLIAVKSDEDLTNIIEEYDRASSLPRPLKIRAI  107


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 34/64 (53%), Gaps = 13/64 (20%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDRsisfsskffiwfcFLSCFEIGTFLWN  1064
             +K LCSYGGKILPRH D  LRY GG  RVL+VD               ++C E+   L  
Sbjct  10    LKILCSYGGKILPRHSDCTLRYVGGHNRVLTVD-------------SSITCTELMEKLKE  56

Query  1063  FLVY  1052
             F  Y
Sbjct  57    FCGY  60



>ref|XP_011101288.1| PREDICTED: uncharacterized protein LOC105179375 [Sesamum indicum]
Length=193

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  1267  AGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + P +  +IKFLCSYGGKI+PR  DG+LRY GG+TRVLSVDR
Sbjct  7     SSPKAPTTIKFLCSYGGKIVPRPTDGELRYVGGQTRVLSVDR  48


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRA  730
            EL+VK GE+ G+S+ L+C+LP+EDLD L+SI S+E+L ++I EYDR     KIRA
Sbjct  54   ELMVKFGELCGSSMDLKCKLPSEDLDVLISIKSEEELRSVIGEYDRVSPEAKIRA  108



>ref|NP_201118.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB10555.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42028.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39954.1| At5g63130 [Arabidopsis thaliana]
 gb|AED97708.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis 
thaliana]
Length=192

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              D    +S  S+KFLCSYGG+ILPR  DGKLRY GG TRVLSVDR
Sbjct  4     VDYTEKNSGSSLKFLCSYGGRILPRSTDGKLRYVGGHTRVLSVDR  48



>ref|XP_003549597.2| PREDICTED: uncharacterized protein LOC100815502 [Glycine max]
Length=264

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-----IKIR  733
             +EL++KL E+  + V+L+C LP  DLD L+S+TSDEDLAN+I  YDR  S     +KIR
Sbjct  113  FSELILKLTELCASPVTLKCPLPNGDLDTLISVTSDEDLANIIHLYDRASSSLPHRLKIR  172

Query  732  A  730
            A
Sbjct  173  A  173


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  1291  PKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             PKS ++ M   +   +IK L SYGGKILPRH D KLRYYGG TRVLS+
Sbjct  60    PKSRDSIMESKAIDNTIKILYSYGGKILPRHTDAKLRYYGGHTRVLSL  107



>ref|XP_004308815.1| PREDICTED: uncharacterized protein LOC101305707 [Fragaria vesca 
subsp. vesca]
Length=203

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRAF  727
            GA+V LRCQLP +DLD L+SI +DEDLAN++EEYD   + +KIRA 
Sbjct  62   GATVVLRCQLPTDDLDTLISIKNDEDLANIVEEYDTAATPLKIRAI  107


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +  ++KFL SYGGKILPRHPDGKLRY+GG TRVL+V R
Sbjct  9     TNHTLKFLYSYGGKILPRHPDGKLRYHGGTTRVLAVPR  46



>ref|NP_001067823.1| Os11g0444900 [Oryza sativa Japonica Group]
 gb|AAM09528.1| susceptibility antioxidant protein [Oryza sativa Indica Group]
 dbj|BAF28186.1| Os11g0444900, partial [Oryza sativa Japonica Group]
Length=108

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCSYGG+ILPRH DG LRY GG+ RV+SVDR
Sbjct  22    VKFLCSYGGRILPRHADGALRYVGGDNRVVSVDR  55


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGA-SVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL  KL EM G  +V LRCQLP EDLDALVS+T D+DLANL+EEYD
Sbjct  61   ELQRKLREMCGWEAVCLRCQLPTEDLDALVSVTGDDDLANLLEEYD  106



>emb|CDY72321.1| BnaAnng40670D [Brassica napus]
Length=179

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  1276  TDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
              D     S  S+KFLCSYGGKILPR  DGKLRY GG TRVLSVD
Sbjct  5     VDANEKKSGSSLKFLCSYGGKILPRSTDGKLRYVGGHTRVLSVD  48


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL  KL E  G SV LRCQLP  DL+ L+S+ SDE+L N++E ++R    KI+A
Sbjct  55   ELTKKLFEFCGYSVDLRCQLPNGDLETLISVKSDEELTNIVELHNRVSGAKIKA  108



>ref|XP_011047807.1| PREDICTED: uncharacterized protein LOC105142057 [Populus euphratica]
 ref|XP_011047808.1| PREDICTED: uncharacterized protein LOC105142057 [Populus euphratica]
Length=175

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRAF  727
            EL+VKLGE  G SV LRCQLP  DL+ L+S+ S+++L +LI E+DR C   KIRA 
Sbjct  53   ELMVKLGEFCGYSVELRCQLPDGDLETLISVKSEDELKSLITEFDRSCPGSKIRAI  108


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  1273  DMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             D    +  +++KFLCSYGGKILPR  DG LRY GG TRVL+VDR
Sbjct  4     DCKTKTKPETLKFLCSYGGKILPRSSDGVLRYVGGLTRVLAVDR  47



>ref|XP_008392895.1| PREDICTED: uncharacterized protein LOC103455081 [Malus domestica]
Length=226

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAF  727
            TEL+ KL E  G SV L+C LP  DL+ L+++ SDEDLAN+IEEY R  S    +KIRA 
Sbjct  48   TELMEKLKEFCGYSVELKCPLPNGDLETLIAVKSDEDLANIIEEYGRASSPPRPLKIRAI  107


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 13/64 (20%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDRsisfsskffiwfcFLSCFEIGTFLWN  1064
             +K LCSYGGKILPRH DG LRY GG  RVL+VD               ++C E+   L  
Sbjct  10    LKILCSYGGKILPRHSDGTLRYVGGHNRVLAVD-------------SSITCTELMEKLKE  56

Query  1063  FLVY  1052
             F  Y
Sbjct  57    FCGY  60



>ref|XP_004515869.1| PREDICTED: uncharacterized protein LOC101504255 [Cicer arietinum]
Length=197

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-----SIKIR  733
             +EL+VKL E+ G+SV+L+  LP  DL+ L+SITSDEDL N+I+EY+R        +KIR
Sbjct  47   FSELIVKLVELCGSSVTLKSPLPNGDLETLISITSDEDLTNIIQEYNRASLSLTHPLKIR  106

Query  732  A  730
            A
Sbjct  107  A  107


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  1270  MAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSV  1148
             M   +   +IKFLCSYGG ILPR  DGKLRY+GG TRVL++
Sbjct  1     MESNTKNTTIKFLCSYGGIILPRLTDGKLRYFGGHTRVLAL  41



>ref|XP_008375507.1| PREDICTED: uncharacterized protein LOC103438742 [Malus domestica]
Length=126

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAF  727
            TEL+ KL E  G SV L+C LP  DL+ ++++ SDEDLAN+IEEY R  S    +KIRA 
Sbjct  50   TELVEKLKEFCGYSVELKCPLPNGDLETMITVKSDEDLANIIEEYGRASSPLRPLKIRAI  109



>ref|XP_002993953.1| hypothetical protein SELMODRAFT_137907, partial [Selaginella 
moellendorffii]
 gb|EFJ05000.1| hypothetical protein SELMODRAFT_137907, partial [Selaginella 
moellendorffii]
Length=172

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  900  VITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
             + ELL KL ++ G S+  + QLP EDLDALVS+ SDEDL N++EEYDR 
Sbjct  83   TLRELLQKLRKLTGKSMLFKYQLPGEDLDALVSVKSDEDLDNMMEEYDRL  132


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  1294  SPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+S+ +  +   S   +K +CSYGGKILPR  D +LRY GGETR++ VDR
Sbjct  30    SPRSDSSTKSDELSNIRVKLMCSYGGKILPRPNDSQLRYMGGETRIVVVDR  80



>ref|XP_010037518.1| PREDICTED: uncharacterized protein LOC104426229 isoform X1 [Eucalyptus 
grandis]
 gb|KCW49229.1| hypothetical protein EUGRSUZ_K02802 [Eucalyptus grandis]
Length=194

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL+VKL E  G SV+LRC LP  DL+ L+S+ SDEDLANLI EYD
Sbjct  54   ELMVKLMEFCGFSVALRCALPDGDLETLISVKSDEDLANLIAEYD  98


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -1

Query  1285  SEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +E +D +  SST  +KFLCSYGGKI  R  DG+LRY GG TR+LSVDR
Sbjct  3     TEPSDSSKTSST--LKFLCSYGGKIALRKSDGELRYVGGFTRILSVDR  48



>ref|NP_001148216.1| octicosapeptide/Phox/Bem1p [Zea mays]
 gb|ACG30208.1| octicosapeptide/Phox/Bem1p [Zea mays]
Length=225

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 5/50 (10%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRAF  727
            G    LRCQLP EDLDAL+S+T D+DLA L+EEY     DR  S+KIRAF
Sbjct  93   GWEAHLRCQLPTEDLDALISVTCDDDLAKLLEEYDEASKDRLQSLKIRAF  142


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+KFLCSYGG+ILPR  DG LRY GG+ RVLSVDR
Sbjct  42    SVKFLCSYGGRILPRRTDGTLRYVGGDNRVLSVDR  76



>gb|AFW60724.1| octicosapeptide/Phox/Bem1p [Zea mays]
Length=228

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 5/50 (10%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEY-----DRCGSIKIRAF  727
            G    LRCQLP EDLDAL+S+T D+DLA L+EEY     DR  S+KIRAF
Sbjct  97   GWEAHLRCQLPTEDLDALISVTCDDDLAKLLEEYDEASKDRLQSLKIRAF  146


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+KFLCSYGG+ILPR  DG LRY GG+ RVLSVDR
Sbjct  46    SVKFLCSYGGRILPRRTDGTLRYVGGDNRVLSVDR  80



>gb|KCW49228.1| hypothetical protein EUGRSUZ_K02802 [Eucalyptus grandis]
Length=252

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL+VKL E  G SV+LRC LP  DL+ L+S+ SDEDLANLI EYD
Sbjct  54   ELMVKLMEFCGFSVALRCALPDGDLETLISVKSDEDLANLIAEYD  98


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -1

Query  1285  SEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +E +D +  SST  +KFLCSYGGKI  R  DG+LRY GG TR+LSVDR
Sbjct  3     TEPSDSSKTSST--LKFLCSYGGKIALRKSDGELRYVGGFTRILSVDR  48



>ref|XP_002318066.2| hypothetical protein POPTR_0012s08690g [Populus trichocarpa]
 gb|EEE96286.2| hypothetical protein POPTR_0012s08690g [Populus trichocarpa]
Length=253

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR-CGSIKIRAF  727
            EL+VKLGE  G SV LRCQLP  DL+ L+S+ S+++L +LI E+DR C   KIRA 
Sbjct  131  ELMVKLGEFCGYSVELRCQLPDGDLETLISVKSEDELKSLILEFDRSCPGSKIRAI  186


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  1273  DMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             D    +  +++KFLCSYGGKILPR  DG LRY GG TRVL+VDR
Sbjct  82    DCKTKTKPETLKFLCSYGGKILPRSSDGVLRYVGGLTRVLAVDR  125



>ref|XP_010037519.1| PREDICTED: uncharacterized protein LOC104426229 isoform X2 [Eucalyptus 
grandis]
Length=128

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL+VKL E  G SV+LRC LP  DL+ L+S+ SDEDLANLI EYD
Sbjct  54   ELMVKLMEFCGFSVALRCALPDGDLETLISVKSDEDLANLIAEYD  98


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -1

Query  1285  SEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +E +D +  SST  +KFLCSYGGKI  R  DG+LRY GG TR+LSVDR
Sbjct  3     TEPSDSSKTSST--LKFLCSYGGKIALRKSDGELRYVGGFTRILSVDR  48



>gb|AFW60723.1| hypothetical protein ZEAMMB73_447142 [Zea mays]
Length=130

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+KFLCSYGG+ILPR  DG LRY GG+ RVLSVDR
Sbjct  46    SVKFLCSYGGRILPRRTDGTLRYVGGDNRVLSVDR  80



>ref|XP_009112066.1| PREDICTED: uncharacterized protein LOC103837458 [Brassica rapa]
Length=191

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  1273  DMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             D     S  S+KFLCSYGGKILPR  DGKLRY GG TRVLS+D
Sbjct  6     DANEKKSGSSLKFLCSYGGKILPRSTDGKLRYVGGHTRVLSLD  48


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIRA  730
            EL  KL E  G SV LRCQLP  DL+ L+S+ SDE+L N++E ++R    KI+A
Sbjct  55   ELTKKLLEFCGYSVDLRCQLPNGDLETLISVKSDEELTNIVELHNRVSGAKIKA  108



>gb|ABK25040.1| unknown [Picea sitchensis]
Length=318

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 7/51 (14%)
 Frame = -1

Query  1273  DMAGPSSTKS-------IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             D   P+STKS       +KFLCSYGGKILPR  DG+LRY GGETR+++VDR
Sbjct  4     DDITPASTKSGDLWGYKMKFLCSYGGKILPRPSDGQLRYVGGETRLVTVDR  54



>gb|EYU22177.1| hypothetical protein MIMGU_mgv1a013453mg [Erythranthe guttata]
Length=220

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS-IKIRA  730
            +EL+VK GE  G+S++L C+LP EDLD LV+I SDE+L  ++EEY R     KIRA
Sbjct  50   SELIVKFGESCGSSMNLTCKLPTEDLDVLVTIKSDEELRIVVEEYGRASPEEKIRA  105


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S K+IKFL SYGG+I+PR  DGKLRY GG TRVL+VDR
Sbjct  8     SVKTIKFLYSYGGRIIPRPIDGKLRYVGGYTRVLAVDR  45



>gb|EYU33942.1| hypothetical protein MIMGU_mgv1a011605mg [Erythranthe guttata]
Length=276

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 5/59 (8%)
 Frame = -2

Query  888  LLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIRAF  727
            LL KL ++YG ASV ++ QLP EDLDAL+++T+DED+ N++EEYDR      S ++R F
Sbjct  81   LLSKLSKLYGTASVCIKYQLPNEDLDALITVTADEDVENMMEEYDRLSHAPKSARLRLF  139


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  41    VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  74



>ref|XP_001770904.1| predicted protein [Physcomitrella patens]
 gb|EDQ64234.1| predicted protein [Physcomitrella patens]
Length=104

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL++K+GE++    +++ +LP EDLDALVS++S+EDLAN++EEYD
Sbjct  60   ELVLKMGELFSHFHTIKYKLPEEDLDALVSVSSNEDLANMMEEYD  104


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +K LCSYGGKILPR  D +LRY GGETR+++V R
Sbjct  21    VKLLCSYGGKILPRPTDNQLRYVGGETRLITVSR  54



>ref|XP_006467921.1| PREDICTED: uncharacterized protein LOC102609705 isoform X2 [Citrus 
sinensis]
Length=436

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 7/65 (11%)
 Frame = -2

Query  900  VITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SI  742
              + LL KL ++ G+S +S++ QLP EDLDAL+S+T+DED+ N+IEEYDR        S 
Sbjct  73   TFSTLLTKLSKLAGSSNISVKYQLPNEDLDALISVTTDEDVENMIEEYDRLAQNQNTRSA  132

Query  741  KIRAF  727
            ++R F
Sbjct  133  RLRLF  137


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -1

Query  1294  SPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+SE      P  T+ ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  23    SPRSEH--QHDPHLTR-VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  70



>ref|XP_006467922.1| PREDICTED: uncharacterized protein LOC102609705 isoform X3 [Citrus 
sinensis]
Length=433

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 7/65 (11%)
 Frame = -2

Query  900  VITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SI  742
              + LL KL ++ G+S +S++ QLP EDLDAL+S+T+DED+ N+IEEYDR        S 
Sbjct  70   TFSTLLTKLSKLAGSSNISVKYQLPNEDLDALISVTTDEDVENMIEEYDRLAQNQNTRSA  129

Query  741  KIRAF  727
            ++R F
Sbjct  130  RLRLF  134


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -1

Query  1294  SPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+SE      P  T+ ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  20    SPRSEH--QHDPHLTR-VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  67



>emb|CBI14960.3| unnamed protein product [Vitis vinifera]
Length=91

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +S + IKFL SYGGKILPR  DGKLRY GG TRVL+VDR
Sbjct  8     ASNRIIKFLYSYGGKILPRRIDGKLRYVGGHTRVLAVDR  46



>ref|XP_006449189.1| hypothetical protein CICLE_v10015301mg [Citrus clementina]
 ref|XP_006449190.1| hypothetical protein CICLE_v10015301mg [Citrus clementina]
 gb|ESR62429.1| hypothetical protein CICLE_v10015301mg [Citrus clementina]
 gb|ESR62430.1| hypothetical protein CICLE_v10015301mg [Citrus clementina]
Length=433

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  900  VITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
              + LL KL ++ G+S +S++ QLP EDLDAL+S+T+DED+ N+IEEYDR
Sbjct  70   TFSTLLTKLSKLAGSSNISVKYQLPNEDLDALISVTTDEDVENMIEEYDR  119


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  34    VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  67



>ref|XP_006467920.1| PREDICTED: uncharacterized protein LOC102609705 isoform X1 [Citrus 
sinensis]
Length=463

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 7/65 (11%)
 Frame = -2

Query  900  VITELLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SI  742
              + LL KL ++ G+S +S++ QLP EDLDAL+S+T+DED+ N+IEEYDR        S 
Sbjct  100  TFSTLLTKLSKLAGSSNISVKYQLPNEDLDALISVTTDEDVENMIEEYDRLAQNQNTRSA  159

Query  741  KIRAF  727
            ++R F
Sbjct  160  RLRLF  164


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -1

Query  1294  SPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+SE      P  T+ ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  50    SPRSEH--QHDPHLTR-VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  97



>ref|XP_001764223.1| predicted protein [Physcomitrella patens]
 gb|EDQ71064.1| predicted protein [Physcomitrella patens]
Length=100

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            EL++K+ E+Y  + +++ +LP EDLDALVS++S+ED+AN++EEYD
Sbjct  56   ELILKMAELYAQAHTIKYKLPEEDLDALVSVSSNEDVANMMEEYD  100


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 7/50 (14%)
 Frame = -1

Query  1270  MAGPSSTKS-------IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             MA   ST S       +K LCSYGGKILPR  D +LRY GGETR+++V R
Sbjct  1     MADEISTHSEDYSFPRVKLLCSYGGKILPRPTDNQLRYVGGETRLITVSR  50



>ref|XP_003576068.1| PREDICTED: uncharacterized protein LOC100829124 [Brachypodium 
distachyon]
Length=220

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 11/68 (16%)
 Frame = -2

Query  897  ITELLVKLGEMYGA----SVSLRCQLPAEDLDALVSITSDEDLANLIEEY-------DRC  751
             TEL  KL EM G     +++LRC+LP EDLDALVS+T D DL +L++EY       DR 
Sbjct  88   FTELERKLREMCGWGEAMAMALRCRLPTEDLDALVSVTGDADLGHLLDEYDAASARRDRM  147

Query  750  GSIKIRAF  727
              +KIRAF
Sbjct  148  EPLKIRAF  155


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = -1

Query  1291  PKSEETDMAGPSSTKS--IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             P+ E  D A  ++     +KFLCSYGG+ILPRH DG LRY GG+ RV+S+ R
Sbjct  33    PEQEHQDAAAAAAAPGAAVKFLCSYGGRILPRHSDGALRYVGGDNRVVSLRR  84



>gb|ABR16614.1| unknown [Picea sitchensis]
Length=664

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  888  LLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
            L+ +L ++ G++V+L+ QLP EDLDAL+S+T+DEDL N++EEYDR
Sbjct  103  LISRLSKLCGSTVTLKYQLPNEDLDALISVTTDEDLENMMEEYDR  147


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CSYGG+ILPR  D +LRY GG+TR+++V R
Sbjct  63    VRFMCSYGGRILPRPHDNELRYVGGDTRIVAVAR  96



>ref|XP_006858576.1| hypothetical protein AMTR_s00071p00184320 [Amborella trichopoda]
 gb|ERN20043.1| hypothetical protein AMTR_s00071p00184320 [Amborella trichopoda]
Length=289

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 4/62 (6%)
 Frame = -2

Query  900  VITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC----GSIKIR  733
            + T+L+ KL +++ A+V L+ Q+  EDLDALVS+TSDEDL +++EE+DR     G+ +IR
Sbjct  1    MATDLMKKLTKLFEANVVLKYQIQPEDLDALVSVTSDEDLRHMMEEHDRYERQEGTPRIR  60

Query  732  AF  727
             F
Sbjct  61   TF  62



>gb|ACN40698.1| unknown [Picea sitchensis]
Length=640

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  888  LLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
            L+ KL ++ G++V+L+ QLP EDLDAL+S+T+DEDL N+++EYDR
Sbjct  94   LISKLSKLCGSAVTLKYQLPNEDLDALISVTTDEDLENMMDEYDR  138


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  1246  SIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++F+CSYGG+ILPR  D +LRY GG+TR+++V R
Sbjct  53    SVRFMCSYGGRILPRPHDNQLRYVGGDTRIVAVAR  87



>ref|XP_004299138.1| PREDICTED: uncharacterized protein LOC101311572 [Fragaria vesca 
subsp. vesca]
Length=201

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             + +++KFLCSYGGKIL RH DG+LRY GG TRVLSVD
Sbjct  10    AAETLKFLCSYGGKILLRHTDGELRYVGGHTRVLSVD  46


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLI  769
             +EL+VKL E  G SV+LRCQLP  DL+ L++I SDEDLANLI
Sbjct  51   FSELMVKLTEFCGQSVTLRCQLPDGDLETLITIKSDEDLANLI  93



>ref|XP_002521124.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF41275.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=1325

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  1294  SPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S KS+ T+++  S    +KFLCS GGKILPR  DGKLRY GGETR++S+ +
Sbjct  178   SAKSDATNVSDRSQPGKMKFLCSSGGKILPRPSDGKLRYVGGETRIISISK  228



>gb|EPS67511.1| hypothetical protein M569_07264, partial [Genlisea aurea]
Length=234

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  1297  VSPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + P SE   +  P  +   KFLCSYGG+I+PR  D KL Y GGET++L+VDR
Sbjct  15    IPPASENPPVNRPPQSLKAKFLCSYGGRIIPRPRDNKLAYLGGETKILAVDR  66



>gb|KFK39161.1| hypothetical protein AALP_AA3G208200 [Arabis alpina]
Length=653

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 5/50 (10%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-----KIRAF  727
            G S +L+ QLP+EDLD+LV+IT+DEDL N+IEEYDR  S      +IR F
Sbjct  112  GRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRATSTATATQRIRLF  161



>gb|EYU21843.1| hypothetical protein MIMGU_mgv11b015635mg [Erythranthe guttata]
Length=159

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  1285  SEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S+E+     +S + IKFLCS+GGKILPR  DG LRY GG TR++SV R
Sbjct  107   SDESGGDTSASVRKIKFLCSFGGKILPRVSDGALRYVGGHTRIISVRR  154



>ref|XP_010265683.1| PREDICTED: uncharacterized protein LOC104603364 [Nelumbo nucifera]
Length=335

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  1282  EETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             E  +    SS   +KFLCSYGGKILPR  DG+L+Y GGETRV++V R
Sbjct  5     ENEEAVALSSDNKVKFLCSYGGKILPRPTDGQLKYVGGETRVVAVSR  51


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 8/65 (12%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR--------CGSI  742
             +EL+ K+  +Y   V L+ QL  E++D LVS+TSDEDL ++++E+DR         G  
Sbjct  55   FSELMKKIRAIYNGDVVLKYQLIPEEMDILVSVTSDEDLQHMLDEHDRRDTKSTESSGLP  114

Query  741  KIRAF  727
            ++RAF
Sbjct  115  RLRAF  119



>ref|XP_008225868.1| PREDICTED: uncharacterized protein LOC103325479 [Prunus mume]
Length=1355

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SS + +KFLCS+GGKILPR  DGKLRY GGETR++ V+R
Sbjct  201   SSVRKLKFLCSFGGKILPRPSDGKLRYVGGETRIIRVNR  239



>emb|CDY62874.1| BnaCnng41080D [Brassica napus]
Length=397

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 7/65 (11%)
 Frame = -2

Query  900  VITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SI  742
              T LL KL ++ G  +VS++ QLP EDLDAL+S+++DED+ N++EEYDR        S 
Sbjct  64   TFTSLLTKLAKLSGKGNVSVKYQLPNEDLDALISVSTDEDVENMMEEYDRVALNQNPRSS  123

Query  741  KIRAF  727
            ++R F
Sbjct  124  RLRLF  128



>ref|XP_008224921.1| PREDICTED: uncharacterized protein LOC103324618 [Prunus mume]
Length=438

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
             + LL KL ++ G ++V+++ QLP EDLDAL+S+T+DED+ N+IEEYDR 
Sbjct  71   FSSLLTKLSKLSGLSNVTVKYQLPNEDLDALISVTTDEDVDNMIEEYDRI  120


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  34    VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  67



>ref|XP_007211679.1| hypothetical protein PRUPE_ppa005876mg [Prunus persica]
 gb|EMJ12878.1| hypothetical protein PRUPE_ppa005876mg [Prunus persica]
Length=439

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  897  ITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
             + LL KL ++ G ++V+++ QLP EDLDAL+S+T+DED+ N+IEEYDR 
Sbjct  71   FSSLLTKLSKLSGLSNVTVKYQLPNEDLDALISVTTDEDVDNMIEEYDRI  120


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  34    VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  67



>ref|XP_009391167.1| PREDICTED: uncharacterized protein LOC103977399 [Musa acuminata 
subsp. malaccensis]
Length=1263

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -2

Query  900  VITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG----SIKIR  733
            ++ E+L K+ E  G  V LR QLP EDLDAL+S+++ EDL N++EEYDR      S K+R
Sbjct  58   LLPEILRKVAEACGGPVVLRYQLPDEDLDALISVSTTEDLDNMMEEYDRLAADSPSAKLR  117

Query  732  AF  727
             F
Sbjct  118  VF  119


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  1249  KSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + +K +CSYGGKILPRH DG LRY GGETR+++V R
Sbjct  20    RKVKLICSYGGKILPRHGDGALRYAGGETRLITVRR  55



>gb|ACJ54183.1| PB1 domain-containing protein [Nicotiana benthamiana]
Length=254

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 6/57 (11%)
 Frame = -1

Query  1294  SPKSEETDMAG------PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+S E D         P S+  +KF+CSYGGKI PR  D +L Y GGET++LSVDR
Sbjct  16    SPRSREIDCENAAWDDQPPSSYKVKFMCSYGGKIHPRPHDNQLAYVGGETKILSVDR  72


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
             + L+ KL  +    V  + QLP EDLDAL+S+T+DEDL +++ EYDR
Sbjct  76   FSNLITKLSSISDCEVCFKYQLPGEDLDALISVTNDEDLEHMMLEYDR  123



>ref|XP_010443452.1| PREDICTED: uncharacterized protein LOC104726317 [Camelina sativa]
Length=1049

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAF  727
            EL++K+ E+Y  +  L+ Q P EDLDALVS+ +D+D+ N++EEYD+ GS     ++R F
Sbjct  64   ELMIKMRELYDGAAVLKYQQPDEDLDALVSVVNDDDVTNMMEEYDKLGSGDGFTRLRIF  122


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCS+ G ILPR  DGKLRY GGETR++SV+R
Sbjct  25    VKFLCSFLGSILPRPQDGKLRYVGGETRIVSVNR  58



>gb|EPS60327.1| hypothetical protein M569_14476 [Genlisea aurea]
Length=188

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S   S+KFL SYGG+ILPR  DGKLRY GG TRVLSVDR
Sbjct  3     SKVTSMKFLYSYGGRILPRSSDGKLRYVGGHTRVLSVDR  41


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD  757
            ++L+ K GE+ G+   L+C+LP EDLD LV+I S+E+L ++I+EY+
Sbjct  46   SDLMAKFGELCGSPAILKCKLPEEDLDFLVTIRSEEELRSIIKEYE  91



>ref|XP_009114662.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103839927 
[Brassica rapa]
Length=444

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -2

Query  900  VITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIK  739
              T LL KL ++ G  ++S++ QLP EDLDAL+S+++DED+ N++EEYDR   I+
Sbjct  93   TFTSLLTKLAKLSGKGNMSVKYQLPNEDLDALISVSTDEDVENMMEEYDRVALIQ  147



>ref|XP_008240220.1| PREDICTED: probable serine/threonine-protein kinase yakA [Prunus 
mume]
Length=708

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  867  MYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKI  736
            ++G   SL+ QLP+EDLD+L+S+T+DEDL N+IEEYDR  S  +
Sbjct  104  LHGRPFSLKYQLPSEDLDSLISVTTDEDLDNMIEEYDRTASTSL  147



>ref|XP_002524705.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37724.1| ATP binding protein, putative [Ricinus communis]
Length=417

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -2

Query  888  LLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC  751
            LL KL ++ G  +V+++ QLP EDLDAL+S+T+DED+ N+IEEYDR 
Sbjct  73   LLTKLSKLSGIPNVTVKYQLPNEDLDALISVTTDEDVENMIEEYDRV  119


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -1

Query  1285  SEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S  +D  GP  T+ ++F+CS+GGKILPR  D +LRY GG+TR+++V R
Sbjct  20    SPRSDNFGPHDTR-VRFMCSFGGKILPRPHDNQLRYVGGDTRIVAVHR  66



>gb|KDP20867.1| hypothetical protein JCGZ_21338 [Jatropha curcas]
Length=429

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = -2

Query  888  LLVKLGEMYGAS-VSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG------SIKIRA  730
            LL KL ++ G S VS++ QLP EDLDAL+S+T+DED+ N++EEYDR        S ++R 
Sbjct  72   LLTKLSKLAGISNVSVKYQLPNEDLDALISVTTDEDVDNMMEEYDRVSMNANPRSARLRL  131

Query  729  F  727
            F
Sbjct  132  F  132


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             ++F+CS+GGKILPR  D +LRY GGETR+++V R
Sbjct  32    VRFMCSFGGKILPRPHDNQLRYVGGETRIVAVHR  65



>ref|XP_010506585.1| PREDICTED: uncharacterized protein LOC104783169 [Camelina sativa]
Length=682

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            G S +L+ QLP+EDLD+LV+IT+DEDL N+IEEYDR  S
Sbjct  115  GRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRVTS  153



>ref|XP_009775146.1| PREDICTED: uncharacterized protein LOC104225079 isoform X2 [Nicotiana 
sylvestris]
Length=1209

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S T  IKFLCS+GG+ILPR  DGKLRY GG+TR++S+ R
Sbjct  192   SQTGKIKFLCSFGGRILPRPSDGKLRYVGGDTRIISIRR  230



>gb|KCW78751.1| hypothetical protein EUGRSUZ_C00189 [Eucalyptus grandis]
 gb|KCW78752.1| hypothetical protein EUGRSUZ_C00189 [Eucalyptus grandis]
Length=1012

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            EL+ K+ E+Y A+  L+ Q P EDLDALVS+ +D+D+ N++EEYD+ GS
Sbjct  29   ELIYKMKELYEAAAVLKYQQPDEDLDALVSVVNDDDVTNMMEEYDKLGS  77



>ref|XP_009406614.1| PREDICTED: uncharacterized protein LOC103989486 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406615.1| PREDICTED: uncharacterized protein LOC103989486 [Musa acuminata 
subsp. malaccensis]
Length=1159

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  1300  FVSPKSEETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
              +SP  E   +  P  +  +KFLCS+GG ILPR  DG+LRY GGETR+++V R
Sbjct  14    LLSPSVEIEMVTAPDDSPRVKFLCSFGGSILPRPIDGRLRYVGGETRIVTVPR  66


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            ELL ++ E++  +  ++ Q P EDLDALVS+ +DED+ N++EEYD+ G+
Sbjct  72   ELLARMRELFDGASIIKYQQPDEDLDALVSLVNDEDVMNMMEEYDKLGT  120



>gb|EPS71406.1| hypothetical protein M569_03356, partial [Genlisea aurea]
Length=111

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -2

Query  894  TELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG-SIKIRA  730
            ++L+VK GE+ G+ + L+C+ P +DLDALV+I SDE+L ++IEEY+      K+RA
Sbjct  39   SDLMVKFGELCGSPMILKCKFPGDDLDALVTIKSDEELRSIIEEYEIAAPDAKVRA  94


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVD  1145
             +KFLCS+GG I+PR  DG LR+ GG+TRVLSVD
Sbjct  1     LKFLCSFGGIIVPRSGDGNLRHIGGDTRVLSVD  33



>ref|XP_010465911.1| PREDICTED: uncharacterized protein LOC104746190 isoform X3 [Camelina 
sativa]
Length=672

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            G S +L+ QLP+EDLD+LV+IT+DEDL N+IEEYDR  S
Sbjct  117  GRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRVTS  155



>ref|XP_010465909.1| PREDICTED: uncharacterized protein LOC104746190 isoform X1 [Camelina 
sativa]
 ref|XP_010465910.1| PREDICTED: uncharacterized protein LOC104746190 isoform X2 [Camelina 
sativa]
Length=687

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            G S +L+ QLP+EDLD+LV+IT+DEDL N+IEEYDR  S
Sbjct  117  GRSFTLKYQLPSEDLDSLVTITTDEDLENMIEEYDRVTS  155



>ref|XP_010942162.1| PREDICTED: uncharacterized protein LOC105060244 isoform X3 [Elaeis 
guineensis]
Length=1303

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC------GSIKI  736
            + EL  K+ E++G    ++ QLP EDLDAL+S++  EDL N++EEYD+       GS K+
Sbjct  127  LAELTSKMSEVFGGPAVVKYQLPGEDLDALISVSCPEDLVNMMEEYDKLASISPHGSAKL  186

Query  735  RAF  727
            R F
Sbjct  187  RVF  189



>ref|XP_002285601.1| PREDICTED: uncharacterized protein LOC100255721 [Vitis vinifera]
Length=462

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 5/56 (9%)
 Frame = -1

Query  1294  SPKSEETDMAG-----PSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SP+S E D        P S   +KF+CSYGGKI PR  D +L Y GGET++LSVDR
Sbjct  14    SPRSREIDTENASWDEPPSNYKVKFMCSYGGKIHPRPQDNQLAYVGGETKILSVDR  69



>ref|XP_010050238.1| PREDICTED: uncharacterized protein LOC104438755 [Eucalyptus grandis]
Length=1096

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
            EL+ K+ E+Y A+  L+ Q P EDLDALVS+ +D+D+ N++EEYD+ GS
Sbjct  117  ELIYKMKELYEAAAVLKYQQPDEDLDALVSVVNDDDVTNMMEEYDKLGS  165



>ref|XP_007213731.1| hypothetical protein PRUPE_ppa000294mg [Prunus persica]
 gb|EMJ14930.1| hypothetical protein PRUPE_ppa000294mg [Prunus persica]
Length=1334

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             SS + +KFLCS+GGKILPR  DG+LRY GGETR++ V+R
Sbjct  180   SSVRKLKFLCSFGGKILPRPSDGRLRYVGGETRIIRVNR  218



>ref|XP_010942161.1| PREDICTED: uncharacterized protein LOC105060244 isoform X2 [Elaeis 
guineensis]
Length=1304

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC------GSIKI  736
            + EL  K+ E++G    ++ QLP EDLDAL+S++  EDL N++EEYD+       GS K+
Sbjct  127  LAELTSKMSEVFGGPAVVKYQLPGEDLDALISVSCPEDLVNMMEEYDKLASISPHGSAKL  186

Query  735  RAF  727
            R F
Sbjct  187  RVF  189



>ref|XP_010942160.1| PREDICTED: uncharacterized protein LOC105060244 isoform X1 [Elaeis 
guineensis]
Length=1320

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = -2

Query  897  ITELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRC------GSIKI  736
            + EL  K+ E++G    ++ QLP EDLDAL+S++  EDL N++EEYD+       GS K+
Sbjct  127  LAELTSKMSEVFGGPAVVKYQLPGEDLDALISVSCPEDLVNMMEEYDKLASISPHGSAKL  186

Query  735  RAF  727
            R F
Sbjct  187  RVF  189



>ref|XP_006448664.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
 gb|ESR61904.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
Length=1177

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>ref|XP_008802012.1| PREDICTED: uncharacterized protein LOC103715979 isoform X1 [Phoenix 
dactylifera]
Length=1223

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  1279  ETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + D A PS++  IK LCSYGGKILPR  DG LRY GG+TR+++V R
Sbjct  17    DDDHASPSASWKIKLLCSYGGKILPRPSDGALRYAGGDTRIITVRR  62


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 7/62 (11%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-------KIR  733
            E + K+ + YG    +R Q P EDLD L+S+++ EDL N++EEYD  G +       K+R
Sbjct  68   EFVRKMADAYGGPTLIRYQFPGEDLDNLISVSTPEDLENMMEEYDNLGQVCPDGATSKLR  127

Query  732  AF  727
             F
Sbjct  128  VF  129



>ref|XP_006448663.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
 gb|ESR61903.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
Length=1329

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>gb|KDO77316.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
Length=1070

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>ref|XP_010279374.1| PREDICTED: uncharacterized protein LOC104613306 [Nelumbo nucifera]
Length=667

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -2

Query  867  MYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIKIR  733
            ++G S +L+ QLP EDLD+L+S+T+DEDL N+IEEYDR  +  ++
Sbjct  96   LHGRSFTLKYQLPNEDLDSLISVTTDEDLENMIEEYDRTSASSLK  140



>ref|XP_008802013.1| PREDICTED: uncharacterized protein LOC103715979 isoform X2 [Phoenix 
dactylifera]
Length=1214

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  1279  ETDMAGPSSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             + D A PS++  IK LCSYGGKILPR  DG LRY GG+TR+++V R
Sbjct  17    DDDHASPSASWKIKLLCSYGGKILPRPSDGALRYAGGDTRIITVRR  62


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 7/62 (11%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI-------KIR  733
            E + K+ + YG    +R Q P EDLD L+S+++ EDL N++EEYD  G +       K+R
Sbjct  68   EFVRKMADAYGGPTLIRYQFPGEDLDNLISVSTPEDLENMMEEYDNLGQVCPDGATSKLR  127

Query  732  AF  727
             F
Sbjct  128  VF  129



>gb|KDO77311.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
Length=1329

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>ref|XP_006468516.1| PREDICTED: uncharacterized protein LOC102618380 isoform X1 [Citrus 
sinensis]
 ref|XP_006468517.1| PREDICTED: uncharacterized protein LOC102618380 isoform X2 [Citrus 
sinensis]
Length=1329

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>ref|XP_007210168.1| hypothetical protein PRUPE_ppa020379mg [Prunus persica]
 gb|EMJ11367.1| hypothetical protein PRUPE_ppa020379mg [Prunus persica]
Length=681

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  867  MYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSI  742
            ++G   SL+ QLP+EDLD+L+S+T+DEDL N+IEEYDR  S 
Sbjct  104  LHGRPFSLKYQLPSEDLDSLISVTTDEDLDNMIEEYDRTAST  145



>ref|XP_006848834.1| hypothetical protein AMTR_s00026p00186490 [Amborella trichopoda]
 gb|ERN10415.1| hypothetical protein AMTR_s00026p00186490 [Amborella trichopoda]
Length=1621

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 6/60 (10%)
 Frame = -2

Query  888  LLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYD------RCGSIKIRAF  727
            L  KL + YG  V ++ QLP EDLDAL+S++ DEDL N++EEYD      R GS K R F
Sbjct  200  LFQKLVDAYGQPVVIKYQLPQEDLDALISVSCDEDLDNMMEEYDKLLENSRKGSPKFRVF  259


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             STK +KFLCS+GGKILPR  DG LRY GG+TR++S+ +
Sbjct  156   STKKVKFLCSFGGKILPRPSDGVLRYVGGQTRIISLRK  193



>ref|XP_009775144.1| PREDICTED: uncharacterized protein LOC104225079 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775145.1| PREDICTED: uncharacterized protein LOC104225079 isoform X1 [Nicotiana 
sylvestris]
Length=1274

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  1258  SSTKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S T  IKFLCS+GG+ILPR  DGKLRY GG+TR++S+ R
Sbjct  192   SQTGKIKFLCSFGGRILPRPSDGKLRYVGGDTRIISIRR  230



>gb|KDO77312.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
 gb|KDO77313.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
Length=1236

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>ref|XP_006448662.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
 gb|ESR61902.1| hypothetical protein CICLE_v10014052mg [Citrus clementina]
Length=1236

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>gb|KDO42187.1| hypothetical protein CISIN_1g0470552mg, partial [Citrus sinensis]
Length=179

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  861  GASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDR  754
            G S +L+ QLP EDLD+LVSIT+DEDL N+IEEYDR
Sbjct  103  GRSFTLKYQLPNEDLDSLVSITTDEDLENMIEEYDR  138



>ref|XP_010483289.1| PREDICTED: uncharacterized protein LOC104761846 [Camelina sativa]
Length=1029

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 4/59 (7%)
 Frame = -2

Query  891  ELLVKLGEMYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS----IKIRAF  727
            EL++K+ E+Y  +   + Q P EDLDALVS+ +D+D+ N++EEYD+ GS     ++R F
Sbjct  64   ELMIKMRELYDGAAVFKYQQPDEDLDALVSVVNDDDVTNMMEEYDKLGSGDGFTRLRIF  122


 Score = 55.5 bits (132),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  1243  IKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             +KFLCS+ G ILPR  DGKLRY GGETR++SV+R
Sbjct  25    VKFLCSFSGSILPRPQDGKLRYVGGETRIVSVNR  58



>ref|XP_010052416.1| PREDICTED: uncharacterized protein LOC104441106 [Eucalyptus grandis]
 gb|KCW76382.1| hypothetical protein EUGRSUZ_D00762 [Eucalyptus grandis]
Length=413

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  900  VITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGSIK  739
                LL KL ++ G A+++++ QLP EDLDAL+S+T+DED+ N++EEYDR    +
Sbjct  70   TFNALLSKLSKLSGTANITVKYQLPNEDLDALISVTTDEDVDNMMEEYDRVAQTQ  124



>ref|XP_006448394.1| hypothetical protein CICLE_v10014450mg [Citrus clementina]
 gb|ESR61634.1| hypothetical protein CICLE_v10014450mg [Citrus clementina]
Length=703

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -2

Query  900  VITELLVKLGE--MYGASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCGS  745
             ++ L+ +L +  + G S SL+ QLP+EDLD+L+S+T+DEDL N+IEEY+R  S
Sbjct  97   TLSSLMSRLSQSLLNGGSFSLKYQLPSEDLDSLISVTTDEDLENMIEEYERTTS  150



>emb|CDY46377.1| BnaA09g19910D [Brassica napus]
Length=396

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  900  VITELLVKLGEMYG-ASVSLRCQLPAEDLDALVSITSDEDLANLIEEYDRCG  748
              T LL KL ++ G  ++S++ QLP EDLDAL+S+++DED+ N++EEYDR  
Sbjct  64   TFTSLLTKLAKLSGKGNMSVKYQLPNEDLDALISVSTDEDVENMMEEYDRVA  115



>gb|KDO77315.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
Length=1042

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



>gb|KDO77314.1| hypothetical protein CISIN_1g000726mg [Citrus sinensis]
Length=1143

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  1255  STKSIKFLCSYGGKILPRHPDGKLRYYGGETRVLSVDR  1142
             S++ +KFLCS+GGKILPR  DGKLRY GGETR++ + R
Sbjct  182   SSRKVKFLCSFGGKILPRPSDGKLRYVGGETRIIRISR  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3947080548888