BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24878_g2_i4 len=3338 path=[3513:0-105 3619:106-110 3624:111-113
@3627@!:114-491 7532:492-657 2746:658-693 7732:694-708 4114:709-737
7775:738-969 8007:970-1001 8038:1002-1030 8067:1031-1208
8244:1209-1575 8611:1576-1613 14308:1614-1616 8652:1617-1752
8788:1753-1767 8803:1768-1793 8828:1794-1800 14337:1801-1820
8855:1821-1949 8984:1950-2082 9117:2083-2085 9120:2086-2111
131:2112-2142 14438:2143-2153 1370:2154-3337]

Length=3338
                                                                      Score     E

ref|XP_009619432.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1452   0.0     
ref|XP_009791486.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1452   0.0     
ref|XP_009629870.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1448   0.0     
gb|AGT40326.1|  methionine synthase                                    1447   0.0     
ref|XP_011094156.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1443   0.0     
ref|XP_011077750.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1442   0.0     
ref|XP_009615630.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1442   0.0     
ref|XP_009804811.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1441   0.0     
ref|NP_001275416.1|  methionine synthase                               1435   0.0     
gb|ABI35986.1|  methionine synthase                                    1433   0.0     Phelipanche ramosa
ref|XP_004249374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1432   0.0     
ref|XP_007204266.1|  hypothetical protein PRUPE_ppa001783mg            1431   0.0     
ref|XP_006443469.1|  hypothetical protein CICLE_v10018965mg            1430   0.0     
sp|Q42699.1|METE_CATRO  RecName: Full=5-methyltetrahydropteroyltr...   1427   0.0     Catharanthus roseus [chatas]
gb|ABI95860.1|  methionine synthase                                    1427   0.0     Nicotiana suaveolens
ref|XP_010247947.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1422   0.0     
ref|XP_009790020.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1422   0.0     
dbj|BAP47511.1|  methionine synthase                                   1422   0.0     
ref|XP_010266670.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1421   0.0     
ref|XP_004291976.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1421   0.0     
emb|CDP10525.1|  unnamed protein product                               1420   0.0     
ref|XP_010054791.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1420   0.0     
ref|XP_009366484.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1420   0.0     
gb|KHG25606.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1419   0.0     
dbj|BAP47510.1|  methionine synthase                                   1419   0.0     
ref|XP_011008839.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1419   0.0     
ref|XP_008237251.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1419   0.0     
ref|XP_008443293.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1418   0.0     
gb|EYU38730.1|  hypothetical protein MIMGU_mgv1a001746mg               1418   0.0     
ref|XP_011008841.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1416   0.0     
gb|KHG11135.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1416   0.0     
ref|XP_004136654.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1415   0.0     
ref|XP_002325856.1|  hypothetical protein POPTR_0019s05430g            1415   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009353101.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1414   0.0     
ref|XP_008391707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1413   0.0     
ref|XP_010549696.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1412   0.0     
ref|XP_010097930.1|  5-methyltetrahydropteroyltriglutamate--homoc...   1412   0.0     
ref|XP_010558700.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1412   0.0     
ref|XP_002525709.1|  5-methyltetrahydropteroyltriglutamate--homoc...   1411   0.0     Ricinus communis
gb|AEO86798.1|  methionine synthase                                    1411   0.0     
gb|ABS01352.1|  methionine synthase                                    1411   0.0     Carica papaya [mamon]
ref|XP_008386852.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1410   0.0     
ref|XP_010524993.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1409   0.0     
gb|KDP39669.1|  hypothetical protein JCGZ_02689                        1409   0.0     
gb|KHG11134.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1407   0.0     
ref|XP_002319710.1|  hypothetical protein POPTR_0013s05850g            1407   0.0     Populus trichocarpa [western balsam poplar]
gb|KHG01449.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1406   0.0     
gb|KHG18420.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1406   0.0     
ref|XP_007030023.1|  Cobalamin-independent synthase family protei...   1405   0.0     
ref|XP_002276438.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1405   0.0     Vitis vinifera
gb|KDP42919.1|  hypothetical protein JCGZ_23861                        1404   0.0     
ref|XP_009398356.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1403   0.0     
emb|CDY38470.1|  BnaA10g16880D                                         1403   0.0     
ref|XP_004228469.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1403   0.0     
ref|XP_010553797.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1402   0.0     
ref|XP_011005896.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1402   0.0     
ref|XP_002515852.1|  5-methyltetrahydropteroyltriglutamate--homoc...   1402   0.0     Ricinus communis
ref|XP_011034320.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1402   0.0     
ref|XP_009591564.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1402   0.0     
ref|XP_004960256.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1401   0.0     
ref|XP_009398511.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1401   0.0     
ref|XP_006384691.1|  hypothetical protein POPTR_0004s20220g            1401   0.0     
ref|XP_009398996.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1400   0.0     
ref|XP_006364490.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1400   0.0     
ref|XP_004960257.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1400   0.0     
ref|XP_003542326.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1400   0.0     
ref|XP_006408261.1|  hypothetical protein EUTSA_v10020127mg            1400   0.0     
ref|XP_002871787.1|  cobalamin-independent methionine synthase         1399   0.0     
emb|CDY25477.1|  BnaC09g39920D                                         1398   0.0     
ref|XP_008464953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1398   0.0     
ref|XP_011044091.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1398   0.0     
ref|XP_010908721.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1397   0.0     
gb|EPS68005.1|  methionine synthase                                    1397   0.0     
ref|XP_008778953.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1397   0.0     
emb|CAA89019.1|  cobalamine-independent methionine synthase            1397   0.0     Plectranthus scutellarioides
ref|NP_197294.1|  5-methyltetrahydropteroyltriglutamate--homocyst...   1397   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685496.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1397   0.0     
ref|XP_010036239.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1397   0.0     
ref|XP_002276908.2|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1397   0.0     Vitis vinifera
ref|XP_009121037.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1396   0.0     
ref|XP_003561625.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1396   0.0     
ref|XP_004144074.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1396   0.0     
ref|XP_006400336.1|  hypothetical protein EUTSA_v10012750mg            1395   0.0     
sp|Q42662.2|METE_PLESU  RecName: Full=5-methyltetrahydropteroyltr...   1395   0.0     Plectranthus scutellarioides
ref|XP_003522969.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1395   0.0     
gb|KHG18658.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1394   0.0     
gb|AAL09712.1|  AT5g17920/MPI7_60                                      1394   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463840.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1394   0.0     
ref|XP_010917850.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1394   0.0     
emb|CDX85436.1|  BnaA02g03770D                                         1394   0.0     
gb|EYU18182.1|  hypothetical protein MIMGU_mgv1a001749mg               1394   0.0     
ref|XP_006479149.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1394   0.0     
emb|CAE55863.1|  cobalamin-independent methionine synthase             1394   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX74207.1|  BnaA03g28400D                                         1393   0.0     
ref|XP_008451024.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1393   0.0     
ref|XP_007015561.1|  Cobalamin-independent synthase family protei...   1393   0.0     
ref|XP_006650367.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1392   0.0     
ref|XP_004141126.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1392   0.0     
gb|KHN41415.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1392   0.0     
emb|CDY02674.1|  BnaC02g07610D                                         1392   0.0     
ref|XP_006470414.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1392   0.0     
ref|XP_006286451.1|  hypothetical protein CARUB_v10000282mg            1392   0.0     
ref|XP_010485733.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1392   0.0     
ref|XP_009408488.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1392   0.0     
emb|CDX78767.1|  BnaA03g06790D                                         1392   0.0     
ref|NP_001067314.1|  Os12g0624000                                      1392   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006443474.1|  hypothetical protein CICLE_v10018921mg            1392   0.0     
dbj|BAN04645.1|  cobalamin-independent methionine synthase             1392   0.0     
ref|NP_001235794.1|  methionine synthase                               1392   0.0     
gb|AAN31836.1|  putative 5-methyltetrahydropteroyltriglutamate--h...   1392   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_001067313.1|  Os12g0623900                                      1391   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514202.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1391   0.0     
ref|XP_009126216.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1390   0.0     
emb|CDX92051.1|  BnaC03g33530D                                         1390   0.0     
ref|XP_002313635.2|  hypothetical protein POPTR_0009s15490g            1390   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010528749.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1389   0.0     
ref|XP_009134741.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1389   0.0     
gb|ABG22095.1|  5-methyltetrahydropteroyltriglutamate-homocystein...   1389   0.0     
ref|XP_009131623.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1389   0.0     
ref|XP_006664220.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1389   0.0     
ref|XP_004502016.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1389   0.0     
ref|XP_006297040.1|  hypothetical protein CARUB_v10013032mg            1389   0.0     
ref|XP_010492770.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1388   0.0     
emb|CDX70785.1|  BnaC03g08690D                                         1388   0.0     
ref|XP_002882307.1|  hypothetical protein ARALYDRAFT_477628            1388   0.0     
gb|KDO66309.1|  hypothetical protein CISIN_1g003819mg                  1387   0.0     
ref|NP_187028.1|  methionine synthase 2                                1385   0.0     Arabidopsis thaliana [mouse-ear cress]
sp|P93263.1|METE_MESCR  RecName: Full=5-methyltetrahydropteroyltr...   1385   0.0     Mesembryanthemum crystallinum
emb|CAN70498.1|  hypothetical protein VITISV_028551                    1385   0.0     Vitis vinifera
gb|AAK64167.1|  putative methionine synthase                           1385   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774960.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1385   0.0     
ref|XP_008680958.1|  PREDICTED: LOC100286153 isoform X1                1385   0.0     
ref|XP_004982263.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1385   0.0     
ref|XP_008778395.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1384   0.0     
ref|XP_010420526.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1384   0.0     
ref|XP_010031619.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1383   0.0     
ref|NP_001152513.1|  LOC100286153                                      1383   0.0     Zea mays [maize]
ref|XP_003554033.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1383   0.0     
ref|XP_006446418.1|  hypothetical protein CICLE_v10014233mg            1382   0.0     
ref|XP_010932648.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1382   0.0     
ref|XP_008789650.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1382   0.0     
ref|XP_004489678.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1382   0.0     
ref|XP_008807626.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1381   0.0     
ref|XP_008662311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1380   0.0     
ref|XP_010909224.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1380   0.0     
ref|XP_007161979.1|  hypothetical protein PHAVU_001G113800g            1379   0.0     
gb|ADO87039.1|  pollen allergen MetE                                   1379   0.0     
ref|XP_010909225.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1379   0.0     
gb|ACO34814.1|  Sal k 3 pollen allergen                                1379   0.0     Kali turgidum [common saltwort]
tpg|DAA47593.1|  TPA: putative methionine synthase family protein      1377   0.0     
ref|XP_007151496.1|  hypothetical protein PHAVU_004G051600g            1376   0.0     
ref|XP_010031616.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1375   0.0     
ref|XP_003551089.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1375   0.0     
ref|NP_001288585.1|  LOC541714                                         1375   0.0     
gb|AFW68110.1|  putative methionine synthase family protein            1373   0.0     
ref|XP_003601341.1|  Methionine synthase                               1373   0.0     
ref|XP_003525709.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1373   0.0     
gb|AAL33589.1|  methionine synthase                                    1373   0.0     Zea mays [maize]
ref|XP_004144075.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1372   0.0     
gb|KHN28122.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1372   0.0     
gb|KDO66310.1|  hypothetical protein CISIN_1g003819mg                  1368   0.0     
ref|XP_006826346.1|  hypothetical protein AMTR_s00004p00117110         1367   0.0     
ref|XP_006446419.1|  hypothetical protein CICLE_v10014233mg            1365   0.0     
emb|CAJ01713.1|  methionine synthase 1 enzyme                          1364   0.0     Hordeum vulgare [barley]
ref|XP_004159344.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1363   0.0     
gb|EMS51950.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1363   0.0     
emb|CAJ01714.1|  methionine synthase 2 enzyme                          1362   0.0     Hordeum vulgare [barley]
dbj|BAJ89541.1|  predicted protein                                     1362   0.0     
ref|XP_010236990.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1361   0.0     
dbj|BAJ88127.1|  predicted protein                                     1361   0.0     
dbj|BAJ87953.1|  predicted protein                                     1361   0.0     
ref|NP_001266005.1|  5-methyltetrahydropteroyltriglutamate--homoc...   1360   0.0     
dbj|BAD34660.1|  methionine synthase                                   1359   0.0     Hordeum vulgare [barley]
ref|XP_003624677.1|  Methionine synthase                               1359   0.0     
gb|AAL73979.1|AF466201_8  methionine synthase protein                  1359   0.0     Sorghum bicolor [broomcorn]
ref|XP_003550102.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1358   0.0     
gb|AIE47233.1|  vitamin B-12-independent methionine synthase           1357   0.0     
ref|XP_010677810.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...   1356   0.0     
ref|XP_006371184.1|  hypothetical protein POPTR_0019s05430g            1355   0.0     
gb|EMT31101.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1355   0.0     
gb|KEH25580.1|  cobalamin-independent methionine synthase              1353   0.0     
dbj|BAE07181.1|  methionine synthase                                   1352   0.0     Beta vulgaris [beet]
emb|CAN73135.1|  hypothetical protein VITISV_018473                    1339   0.0     Vitis vinifera
ref|XP_003624679.1|  Methionine synthase                               1331   0.0     
gb|ABR17712.1|  unknown                                                1325   0.0     Picea sitchensis
pdb|1U1H|A  Chain A, A. Thaliana Cobalamine Independent Methionin...   1325   0.0     
emb|CDY50662.1|  BnaC05g48040D                                         1325   0.0     
ref|XP_011090233.1|  PREDICTED: LOW QUALITY PROTEIN: 5-methyltetr...   1323   0.0     
gb|EYU35999.1|  hypothetical protein MIMGU_mgv1a001741mg               1318   0.0     
gb|EPS74353.1|  methionine synthase                                    1315   0.0     
gb|ADE75603.1|  unknown                                                1313   0.0     
ref|XP_006400670.1|  hypothetical protein EUTSA_v10012712mg            1309   0.0     
ref|XP_010541663.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1307   0.0     
ref|XP_009346240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1306   0.0     
ref|XP_007207630.1|  hypothetical protein PRUPE_ppa021650mg            1299   0.0     
gb|KFK26314.1|  hypothetical protein AALP_AA8G231500                   1299   0.0     
ref|XP_008230954.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1296   0.0     
emb|CDX88830.1|  BnaA03g08190D                                         1295   0.0     
ref|XP_010454417.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1294   0.0     
ref|XP_008775707.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1294   0.0     
ref|XP_010242374.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1293   0.0     
ref|XP_010493215.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1292   0.0     
ref|XP_006286361.1|  hypothetical protein CARUB_v10000244mg            1291   0.0     
ref|XP_009131831.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1291   0.0     
ref|XP_010454415.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1290   0.0     
ref|XP_010454416.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1289   0.0     
ref|XP_010420946.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1288   0.0     
emb|CDX70955.1|  BnaC03g10390D                                         1287   0.0     
ref|NP_197598.2|  methionine synthase 3                                1286   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874026.1|  hypothetical protein ARALYDRAFT_489009            1286   0.0     
ref|XP_010933712.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1285   0.0     
gb|ABR16134.1|  unknown                                                1285   0.0     Picea sitchensis
emb|CAE55865.1|  cobalamin-independent methionine synthase             1284   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EMS50887.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1284   0.0     
ref|XP_010521311.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1283   0.0     
ref|XP_006842129.1|  hypothetical protein AMTR_s00078p00112410         1282   0.0     
gb|ABR18027.1|  unknown                                                1277   0.0     Picea sitchensis
emb|CDX92419.1|  BnaA10g14580D                                         1276   0.0     
ref|XP_010036242.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1273   0.0     
ref|XP_009120742.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1273   0.0     
emb|CDY16584.1|  BnaC09g36890D                                         1272   0.0     
ref|XP_009120746.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1272   0.0     
emb|CCC42221.1|  vitamin-b12 independent methionine synthase           1257   0.0     
ref|XP_003592244.1|  Methionine synthase                               1248   0.0     
ref|XP_010036240.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1236   0.0     
gb|ABG22093.1|  5-methyltetrahydropteroyltriglutamate-homocystein...   1236   0.0     
emb|CBI31233.3|  unnamed protein product                               1221   0.0     
gb|KCW47766.1|  hypothetical protein EUGRSUZ_K01515                    1219   0.0     
gb|KCW45140.1|  hypothetical protein EUGRSUZ_L01249                    1217   0.0     
ref|XP_001757366.1|  predicted protein                                 1208   0.0     
ref|XP_001758527.1|  predicted protein                                 1204   0.0     
ref|XP_002993286.1|  hypothetical protein SELMODRAFT_162950            1199   0.0     
gb|KHN34672.1|  5-methyltetrahydropteroyltriglutamate--homocystei...   1198   0.0     
ref|XP_002969765.1|  hypothetical protein SELMODRAFT_171028            1198   0.0     
ref|XP_001784286.1|  predicted protein                                 1190   0.0     
ref|XP_006371191.1|  hypothetical protein POPTR_0019s05430g            1182   0.0     
ref|XP_010036243.1|  PREDICTED: 5-methyltetrahydropteroyltrigluta...   1180   0.0     
ref|XP_006408262.1|  hypothetical protein EUTSA_v10020127mg            1167   0.0     
ref|XP_010103482.1|  5-methyltetrahydropteroyltriglutamate--homoc...   1106   0.0     
gb|ABG22097.1|  5-methyltetrahydropteroyltriglutamate-homocystein...   1063   0.0     
ref|XP_006443470.1|  hypothetical protein CICLE_v10018965mg            1057   0.0     
ref|XP_007015562.1|  Cobalamin-independent synthase family protei...   1034   0.0     
gb|KDO66311.1|  hypothetical protein CISIN_1g003819mg                  1025   0.0     
ref|XP_006443468.1|  hypothetical protein CICLE_v10018965mg            1023   0.0     
gb|AES80897.2|  cobalamin-independent methionine synthase              1007   0.0     
gb|ABK93849.1|  unknown                                                1003   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003624678.1|  Methionine synthase                                986   0.0     
gb|KCW45141.1|  hypothetical protein EUGRSUZ_L01250                     976   0.0     
dbj|BAF01079.1|  5-methyltetrahydropteroyltriglutamate- homocyste...    950   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KCW47763.1|  hypothetical protein EUGRSUZ_K01511                     924   0.0     
ref|XP_006443472.1|  hypothetical protein CICLE_v10018965mg             848   0.0     
tpg|DAA47598.1|  TPA: putative methionine synthase family protein       810   0.0     
gb|AHJ69501.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    816   0.0     
ref|WP_011631490.1|  5-methyltetrahydropteroyltriglutamate--homoc...    816   0.0     
ref|WP_035607523.1|  5-methyltetrahydropteroyltriglutamate--homoc...    810   0.0     
gb|KCW47761.1|  hypothetical protein EUGRSUZ_K015082                    795   0.0     
gb|AHJ62603.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    806   0.0     
gb|AHJ66832.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    802   0.0     
ref|WP_021831255.1|  5-methyltetrahydropteroyltriglutamate--homoc...    798   0.0     
dbj|GAK51674.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    795   0.0     
ref|WP_002644197.1|  5-methyltetrahydropteroyltriglutamate--homoc...    795   0.0     
ref|WP_007308257.1|  5-methyltetrahydropteroyltriglutamate--homoc...    795   0.0     
ref|WP_010693201.1|  5-methyltetrahydropteroyltriglutamate--homoc...    794   0.0     
ref|WP_028481683.1|  5-methyltetrahydropteroyltriglutamate--homoc...    794   0.0     
ref|WP_012875131.1|  5-methyltetrahydropteroyltriglutamate--homoc...    791   0.0     
ref|WP_012168116.1|  5-methyltetrahydropteroyltriglutamate--homoc...    791   0.0     
gb|KCW47768.1|  hypothetical protein EUGRSUZ_K015172                    778   0.0     
tpg|DAA47596.1|  TPA: putative methionine synthase family protein       777   0.0     
ref|WP_009949830.1|  5-methyltetrahydropteroyltriglutamate--homoc...    789   0.0     
ref|WP_012817024.1|  5-methyltetrahydropteroyltriglutamate--homoc...    789   0.0     
ref|WP_014500443.1|  5-methyltetrahydropteroyltriglutamate--homoc...    788   0.0     
ref|WP_014848375.1|  5-methyltetrahydropteroyltriglutamate--homoc...    787   0.0     
ref|WP_011240849.1|  5-methyltetrahydropteroyltriglutamate--homoc...    786   0.0     
ref|WP_037496901.1|  5-methyltetrahydropteroyltriglutamate--homoc...    786   0.0     
ref|WP_004088273.1|  5-methyltetrahydropteroyltriglutamate--homoc...    785   0.0     
emb|CDS91878.1|  5-methyltetrahydropteroyltriglutamate-homocystei...    785   0.0     
ref|WP_038271147.1|  5-methyltetrahydropteroyltriglutamate--homoc...    785   0.0     
gb|KIA57526.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    783   0.0     
ref|WP_038165438.1|  5-methyltetrahydropteroyltriglutamate--homoc...    784   0.0     
ref|WP_009959552.1|  5-methyltetrahydropteroyltriglutamate--homoc...    784   0.0     
ref|WP_008260122.1|  5-methyltetrahydropteroyltriglutamate--homoc...    784   0.0     
ref|WP_038228301.1|  5-methyltetrahydropteroyltriglutamate--homoc...    782   0.0     
ref|WP_012337958.1|  5-methyltetrahydropteroyltriglutamate--homoc...    781   0.0     
ref|WP_002716440.1|  5-methyltetrahydropteroyltriglutamate-homocy...    782   0.0     
ref|WP_024919717.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    782   0.0     
gb|EAO13924.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    782   0.0     
ref|WP_018980117.1|  hypothetical protein                               781   0.0     
ref|WP_035307178.1|  5-methyltetrahydropteroyltriglutamate--homoc...    781   0.0     
ref|WP_023906296.1|  5-methyltetrahydropteroyltriglutamate--homoc...    780   0.0     
ref|WP_038695440.1|  5-methyltetrahydropteroyltriglutamate--homoc...    780   0.0     
ref|WP_012794049.1|  5-methyltetrahydropteroyltriglutamate--homoc...    780   0.0     
ref|WP_035728278.1|  5-methyltetrahydropteroyltriglutamate--homoc...    780   0.0     
ref|WP_024520597.1|  5-methyltetrahydropteroyltriglutamate--homoc...    779   0.0     
ref|WP_034681863.1|  5-methyltetrahydropteroyltriglutamate--homoc...    779   0.0     
ref|WP_010894720.1|  5-methyltetrahydropteroyltriglutamate--homoc...    778   0.0     
ref|WP_006019596.1|  5-methyltetrahydropteroyltriglutamate-homocy...    779   0.0     
ref|WP_021592118.1|  hypothetical protein                               777   0.0     
ref|WP_031454328.1|  5-methyltetrahydropteroyltriglutamate--homoc...    776   0.0     
ref|WP_024749154.1|  5-methyltetrahydropteroyltriglutamate--homoc...    776   0.0     
ref|WP_006265875.1|  5-methyltetrahydropteroyltriglutamate--homoc...    776   0.0     
ref|WP_035038989.1|  5-methyltetrahydropteroyltriglutamate--homoc...    774   0.0     
ref|WP_019631992.1|  hypothetical protein                               774   0.0     
ref|WP_028338134.1|  5-methyltetrahydropteroyltriglutamate--homoc...    774   0.0     
ref|WP_024808671.1|  5-methyltetrahydropteroyltriglutamate--homoc...    774   0.0     
ref|WP_026995232.1|  5-methyltetrahydropteroyltriglutamate--homoc...    774   0.0     
ref|WP_018290363.1|  hypothetical protein                               774   0.0     
ref|WP_028070671.1|  5-methyltetrahydropteroyltriglutamate--homoc...    773   0.0     
ref|WP_017973577.1|  hypothetical protein                               773   0.0     
ref|WP_010500751.1|  5-methyltetrahydropteroyltriglutamate--homoc...    772   0.0     
ref|WP_035093200.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|WP_024896950.1|  5-methyltetrahydropteroyltriglutamate--homoc...    772   0.0     
ref|XP_004347318.1|  5-methyltetrahydropteroyltriglutamate-homocy...    771   0.0     
ref|WP_006264310.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|XP_005534953.1|  vitamine B12-independent methionine synthase       771   0.0     
ref|WP_026728557.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|WP_003008589.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|WP_039328290.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|WP_006128671.1|  5-methyltetrahydropteroyltriglutamate-homocy...    771   0.0     
ref|WP_010072662.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    771   0.0     
ref|WP_029184065.1|  5-methyltetrahydropteroyltriglutamate--homoc...    770   0.0     
ref|WP_002997541.1|  5-methyltetrahydropteroyltriglutamate--homoc...    770   0.0     
ref|WP_011664582.1|  5-methyltetrahydropteroyltriglutamate--homoc...    771   0.0     
ref|WP_006261782.1|  5-methyltetrahydropteroyltriglutamate--homoc...    770   0.0     
gb|KCW47767.1|  hypothetical protein EUGRSUZ_K01516                     758   0.0     
ref|WP_029085164.1|  5-methyltetrahydropteroyltriglutamate--homoc...    770   0.0     
gb|KIF71634.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    770   0.0     
ref|WP_016648902.1|  5-methyltetrahydropteroyltriglutamate-homocy...    769   0.0     
ref|WP_024580266.1|  5-methyltetrahydropteroyltriglutamate--homoc...    770   0.0     
ref|WP_007041287.1|  5-methyltetrahydropteroyltriglutamate--homoc...    769   0.0     
ref|WP_038987044.1|  5-methyltetrahydropteroyltriglutamate--homoc...    769   0.0     
ref|WP_006258640.1|  5-methyltetrahydropteroyltriglutamate--homoc...    768   0.0     
ref|WP_017497265.1|  5-methyltetrahydropteroyltriglutamate--homoc...    768   0.0     
ref|WP_027555274.1|  5-methyltetrahydropteroyltriglutamate--homoc...    768   0.0     
ref|WP_026715519.1|  5-methyltetrahydropteroyltriglutamate--homoc...    768   0.0     
ref|WP_011157948.1|  5-methyltetrahydropteroyltriglutamate--homoc...    768   0.0     
ref|WP_038249736.1|  5-methyltetrahydropteroyltriglutamate--homoc...    767   0.0     
ref|WP_018150456.1|  hypothetical protein                               767   0.0     
ref|WP_031427865.1|  5-methyltetrahydropteroyltriglutamate--homoc...    767   0.0     
ref|WP_035243243.1|  5-methyltetrahydropteroyltriglutamate--homoc...    767   0.0     
ref|WP_002713495.1|  5-methyltetrahydropteroyltriglutamate-homocy...    767   0.0     
gb|EGP55139.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    767   0.0     
ref|WP_021071195.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_012023597.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_015005731.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_039108662.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_012495876.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_030605039.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_032767842.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_002726730.1|  5-methyltetrahydropteroyltriglutamate--homoc...    765   0.0     
ref|WP_013912982.1|  5-methyltetrahydropteroyltriglutamate--homoc...    766   0.0     
ref|WP_037340166.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
emb|CDG32926.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    765   0.0     
ref|WP_013933581.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
gb|AAF81245.1|  5-methyltetrahydropteroyltriglutamate-homocystein...    765   0.0     
ref|WP_026596284.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_021155704.1|  5-methyltetrahydropteroyltriglutamate--homoc...    765   0.0     
ref|WP_007804986.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_037234711.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
gb|KAI95639.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    764   0.0     
ref|WP_025124656.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_012563888.1|  5-methyltetrahydropteroyltriglutamate--homoc...    765   0.0     
ref|WP_035619783.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_037103251.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_021132144.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_026362594.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_013216015.1|  5-methyltetrahydropteroyltriglutamate--homoc...    764   0.0     
ref|WP_003965121.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_009734382.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_026970166.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_030431666.1|  5-methyltetrahydropteroyltriglutamate--homoc...    762   0.0     
ref|WP_021246962.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_034711521.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_029915633.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_037518861.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_030067371.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_028861604.1|  5-methyltetrahydropteroyltriglutamate--homoc...    763   0.0     
ref|WP_003476591.1|  5-methyltetrahydropteroyltriglutamate--homoc...    762   0.0     
ref|WP_012842941.1|  5-methyltetrahydropteroyltriglutamate--homoc...    762   0.0     
ref|WP_036297119.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_009340618.1|  5-methyltetrahydropteroyltriglutamate--homoc...    762   0.0     
ref|WP_026629687.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_014555975.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
gb|EPD13914.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    763   0.0     
ref|WP_035850403.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_026234673.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_032775461.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_011571495.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_026990508.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_029271859.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
dbj|GAJ30258.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    760   0.0     
ref|WP_020932738.1|  Methionine synthase II (cobalamin-independent)     760   0.0     
ref|WP_011003974.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_027841346.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_034748794.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_027525720.1|  5-methyltetrahydropteroyltriglutamate--homoc...    761   0.0     
ref|WP_014005529.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_026709548.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_020401013.1|  hypothetical protein                               759   0.0     
gb|KGI79973.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    760   0.0     
ref|WP_012378383.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_036252707.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_030724232.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    760   0.0     
ref|WP_020500547.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_030293446.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_031213554.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_032772285.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_028163660.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_029182681.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_005466580.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_038490539.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_030331426.1|  5-methyltetrahydropteroyltriglutamate--homoc...    760   0.0     
ref|WP_030702802.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    759   0.0     
ref|WP_027022419.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
emb|CEL18357.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    759   0.0     
ref|WP_030339453.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    759   0.0     
ref|WP_039112443.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_034725284.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_015036761.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_028854227.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_032787200.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_023747666.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_019855266.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_023737106.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_012912006.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_013061793.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_035222808.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_030211308.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_020158021.1|  hypothetical protein                               758   0.0     
ref|WP_031356299.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
dbj|BAO45454.1|  5-methyltetrahydropteroyltriglutamate--homocyste...    758   0.0     
ref|WP_026983829.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_033563441.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_011404021.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_030783023.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_031058482.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_009946026.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_020830230.1|  5-methyltetrahydropteroyltriglutamate--homoc...    759   0.0     
ref|WP_031210616.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_031245605.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_010177272.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_022690371.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_031250155.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_030887967.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_031240990.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_030385439.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_026482795.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_034698591.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
gb|ESZ24024.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    757   0.0     
ref|WP_031205853.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|WP_031251506.1|  5-methyltetrahydropteroyltriglutamate--homoc...    758   0.0     
ref|XP_005966092.1|  PREDICTED: probable 5-methyltetrahydropteroy...    761   0.0     
ref|WP_007137401.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_036412411.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_030722759.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_018548575.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_031204787.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_028988857.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_039116927.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_030187911.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_027159243.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_030278061.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    757   0.0     
ref|WP_019867870.1|  hypothetical protein                               756   0.0     
ref|WP_031197364.1|  5-methyltetrahydropteroyltriglutamate--homoc...    757   0.0     
ref|WP_004920216.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
gb|ESZ01137.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    756   0.0     
ref|WP_030814380.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_030349384.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_020012133.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    756   0.0     
gb|ESX00583.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    756   0.0     
ref|WP_007839712.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    756   0.0     
ref|WP_025141654.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_027562722.1|  MULTISPECIES: 5-methyltetrahydropteroyltrigl...    756   0.0     
ref|WP_030736981.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
gb|ESY79421.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    756   0.0     
ref|WP_030881081.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_030084234.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
gb|ESY84750.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    755   0.0     
ref|WP_014938418.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_035268050.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_015808943.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_027765038.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_003520856.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
gb|ESY33171.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    755   0.0     
ref|WP_007473510.1|  5-methyltetrahydropteroyltriglutamate--homoc...    754   0.0     
gb|KIF78105.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    755   0.0     
ref|WP_014615165.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_032753913.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_030562869.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_014778121.1|  5-methyltetrahydropteroyltriglutamate--homoc...    754   0.0     
ref|WP_030704191.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_023432491.1|  5-methyltetrahydropteroyltriglutamate-- homo...    754   0.0     
ref|WP_013419461.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_009756568.1|  5-methyltetrahydropteroyltriglutamate--homoc...    756   0.0     
ref|WP_018653971.1|  hypothetical protein                               754   0.0     
ref|WP_031252634.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
gb|ESZ29599.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    754   0.0     
ref|WP_027577670.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_031257112.1|  5-methyltetrahydropteroyltriglutamate--homoc...    755   0.0     
ref|WP_036793096.1|  5-methyltetrahydropteroyltriglutamate--homoc...    754   0.0     
gb|ESZ70074.1|  5-methyltetrahydropteroyltriglutamate--homocystei...    754   0.0     



>ref|XP_009619432.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009619433.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =  1452 bits (3760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/762 (93%), Positives = 733/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNWAGGEI FDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DL++HQLEAFTKAYAELES   GLNVL 
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLQAHQLEAFTKAYAELESSLSGLNVLT  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVTAFGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTAFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH FYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHTFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKY EVKPALENMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALENMVSAAKAIRTQLA  762



>ref|XP_009791486.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
 ref|XP_009791487.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana sylvestris]
Length=765

 Score =  1452 bits (3759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/762 (93%), Positives = 733/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNWAGGEI FDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPARYNWAGGEIAFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV+TVPVL+GPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DL++HQLEAFTKAYAELES   GLNVL 
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLQAHQLEAFTKAYAELESSLSGLNVLT  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVTAFGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTAFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAA ALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEAVQKAATALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVVLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKY EVKPALENMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALENMVSAAKAIRTQLA  762



>ref|XP_009629870.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
 ref|XP_009629878.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=765

 Score =  1448 bits (3748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/762 (93%), Positives = 734/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV+TVPVLVGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DLE+ +LEAFTKAYAELES   GLNV+V
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLEALKLEAFTKAYAELESSLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVT FGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTGFGFDLVRGTQALDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLDNEIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDNEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKA+AAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALAGTKDEAFFSANAAAQASRKSSPRVTNEAVQKASAALQGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQ+KLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQQKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTTNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKAIRTQLA  762



>gb|AGT40326.1| methionine synthase [Nicotiana attenuata]
Length=765

 Score =  1447 bits (3747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/762 (93%), Positives = 733/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMA+AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMAEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV+TVPVLVGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQ DEP LV+DLE+H+LEAFTKAY +LES   GLNV+V
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQLDEPTLVLDLEAHKLEAFTKAYGDLESSLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVT FGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTGFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLDNEIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDNEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFS NAAAQASRKSSPRVTNE+VQKA+AAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALTGAKDEAFFSVNAAAQASRKSSPRVTNEAVQKASAALQGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKSIRTQLA  762



>ref|XP_011094156.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Sesamum indicum]
Length=765

 Score =  1443 bits (3735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/762 (92%), Positives = 735/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KV+ DLRASIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL+GPV+YLLLSKPAKGVEK+FPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQLEAFTKAYAEL+S F GLNVLV
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYAELQSSFSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLTAL GVT FGFDL+RG K++DLIK  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAPAFKTLTALSGVTGFGFDLVRGAKTLDLIKSEFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TLKSLE IVGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLDASLVTLKSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDSEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEY+K+IKEEI+KVVKLQE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYIKSIKEEINKVVKLQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK+EVEDLEKA I 
Sbjct  541   FWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKEEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPALENMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALENMVAAAKLLRTQLA  762



>ref|XP_011077750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Sesamum indicum]
Length=765

 Score =  1442 bits (3734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/762 (92%), Positives = 735/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAE+L+KV+ DLRASIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEELEKVATDLRASIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVL+GPV+YLLLSKPAKGVEK+FPLLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLIGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV++ELK AGASWIQFDEP LV+DLESHQLEAFTKAY+ELES   G+NVLV
Sbjct  181   LDKILPIYKEVVAELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYSELESSLSGVNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P   FKTLT+LKGV  FGFDL+RGTK++DLIK GFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLPEATFKTLTSLKGVCGFGFDLVRGTKTLDLIKSGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL+TL+SLE IVGKDKLVVSTSCSLLHTAVDL NE KLD EIKSWLAFAAQKV+E
Sbjct  301   NDLSASLTTLQSLEGIVGKDKLVVSTSCSLLHTAVDLANEPKLDKEIKSWLAFAAQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANA AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALTGQKDEAFFSANAEAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKANKISEEEY+K+IKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKANKISEEEYIKSIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK+EVEDLEKA I 
Sbjct  541   FWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKNEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPALENMV+AAK +RT+LA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALENMVAAAKLLRTKLA  762



>ref|XP_009615630.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615631.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
 ref|XP_009615632.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nicotiana tomentosiformis]
Length=765

 Score =  1442 bits (3732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/762 (93%), Positives = 730/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV TVPVL+GPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVNTVPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDK+LPIYKEVISELK AGASWIQFDEP LV+DLE+HQLEAFTKAYAELES   GL+VL+
Sbjct  181   LDKVLPIYKEVISELKAAGASWIQFDEPTLVLDLEAHQLEAFTKAYAELESTLSGLDVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLTALKGVTAFGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAGAFKTLTALKGVTAFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL  LKSLE I GKDKLVVSTSCSLLHTAVDL+NE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLELLKSLEGIAGKDKLVVSTSCSLLHTAVDLINEPKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSA+AAAQASRK+SPRVTNE+VQKAAAAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALAGDKDEAFFSASAAAQASRKTSPRVTNEAVQKAAAALRGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSIAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN  +Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNVDIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+ MVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQAMVSAAKAIRTQLA  762



>ref|XP_009804811.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804812.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009804813.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =  1441 bits (3730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/762 (92%), Positives = 730/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV T PVL+GPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVNTAPVLIGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVISELK AGASWIQFDEP LV+DLE+HQLEAFTKAYAELES   GL+VL+
Sbjct  181   LDKILPIYKEVISELKAAGASWIQFDEPTLVLDLEAHQLEAFTKAYAELESTLSGLDVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLTALKGVTAFGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAGAFKTLTALKGVTAFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL  LKSLE IVGKD+LVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLELLKSLEGIVGKDRLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSA+AAAQASRK+SPRVTNE+VQKAAAAL+GSDHRR TNVSARL
Sbjct  361   VNALAKALAGDKDEAFFSASAAAQASRKTSPRVTNEAVQKAAAALRGSDHRRTTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             D+QQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV+LQEE
Sbjct  421   DSQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSIAQSMTNRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN  +Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNVDIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+ MVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQAMVSAAKAIRTQLA  762



>ref|NP_001275416.1| methionine synthase [Solanum tuberosum]
 gb|AAF74983.1|AF082893_1 methionine synthase [Solanum tuberosum]
Length=765

 Score =  1435 bits (3714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/762 (92%), Positives = 730/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQM+DAGIK+IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEI F TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKA GV+TVPVLVGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQ DEP LV+DLESH+LEAFTKAYA+LES   GLNVLV
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQLDEPTLVLDLESHKLEAFTKAYADLESSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVTAFGFDL+RGT++++LIK  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTAFGFDLVRGTQTLELIKSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE +VGKDKLV STSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLALLQSLEGVVGKDKLVASTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKA+AAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALSGAKDEAFFSANAAAQASRKSSPRVTNEAVQKASAALQGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAI EEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAITEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSKAQEMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN G+++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNVGIEDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKTIRTQLA  762



>gb|ABI35986.1| methionine synthase [Orobanche ramosa]
Length=765

 Score =  1433 bits (3710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/762 (91%), Positives = 734/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADL+ASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLKASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EY EAKALGV TVPVLVGPV+YLLLSKPAKGVEK+FPLLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYNEAKALGVNTVPVLVGPVTYLLLSKPAKGVEKTFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQLEAFTKAYAELES   GLNVL+
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYAELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA A+K LT+L  V+ FGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAAAYKALTSLSAVSGFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL+SLE I+GKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLSASLCTLQSLEGIIGKDKLVVSTSCSLLHTAVDLVNEPKLDQEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGEKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEY+KAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYIKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVEDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPALENMVSAAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALENMVSAAKLLRTQLA  762



>ref|XP_004249374.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
 ref|XP_010312196.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=765

 Score =  1432 bits (3708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/762 (92%), Positives = 728/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQM D GIK+IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMCDTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW GGEI F TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTGGEIEFATYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKA GV+TVPVLVGPVSYLLLSKPAKGV+KSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKAQGVDTVPVLVGPVSYLLLSKPAKGVDKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQ DEP LV+DLESH+LEAFTKAYA+LES   GLNVLV
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQLDEPTLVLDLESHKLEAFTKAYADLESSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVTAFGFDL+RGT++++LIK  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTAFGFDLVRGTQTLELIKSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L++LE +VGKDKLV STSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLALLQTLEGVVGKDKLVASTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKA+AAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALSGAKDEAFFSANAAAQASRKSSPRVTNEAVQKASAALQGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAI EEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAITEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSKAQEMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKTIRTQLA  762



>ref|XP_007204266.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
 gb|EMJ05465.1| hypothetical protein PRUPE_ppa001783mg [Prunus persica]
Length=765

 Score =  1431 bits (3704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/762 (91%), Positives = 730/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGK+SAEDLQKV+ADLR+SIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKTSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYDHVLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDHVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+T+PVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEVISELK AGASWIQFDEP LVMDL+SH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKIIPIYKEVISELKAAGASWIQFDEPTLVMDLDSHKLQAFTDAYSHLESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LKGVTA+GFDL+RGTK++DLIKG FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKGVTAYGFDLVRGTKTLDLIKGEFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  301   NDLSASLSTLQTLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEIS VVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEISNVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET YQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL N+V+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNLVAAAKLLRTQLA  762



>ref|XP_006443469.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006443471.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 ref|XP_006479148.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Citrus sinensis]
 gb|ESR56709.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56711.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=765

 Score =  1430 bits (3702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/762 (92%), Positives = 729/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAK LGVETVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDL+SH+L AF++AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVISELKAAGASWIQFDEPLLVMDLDSHKLHAFSEAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAF+TLT+LKGVTA+GFDL+RGTK+++LIK GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFQTLTSLKGVTAYGFDLVRGTKTLELIKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L+ LE +VGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSVLRGLEGVVGKDKLVVSTSCSLLHTAVDLVNENKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE FFSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEGFFSANAAAQASRKSSPRVTNERVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYV +IKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVASIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA  762



>sp|Q42699.1|METE_CATRO RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Catharanthus roseus]
 emb|CAA58474.1| methionine synthase [Catharanthus roseus]
Length=765

 Score =  1427 bits (3694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/762 (91%), Positives = 727/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVPPRYN+AGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTATMLGAVPPRYNFAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAK LGV+TVPVLVGPV++LLLSKPAKGVEK+FPLLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKELGVDTVPVLVGPVTFLLLSKPAKGVEKTFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILP+YKEVI ELK AGASWIQFDEP LV+DLESHQLEAFTKAY+ELES   GLNV+V
Sbjct  181   LDKILPVYKEVIGELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYSELESTLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +K LTALKGVT FGFDL+RG K++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAETYKILTALKGVTGFGFDLVRGAKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFS NAAAQASRKSSPRVTN++VQKAAAAL+GSDHRRAT VSARL
Sbjct  361   VNALAKALAGEKDEAFFSENAAAQASRKSSPRVTNQAVQKAAAALRGSDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKA KISE++YVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREYKAKKISEDDYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSQTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITN  +Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNLPLQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADV+TIENSRS EKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVMTIENSRSSEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKY EVKPALENMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALENMVSAAKLIRTQLA  762



>gb|ABI95860.1| methionine synthase [Nicotiana suaveolens]
Length=765

 Score =  1427 bits (3693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/762 (91%), Positives = 727/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW  GEIGFDTYF MARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTRGEIGFDTYFFMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKE K LGV+TVPVL GPVSYLLL KPAKGVEKSFPLLSL
Sbjct  121   VPELGPEVNFSYASHKAVDEYKEGKGLGVDTVPVLFGPVSYLLLFKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQ DEP LV+DLE+H+LEAFTKAYAELES   GLNV+V
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQLDEPTLVLDLEAHKLEAFTKAYAELESSLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVT FGFDL+RGT+++DLIK GFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTGFGFDLVRGTQTLDLIKSGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDSEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNAL+KAL G KDEAFFSANAAAQASRKSSPRVTN++VQKA+AAL+GSDHRRATNVSARL
Sbjct  361   VNALSKALAGAKDEAFFSANAAAQASRKSSPRVTNQAVQKASAALQGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT ELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTAELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKEGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAG+GPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGMGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKAIRTQLA  762



>ref|XP_010247947.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nelumbo nucifera]
Length=765

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/762 (91%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLRASIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPDRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYKEAK LGV TVPV++GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYASHKAVNEYKEAKELGVNTVPVIIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILP+YKEV++ELK AG+SWIQFDEP LV+DL SHQLEAFT AY+ELES   GLNVL+
Sbjct  181   LEKILPVYKEVVAELKAAGSSWIQFDEPTLVLDLHSHQLEAFTYAYSELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVT FGFD +RG ++IDLIKGGFPSGK+LFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTGFGFDFVRGPQTIDLIKGGFPSGKFLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL +LE IVGKDKLVVSTSCSLLHTAVDL NETKLD E+KSWLAFAAQKVVE
Sbjct  301   NDLASSLNTLGALEGIVGKDKLVVSTSCSLLHTAVDLANETKLDKELKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE FFSANAAAQASRKSSPRVTNE+VQKAAAALKGS+HRRATNVSARL
Sbjct  361   VNALAKALAGQKDEEFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSEHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISE++YVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEDDYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA + 
Sbjct  541   FWSSLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAAVT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPAL NMVSAAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALSNMVSAAKLLRTQLA  762



>ref|XP_009790020.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
 ref|XP_009790021.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=765

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/762 (93%), Positives = 732/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNW  GEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYNWTSGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK LGV+TVPVLVGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKGLGVDTVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQ DEP LV+DLE+H+LEAFTKAYA+LES   GLNV+V
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQLDEPTLVLDLEAHKLEAFTKAYADLESSLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLTALKGVT FGFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTALKGVTGFGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLNLLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKA+AAL+GSDH RATNVSARL
Sbjct  361   VNALAKALAGAKDEAFFSANAAAQASRKSSPRVTNEAVQKASAALQGSDHHRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSAAQNMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMVSAAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVSAAKSIRTQLA  762



>dbj|BAP47511.1| methionine synthase [Gentiana triflora]
Length=765

 Score =  1422 bits (3682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/762 (91%), Positives = 725/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ +LRASIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVATELRASIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVPPRYN+ GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTATMLGAVPPRYNYGGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAK LGV+TVPVLVGPVS+LL SKPAKGVEKSFPLLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKELGVDTVPVLVGPVSFLLQSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQL+AFTKAYAELES   GLNVLV
Sbjct  181   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLDAFTKAYAELESSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLT LKGVTAFGFDL+RGTK+I+LIKG +PSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAGAFKTLTTLKGVTAFGFDLVRGTKTIELIKGEYPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL+SLE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLSASLSTLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQK+E  FSANAAA ASRKSSPRV NE+VQKAAAALKGS+HRRAT VSARL
Sbjct  361   VDALAKALAGQKNEEIFSANAAALASRKSSPRVNNEAVQKAAAALKGSEHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKANKISE++Y+KAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKANKISEDDYIKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ  TKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTAAQSFTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNTGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKY EVKPAL+NMV AAK IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYGEVKPALQNMVEAAKVIRTQLA  762



>ref|XP_010266670.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Nelumbo nucifera]
Length=765

 Score =  1421 bits (3679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/762 (91%), Positives = 725/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQM   GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMDSVGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYNWAGGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYNWAGGEIGFGTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYKEAK LG++TVPV+VGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPNTKFSYASHKAVNEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILP+YKEV +ELK AGASWIQFDEP LV+DLE HQLEAFTKAYAELES   GLNVL+
Sbjct  181   LEKILPVYKEVAAELKAAGASWIQFDEPTLVLDLEHHQLEAFTKAYAELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPA A+KTLT+LKGVT FGFD +RG +++DLIKG FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAAAYKTLTSLKGVTGFGFDFVRGPQTLDLIKGEFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE IVGK+KLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLEALEGIVGKEKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE+ FS NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDESIFSENAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKANKISE++Y+KAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREYKANKISEDDYIKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E +FYL WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQSFYLEWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPAL NMV+AAK +RT+LA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRTELA  762



>ref|XP_004291976.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Fragaria vesca subsp. vesca]
Length=765

 Score =  1421 bits (3678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/762 (91%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR SIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRCSIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSHYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVKEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEVISELK AGASWIQFDEP LVMDL+SH+L AFT AY++LES   GLNVL+
Sbjct  181   LGKIIPIYKEVISELKAAGASWIQFDEPTLVMDLDSHKLHAFTDAYSQLESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKGVTAYGFDLVRGTKTLDLIKSDFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL++LE IVGKD LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NDLSASLSTLQALEGIVGKDHLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAHYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL  MV+AAK++RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALSAMVAAAKQLRTQLA  762



>emb|CDP10525.1| unnamed protein product [Coffea canephora]
Length=813

 Score =  1420 bits (3677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/776 (89%), Positives = 734/776 (95%), Gaps = 0/776 (0%)
 Frame = +2

Query  77    VNEQLPLFP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIW  256
             +N  +P        MASHIVGYPRMGPKRELKFALESFWD KSSAE+L+KV+ADLRASIW
Sbjct  35    LNHHIPGLTSSERIMASHIVGYPRMGPKRELKFALESFWDKKSSAEELEKVAADLRASIW  94

Query  257   KQMADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPA  436
             KQMADAGIK+IP NTFSYYD VLDT A+LGAVPPRYNW+GGEIGFDTYFSMARGNASVPA
Sbjct  95    KQMADAGIKYIPGNTFSYYDQVLDTIALLGAVPPRYNWSGGEIGFDTYFSMARGNASVPA  154

Query  437   MEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSK  616
             MEMTKWFDTNYHFIVPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGP ++L LSK
Sbjct  155   MEMTKWFDTNYHFIVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPFTFLSLSK  214

Query  617   PAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAY  796
             PAKGVEK+F  LSLLDKILPIYKEVI++LK AGASWIQFDEP LVMDLESHQL+AFTKAY
Sbjct  215   PAKGVEKTFNKLSLLDKILPIYKEVIADLKAAGASWIQFDEPILVMDLESHQLQAFTKAY  274

Query  797   AELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGK  976
             +ELES F GLNVL+ETYFAD+P EAFK +T+L GV+A GFDL+RG K++DLIKGGFP+GK
Sbjct  275   SELESSFSGLNVLIETYFADVPEEAFKAVTSLSGVSAIGFDLVRGAKTLDLIKGGFPAGK  334

Query  977   YLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNE  1156
             YLFAGVVDGRNIWANDLA SL+TL++LE IVGKDKLVVSTS SLLHTAVDLVNE KLD E
Sbjct  335   YLFAGVVDGRNIWANDLAASLTTLQALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDKE  394

Query  1157  IKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALK  1336
             IKSWLAFAAQKVVEV+ALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAAL+
Sbjct  395   IKSWLAFAAQKVVEVDALAKALSGAKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALR  454

Query  1337  GSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKA  1516
             GSDHRRATNVSARLDAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISE+ YVKA
Sbjct  455   GSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKISEDGYVKA  514

Query  1517  IKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP  1696
             IKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP
Sbjct  515   IKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP  574

Query  1697  IIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALA  1876
             IIYGDVSRP PMTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALA
Sbjct  575   IIYGDVSRPNPMTVFWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALA  634

Query  1877  IKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHT  2056
             IKDEVEDLEKA INVIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHT
Sbjct  635   IKDEVEDLEKAGINVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHT  694

Query  2057  HMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP  2236
             HMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP
Sbjct  695   HMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP  754

Query  2237  STEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             STEEIADR+NKMLAVLDTNILWVNPDCGLKTRKY EVKPAL+NMV+AAK+IRTQLA
Sbjct  755   STEEIADRVNKMLAVLDTNILWVNPDCGLKTRKYAEVKPALQNMVAAAKQIRTQLA  810



>ref|XP_010054791.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Eucalyptus grandis]
 gb|KCW89900.1| hypothetical protein EUGRSUZ_A02126 [Eucalyptus grandis]
Length=765

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/762 (90%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQMADA IK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADASIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWKGGEIGHDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV+EYKEAKALGV TVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVSEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVDKNFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVISELK AGASWIQFDEP LVMDL+SH+L+AFT+AY++LES   GLNVL+
Sbjct  181   LGKILPVYKEVISELKAAGASWIQFDEPTLVMDLDSHKLQAFTEAYSQLESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+K LT+LKGVT FGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKVLTSLKGVTGFGFDLVRGTKTLDLIKGAFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL +LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLNALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VN LAKAL GQKDEAFFSANA AQASRK+SPRV N++VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNMLAKALAGQKDEAFFSANATAQASRKTSPRVINQAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISE+EYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEDEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL WAVHSFRITNCGV++TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLEWAVHSFRITNCGVKDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV+AAK +RTQLA
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVKPALKNMVAAAKVLRTQLA  762



>ref|XP_009366484.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009366485.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =  1420 bits (3675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/762 (91%), Positives = 727/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+SELK AGASWIQFDEP LV+DLES +L+AFT AY+ELES   GLNVL+
Sbjct  181   LPKILPIYKEVVSELKAAGASWIQFDEPTLVLDLESDKLQAFTGAYSELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAAAFKTLTSLKGVTAYGFDLVRGTKTLDLIKSEFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTLK+LE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQK++E
Sbjct  301   NDLSASLSTLKTLEGIVGKDKLVVSTSSSLLHTAVDLVNETKLDQEIKSWLAFAAQKIIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEIYKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET YQIALAIKDEVEDLEKA I+
Sbjct  541   FWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKAGIS  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN  VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSCVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RT+LA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTELA  762



>gb|KHG25606.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =  1419 bits (3674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/762 (91%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR++IWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSAIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD T+MLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAK+LGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKSLGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LV+DL+SHQL+AFT AYA+LES   GLNVL+
Sbjct  181   LPKILPIYKEVISELKAAGASWIQFDEPTLVLDLDSHQLQAFTAAYADLESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+  EA+KTL  LKGVTA+G DL+RGT++IDL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTTEAYKTLVGLKGVTAYGLDLVRGTQTIDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL+ LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLQQLEAIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF+ANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFAANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRRE+KANKISEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREFKANKISEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTQRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLKWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI+KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRIDKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALNNMVAAAKLLRTQLA  762



>dbj|BAP47510.1| methionine synthase [Gentiana triflora]
Length=765

 Score =  1419 bits (3674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/762 (91%), Positives = 728/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ +LRASIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATELRASIWKQMSGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVPPRYN+ GGEIG D YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTVTMLGAVPPRYNFNGGEIGHDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSY+SHKAV EYKEAK LG++TVPVLVGPV++LLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPEVNFSYSSHKAVNEYKEAKELGIDTVPVLVGPVTFLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVISELK AGASWIQFDEP LV+DLESHQLEAFTKAYAEL S   GLNVLV
Sbjct  181   LDKILPIYKEVISELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYAELASSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P  AFKTLTAL+GVTAFGFDL+RGTK++DLIKGGFP+ KYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPVGAFKTLTALQGVTAFGFDLVRGTKTLDLIKGGFPTDKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL+SLE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQKV+E
Sbjct  301   NDLSESLSTLQSLEAIVGKDKLVVSTSTSLLHTAVDLVNETKLDKEIKSWLAFAAQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA AL GQK+E FFSANAAA +SRKSSPRVTNE+VQKAA+ALKGSDHRR+TNVSARL
Sbjct  361   VNALATALAGQKNEEFFSANAAALSSRKSSPRVTNEAVQKAASALKGSDHRRSTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISE++YVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEDDYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSEAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNTGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL+NMV+AAK IRTQL+
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALQNMVAAAKVIRTQLS  762



>ref|XP_011008839.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
 ref|XP_011008840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X1 [Populus euphratica]
Length=779

 Score =  1419 bits (3672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLQAFTGAYSALESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+LKGVTAFGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEQYKTLTSLKGVTAFGFDLVRGTKTLDLIKGDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S STL++LE IVGK+KLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASFSTLETLEGIVGKEKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE  FSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEDIFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE++YVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEDDYVKAIKEEIRKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSTLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL+NMV AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLLRTQLA  762



>ref|XP_008237251.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Prunus mume]
Length=765

 Score =  1419 bits (3672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 725/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+T+PVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVDTIPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEVISELK AGASWIQFDEP LVMDL+SH+L+AFT+AY+ LES   GLNVL+
Sbjct  181   LGKIIPIYKEVISELKAAGASWIQFDEPTLVMDLDSHKLQAFTEAYSHLESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ET  A++PA++FKTLT+LKGVTAFG DL+RG K++DLIKG FP GKYLFAG+VDGRNIWA
Sbjct  241   ETXXAELPAQSFKTLTSLKGVTAFGVDLVRGAKTLDLIKGEFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  301   NDLSASLSTLQTLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANA AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANATAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET YQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_008443293.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=765

 Score =  1418 bits (3670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/762 (90%), Positives = 730/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ADLR+SIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY+W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYSWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121   VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILP+YKEVIS+LK AGA+WIQFDEP LV+DL+SH+L+AF+ AYA+LES   GLNVLV
Sbjct  181   LDKILPVYKEVISDLKAAGATWIQFDEPTLVLDLDSHKLKAFSDAYADLESSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVT +GFDL+RGTK++DLIKG FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTGYGFDLVRGTKTLDLIKGDFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+STL+ L  +VGKD LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NDLAASVSTLEELAAVVGKDNLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF++NA A ASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFASNAEAHASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVR DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRVDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+W+VHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWSVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EV PAL+NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVNPALKNMVAAAKLLRTQLA  762



>gb|EYU38730.1| hypothetical protein MIMGU_mgv1a001746mg [Erythranthe guttata]
Length=765

 Score =  1418 bits (3670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/762 (91%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLRASIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRASIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTA+LGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFAYYDQVLDTTALLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EY EAKALG++TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVTFSYASHKAVNEYNEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI ELK AGASWIQFDEP LV+DLE+HQLEAFTKAYAELES   G+NVLV
Sbjct  181   LDKILPIYKEVIGELKAAGASWIQFDEPTLVLDLEAHQLEAFTKAYAELESSLSGVNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA A+KTLT+L G++ FGFDLIRG+K++DLIKG FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAPAYKTLTSLSGISGFGFDLIRGSKTLDLIKGSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+SLE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLTTLQSLEGIVGKDKLVVSTSTSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDE FF+ANAAAQASRKSSPRV NE+VQKAAAALKGS+HRRATNVSARL
Sbjct  361   VNALAKALTGAKDEEFFAANAAAQASRKSSPRVNNEAVQKAAAALKGSEHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEY KAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYTKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITN GV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNVGVEDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPALE MVSAAK +R +LA
Sbjct  721   VLETNILWVNPDCGLKTRKYGEVKPALEAMVSAAKLLRKELA  762



>ref|XP_011008841.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform X2 [Populus euphratica]
Length=779

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/762 (91%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLQAFTGAYSALESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+LKGVTAFGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEQYKTLTSLKGVTAFGFDLVRGTKTLDLIKGDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S STL++LE IVGK+KLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASFSTLETLEGIVGKEKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE  FSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEDIFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE++YVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEDDYVKAIKEEIRKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSTLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRK+TEVKPAL+NMV AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKHTEVKPALKNMVDAAKLLRTQLA  762



>gb|KHG11135.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =  1416 bits (3666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/762 (90%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR+SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD T+MLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EY+EAKALGV+T+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGASWIQFDEP LV+DL+SHQL+AFT AYAELE+   GLNVL+
Sbjct  181   LPKILPIYKEVIAELKAAGASWIQFDEPTLVLDLDSHQLQAFTAAYAELETTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTLT LKGVTA+G DL+RGT++I+LIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTAEAYKTLTELKGVTAYGLDLVRGTQTIELIKSNFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLQALEAVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF+ANA+AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNV+ARL
Sbjct  361   VNALAKALAGQKDEAFFTANASAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRRE+KANKISE++YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREFKANKISEDDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFY  WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYQKWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_004136654.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 ref|XP_004170195.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 gb|KGN59474.1| Methionine synthase [Cucumis sativus]
Length=765

 Score =  1415 bits (3664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/762 (90%), Positives = 729/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ADLR+SIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD VLDTTA+LGAVPPRYNW GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSCYDQVLDTTALLGAVPPRYNWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121   VPELGPEVKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILP+YKEVI++LK AGASWIQFDEP LV+DL+SH+L+AF+ AYAELES   GLNVL+
Sbjct  181   LDKILPVYKEVIADLKAAGASWIQFDEPTLVLDLDSHKLKAFSDAYAELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVT +GFDL+RGTK+++LIKG FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTGYGFDLVRGTKTLELIKGDFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+STL+ L  +VGKD LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NDLAASVSTLEELTALVGKDHLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF++NA A ASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFASNAQAHASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVR DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRVDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+W+VHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWSVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EV PAL+NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVNPALKNMVAAAKLLRTQLA  762



>ref|XP_002325856.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371179.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 ref|XP_006371180.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371181.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371182.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371183.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371185.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371186.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371187.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371188.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371189.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 ref|XP_006371190.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|EEF00238.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48976.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|ERP48977.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48978.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48979.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48980.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48982.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48983.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48984.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48985.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48986.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48987.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=765

 Score =  1415 bits (3663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/762 (90%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLQAFTGAYSALESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+LKGVTAFGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEQYKTLTSLKGVTAFGFDLVRGTKTLDLIKGDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S STL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASFSTLETLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE  FSANAAA ASRKSSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEEIFSANAAALASRKSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE++YVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEDDYVKAIKEEIRKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSTLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL+NMV AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLLRTQLA  762



>ref|XP_009353101.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
 ref|XP_009353102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Pyrus x bretschneideri]
Length=765

 Score =  1414 bits (3660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 725/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM DAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+SELK AGASWIQFDEP LV+DLES +L+AFT AY+ELES   GLN L+
Sbjct  181   LPKILPIYKEVVSELKAAGASWIQFDEPTLVLDLESDKLQAFTDAYSELESTLSGLNALI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAAAFKTLTSLKGVTAYGFDLVRGTKTLDLIKSEFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL++LE IVGK+KLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  301   NDLSASLSTLETLEGIVGKEKLVVSTSSSLLHTAVDLVNETKLDQEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAA ASRKSSPRVTNE+VQKAAAALK SDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAALASRKSSPRVTNEAVQKAAAALKDSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET YQIALAIKDEVEDLEKA I+
Sbjct  541   FWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKAGIS  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_008391707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
 ref|XP_008391708.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Malus domestica]
Length=765

 Score =  1413 bits (3658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 724/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM DAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMTDAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEV+SELK AGASWIQFDEP LV+DLES +L+AFT AY+ELES   GLNVL+
Sbjct  181   LPKILPVYKEVVSELKAAGASWIQFDEPTLVLDLESDKLQAFTDAYSELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFK LT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAAAFKILTSLKGVTAYGFDLVRGTKTLDLIKSEFPKGKYLFAGLVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SLSTL +LE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  301   NDLSASLSTLLTLEGIVGKDKLVVSTSTSLLHTAVDLVNETKLDQEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAA ASRKSSPRVTNE+VQKAAAALK SDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAALASRKSSPRVTNEAVQKAAAALKDSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET YQIALAIKDEVEDLEKA I+
Sbjct  541   FWSSAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTYQIALAIKDEVEDLEKAGIS  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_010549696.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Tarenaya hassleriana]
Length=765

 Score =  1412 bits (3655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVL+GPVSYLLLSK AKGVEK+F LLSL
Sbjct  121   VPELGPEVKFSYASHKAVDEYKEAKALGVETVPVLIGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEVISELKGAGA+WIQFDEP LVMDLES +L+AFT AYAELES   GLNVLV
Sbjct  181   IDKILPIYKEVISELKGAGATWIQFDEPLLVMDLESDKLQAFTDAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLIKAGFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL  LE I GKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLSELEGIAGKDKLVVSTSCSLLHTAVDLVNEPKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+L GQKDEAFFSANAAA ASR+SSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKSLAGQKDEAFFSANAAALASRRSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKISEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYAEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_010097930.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
 gb|EXB73286.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
Length=765

 Score =  1412 bits (3655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/762 (90%), Positives = 724/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSAEDLQKV+ADLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRVGPKRELKFALESFWDGKSSAEDLQKVAADLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P++KFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELSPEIKFSYASHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +  ILP+YKEV++ELK AGA+W+QFDEP LV DL++HQL+AFT AY+ELES   GLNV++
Sbjct  181   IGSILPVYKEVLAELKAAGATWVQFDEPTLVKDLDAHQLQAFTHAYSELESSLSGLNVVI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEAFKTLT LKGVT +GFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVTAEAFKTLTGLKGVTGYGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF+ANA AQASR+SSPRVTNE+VQKAAAALKGSDHRRATNVS+RL
Sbjct  361   VNALAKALAGQKDEAFFTANAGAQASRRSSPRVTNEAVQKAAAALKGSDHRRATNVSSRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP LPTTTIGSFPQT+ELRRVRREYKA KISEEEYV AIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPALPTTTIGSFPQTLELRRVRREYKAKKISEEEYVNAIKEEIKKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ  TKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSFAQSTTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSREEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +R+QLA
Sbjct  721   VLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRSQLA  762



>ref|XP_010558700.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558701.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010558702.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =  1412 bits (3654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 690/762 (91%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQM+DAGIKFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSY+SHKAV EYKEAKALGVETVPVL+GPVSYLLLSK AKGVEK+F LLSL
Sbjct  121   VPELGPEVTFSYSSHKAVDEYKEAKALGVETVPVLIGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI ELKGAGA+WIQFDEP LVMDLES +L+AFT AYAELES F GLNVLV
Sbjct  181   LGKILPIYKEVIGELKGAGATWIQFDEPLLVMDLESDKLQAFTDAYAELESSFSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEAFKTLT+LKGVTAFGFDL+RGTK++DLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAFKTLTSLKGVTAFGFDLVRGTKTLDLIKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SLSTL  LE IVGKD+LVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLVASLSTLSELEGIVGKDRLVVSTSCSLLHTAVDLVNEPKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS NA+A ASR+SSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSVNASALASRRSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSTTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_002525709.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF36692.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=765

 Score =  1411 bits (3653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/762 (90%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR SIWKQMA AGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVASDLRESIWKQMAAAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAVTEYKEAKA GV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVTEYKEAKAHGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVISELK AGASWIQFDEP LV+DL+SH+L+AFT AY+ELES   GLNVL+
Sbjct  181   LGKILPVYKEVISELKAAGASWIQFDEPTLVLDLDSHKLQAFTDAYSELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEAFKTLT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAFKTLTSLKGVTAYGFDLVRGTKTLDLIKSEFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+ L  LE IVGKDKLVVSTS SLLHTAVDLVNETKLD E+KSWLAFAAQK+VE
Sbjct  301   NDLAASLTILHELEGIVGKDKLVVSTSSSLLHTAVDLVNETKLDKELKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGEKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA K+SE++YVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKVSEDDYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLEMNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRTQLA  762



>gb|AEO86798.1| methionine synthase [Camellia sinensis]
Length=765

 Score =  1411 bits (3653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/762 (90%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV+ADLR+SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMASAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEM KWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMAKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPEIKFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV++ELK AGASWIQFDEP LV DLESHQL+AFT AY+ELES   GLNV+V
Sbjct  181   LDKILPIYKEVVAELKAAGASWIQFDEPTLVKDLESHQLQAFTAAYSELESALSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LK VT FGFDL+RG +++DLI  GFPSG+YLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKCVTGFGFDLVRGAQTLDLITSGFPSGEYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L++LE IVGKDKLVVSTSCSLLHTAVDLVNETK D E+KSWLAFAAQKVVE
Sbjct  301   NDLAASLSLLQTLEGIVGKDKLVVSTSCSLLHTAVDLVNETKFDKELKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VN+LAKAL G KDEAFFS NAAAQASRKSSPRVTNE+VQKAAAAL+GSDHRRATNVSARL
Sbjct  361   VNSLAKALAGHKDEAFFSENAAAQASRKSSPRVTNEAVQKAAAALRGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPII+GDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIFGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSMAQSMTTRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQ+DEAALREGLPLRK+E AFYL+WAVHSFRITNCGV +TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQMDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVTDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML 
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLQ  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK+IRTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYHEVKPALLNMVAAAKQIRTQLA  762



>gb|ABS01352.1| methionine synthase [Carica papaya]
Length=765

 Score =  1411 bits (3653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/762 (90%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQM+DA IK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDARIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAVTEYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVTFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILP+YKEVISELK AGASWIQFDEP LV+DL++H+L+AFT AY+ELES   GL+VL+
Sbjct  181   LNKILPVYKEVISELKAAGASWIQFDEPTLVLDLDAHKLQAFTDAYSELESTLSGLSVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT LKGVT +GFDL+RGTK++DLIKGGFP GKYLF+GVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTGLKGVTGYGFDLVRGTKTLDLIKGGFPKGKYLFSGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL+ LE IVGK+ LVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLQELEGIVGKENLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA+AL GQKDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAQALAGQKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKA KISE++YVKAIK EI KVV LQE+
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREYKAKKISEDDYVKAIKAEIKKVVALQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLEWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPAL+NMV+AAK +RT+LA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALKNMVAAAKLLRTELA  762



>ref|XP_008386852.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
 ref|XP_008386853.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Malus domestica]
Length=765

 Score =  1410 bits (3651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/762 (91%), Positives = 724/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQMADAGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMADAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+SELK AGASWIQFDEP LV+DLES +L+AFT AY+ELES   GLNVL+
Sbjct  181   LPKILPIYKEVVSELKAAGASWIQFDEPTLVLDLESDKLQAFTGAYSELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA AFKTLT+LKGVTA+GFDL+RGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAAAFKTLTSLKGVTAYGFDLVRGTKTLDLIKSKFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SLSTL++LE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQK++E
Sbjct  301   NDLCASLSTLETLEGIVGKDKLVVSTSTSLLHTAVDLVNETKLDQEIKSWLAFAAQKIIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALK SDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKDSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEIXKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS AAQ MT RPMKGMLTGPVTILNWSFVRNDQPRFET +QIALAIKDEVEDLEKA I+
Sbjct  541   FWSCAAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETTFQIALAIKDEVEDLEKAGIS  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNSGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYPEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_010524993.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/762 (91%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQM+DAG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMSDAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPSRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGVEK+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVDEYKEAKALGVETVPVLVGPVSYLLLSKRAKGVEKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             ++KILPIYKEVI+ELKGAGA+WIQFDEP LVMDLE  +L+AFT AYAELES   GLNVLV
Sbjct  181   VEKILPIYKEVITELKGAGATWIQFDEPLLVMDLEGDKLQAFTDAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFD IRGTK++DLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDFIRGTKTLDLIKAGFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL  LE IVGKD LVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLSELEGIVGKDNLVVSTSCSLLHTAVDLVNEPKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAA ASR+SSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSANAAALASRRSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKISEEEYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I+
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIS  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYAEVKPALKNMVDAAKLIRSQLA  762



>gb|KDP39669.1| hypothetical protein JCGZ_02689 [Jatropha curcas]
Length=765

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/762 (90%), Positives = 724/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV+ +LR SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLEKVAFELRESIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA+LGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTALLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVISELK AGASWIQFDEP LVMDL+SH+L+AFT AY+ELES   GLNV+V
Sbjct  181   LGKILPVYKEVISELKEAGASWIQFDEPTLVMDLDSHKLQAFTDAYSELESTLSGLNVVV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LKGVT +GFDL+RGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKGVTGYGFDLVRGTKTLDLIKSDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL+ LE IVGKDKLVVSTS SLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLQELEGIVGKDKLVVSTSSSLLHTAVDLVNETKLDQEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALAGEKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALRGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEY KAIK EI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYTKAIKAEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGF FT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFVFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY+EVKPAL+NMV+AAK +RT+LA
Sbjct  721   VLEKNILWVNPDCGLKTRKYSEVKPALKNMVAAAKLLRTELA  762



>gb|KHG11134.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=778

 Score =  1407 bits (3643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/775 (89%), Positives = 726/775 (94%), Gaps = 13/775 (2%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR+SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMAAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD T+MLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EY+EAKALGV+T+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYEEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGASWIQFDEP LV+DL+SHQL+AFT AYAELE+   GLNVL+
Sbjct  181   LPKILPIYKEVIAELKAAGASWIQFDEPTLVLDLDSHQLQAFTAAYAELETTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTLT LKGVTA+G DL+RGT++I+LIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTAEAYKTLTELKGVTAYGLDLVRGTQTIELIKSNFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLSTLQALEAVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF+ANA+AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNV+ARL
Sbjct  361   VNALAKALAGQKDEAFFTANASAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRRE+KANKISE++YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREFKANKISEDDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPE-------------RNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPI  1699
             LDIDVLVHGEPE             RNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPI
Sbjct  481   LDIDVLVHGEPELLASILVILKIVQRNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPI  540

Query  1700  IYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAI  1879
             IYGDVSRPKPMTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAI
Sbjct  541   IYGDVSRPKPMTVFWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAI  600

Query  1880  KDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTH  2059
             KDEVEDLEKA INVIQIDEAALREGLPLRK+EHAFY  WAVHSFRITNCGVQ+TTQIHTH
Sbjct  601   KDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYQKWAVHSFRITNCGVQDTTQIHTH  660

Query  2060  MCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS  2239
             MCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS
Sbjct  661   MCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS  720

Query  2240  TEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             TEEIADRINKMLAVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   TEEIADRINKMLAVLETNILWVNPDCGLKTRKYAEVKPALSNMVAAAKLLRTQLA  775



>ref|XP_002319710.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 ref|XP_006375907.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
 gb|EEE95633.1| hypothetical protein POPTR_0013s05850g [Populus trichocarpa]
 gb|ERP53704.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
family protein [Populus trichocarpa]
Length=765

 Score =  1407 bits (3641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/762 (90%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAVTEYKEAKALGV+T+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVTEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+LEAFT+AY+ELES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLEAFTEAYSELESTVSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPA+ +KTLT+LKGVTA GFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAKQYKTLTSLKGVTALGFDLVRGTKTLDLIKGEFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL +LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLVALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDE FFSAN AA  SRKSSPRV NE+VQKAAAALKGSDHRR TNVSARL
Sbjct  361   VNALAKALAGEKDEEFFSANVAAHTSRKSSPRVNNEAVQKAAAALKGSDHRRVTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE +YV+AIK+EISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEVDYVEAIKKEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGF F+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFVFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSALAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPAL+NMV AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALKNMVDAAKLLRTQLA  762



>gb|KHG01449.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =  1406 bits (3640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/762 (90%), Positives = 722/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR+SIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD T+MLGAVPPRY W+GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATSMLGAVPPRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV TVPVL+GPVSYLLLSKPAKGV+K+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKALGVNTVPVLIGPVSYLLLSKPAKGVDKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVIS+LK AGASWIQFDEP LV+DL+SH+L+AFT AY +LES   GLNVL+
Sbjct  181   LPKILPIYKEVISDLKAAGASWIQFDEPTLVLDLDSHKLQAFTAAYDDLESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTL  LKGVTA+G DL+RG +++DL+K  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTAEAYKTLIGLKGVTAYGLDLVRGAQTLDLVKSNFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTLK LE +VGK+ LVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLKELEAVVGKENLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKL+LP+LPTTTIGSFPQT+ELRRVRRE+KANKISE++Y+KAIKEEI KVV LQEE
Sbjct  421   DAQQKKLDLPILPTTTIGSFPQTLELRRVRREFKANKISEDDYIKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLKWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALNNMVAAAKLLRTQLA  762



>gb|KHG18420.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=765

 Score =  1406 bits (3639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/762 (90%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSS EDLQKV+A LR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSGEDLQKVAAGLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV EYKEAKALGV TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVRFSYASHKAVDEYKEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LV+DL++HQL+AFT AYA+LES   GLNVL+
Sbjct  181   LPKILPIYKEVISELKAAGASWIQFDEPTLVLDLDAHQLQAFTAAYADLESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ + A+KTL  LKGVTA+G DL+RGTK+IDLIK  FP GK+LFAGVVDGRNIWA
Sbjct  241   ETYFADLTSGAYKTLIELKGVTAYGLDLVRGTKTIDLIKTNFPKGKFLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL++LE IVGK  LVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLGTLQALEAIVGKGNLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFF++NA AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFTSNATAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRRE+KANKISE++YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREFKANKISEDDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLKWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALNNMVAAAKLLRTQLA  762



>ref|XP_007030023.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007030024.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10525.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10526.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=765

 Score =  1405 bits (3636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 686/762 (90%), Positives = 722/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTT+MLGAVPPRY+W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTSMLGAVPPRYSWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+P+YKEVISELK AGASWIQFDEP LV+DL+S++LEAFT AYA+LES   GLNVLV
Sbjct  181   LPKIIPVYKEVISELKAAGASWIQFDEPTLVLDLDSYKLEAFTAAYADLESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEAFKTL  LKGVTA+G DL+RGT++I LIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTAEAFKTLCGLKGVTAYGVDLVRGTQTIGLIKSDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S++TL+ LE +VGKDKLVVS+SCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSVNTLQELEAVVGKDKLVVSSSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAA ASRKSSPRVTNE+VQKAAAALK SDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSANAAALASRKSSPRVTNEAVQKAAAALKSSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT+ELRRVRRE+KA KISE+ YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTLELRRVRREFKAKKISEDVYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLKWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPAL+NMV+AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVKPALKNMVAAAKLLRTQLA  762



>ref|XP_002276438.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Vitis vinifera]
Length=765

 Score =  1405 bits (3636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/762 (90%), Positives = 725/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLRASIWKQMADAG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEI FD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EY+EAKALGV+TVPV VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVFVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV++ELK AGAS IQFDEP LVMDL+SH+L+AFT AY+ELE+   GLNV+V
Sbjct  181   LDKILPIYKEVVAELKAAGASSIQFDEPTLVMDLDSHKLQAFTHAYSELEASCSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P+EAFKTLT+LKGVT FGFDL+RGTK++DLIK GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPSEAFKTLTSLKGVTGFGFDLVRGTKTLDLIKVGFPTGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L+ LE IVGKDKLVVSTSCSLLHTAVDL+NE KLD EIKSWLAFAAQK+VE
Sbjct  301   NDLAASLSVLQELESIVGKDKLVVSTSCSLLHTAVDLINEPKLDQEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G K+EAFFS NA+AQASRKSSPRVTNE+VQKAA+ALKGSDHRRAT+VSARL
Sbjct  361   VNALAKALAGHKEEAFFSDNASAQASRKSSPRVTNEAVQKAASALKGSDHRRATDVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQ+KL LPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQRKLKLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEV PAL+NMV+AAK +RT+LA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVMPALKNMVAAAKLLRTELA  762



>gb|KDP42919.1| hypothetical protein JCGZ_23861 [Jatropha curcas]
Length=765

 Score =  1404 bits (3634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 728/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKV+ADLR+SIWKQMAD+ IKFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWKQMADSDIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALG+ETVPV+VGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVDEYKEAKALGIETVPVIVGPVSYLLLSKQAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILP+YKEV++ELK AGASWIQFDEP LVMDL++H+L+AFT+AY+ELE    G+NVL+
Sbjct  181   LDKILPVYKEVVTELKEAGASWIQFDEPKLVMDLDAHELQAFTQAYSELEGTLSGVNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGV+ FGFDL+RGTK++DLIKGGFP+GK+LFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVSGFGFDLVRGTKTLDLIKGGFPTGKFLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+  L S+E IVGKDK+VVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKV+E
Sbjct  301   NDLASSIDLLHSIEAIVGKDKVVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NA AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALVGQKDEAFFSSNALAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE++YVKAIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTLDLRRVRREYKAKKISEDDYVKAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ +TKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSTMAQSLTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY EVKPAL NMV+AAK +RT+LA
Sbjct  721   VLESNILWVNPDCGLKTRKYAEVKPALSNMVAAAKLLRTELA  762



>ref|XP_009398356.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Musa acuminata subsp. malaccensis]
Length=766

 Score =  1403 bits (3632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/763 (90%), Positives = 721/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+A+DLQKV+ DLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTADDLQKVATDLRHSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYN+ GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHK V+EYKEAKALG+ETVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELGPNTKFSYSSHKPVSEYKEAKALGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEVI+ELK AGASWIQFDEP LVMDLESHQLEAFTKAY ELES   GLNVL 
Sbjct  181   LGSILPIYKEVIAELKAAGASWIQFDEPTLVMDLESHQLEAFTKAYTELESSLSGLNVLA  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+P EA+KT+TALK ++ FGFDL+RGTK++DL+K  GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPPEAYKTITALKSISGFGFDLVRGTKTLDLVKSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S+STL++LE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLASSISTLETLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEAFFSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAFFSANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEISKVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVKPALTNMVAAAKLLRTQLA  763



>emb|CDY38470.1| BnaA10g16880D [Brassica napus]
Length=765

 Score =  1403 bits (3632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/762 (89%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLRA+IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRANIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTVAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDFAASLSTLEALEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  IN
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_004228469.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Solanum lycopersicum]
Length=817

 Score =  1403 bits (3631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/766 (89%), Positives = 728/766 (95%), Gaps = 0/766 (0%)
 Frame = +2

Query  107   RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKF  286
             R   MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KV+ADLR SIWKQMADAGIK+
Sbjct  49    RFRTMASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRLSIWKQMADAGIKY  108

Query  287   IPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTN  466
             IPSNTFSYYD VLDTTAMLGAVPPRY W GGEIGFD YF MARGNASVPAMEMTKWFDTN
Sbjct  109   IPSNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTN  168

Query  467   YHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFP  646
             YH+IVPELGPDVKFSYASHKAV+EYKEAK+LG++TVPVLVGPVS+LLLSK AKGVEKSFP
Sbjct  169   YHYIVPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVLVGPVSFLLLSKAAKGVEKSFP  228

Query  647   LLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGL  826
             LLSL++KILP+YKEVI+ELK AGASWIQFDEP LV DL+SHQL+AF+ AY+ELES   GL
Sbjct  229   LLSLIEKILPVYKEVIAELKAAGASWIQFDEPTLVKDLDSHQLQAFSHAYSELESPLSGL  288

Query  827   NVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGR  1006
             NVL+ETYFAD+PAEAFKT+T+LK VTA GFDL+RG+K++DLIK GFPS KYLFAGVVDGR
Sbjct  289   NVLIETYFADVPAEAFKTVTSLKCVTALGFDLVRGSKNLDLIKSGFPSEKYLFAGVVDGR  348

Query  1007  NIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQ  1186
             NIWANDLA SLSTL++LE++VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQ
Sbjct  349   NIWANDLAASLSTLQALENVVGKDKLVVSTSCSLLHTAVDLVNETKLDEEIKSWLAFAAQ  408

Query  1187  KVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNV  1366
             K+VEVNALAKAL GQKDEAFFSANAAA+ SRKSSPRVTN +VQKAAAALKGSDHRRAT V
Sbjct  409   KLVEVNALAKALAGQKDEAFFSANAAARTSRKSSPRVTNGAVQKAAAALKGSDHRRATTV  468

Query  1367  SARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVK  1546
             SARL+AQQKKL+LP LPTTTIGSFPQT+ELR+VRREYKANKISEE+YVK I EEISKVVK
Sbjct  469   SARLEAQQKKLSLPSLPTTTIGSFPQTLELRKVRREYKANKISEEDYVKYITEEISKVVK  528

Query  1547  LQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK  1726
             LQE+LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK
Sbjct  529   LQEDLDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK  588

Query  1727  PMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEK  1906
             PMTVFWSS AQ M+KRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEK
Sbjct  589   PMTVFWSSRAQSMSKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEK  648

Query  1907  ANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDI  2086
             A INVIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDI
Sbjct  649   AGINVIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDI  708

Query  2087  IHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRIN  2266
             IHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHS RIPSTEEIADRI+
Sbjct  709   IHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSQRIPSTEEIADRIS  768

Query  2267  KMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             KMLAVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R QLA
Sbjct  769   KMLAVLDTNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRNQLA  814



>ref|XP_010553797.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010553799.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=765

 Score =  1402 bits (3630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/762 (90%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWK+MADA IK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKRMADAEIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAVTEYKEA ALGVETVPVLVGPVSYLLLSKPAK VEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVTEYKEAMALGVETVPVLVGPVSYLLLSKPAKDVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILP+YKEVISELK AGA+WIQFDEP LVMDL++++L+AFT AYAELES   GLNVL+
Sbjct  181   LNKILPVYKEVISELKQAGATWIQFDEPQLVMDLDANKLKAFTDAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KT+T+LKGVTA+G DL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTITSLKGVTAYGLDLVRGTKNLDLVKSGFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+ LE I GKDKLVVSTSCSLLHTAVDL+NETKLDNEIKSWLAFAAQKV+E
Sbjct  301   NDLASSLKTLQELEGIAGKDKLVVSTSCSLLHTAVDLINETKLDNEIKSWLAFAAQKVIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANA AQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALDGHKDEAFFSANAEAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+Y+KAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYIKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMD DVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEE+A+RINKMLA
Sbjct  661   IDMDTDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEMAERINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_011005896.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=814

 Score =  1402 bits (3629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/762 (89%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQ+V+ADLR+SIWKQM+DAGIKFIPSN
Sbjct  50    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQRVAADLRSSIWKQMSDAGIKFIPSN  109

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  110   TFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  169

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  170   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  229

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+Y+EV++ELK AGASWIQFDEP LVMDL +H+L+AFT AY+ LE+   GLNVLV
Sbjct  230   IDKILPVYQEVLAELKAAGASWIQFDEPKLVMDLGAHELQAFTHAYSALEASLSGLNVLV  289

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P EA+KTLT+LK VT FGFDL+RGTK+++LIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  290   ETYFADVPVEAYKTLTSLKSVTGFGFDLVRGTKTLELIKGGFPSGKYLFAGVVDGRNIWA  349

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+LA SL TLK+LE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  350   NNLASSLDTLKALEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  409

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQ+DEAFFSANAAAQASRKSSPRVTNE+VQKAA ALKGSDHRRATNVSARL
Sbjct  410   VNALAKALAGQQDEAFFSANAAAQASRKSSPRVTNEAVQKAAVALKGSDHRRATNVSARL  469

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE+ YV+AIKEEI+KVVK+QEE
Sbjct  470   DAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISEQNYVEAIKEEINKVVKIQEE  529

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  530   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  589

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  590   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  649

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  650   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNCGVEDTTQIHTHMCYSNFNDIIHSI  709

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI KMLA
Sbjct  710   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSEEEIADRIEKMLA  769

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY EVKPAL NMV+AAK +RT+L 
Sbjct  770   VLESNILWVNPDCGLKTRKYAEVKPALSNMVAAAKHLRTKLG  811



>ref|XP_002515852.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
 gb|EEF46521.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase, 
putative [Ricinus communis]
Length=815

 Score =  1402 bits (3629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/762 (89%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHI GYPRMGPKRELKFALESFWDGKSSAEDLQKV+A+LRASIWKQMADAG KFIPSN
Sbjct  51    MASHIAGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADAGTKFIPSN  110

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  111   TFSYYDQVLDTTAMLGAVPPRYGWDGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  170

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  171   VPELGPEVKFSYASHKAVDEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  230

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +D+ILPIYKEVI+ELK AGA WIQFDEP LVMDL+SH+L+AFT AY+ELE+   G++V+V
Sbjct  231   IDRILPIYKEVIAELKAAGARWIQFDEPKLVMDLDSHELQAFTNAYSELEASLSGVHVVV  290

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVT FGFDL+RGTK++DLIKGGFP+GK+LFAGVVDGRNIWA
Sbjct  291   ETYFADLPAEAYKTLTSLKGVTGFGFDLVRGTKTLDLIKGGFPTGKFLFAGVVDGRNIWA  350

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL +LE  VGKDK+VVSTSCSLLHTAVDL NE KLD EIKSWLAFAAQKV+E
Sbjct  351   NDLASSLDTLHALESAVGKDKVVVSTSCSLLHTAVDLANEPKLDKEIKSWLAFAAQKVLE  410

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G +DEAFFS+NA A ASRKSSPRVTNE+VQ+AAAALKGSDHRRATNVSARL
Sbjct  411   VNALAKALAGNRDEAFFSSNALAHASRKSSPRVTNEAVQQAAAALKGSDHRRATNVSARL  470

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE++YVKAIKEEISKVVK+QEE
Sbjct  471   DAQQKKLNLPILPTTTIGSFPQTLDLRRVRREYKAKKISEDDYVKAIKEEISKVVKIQEE  530

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  531   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  590

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I 
Sbjct  591   FWSSMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIT  650

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  651   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVEDTTQIHTHMCYSNFNDIIHSI  710

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  711   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  770

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY+EVKPAL NMV+A K +RTQLA
Sbjct  771   VLESNILWVNPDCGLKTRKYSEVKPALSNMVAATKILRTQLA  812



>ref|XP_011034320.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
 ref|XP_011034321.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Populus euphratica]
Length=765

 Score =  1402 bits (3628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFA ESFWDGKSSAEDLQKV+ADLR SIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFASESFWDGKSSAEDLQKVAADLRESIWKQMTDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+T+PVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFSYASHKAVAEYKEAKALGVDTIPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+LEAFT+AY+ELES   G+NVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLEAFTEAYSELESTVSGMNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPA+ +KTLT+LKGVTA GFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAKQYKTLTSLKGVTALGFDLVRGTKTLDLIKGEFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDE FFSAN AA  SRKSSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGVKDEEFFSANVAAHTSRKSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE +YV+AIK+EISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEVDYVEAIKKEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGF F+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFVFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSALAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIE SRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIEKSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EVKPAL+NMV AAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVKPALKNMVDAAKLLRTQLA  762



>ref|XP_009591564.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana tomentosiformis]
Length=829

 Score =  1402 bits (3628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 723/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGK+S+EDL+KV+ADLR+SIWKQMA+AG+K+IPSN
Sbjct  65    MASHVVGYPRMGPKRELKFALESFWDGKNSSEDLEKVAADLRSSIWKQMAEAGVKYIPSN  124

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W G EIGFD YF MARGNASVPAMEMTKWFDTNYH+I
Sbjct  125   TFSYYDQVLDTTAMLGAVPPRYSWNGSEIGFDVYFPMARGNASVPAMEMTKWFDTNYHYI  184

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKF YASHKAV EYKEAK+LGV+TVPVLVGPVS+LLLSK AKGVEKSFPLLSL
Sbjct  185   VPELGPDVKFCYASHKAVNEYKEAKSLGVDTVPVLVGPVSFLLLSKAAKGVEKSFPLLSL  244

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEVI+ELK AGASWIQFDEP LV DL+SHQL  F+ AY+ELES   GLNVL+
Sbjct  245   IDKILPVYKEVITELKAAGASWIQFDEPTLVKDLDSHQLREFSHAYSELESSLSGLNVLI  304

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKT+TALKGVTA GFDL+RG+K++DLIK  FPS KYLFAGVVDGRNIWA
Sbjct  305   ETYFADVPAEAFKTVTALKGVTALGFDLVRGSKTLDLIKSSFPSEKYLFAGVVDGRNIWA  364

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE+IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  365   NDLASSLSTLQALENIVGKDKLVVSTSCSLLHTAVDLVNETKLDEEIKSWLAFAAQKLVE  424

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQ+DEAFFSANAAA+ SRKSSPRVTNE+VQKAAA+LKGSDHRRATNVS RL
Sbjct  425   VNALAKALAGQRDEAFFSANAAARTSRKSSPRVTNEAVQKAAASLKGSDHRRATNVSVRL  484

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             +AQQKKLNLPVLPTTTIGSFPQT+ELR+VRREYKANKIS E YVK I EEISKVVKLQEE
Sbjct  485   EAQQKKLNLPVLPTTTIGSFPQTLELRKVRREYKANKISGEGYVKYITEEISKVVKLQEE  544

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  545   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  604

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ M+KRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  605   FWSSLAQSMSKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKAGIN  664

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  665   VIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  724

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI+KMLA
Sbjct  725   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRISKMLA  784

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEV PAL NMV+AAK +R QLA
Sbjct  785   VLDTNILWVNPDCGLKTRKYTEVNPALSNMVAAAKLLRAQLA  826



>ref|XP_004960256.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Setaria italica]
Length=774

 Score =  1401 bits (3627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/763 (89%), Positives = 722/763 (95%), Gaps = 0/763 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ DLRASIWKQMADAGIK+IPS
Sbjct  9     KMASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPS  68

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVP RY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHF
Sbjct  69    NTFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHF  128

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGP+ KF+Y+SHKAV EYKEAKALGV+TVPVL GPVSYLLLSK AKGVEK FPLLS
Sbjct  129   IVPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVLTGPVSYLLLSKAAKGVEKGFPLLS  188

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL  ILP+YKEVI+ELK AGASWIQFDEP LV+DL+S +L AF+ AY ELES   GLNVL
Sbjct  189   LLSGILPVYKEVIAELKAAGASWIQFDEPTLVLDLDSQKLAAFSAAYTELESALSGLNVL  248

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
             +ETYFAD+PAE++KTLT+L GVTA+GFDL+RG +++DL+K GFP+GKYLFAGVVDGRNIW
Sbjct  249   IETYFADVPAESYKTLTSLSGVTAYGFDLVRGAQTLDLVKSGFPAGKYLFAGVVDGRNIW  308

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVV
Sbjct  309   ADDLAASLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDAEIKSWLAFAAQKVV  368

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL GQKDEA+F+ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  369   EVDALAKALAGQKDEAYFAANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  428

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYV AIKEEI+KVVKLQE
Sbjct  429   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVTAIKEEINKVVKLQE  488

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  489   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  548

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  549   VFWSTTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  608

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNC +++TTQIHTHMCYSNFNDIIHS
Sbjct  609   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCEIKDTTQIHTHMCYSNFNDIIHS  668

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  669   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  728

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQLA
Sbjct  729   AVLETNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQLA  771



>ref|XP_009398511.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Musa acuminata subsp. malaccensis]
Length=766

 Score =  1401 bits (3626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/763 (89%), Positives = 719/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRE+KFALESFWDGKSSA+DLQKV+ DLR SIWKQM D GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKREIKFALESFWDGKSSADDLQKVATDLRCSIWKQMTDVGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD TAMLGAVP RYN+ GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATAMLGAVPERYNYTGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV+EYKEAKALG+ET+PVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELGPNTKFSYSSHKAVSEYKEAKALGIETIPVLIGPVTYLLLSKPAKGVEKSFAPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+ ILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQLEAFTKAY ELES   GLNVL+
Sbjct  181   LESILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLEAFTKAYTELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+K +TALKGV+ FGFDLIRG K++DL+K  GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKIITALKGVSGFGFDLIRGAKTLDLVKSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S STL++LE IVGKDKLVVSTSCSL+HTAVDLVNETKLDNEIKSWLAFAAQKVV
Sbjct  301   ANDLASSFSTLQALEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDNEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEAFFSANAAAQ+SRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAFFSANAAAQSSRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEVAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMVSAAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVNPALTNMVSAAKVLRTQLA  763



>ref|XP_006384691.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
 gb|ERP62488.1| hypothetical protein POPTR_0004s20220g [Populus trichocarpa]
Length=817

 Score =  1401 bits (3626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/762 (89%), Positives = 722/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQM+DAGIKFIPSN
Sbjct  53    MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMSDAGIKFIPSN  112

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  113   TFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  172

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  173   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  232

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+Y+EV++ELK AGASWIQFDEP LVMDL +H+L+AFT AY+ LE+   GLNVLV
Sbjct  233   IDKILPVYQEVLAELKAAGASWIQFDEPKLVMDLGAHELQAFTHAYSALEASLSGLNVLV  292

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P EA+KTLT+LK VT FGFDL+RGTK+++LIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  293   ETYFADVPVEAYKTLTSLKSVTGFGFDLVRGTKTLELIKGGFPSGKYLFAGVVDGRNIWA  352

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+L  SL TLK+LE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  353   NNLGSSLDTLKALEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  412

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQ+DEAFFSANAAAQASRKSSPRVTNE+VQKAA ALKGSDHRRATNVSARL
Sbjct  413   VNALAKALAGQQDEAFFSANAAAQASRKSSPRVTNEAVQKAAVALKGSDHRRATNVSARL  472

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE+ YV+AIKEEI+KVVK+QEE
Sbjct  473   DAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISEQNYVEAIKEEINKVVKIQEE  532

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  533   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  592

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  593   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  652

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  653   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNCGVEDTTQIHTHMCYSNFNDIIHSI  712

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI KMLA
Sbjct  713   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSEEEIADRIEKMLA  772

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY EVKPAL NMV+AAK +RT+L 
Sbjct  773   VLESNILWVNPDCGLKTRKYAEVKPALSNMVAAAKHLRTKLG  814



>ref|XP_009398996.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =  1400 bits (3625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/763 (89%), Positives = 718/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ DLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYN+ G EIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYNYTGAEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KF+Y+SHKA++EYKEAKALG+ETVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELGPNTKFTYSSHKALSEYKEAKALGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEV +ELK AGASWIQFDEP LVMDLESHQLEAFTKAY ELES   GLNVL+
Sbjct  181   LGNILPIYKEVTAELKAAGASWIQFDEPTLVMDLESHQLEAFTKAYTELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+TALKG++  G DLIRGTK++DL+K  GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITALKGISGVGLDLIRGTKTLDLVKSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL++LE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLASSLSTLQALEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEAFFSAN AAQ+SRKSSPRVTNE VQKAAAALKGSDHRR TNVSAR
Sbjct  361   EVNALAKALAGQKDEAFFSANVAAQSSRKSSPRVTNEEVQKAAAALKGSDHRRVTNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE KANKISEEEYVKAIKEEISKVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRRECKANKISEEEYVKAIKEEISKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPAL NMVSAAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYGEVKPALTNMVSAAKLLRTQLA  763



>ref|XP_006364490.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Solanum tuberosum]
Length=765

 Score =  1400 bits (3624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 727/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKS++EDL+KV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSNSEDLEKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YF MARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFPMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV+EYKEAK+LG++TVPVLVGPVS+LLLSK AKGVEKSFPLLSL
Sbjct  121   VPELGPDVKFSYASHKAVSEYKEAKSLGIDTVPVLVGPVSFLLLSKAAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             ++KILP+YKEVI+ELK AGA+WIQFDEP LV DL+SHQL+AF+ AY+ELES   GLNVL+
Sbjct  181   IEKILPVYKEVIAELKAAGANWIQFDEPTLVKDLDSHQLQAFSHAYSELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKT+T+LK VTA GFDL+RG+K++DLIK GFPS KYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTVTSLKCVTALGFDLVRGSKNLDLIKSGFPSEKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE++VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  301   NDLASSLSTLQALENLVGKDKLVVSTSCSLLHTAVDLVNETKLDEEIKSWLAFAAQKLVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA+ SRKSSPRVTN +VQKAAAALKGSDHRRAT VSARL
Sbjct  361   VNALAKALAGQKDEAVFSANAAARTSRKSSPRVTNGAVQKAAAALKGSDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             +AQQKKL+LP LPTTTIGSFPQT+ELR+VRREYKANKISEE+YVK I EEIS+VVKLQE+
Sbjct  421   EAQQKKLSLPALPTTTIGSFPQTLELRKVRREYKANKISEEDYVKYITEEISRVVKLQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ M+KRPMKGMLTGPVTILNWSFVR+DQ RFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSRAQSMSKRPMKGMLTGPVTILNWSFVRDDQLRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI+KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRISKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R QLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRDQLA  762



>ref|XP_004960257.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Setaria italica]
Length=765

 Score =  1400 bits (3624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KF+Y+SHKAV EYKEAKALGV+TVPVL GPVSYLLLSK AKGVEK FPLLSL
Sbjct  121   VPELGPNTKFTYSSHKAVNEYKEAKALGVDTVPVLTGPVSYLLLSKAAKGVEKGFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV+DL+S +L AF+ AY ELES   GLNVL+
Sbjct  181   LSGILPVYKEVIAELKAAGASWIQFDEPTLVLDLDSQKLAAFSAAYTELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RG +++DL+K GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGAQTLDLVKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQKDEA+F+ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VDALAKALAGQKDEAYFAANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYV AIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVTAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I 
Sbjct  541   FWSTTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNC +++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCEIKDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQLA  762



>ref|XP_003542326.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Glycine max]
 gb|KHN46660.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=803

 Score =  1400 bits (3623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/765 (88%), Positives = 721/765 (94%), Gaps = 0/765 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             +  MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKV+ADLR++IWKQMADAGIK+I
Sbjct  36    SRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSAIWKQMADAGIKYI  95

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFS YD VLDTTAMLGAVP RYNW GGEIGFD YFSMARGNASVPAMEMTKWFDTNY
Sbjct  96    PSNTFSLYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNY  155

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGPDVKFSYASHKAV E+KEAK LGV TVPVLVGPVSYLLLSKPAKGVEKSF L
Sbjct  156   HYIVPELGPDVKFSYASHKAVDEFKEAKVLGVNTVPVLVGPVSYLLLSKPAKGVEKSFSL  215

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSL+DKILP+Y+EV++ELK AGA+WIQFDEP LV DL +HQL+AFT AYAELES   G N
Sbjct  216   LSLIDKILPVYREVVAELKAAGATWIQFDEPTLVKDLNTHQLQAFTHAYAELESSLSGFN  275

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFAD+PAEA+KTLT+LK VTA+GFD++RGTK++DLIK GFPSGK+LFAGVVDGRN
Sbjct  276   VLIETYFADVPAEAYKTLTSLKAVTAYGFDIVRGTKTLDLIKQGFPSGKFLFAGVVDGRN  335

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWAN LA SL+TL++L DIVG DK+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK
Sbjct  336   IWANSLASSLNTLQALGDIVGNDKVVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQK  395

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALAKAL GQKDE FFSANAAA  SRKSSPRVTNE+VQKAAAALKGSDHRRATNVS
Sbjct  396   VVEVNALAKALSGQKDEVFFSANAAALDSRKSSPRVTNEAVQKAAAALKGSDHRRATNVS  455

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARLD+QQKKLNLPVLPTTTIGSFPQT +LRRVRRE+KANKISEE+Y+  IKEEI+ VVKL
Sbjct  456   ARLDSQQKKLNLPVLPTTTIGSFPQTADLRRVRREFKANKISEEDYIHFIKEEINNVVKL  515

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP
Sbjct  516   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  575

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA
Sbjct  576   MTVFWSSTAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKA  635

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGV++TTQIHTHMCYSNFNDII
Sbjct  636   GITVIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVEDTTQIHTHMCYSNFNDII  695

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG+YDIHSPRIP TEEIADRINK
Sbjct  696   HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGIYDIHSPRIPPTEEIADRINK  755

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             MLAVL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK IR QLA
Sbjct  756   MLAVLESNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRNQLA  800



>ref|XP_006408261.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 dbj|BAJ33898.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49714.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=765

 Score =  1400 bits (3623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/762 (90%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVIAELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LKGVT+FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKGVTSFGFDLIRGTKTLDLIKSSFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE  VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGAVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +EAFFSANAAA +SR+SSPRVTNESVQKAAAALKGSDHRRAT VSARL
Sbjct  361   VDALAKALVGQTNEAFFSANAAALSSRRSSPRVTNESVQKAAAALKGSDHRRATEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGV+++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVEDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_002871787.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48046.1| cobalamin-independent methionine synthase [Arabidopsis lyrata 
subsp. lyrata]
Length=765

 Score =  1399 bits (3622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>emb|CDY25477.1| BnaC09g39920D [Brassica napus]
Length=765

 Score =  1398 bits (3619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSAD+R+ IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+A T AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQALTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDFAASLSTLEALEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  IN
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_008464953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis melo]
Length=765

 Score =  1398 bits (3619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD TA LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATATLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KFSYASHKAV EYKEAKALGVETVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121   VPELGPEMKFSYASHKAVEEYKEAKALGVETVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV+S+LK AGASWIQFDEP LV DL+S +L+AF+ AYA+LES   GLNVLV
Sbjct  181   LDKILPIYKEVVSDLKAAGASWIQFDEPTLVKDLDSDKLKAFSDAYAQLESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTA+GFDL+RGTK++DLIKG FP GK+LFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAYGFDLVRGTKTLDLIKGDFPKGKFLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+S L+ L  +VGKD LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK++E
Sbjct  301   NDLAASVSVLEELAGVVGKDHLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDE FF++NA A ASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGNKDEVFFASNAGAHASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISE+EYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEDEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVR DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSTTAQSMTSRPMKGMLTGPVTILNWSFVRVDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EV PAL+NMV+AAK +R +L 
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVNPALKNMVAAAKLLRKELG  762



>ref|XP_011044091.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
 ref|XP_011044098.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Populus euphratica]
Length=813

 Score =  1398 bits (3618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ V+ADLR+SIWKQM+DAGIKFIPSN
Sbjct  49    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAADLRSSIWKQMSDAGIKFIPSN  108

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  109   TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  168

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  169   VPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  228

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIY+EV++ELK AGA+WIQFDEP LVMDL  H+L+AFT AY+ LE+   GLNVL+
Sbjct  229   IDKILPIYQEVVAELKAAGATWIQFDEPKLVMDLGVHELQAFTHAYSALEASLSGLNVLI  288

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P EA+KTL +LK VT FGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  289   ETYFADVPVEAYKTLISLKSVTGFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  348

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L +LE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  349   NDLASSLSVLHALEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  408

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKD  FFSANAAAQASRKSSPRVTNE+VQ+AAAALKGSDHRRATNVS RL
Sbjct  409   VNALAKALSGQKDGEFFSANAAAQASRKSSPRVTNEAVQQAAAALKGSDHRRATNVSDRL  468

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA K+SEE+YV+AIK+EI+KVVKLQEE
Sbjct  469   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKVSEEDYVEAIKKEINKVVKLQEE  528

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  529   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  588

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  589   FWSSLAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  648

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITNCGV+++TQIHTHMCYSNFNDIIHSI
Sbjct  649   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNCGVEDSTQIHTHMCYSNFNDIIHSI  708

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADR+ KMLA
Sbjct  709   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSEEEIADRVEKMLA  768

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY EVKPAL NMV+AAK++RT+ A
Sbjct  769   VLESNILWVNPDCGLKTRKYAEVKPALSNMVAAAKRLRTKFA  810



>ref|XP_010908721.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Elaeis guineensis]
Length=766

 Score =  1397 bits (3617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/763 (89%), Positives = 720/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ DLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRCSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVP RY W G EIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSFYDQVLDTTAMLGAVPDRYRWNGVEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV+EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEVI+ELK AGASWIQFDEP LVMDL+SHQL+AF  AY+ELES F GLNVLV
Sbjct  181   LGNILPIYKEVIAELKVAGASWIQFDEPTLVMDLDSHQLQAFADAYSELESSFSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+TALKG++ FGFDL+RGT ++DLI+  GFP+GK+LFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITALKGISGFGFDLVRGTNTLDLIRSSGFPAGKFLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL+ LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWL FAAQKVV
Sbjct  301   ANDLAASLSTLQVLEAVVGKDKLVVSTSCSLLHTAVDLVNETKLDTEIKSWLGFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEAFF ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAFFLANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE KANKISEEEYVKAIK EI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRRECKANKISEEEYVKAIKAEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVKPALTNMVAAAKVLRTQLA  763



>gb|EPS68005.1| methionine synthase [Genlisea aurea]
Length=765

 Score =  1397 bits (3617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSAE+L+KV+ D+R SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRVGPKRELKFALESFWDGKSSAEELEKVAKDIRTSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTA LGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAFLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVE +F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEGNFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVISELK AGASWIQFDEP LV+DLE ++LEAFTKAYA+LES   GL VL+
Sbjct  181   LDKILPIYKEVISELKSAGASWIQFDEPTLVLDLEPYKLEAFTKAYADLESSLSGLQVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIP  A+KTLT+L GV+AFGFDL+RGTKS+DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPEAAYKTLTSLSGVSAFGFDLVRGTKSLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL+TLKSLE IVGKDKLVVSTS SLLHTAVDLVNE KLD EIKSWLAFAAQK+VE
Sbjct  301   NDLEASLATLKSLESIVGKDKLVVSTSSSLLHTAVDLVNEPKLDKEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G K+EAFFS NAAA ASRKSSPRV NE+VQKAAAALK SDHRRATNVSARL
Sbjct  361   VNALAKALTGDKEEAFFSENAAAHASRKSSPRVNNEAVQKAAAALKDSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEY+ +IKEEI KVV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYISSIKEEIRKVVQLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPI+YGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIVYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ  TKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEK+ I 
Sbjct  541   FWSTAAQSYTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKSGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITN GV +TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNSGVHDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFR GVKYGAGIGPGVYDIHSPRIPSTEEIADR+ KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFRSGVKYGAGIGPGVYDIHSPRIPSTEEIADRVKKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPALENMV+AAK +R++LA
Sbjct  721   VLETNILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRSELA  762



>ref|XP_008778953.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Phoenix dactylifera]
Length=766

 Score =  1397 bits (3616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/763 (89%), Positives = 721/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ DLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVATDLRRSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KFSYASHKAV+EYKEA ALGV+TVPVL+GPV+YLL+SKPAKGVEKSF LLSL
Sbjct  121   VPELGPSTKFSYASHKAVSEYKEANALGVDTVPVLIGPVTYLLMSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +LPIYKEVI+ELK AGASWIQFDEP L MDL+SHQL+AF+ AY+ELES F GL+VL+
Sbjct  181   LGNVLPIYKEVIAELKAAGASWIQFDEPTLAMDLDSHQLQAFSDAYSELESSFSGLSVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+TALKG++ FGFDL+RGTK++DLIK  GFP+GK+LFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITALKGISGFGFDLVRGTKTLDLIKSSGFPAGKFLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL+ LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLAASLSTLQVLEAVVGKDKLVVSTSCSLLHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALA AL GQKDEAFFSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALATALAGQKDEAFFSANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKIS E+YVK I+EEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISGEDYVKTIREEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIK EVEDLE + I
Sbjct  541   VFWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKKEVEDLEASGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVKPALTNMVAAAKVLRTQLA  763



>emb|CAA89019.1| cobalamine-independent methionine synthase [Solenostemon scutellarioides]
Length=784

 Score =  1397 bits (3616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/763 (89%), Positives = 723/763 (95%), Gaps = 1/763 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+DAGIK+IPS
Sbjct  20    KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPS  78

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHF
Sbjct  79    NTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHF  138

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYL+LSKPAKGVEK+FPLLS
Sbjct  139   IVPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLILSKPAKGVEKTFPLLS  198

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LLDKILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQL+AFTKAYAELES   GL+ L
Sbjct  199   LLDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLDAFTKAYAELESSLSGLSTL  258

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
             +ETYFAD+PA A+KTLT+L G++ FGFDL+RG ++I+LIKGGFPSGKYLFAGVVDGRNIW
Sbjct  259   IETYFADVPAPAYKTLTSLSGISGFGFDLVRGAQTIELIKGGFPSGKYLFAGVVDGRNIW  318

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S++TL++LE IVGKDKLVVSTS SLLHTAVDLVNE KLD EIKSWLAFAAQK+V
Sbjct  319   ANDLASSITTLQALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIV  378

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDEAFFS NAAAQASRKSSPRV NE+VQKAAAAL+GS+HRR TNVSAR
Sbjct  379   EVNALAKALTGHKDEAFFSPNAAAQASRKSSPRVNNEAVQKAAAALRGSEHRRVTNVSAR  438

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+K  +ISEEEYVKAIKEEI+KVVKLQE
Sbjct  439   LDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKPTRISEEEYVKAIKEEINKVVKLQE  498

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  499   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  558

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+AAQ MT+RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I
Sbjct  559   VFWSTAAQSMTQRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGI  618

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  619   TVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHS  678

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  679   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  738

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPALENMV+AAK +RTQLA
Sbjct  739   AVLETNILWVNPDCGLKTRKYAEVKPALENMVAAAKLLRTQLA  781



>ref|NP_197294.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 ref|NP_001078599.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 sp|O50008.1|METE1_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1; Short=AtMS1; AltName: Full=Vitamin-B12-independent 
methionine synthase 1 [Arabidopsis thaliana]
 gb|AAK43899.1|AF370522_1 cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAC50037.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 dbj|BAB11226.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AAK82464.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL06986.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL09740.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL47432.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAL50108.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AAM10291.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
 gb|AED92486.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
 gb|AED92487.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Arabidopsis thaliana]
Length=765

 Score =  1397 bits (3616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGA+WIQ DEP LVMDLE  +L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVITELKAAGATWIQLDEPVLVMDLEGQKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_010685496.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. vulgaris]
Length=817

 Score =  1397 bits (3615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/765 (88%), Positives = 724/765 (95%), Gaps = 0/765 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             T  MASHIVGYPRMGPKRELKFALESFWDGK +AE+LQ V+  LR SIWKQM+DAGIK+I
Sbjct  50    TRTMASHIVGYPRMGPKRELKFALESFWDGKINAEELQNVAHSLRTSIWKQMSDAGIKYI  109

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD VLDTTAMLGAVPPRY W GGEIG D YFSMARGNA VPAMEMTKWFDTNY
Sbjct  110   PSNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIGNDVYFSMARGNADVPAMEMTKWFDTNY  169

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGPD+KF+YASHKAV EYKEAKALGVETVPV+VGPVSYLL SKPAKG+EKSFPL
Sbjct  170   HYIVPELGPDMKFTYASHKAVDEYKEAKALGVETVPVIVGPVSYLLSSKPAKGIEKSFPL  229

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSLLDKILP+YKEVISELK AGASWIQFDEP LVMDL++HQL+AFT AY+ELES   GLN
Sbjct  230   LSLLDKILPVYKEVISELKAAGASWIQFDEPKLVMDLDAHQLQAFTHAYSELESALSGLN  289

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFADIP EA+KTLT+LKGVTAFGFDL+RGTK++DL+KGGFPSGKYLFAGVVDGRN
Sbjct  290   VLIETYFADIPTEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKGGFPSGKYLFAGVVDGRN  349

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWANDLA SLS+L+SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+E+KSWLAFAAQK
Sbjct  350   IWANDLAASLSSLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDSELKSWLAFAAQK  409

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             ++EVNALAKAL G+KDEAFFSANAAA ASRKSSPRVTNE+VQKAAAAL+GSDHRRAT VS
Sbjct  410   IIEVNALAKALSGEKDEAFFSANAAALASRKSSPRVTNEAVQKAAAALRGSDHRRATTVS  469

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARL+AQQKKLNLP+LPTTTIGSFPQT++LRRVRRE+KANKISEEEYV AIKEEISKVV+L
Sbjct  470   ARLEAQQKKLNLPLLPTTTIGSFPQTMDLRRVRREFKANKISEEEYVTAIKEEISKVVEL  529

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP P
Sbjct  530   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNP  589

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA
Sbjct  590   MTVFWSTMAQNMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  649

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDEAALREGLPLRK+E  FYL+WAVHSFRITNCGVQ+T+QIHTHMCYSNFNDII
Sbjct  650   GITVIQIDEAALREGLPLRKSEQPFYLDWAVHSFRITNCGVQDTSQIHTHMCYSNFNDII  709

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSII+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EI DR+ K
Sbjct  710   HSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIVDRVTK  769

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             MLAVL++++LWVNPDCGLKTRKY EV+PAL NMV+AAK +RTQLA
Sbjct  770   MLAVLESHVLWVNPDCGLKTRKYGEVRPALTNMVAAAKAVRTQLA  814



>ref|XP_010036239.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=768

 Score =  1397 bits (3615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/765 (89%), Positives = 721/765 (94%), Gaps = 3/765 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVSADLR+SIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRSSIWKQMSHAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKA+TEYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAITEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKNFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+LPIYKEV+SELK AGASWIQFDEP LVMDL+SH+L+AFT+AY+ELESC  G+NV+V
Sbjct  181   LGKVLPIYKEVVSELKAAGASWIQFDEPTLVMDLDSHKLQAFTEAYSELESCLSGVNVVV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+K LT+LKGVT FGFDL+RG++++DLIKGGFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKVLTSLKGVTGFGFDLVRGSQTLDLIKGGFPTGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDK---LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             NDLAGSLS L +LE IVGK     +     CSLLHTAVDLVNETKLD EIKSWLAFAAQK
Sbjct  301   NDLAGSLSILHALEGIVGKGTTFYIFFFFQCSLLHTAVDLVNETKLDKEIKSWLAFAAQK  360

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALAKAL GQKDE FFSANAAAQASRK SPRVTNE+VQKAAAAL+GSDHRRAT VS
Sbjct  361   VVEVNALAKALVGQKDEEFFSANAAAQASRKCSPRVTNEAVQKAAAALRGSDHRRATTVS  420

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARLDAQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI+KVVKL
Sbjct  421   ARLDAQQKKLNLPVLPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEINKVVKL  480

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP P
Sbjct  481   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNP  540

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA
Sbjct  541   MTVFWSTTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  600

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              INVIQIDEAALREGLPLRK+E +FYL+WAVHSFRITNCGV +TTQIHTHMCYS+FNDII
Sbjct  601   GINVIQIDEAALREGLPLRKSEQSFYLDWAVHSFRITNCGVVDTTQIHTHMCYSHFNDII  660

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI K
Sbjct  661   HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRITK  720

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             MLAVL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RTQLA
Sbjct  721   MLAVLETNILWVNPDCGLKTRKYTEVKPALLNMVAAAKLLRTQLA  765



>ref|XP_002276908.2| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Vitis vinifera]
 emb|CBI24392.3| unnamed protein product [Vitis vinifera]
Length=804

 Score =  1397 bits (3615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/770 (88%), Positives = 721/770 (94%), Gaps = 0/770 (0%)
 Frame = +2

Query  98    FP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAG  277
             F  R   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+A+LRASIWKQMADAG
Sbjct  33    FNLRFRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAAELRASIWKQMADAG  92

Query  278   IKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWF  457
             IK+IPSNTFSYYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASV AMEMTKWF
Sbjct  93    IKYIPSNTFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVTAMEMTKWF  152

Query  458   DTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEK  637
             DTNYHFIVPELGP+VKFSYASHKAV E+KEAKALG+ETVPV+VGPVSYLLLSKPAKG+EK
Sbjct  153   DTNYHFIVPELGPNVKFSYASHKAVNEFKEAKALGIETVPVIVGPVSYLLLSKPAKGLEK  212

Query  638   SFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCF  817
             SF LLSL+DKILPIYKEV++ELK AGA+WIQFDEP LV+DL+SH L+AFT AY+ELES  
Sbjct  213   SFSLLSLIDKILPIYKEVVTELKKAGATWIQFDEPTLVLDLDSHHLQAFTHAYSELESTV  272

Query  818   GGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVV  997
              GLNVL+ETYFAD+PAEA+KTLT+LKGVT FGFDL+RGTK++DLI  GFPSGK LFAGVV
Sbjct  273   SGLNVLIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGTKTLDLIHSGFPSGKQLFAGVV  332

Query  998   DGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAF  1177
             DGRNIWANDLA SL+TLKSLED VGK  LVVSTSCSLLHTAVDL NETKLD EIKSWLAF
Sbjct  333   DGRNIWANDLAASLNTLKSLEDKVGKGNLVVSTSCSLLHTAVDLANETKLDKEIKSWLAF  392

Query  1178  AAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRA  1357
             AAQKV EVNALAKAL GQ+DEAFF +NAAA +SRK SPRVTNE+VQKAAA+LKGSDHRRA
Sbjct  393   AAQKVHEVNALAKALSGQRDEAFFFSNAAAHSSRKFSPRVTNENVQKAAASLKGSDHRRA  452

Query  1358  TNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISK  1537
             T+VSARLDAQQKKL LPVLPTTTIGSFPQT++LRRVRRE+KA KISE++YVKAIK+EI+K
Sbjct  453   TDVSARLDAQQKKLGLPVLPTTTIGSFPQTMDLRRVRREFKAKKISEDDYVKAIKDEINK  512

Query  1538  VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVS  1717
             VV LQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVS
Sbjct  513   VVVLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVS  572

Query  1718  RPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED  1897
             RPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED
Sbjct  573   RPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED  632

Query  1898  LEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNF  2077
             LE+A I VIQIDEAALREGLPLRK+E AFYL WAVHSFRITNC VQ+TTQIHTHMCYSNF
Sbjct  633   LERAGITVIQIDEAALREGLPLRKSEQAFYLEWAVHSFRITNCSVQDTTQIHTHMCYSNF  692

Query  2078  NDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAD  2257
             NDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAD
Sbjct  693   NDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAD  752

Query  2258  RINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             RINKMLAVL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RTQLA+
Sbjct  753   RINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLAR  802



>ref|XP_009121037.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =  1396 bits (3614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSAD+R+ IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGKDKLVVS SCSLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDFAASLSTLEALEGVVGKDKLVVSPSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  IN
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_003561625.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
 ref|XP_010231869.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brachypodium distachyon]
Length=766

 Score =  1396 bits (3614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/763 (89%), Positives = 719/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPETKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +  ILPIYKEVI+ELK AGASWIQFDEP LV DL++HQL AFT AY +LES   GLNVL+
Sbjct  181   VGSILPIYKEVIAELKAAGASWIQFDEPTLVKDLDAHQLAAFTSAYTDLESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK++DL+K  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTLDLVKSVGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL GQKDEA+F+ANAAAQASRKSSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGQKDEAYFAANAAAQASRKSSPRVNNEEVQKAAAALKGSDHRRATTVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEEEYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKIAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKY EVKPAL NMVSAAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYAEVKPALTNMVSAAKLIRTQLA  763



>ref|XP_004144074.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform 1 [Cucumis sativus]
 gb|KGN66367.1| hypothetical protein Csa_1G599580 [Cucumis sativus]
Length=827

 Score =  1396 bits (3613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/762 (88%), Positives = 728/762 (96%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKV+ADLR+SIWKQMA+AGIKFIPSN
Sbjct  63    MASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMAEAGIKFIPSN  122

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  123   TFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  182

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P+ KF+YASHKAV E+KEAKALGVETVPVLVGPVS+LLLSKPAKGVEKSF LLSL
Sbjct  183   VPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKSFSLLSL  242

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+SELK AGA+WIQFDEP LV DL++H L+AFT+AY+ELES   GLNVL+
Sbjct  243   IDKILPVYKEVVSELKAAGATWIQFDEPTLVKDLDAHHLQAFTQAYSELESTLSGLNVLI  302

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGV+ +GFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIW+
Sbjct  303   ETYFADVPAEAYKTLTSLKGVSGYGFDLVRGTQTVDLIKGGFPSGKYLFAGVVDGRNIWS  362

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  S++TL++LE++VGK+K+VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  363   NDLQASITTLEALENVVGKEKIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  422

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRR+TNVSARL
Sbjct  423   VNALAKALSGHKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRSTNVSARL  482

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE+KA KISEE+YV +IKEEI+KVV+LQEE
Sbjct  483   DAQQKKLNLPMLPTTTIGSFPQTMDLRRVRREFKAKKISEEDYVSSIKEEINKVVQLQEE  542

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  543   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  602

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  603   FWSTMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  662

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  663   VIQIDEAALREGLPLRKSEENFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  722

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  723   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  782

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R+QLA
Sbjct  783   VLESNILWVNPDCGLKTRKYTEVKPALLNMVAAAKLLRSQLA  824



>ref|XP_006400336.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 ref|XP_006400337.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41789.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
 gb|ESQ41790.1| hypothetical protein EUTSA_v10012750mg [Eutrema salsugineum]
Length=765

 Score =  1395 bits (3610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR++IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFG DL+RGTK+++L+K GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGLDLVRGTKTLELVKAGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRR+TNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRSTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>sp|Q42662.2|METE_PLESU RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Solenostemon scutellarioides]
Length=764

 Score =  1395 bits (3610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/762 (89%), Positives = 722/762 (95%), Gaps = 1/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPSN  59

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  60    TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  119

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYL+LSKPAKGVEK+FPLLSL
Sbjct  120   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLILSKPAKGVEKTFPLLSL  179

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGASWIQFDEP LV+DLESHQL+AFTKAYAELES   GL+ L+
Sbjct  180   LDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLESHQLDAFTKAYAELESSLSGLSTLI  239

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA A+KTLT+L G++ FGFDL+RG ++I+LIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  240   ETYFADVPAPAYKTLTSLSGISGFGFDLVRGAQTIELIKGGFPSGKYLFAGVVDGRNIWA  299

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S++TL++LE IVGKDKLVVSTS SLLHTAVDLVNE KLD EIKSWLAFAAQK+VE
Sbjct  300   NDLASSITTLQALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVE  359

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFS NAAAQASRKSSPRV NE+VQKAAAAL+GS+HRR TNVSARL
Sbjct  360   VNALAKALTGHKDEAFFSPNAAAQASRKSSPRVNNEAVQKAAAALRGSEHRRVTNVSARL  419

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+K  +ISEEEYVKAIKEEI+KVVKLQEE
Sbjct  420   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKPTRISEEEYVKAIKEEINKVVKLQEE  479

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  480   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  539

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+AAQ MT+RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  540   FWSTAAQSMTQRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  599

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  600   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  659

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  660   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  719

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPALENMV+AAK +RTQLA
Sbjct  720   VLETNILWVNPDCGLKTRKYAEVKPALENMVAAAKLLRTQLA  761



>ref|XP_003522969.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=799

 Score =  1395 bits (3610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/764 (88%), Positives = 720/764 (94%), Gaps = 0/764 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             +  MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ADLR++IWKQMADAGIK+I
Sbjct  36    SRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGIKYI  95

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD VLDTTAMLGAVP RYNW GGEIGFD YFSMARGN+SVPAMEMTKWFDTNY
Sbjct  96    PSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFDTNY  155

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGPDVKFSYASHK V EYKEAK LG+ TVPVLVGPVSYLLLSKPAKGVEKSF L
Sbjct  156   HYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVLVGPVSYLLLSKPAKGVEKSFSL  215

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSL+DKILP+Y+EV++ELK AGA+WIQFDEP LV DL +HQL+AFT AYAELES   GLN
Sbjct  216   LSLIDKILPVYREVVAELKAAGATWIQFDEPTLVKDLNAHQLQAFTHAYAELESSLSGLN  275

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFAD+PAEA+KTLT+LK VTA+GFD++RGTK++DLIK GFPSGK+LFAGVVDGRN
Sbjct  276   VLIETYFADVPAEAYKTLTSLKAVTAYGFDIVRGTKTLDLIKQGFPSGKFLFAGVVDGRN  335

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWAN+ A SL+TL++L DIVG DK+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK
Sbjct  336   IWANNFASSLNTLQALGDIVGNDKVVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQK  395

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALAKAL GQKDE FFSANAAA ASRKSSPRV NE+VQKAAAALKGSDHRRATNVS
Sbjct  396   VVEVNALAKALSGQKDEVFFSANAAALASRKSSPRVINEAVQKAAAALKGSDHRRATNVS  455

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARLDAQQKKLNL VLPTTTIGSFPQT +LRRVRRE+KANKISEE+Y++ IKEEI  VVKL
Sbjct  456   ARLDAQQKKLNLSVLPTTTIGSFPQTADLRRVRREFKANKISEEDYIRFIKEEIYNVVKL  515

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP
Sbjct  516   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  575

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA
Sbjct  576   MTVFWSSTAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKA  635

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGV++TTQIHTHMCYSNFNDII
Sbjct  636   GITVIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVEDTTQIHTHMCYSNFNDII  695

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINK
Sbjct  696   HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINK  755

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
             MLAVL+++ILWVNPDCGLKTRKYTEVKPAL NMV+AAK IR QL
Sbjct  756   MLAVLESSILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRNQL  799



>gb|KHG18658.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Gossypium arboreum]
Length=770

 Score =  1394 bits (3609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/767 (89%), Positives = 722/767 (94%), Gaps = 5/767 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV+ADLR+SIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVAADLRSSIWKQMSGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTT+MLGAVPPRYNW GGEIG DTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTSMLGAVPPRYNWTGGEIGDDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV E+KEAKALGV+TVPVL+GPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVDEFKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEVISELK AGASWIQFDEP LV+DL+S QL+AFT AYA+LES   GLNVL+
Sbjct  181   LPKIIPIYKEVISELKAAGASWIQFDEPTLVLDLDSQQLQAFTAAYADLESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+  EA+KTL  LKGVTA+G DL+RGT++ DL+K  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTPEAYKTLIGLKGVTAYGLDLVRGTQTTDLVKKDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLRTLQALEAVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NAAAQASRKSSPRVTN +VQKAA ALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSSNAAAQASRKSSPRVTNAAVQKAADALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KANKISE++YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEDDYVKAIKEEIKKVVNLQEE  480

Query  1559  LDIDVLVHGEPE-----RNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  1723
             LDIDVLVHGEPE     RNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP
Sbjct  481   LDIDVLVHGEPEASILQRNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRP  540

Query  1724  KPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  1903
             K MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE
Sbjct  541   KAMTVFWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  600

Query  1904  KANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFND  2083
             KA INVIQIDEAALREGLPLRK+EHAFYL WAVHSFRITNCGV++TTQIHTHMCYSNFND
Sbjct  601   KAGINVIQIDEAALREGLPLRKSEHAFYLKWAVHSFRITNCGVKDTTQIHTHMCYSNFND  660

Query  2084  IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  2263
             IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI
Sbjct  661   IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  720

Query  2264  NKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             NKMLAVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAK++RT+LA
Sbjct  721   NKMLAVLETNILWVNPDCGLKTRKYEEVKPALNNMVAAAKQLRTKLA  767



>gb|AAL09712.1| AT5g17920/MPI7_60 [Arabidopsis thaliana]
Length=765

 Score =  1394 bits (3609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGA+WIQ DEP LVMDLE  +L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVITELKAAGATWIQLDEPVLVMDLEGQKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+ GTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVLGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_010463840.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =  1394 bits (3608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/762 (89%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY +  GEIG D +FSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQFDEP  VMDLE H+LEAF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQFDEPLFVMDLEGHKLEAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ +V AAK IR+QL+
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAVVDAAKLIRSQLS  762



>ref|XP_010917850.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Elaeis guineensis]
Length=803

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/764 (88%), Positives = 721/764 (94%), Gaps = 1/764 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASH+VGYPRMGPKRELKFALESFWDGKSSA DLQKVS DLR SIWKQM+DAG+K+IPS
Sbjct  37    KMASHVVGYPRMGPKRELKFALESFWDGKSSAADLQKVSQDLRCSIWKQMSDAGVKYIPS  96

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLD TAMLGAVP RY W+GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH+
Sbjct  97    NTFSYYDQVLDATAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHY  156

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPEL PD KF+YASHKAV+EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEK+FPLLS
Sbjct  157   IVPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKAFPLLS  216

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL  +LP+YKEVI+ELK AGASW+QFDEP LVMDL++HQLEAFTKAY+ELES F GLNVL
Sbjct  217   LLGNVLPVYKEVIAELKAAGASWVQFDEPTLVMDLDAHQLEAFTKAYSELESSFSGLNVL  276

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNI  1012
             +ETYFAD+P+EA+KT+T+L G++ FGFDL+RGTK++DLIK  GFP GKYLFAGVVDGRNI
Sbjct  277   IETYFADVPSEAYKTITSLNGISGFGFDLVRGTKTLDLIKSSGFPIGKYLFAGVVDGRNI  336

Query  1013  WANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV  1192
             WANDLA SL+TL  LE +VGKDKLVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKV
Sbjct  337   WANDLAASLNTLNDLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDAEIKSWLAFAAQKV  396

Query  1193  VEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSA  1372
             VEVNALAKAL G KDEAFFSANAAAQASRKSSPRVTN+ VQKAAAALKGSDHRRAT+VSA
Sbjct  397   VEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNQEVQKAAAALKGSDHRRATDVSA  456

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYV AIKEEI+KVVKLQ
Sbjct  457   RLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVNAIKEEINKVVKLQ  516

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             EELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP+PM
Sbjct  517   EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPRPM  576

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TVFWSS AQ MT  PMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A 
Sbjct  577   TVFWSSMAQSMTSHPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAG  636

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             I VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIH
Sbjct  637   IQVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIH  696

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM
Sbjct  697   SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  756

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             LAVL++ ILWVNPDCGLKTRKYTEVKPAL NMVSAAK +R QLA
Sbjct  757   LAVLESKILWVNPDCGLKTRKYTEVKPALTNMVSAAKLLREQLA  800



>emb|CDX85436.1| BnaA02g03770D [Brassica napus]
Length=765

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR++IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI+ELK AGA+WIQ DEP LVMDLE H+LEAFT AYAELES   GLNVLV
Sbjct  181   LPKVLAVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLEAFTAAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTA+GFDL+RGTK++DL+K  FP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAYGFDLVRGTKTLDLVKSSFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL+ LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQELEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA FSANAAA ASR+SSPRVTNESVQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGHKDEALFSANAAALASRRSSPRVTNESVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIA+R+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAERVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>gb|EYU18182.1| hypothetical protein MIMGU_mgv1a001749mg [Erythranthe guttata]
Length=765

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQM+D GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRSSIWKQMSDVGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALG++TVPVLVGPV+YLLLSKPAKGVEK+FP++SL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGIDTVPVLVGPVTYLLLSKPAKGVEKNFPIISL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEVI+ELK AGA+WIQFDEP LV DL+SH LEAF KAY+EL++ + G+NVL+
Sbjct  181   LDKILPIYKEVIAELKAAGATWIQFDEPTLVKDLDSHDLEAFMKAYSELKTSWSGVNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             +TYFAD+P  AFKTLT+L GV  +GFDL+RG K+++LI+  FP G +LFAGVVDGRNIWA
Sbjct  241   QTYFADVPEAAFKTLTSLPGVAGYGFDLVRGAKTLNLIRTEFPLGMHLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TL+SLE IVGKDKLVVSTS SLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  301   NDLEASLKTLQSLEAIVGKDKLVVSTSSSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK L G+KD  FFSANAAAQASRKSSPRV NE+VQKAA+ALKGSDHRR TNVSARL
Sbjct  361   VNALAKGLTGEKDAEFFSANAAAQASRKSSPRVNNEAVQKAASALKGSDHRRVTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KI+EEEYVK+IKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKITEEEYVKSIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSSAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA + 
Sbjct  541   FWSSAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGVT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVEDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EVKPALENMVSAAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYHEVKPALENMVSAAKLLRTQLA  762



>ref|XP_006479149.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Citrus sinensis]
Length=795

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/762 (89%), Positives = 721/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM++AGIK+IPS
Sbjct  3     KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPS  62

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNASV AMEMTKWFDTNYHF
Sbjct  63    NTFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHF  122

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGPDVKFSYASHKAVTEYKEAK  GVETVPVL+GPVSYLLLSKPA GVEK+F +LS
Sbjct  123   IVPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVLIGPVSYLLLSKPAWGVEKTFSVLS  182

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL KILPIYKEV+SELK AGASWIQFDEP LV DL+SH+L+AF++AYAELES   GLNVL
Sbjct  183   LLPKILPIYKEVVSELKAAGASWIQFDEPLLVTDLDSHKLQAFSEAYAELESTLSGLNVL  242

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
             VETYFAD+PAEAF+TLT+LKGVTA+GFDL+RGTK+++LIK GFP+GKYLFAGVVDGRNIW
Sbjct  243   VETYFADVPAEAFQTLTSLKGVTAYGFDLVRGTKTLELIKSGFPAGKYLFAGVVDGRNIW  302

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLS L+ LE +VGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVV
Sbjct  303   ANDLAASLSVLRGLEGVVGKDKLVVSTSCSLLHTAVDLVNENKLDDEIKSWLAFAAQKVV  362

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDE FFSANAAAQASRKSSPRVTNE+VQKAAAAL+GSDHRRATNVSAR
Sbjct  363   EVNALAKALAGQKDEGFFSANAAAQASRKSSPRVTNEAVQKAAAALRGSDHRRATNVSAR  422

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYV +IKEEI+KVVKLQE
Sbjct  423   LDAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVASIKEEINKVVKLQE  482

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  483   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMT  542

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I
Sbjct  543   VFWSSWAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGI  602

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
             NVIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCG+Q+TTQIHTHMCYSNFNDIIHS
Sbjct  603   NVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGIQDTTQIHTHMCYSNFNDIIHS  662

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRS+E LLSVFREGV+Y A IGPGVYDIHSPRIPSTEEI DRI +M 
Sbjct  663   IIDMDADVITIENSRSNENLLSVFREGVQYDAAIGPGVYDIHSPRIPSTEEIVDRIYEMR  722

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
              VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+A K +RTQL
Sbjct  723   TVLETNILWVNPDCGLKTRKYTEVKPALSNMVAATKLLRTQL  764



>emb|CAE55863.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
Length=765

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGA+WIQ DEP LVMDLE  +L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVITELKAAGATWIQLDEPVLVMDLEGQKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K G P GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGSPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>emb|CDX74207.1| BnaA03g28400D [Brassica napus]
Length=765

 Score =  1393 bits (3605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVIAELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVTAFGFDLIRGTK+IDLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTAFGFDLIRGTKTIDLIKSSFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +++FFSANA A +SR+SSPRVTN+SVQKAAA LKGSDHRRAT V+ARL
Sbjct  361   VDALAKALAGQTNQSFFSANAEALSSRRSSPRVTNQSVQKAAADLKGSDHRRATEVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_008451024.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Cucumis melo]
Length=829

 Score =  1393 bits (3605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/762 (88%), Positives = 726/762 (95%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKV+ADLR+SIWKQMADAGIKFIPSN
Sbjct  65    MASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMADAGIKFIPSN  124

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  125   TFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  184

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P+ KF+YASHKAV E+KEAKALGVETVPVLVGPVS+LLLSKPAKGVEKSF LLSL
Sbjct  185   VPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKSFSLLSL  244

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+SELK AGA+WIQFDEP LV DL++HQL+AF  AY+ELES   GLNVL+
Sbjct  245   IDKILPVYKEVVSELKAAGATWIQFDEPTLVKDLDAHQLQAFAHAYSELESTLSGLNVLI  304

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGV+ +GFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIW+
Sbjct  305   ETYFADVPAEAYKTLTSLKGVSGYGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWS  364

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+L  S++TL++L ++VGK+K+VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  365   NNLQASITTLEALGNVVGKEKIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  424

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  425   VNALAKALSGHKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  484

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE+KA KISEE+YV +IKEEI+KVV+LQEE
Sbjct  485   DAQQKKLNLPMLPTTTIGSFPQTMDLRRVRREFKAKKISEEDYVSSIKEEINKVVQLQEE  544

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  545   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  604

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  605   FWSTMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  664

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  665   VIQIDEAALREGLPLRKSEENFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  724

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  725   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  784

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R+QLA
Sbjct  785   VLESNILWVNPDCGLKTRKYTEVKPALLNMVAAAKLLRSQLA  826



>ref|XP_007015561.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33180.1| Cobalamin-independent synthase family protein isoform 1 [Theobroma 
cacao]
Length=821

 Score =  1393 bits (3605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/773 (87%), Positives = 725/773 (94%), Gaps = 0/773 (0%)
 Frame = +2

Query  86    QLPLFP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQM  265
             +L L P     MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKV+ADLR+SIW+QM
Sbjct  46    RLTLRPFSLRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQM  105

Query  266   ADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEM  445
             ++AGIK+IPSNTFSYYD +LD TAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEM
Sbjct  106   SEAGIKYIPSNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEM  165

Query  446   TKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAK  625
             TKWFDTNYH+IVPELGPDVKFSYASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPAK
Sbjct  166   TKWFDTNYHYIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPAK  225

Query  626   GVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAEL  805
             GVEKSF LLSL+ KILPIYKEV++ELK AGA+WIQFDEP L++DLESHQL+AFT AY+EL
Sbjct  226   GVEKSFSLLSLIGKILPIYKEVVAELKAAGATWIQFDEPTLILDLESHQLQAFTHAYSEL  285

Query  806   ESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLF  985
             ES   GLNVL+ETYFAD+P E +K LT+LKGVT FGFDL+RGTK++DLIK GFPS KYLF
Sbjct  286   ESSLSGLNVLIETYFADVPVETYKKLTSLKGVTGFGFDLVRGTKTLDLIKSGFPSDKYLF  345

Query  986   AGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKS  1165
             AGVVDGRNIWANDLA SLSTL++LE IVGK+K+VVSTSCSLLHTAVDLVNETKLD E+KS
Sbjct  346   AGVVDGRNIWANDLASSLSTLQALEGIVGKEKVVVSTSCSLLHTAVDLVNETKLDKELKS  405

Query  1166  WLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSD  1345
             WLAFAAQK+VEVNALAKAL GQKDEAFF++NA A ASRKSSPRVTNE+VQKAAAAL+GSD
Sbjct  406   WLAFAAQKIVEVNALAKALVGQKDEAFFASNATAHASRKSSPRVTNEAVQKAAAALRGSD  465

Query  1346  HRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKE  1525
             HRRATNVSARLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE +YV AIKE
Sbjct  466   HRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISETDYVNAIKE  525

Query  1526  EISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIY  1705
             EI+KVVKLQE LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPII+
Sbjct  526   EINKVVKLQEVLDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIF  585

Query  1706  GDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKD  1885
             GDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKD
Sbjct  586   GDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKD  645

Query  1886  EVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMC  2065
             EVEDLE+A I VIQIDEAALREGLPLRK+E +FYL+WAVHSFRITNCGV++TTQIHTHMC
Sbjct  646   EVEDLERAGITVIQIDEAALREGLPLRKSEQSFYLDWAVHSFRITNCGVKDTTQIHTHMC  705

Query  2066  YSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE  2245
             YSNFNDIIHSII+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE
Sbjct  706   YSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE  765

Query  2246  EIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             E+ADRINKMLAVL+ NILWVNPDCGLKTRKYTEV+PAL NMV+AAK IRTQLA
Sbjct  766   EVADRINKMLAVLECNILWVNPDCGLKTRKYTEVQPALSNMVAAAKLIRTQLA  818



>ref|XP_006650367.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =  1392 bits (3604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/763 (90%), Positives = 723/763 (95%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGF TYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV+EYKEAKALGVETVPVLVGPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121   VPELGPNTKFSYASHKAVSEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEV++ELK AG+SWIQFDEP LV+DL++HQL AF+ AYAELES   GLNVL+
Sbjct  181   LSSILPVYKEVVAELKAAGSSWIQFDEPTLVLDLDAHQLAAFSAAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L GVTA+GFDL+RGTK++DL+K  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLSGVTAYGFDLVRGTKTLDLVKSEGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DL  SLSTL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLVASLSTLQSLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F ANAAAQASR+SSPRVTN+ VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFVANAAAQASRRSSPRVTNQEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEEEYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVDAAKLIRTQLA  763



>ref|XP_004141126.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 ref|XP_004158333.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
 gb|KGN59730.1| hypothetical protein Csa_3G842030 [Cucumis sativus]
Length=765

 Score =  1392 bits (3604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LD T  LGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDATTTLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVEEYKEAKALGVETVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV+S+LK AGASWIQFDEP LV DL+S +L+AF+ AYA+LES   GLNVLV
Sbjct  181   LDKILPIYKEVVSDLKAAGASWIQFDEPTLVKDLDSDKLKAFSDAYAQLESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTA+GFDL+RGTK++DLIKG FP GK+LFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAYGFDLVRGTKTLDLIKGDFPKGKFLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+S L+ L  IVGKD LVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK++E
Sbjct  301   NDLAASVSVLEELAGIVGKDHLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KD AFF++NA A ASRK+SPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGNKDGAFFASNAGAHASRKASPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISE+EYVKAIKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEDEYVKAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVR DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSTTAQSMTSRPMKGMLTGPVTILNWSFVRVDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EV PAL+NMV AAK +R +L 
Sbjct  721   VLETNILWVNPDCGLKTRKYAEVNPALKNMVEAAKLLRKELG  762



>gb|KHN41415.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=799

 Score =  1392 bits (3603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/764 (88%), Positives = 719/764 (94%), Gaps = 0/764 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             +  MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ADLR++IWKQMADAGIK+I
Sbjct  36    SRAMASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRSAIWKQMADAGIKYI  95

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD VLDTTAMLGAVP RYNW GGEIGFD YFSMARGN+SVPAMEMTKWFDTNY
Sbjct  96    PSNTFSYYDQVLDTTAMLGAVPSRYNWNGGEIGFDVYFSMARGNSSVPAMEMTKWFDTNY  155

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGPDVKFSYASHK V EYKEAK LG+ TVPVLVGPVSYLLLSKPAKGVEKSF L
Sbjct  156   HYIVPELGPDVKFSYASHKVVDEYKEAKVLGINTVPVLVGPVSYLLLSKPAKGVEKSFSL  215

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSL+DKILP+Y+EV++ELK AGA+WIQFDEP LV DL +HQL+AFT AYAELES   GLN
Sbjct  216   LSLIDKILPVYREVVAELKAAGATWIQFDEPTLVKDLNAHQLQAFTHAYAELESSLSGLN  275

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFAD+PAEA+KTLT+LK VTA+GFD++RGTK++DLIK GFPSGK+LFAGVVDGRN
Sbjct  276   VLIETYFADVPAEAYKTLTSLKAVTAYGFDIVRGTKTLDLIKQGFPSGKFLFAGVVDGRN  335

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWAN+ A SL+TL++L DIVG DK+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK
Sbjct  336   IWANNFASSLNTLQALGDIVGNDKVVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQK  395

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALAKAL GQKDE FFSANAAA ASRKSSPRV NE+VQKAAAALKGSDHRRATNVS
Sbjct  396   VVEVNALAKALSGQKDEVFFSANAAALASRKSSPRVINEAVQKAAAALKGSDHRRATNVS  455

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARLDAQQKKLNL VLPTTTIGSFPQT +LRRVRRE+KANKISEE+Y++ IKEEI  VVKL
Sbjct  456   ARLDAQQKKLNLSVLPTTTIGSFPQTADLRRVRREFKANKISEEDYIRFIKEEIYNVVKL  515

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP
Sbjct  516   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  575

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA
Sbjct  576   MTVFWSSTAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKA  635

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGV++TTQIHTHMCYSNFNDII
Sbjct  636   GITVIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVEDTTQIHTHMCYSNFNDII  695

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIP TEEIADRINK
Sbjct  696   HSIIDMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPPTEEIADRINK  755

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
             MLAVL+++ILWVNPDCGLKTRKYTEVKPAL NMV+AAK IR QL
Sbjct  756   MLAVLESSILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRNQL  799



>emb|CDY02674.1| BnaC02g07610D [Brassica napus]
Length=765

 Score =  1392 bits (3603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR++IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI+ELK AGA+WIQ DEP LVMDLE H+LEAF  AYAELES   GLNVLV
Sbjct  181   LPKVLAVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLEAFAGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K  FP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKASFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SL+TL+ LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLTTLQELEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIA+R+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAERVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_006470414.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Citrus sinensis]
Length=811

 Score =  1392 bits (3603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/787 (86%), Positives = 728/787 (93%), Gaps = 8/787 (1%)
 Frame = +2

Query  68    SVSVNEQLPLFP*--------RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQ  223
             S+S ++  PLF          R   MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ
Sbjct  22    SISFSKTSPLFSFLRCSFRRTRFRAMASHVVGYPRMGPKRELKFALESFWDGKSSADELQ  81

Query  224   KVSADLRASIWKQMADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYF  403
              V+ADLRASIWKQMADAGIKFIPS+TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YF
Sbjct  82    NVAADLRASIWKQMADAGIKFIPSSTFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYF  141

Query  404   SMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVL  583
             SMARGNASVPAMEMTKWFDTNYH+IVPELGPDV FSYASHKAV EYKEAKALG+ETVPVL
Sbjct  142   SMARGNASVPAMEMTKWFDTNYHYIVPELGPDVNFSYASHKAVQEYKEAKALGMETVPVL  201

Query  584   VGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLE  763
             VGPVSYLLLSKPAKGVEKSF LLSL+DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+
Sbjct  202   VGPVSYLLLSKPAKGVEKSFSLLSLIDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLD  261

Query  764   SHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSI  943
             SH+L+AF+ AY+ELES   GLNVL+ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++
Sbjct  262   SHKLQAFSDAYSELESSLSGLNVLIETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTL  321

Query  944   DLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAV  1123
             DLIK  FP GKYLFAGVVDGRNIWANDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAV
Sbjct  322   DLIKTEFPLGKYLFAGVVDGRNIWANDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAV  381

Query  1124  DLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTN  1303
             DL NETKLD EIKSWLAFAAQKVVEVNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTN
Sbjct  382   DLENETKLDQEIKSWLAFAAQKVVEVNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTN  441

Query  1304  ESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA  1483
             E+VQKAAAALKGSDHRRATNVSARLDAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA
Sbjct  442   EAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKA  501

Query  1484  NKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWV  1663
              KISE++YVK IKEEI+ VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWV
Sbjct  502   KKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWV  561

Query  1664  QSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQP  1843
             QSYGSRCVKPPIIYGDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQP
Sbjct  562   QSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQP  621

Query  1844  RFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITN  2023
             RFETCYQIALAIKDEVEDLEKA I VIQIDEAALREGLPLRK+E  FYL WAVHSFRITN
Sbjct  622   RFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEQDFYLKWAVHSFRITN  681

Query  2024  CGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGP  2203
             CGVQ+TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKY AGIGP
Sbjct  682   CGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYCAGIGP  741

Query  2204  GVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAK  2383
             GVYDIHSPRIPSTEEIADRINKMLAVL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK
Sbjct  742   GVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAK  801

Query  2384  KIRTQLA  2404
              +RTQLA
Sbjct  802   LLRTQLA  808



>ref|XP_006286451.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
 gb|EOA19349.1| hypothetical protein CARUB_v10000282mg [Capsella rubella]
Length=765

 Score =  1392 bits (3603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVISELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVISELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSW+AFAAQKV+E
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWMAFAAQKVIE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYHEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_010485733.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
 ref|XP_010485734.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Camelina sativa]
Length=765

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY +  GEIG D +FSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQFDEP  VMDLE H+LEAF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQFDEPLFVMDLEGHKLEAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+Y+KAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYIKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ +V AAK IR+QL+
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAVVDAAKLIRSQLS  762



>ref|XP_009408488.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Musa acuminata subsp. malaccensis]
Length=766

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/763 (89%), Positives = 717/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSA+DLQKV+ DLR SIWKQMA AGIK IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSADDLQKVATDLRHSIWKQMAGAGIKHIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RYN+ GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYNFTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KFSY+SHK V+EYKEAK+LG+ETVPVL+GPV+YLLLSKPAKGVEKSF  L+L
Sbjct  121   VPELGPTTKFSYSSHKPVSEYKEAKSLGIETVPVLIGPVTYLLLSKPAKGVEKSFSPLTL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEVI+ELK AGASWIQFDEP LV DLESHQLEAFTKAY ELES   GLNVLV
Sbjct  181   LGDILPIYKEVITELKAAGASWIQFDEPTLVKDLESHQLEAFTKAYTELESSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+TALK ++ FGFDL+RGTK++DL+K  GFP+GKYLFAG+VDGRNIW
Sbjct  241   ETYFADVPAEAYKTITALKSISGFGFDLVRGTKTLDLVKSVGFPAGKYLFAGIVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL++LE IVGKDKLVVSTSCSL+HTAVDL+NETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLASSLSTLQALEAIVGKDKLVVSTSCSLMHTAVDLINETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL  QKDEAFFSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALADQKDEAFFSANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI+KVVK+QE
Sbjct  421   LDEQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEINKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EVKPAL NMVSAAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVKPALTNMVSAAKILRTQLA  763



>emb|CDX78767.1| BnaA03g06790D [Brassica napus]
Length=765

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/762 (88%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKVSAD+R+ IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLEALEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|NP_001067314.1| Os12g0624000 [Oryza sativa Japonica Group]
 sp|Q2QLY4.1|METE2_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2 [Oryza sativa Japonica Group]
 gb|ABA99428.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABA99429.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30333.1| Os12g0624000 [Oryza sativa Japonica Group]
 dbj|BAG90565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69709.1| hypothetical protein OsI_39180 [Oryza sativa Indica Group]
 gb|EEE53643.1| hypothetical protein OsJ_36927 [Oryza sativa Japonica Group]
 gb|AFI71268.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/763 (90%), Positives = 720/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGA+WIQFDEP LV+DL+SHQL AF+ AY ELES   GLNVL+
Sbjct  181   LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L  VTA+GFDLIRG+K++DL+K  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLNSVTAYGFDLIRGSKTLDLVKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+AN AAQASR+SSPRVTNE VQKAAAAL+GSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFAANTAAQASRRSSPRVTNEEVQKAAAALRGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISE+EYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEDEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVLAAKLIRTQLA  763



>ref|XP_006443474.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
 gb|ESR56714.1| hypothetical protein CICLE_v10018921mg [Citrus clementina]
Length=792

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/761 (89%), Positives = 720/761 (95%), Gaps = 0/761 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPR+NW GGEIGFD YFSMARGNASV AMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRFNWNGGEIGFDVYFSMARGNASVLAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAK  GVETVPVL+GPVSYLLLSKPA GVEK+F +LSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKGHGVETVPVLIGPVSYLLLSKPAWGVEKTFSVLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+SELK AGASWIQFDEP LV DL+SH+L+AF++AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVVSELKAAGASWIQFDEPLLVTDLDSHKLQAFSEAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAF+TLT+LKGVTA+GFDL+RGTK+++LIK GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFQTLTSLKGVTAYGFDLVRGTKTLELIKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L+ LE +VGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSVLRGLEGVVGKDKLVVSTSCSLLHTAVDLVNENKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE FFSANAAAQASRKSSPRVTNE+VQKAAAAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEGFFSANAAAQASRKSSPRVTNEAVQKAAAALRGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYV +IKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVASIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSWAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCG+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRS+E LLSVFREGV+Y A IGPGVYDIHSPRIPSTEEI DRI +M  
Sbjct  661   IDMDADVITIENSRSNENLLSVFREGVQYDAAIGPGVYDIHSPRIPSTEEIVDRIYEMRT  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+A K +RTQL
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAATKLLRTQL  761



>dbj|BAN04645.1| cobalamin-independent methionine synthase [Senna obtusifolia]
Length=765

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/762 (89%), Positives = 711/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLRASIWKQM+DAGIK+IP N
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRASIWKQMSDAGIKYIPCN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD T+MLGAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATSMLGAVPPRYGWNGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV E+KEAKALGV TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVDEFKEAKALGVNTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+++LK AGASWIQFDEP LV DLE+HQL+AFT+AY+ELES   GLNVLV
Sbjct  181   LPKILPIYKEVVADLKAAGASWIQFDEPTLVSDLEAHQLQAFTEAYSELESSVSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLTALKG+TAFGFD IRGTK++DLIK GFPS K+LFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTALKGITAFGFDFIRGTKTLDLIKSGFPSNKHLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE IVGKD LVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+ E
Sbjct  301   NDLAASLSTLQNLEGIVGKDNLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKIFE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE FFSAN  A ASRKSSPRVTNE+VQKAAAALKGSDHRR TNVSARL
Sbjct  361   VNALAKALSGQKDEDFFSANGQALASRKSSPRVTNEAVQKAAAALKGSDHRRGTNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYVK IKEEI KVV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVKEIKEEIRKVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FW SAAQ MTKRPMKGMLTGPVTILNWSFVRNDQPR  TCYQIALAIK EVEDLEKA IN
Sbjct  541   FWLSAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSGTCYQIALAIKVEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             V+QIDEAALREGLPLRK+E   YL WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VVQIDEAALREGLPLRKSEQGNYLKWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVK AL NMV A K+IR QLA
Sbjct  721   VLEKNILWVNPDCGLKTRKYNEVKAALTNMVQATKQIRNQLA  762



>ref|NP_001235794.1| methionine synthase [Glycine max]
 gb|AAQ08403.1| methionine synthase [Glycine max]
Length=763

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/763 (89%), Positives = 718/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVS+DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSSDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSHYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGV+TVPVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFTYASHKAVDEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI++LK AGASWIQFDEP LV+DLESH+L+AFT AYAEL     GLNVLV
Sbjct  181   LPKVLAVYKEVIADLKAAGASWIQFDEPTLVLDLESHKLQAFTDAYAELAPALSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+L GVTA+GFDL+RGT ++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLNGVTAYGFDLVRGTNTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ LE IVGKDKLVVSTS SLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDLAASLTTLQGLEGIVGKDKLVVSTSSSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFS NAAA ASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGHKDEAFFSGNAAALASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             D+QQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KANKISEEEYVK+IKEEI KVV+LQEE
Sbjct  421   DSQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYVKSIKEEIRKVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ  TKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIAL+IKDEVEDLEKA I 
Sbjct  541   FWSSLAQSFTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALSIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVH+FRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAHYLDWAVHAFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKYTEVKPAL NMV+AAK IR +LAK
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRNELAK  763



>gb|AAN31836.1| putative 5-methyltetrahydropteroyltriglutamate--homocysteine 
S-methyltransferase [Arabidopsis thaliana]
Length=765

 Score =  1392 bits (3602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQM+ AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELK AGA+WIQ DEP LVMDLE  +L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVITELKAAGATWIQLDEPVLVMDLEGQKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVD RNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDRRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFP+TVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPRTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|NP_001067313.1| Os12g0623900 [Oryza sativa Japonica Group]
 sp|Q2QLY5.1|METE1_ORYSJ RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1; AltName: Full=Cobalamin-independent 
methionine synthase 1 [Oryza sativa Japonica Group]
 gb|ABA99427.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22094.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30332.1| Os12g0623900 [Oryza sativa Japonica Group]
 gb|EAY83957.1| hypothetical protein OsI_39179 [Oryza sativa Indica Group]
 gb|EAZ21274.1| hypothetical protein OsJ_36926 [Oryza sativa Japonica Group]
 gb|AFI71269.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase 
[Oryza sativa Japonica Group]
Length=766

 Score =  1391 bits (3601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/763 (90%), Positives = 720/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT AMLGAVP RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGA+WIQFDEP LV+DL+SHQL AF+ AY ELES   GLNVL+
Sbjct  181   LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L  VTA+GFDLIRG K++DLIK  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLNSVTAYGFDLIRGAKTLDLIKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKY EVKPAL NMVSAAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYNEVKPALTNMVSAAKLIRTQLA  763



>ref|XP_010514202.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Camelina sativa]
Length=765

 Score =  1391 bits (3600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY +  GEIG D +FSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQFDEP  VMDLE H+LEAF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGATWIQFDEPLFVMDLEGHKLEAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ +V AAK IR+QL+
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAVVDAAKLIRSQLS  762



>ref|XP_009126216.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brassica rapa]
Length=765

 Score =  1390 bits (3598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR++IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI+ELK AGA+WIQ DEP LVMDLE H+LEAFT AYAELES   GLNVLV
Sbjct  181   LPKVLAVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLEAFTAAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTA+GFDL+RGTK++DL+K  FP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAYGFDLVRGTKTLDLVKASFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL+ LE +VGKDKLVVSTSCSLLH AVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDFAASLSTLQELEGVVGKDKLVVSTSCSLLHPAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIA+R+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAERVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>emb|CDX92051.1| BnaC03g33530D [Brassica napus]
Length=765

 Score =  1390 bits (3598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGK++AEDL+KVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKTTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVIAELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVTAFGFDLIRGTK+IDLIK GFP  KYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTAFGFDLIRGTKTIDLIKSGFPKDKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDSEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +++FFSANA A +SR+SSPRVTN+SVQKAAA LKGSDHRRAT V+ARL
Sbjct  361   VDALAKALAGQTNQSFFSANAEALSSRRSSPRVTNQSVQKAAADLKGSDHRRATEVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPV ILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVMILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_002313635.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 ref|XP_006379333.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|EEE87590.2| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
 gb|ERP57130.1| hypothetical protein POPTR_0009s15490g [Populus trichocarpa]
Length=813

 Score =  1390 bits (3597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDLQ V+A+LR+SIWKQM+DAGIKFIPSN
Sbjct  49    MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLQNVAAELRSSIWKQMSDAGIKFIPSN  108

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  109   TFSCYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  168

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  169   VPELGPEVNFSYASHKAVIEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  228

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+Y+EV++ELK AGA+WIQFDEP LVMDL +H+L+AFT AY+ LE+   GLNVL+
Sbjct  229   IDKILPVYQEVVAELKAAGATWIQFDEPKLVMDLGAHELQAFTHAYSALEASLSGLNVLI  288

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+P EA+KTL +LK VT FGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  289   ETYFADVPVEAYKTLISLKCVTGFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  348

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L +LE IVGKDKLVVSTSCSLLHTAVDLVNE KLD EIKSWLAFAAQKVVE
Sbjct  349   NDLASSLSVLHALEGIVGKDKLVVSTSCSLLHTAVDLVNEPKLDKEIKSWLAFAAQKVVE  408

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKD AFFSANAAAQASRKSSPRVTNE+VQ+AAAALKGSDHRRATNVS RL
Sbjct  409   VNALAKALSGQKDGAFFSANAAAQASRKSSPRVTNEAVQQAAAALKGSDHRRATNVSDRL  468

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA K+SEE+YV+AIK+EI+KVVKLQEE
Sbjct  469   DAQQKKLNLPILPTTTIGSFPQTLELRRVRREYKAKKVSEEDYVEAIKKEINKVVKLQEE  528

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  529   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  588

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  589   FWSSLAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  648

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYLNWAVHSFRITNCGV+++TQIHTHMCYSNFNDIIHSI
Sbjct  649   VIQIDEAALREGLPLRKSEHAFYLNWAVHSFRITNCGVEDSTQIHTHMCYSNFNDIIHSI  708

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADR+ KMLA
Sbjct  709   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSEEEIADRVEKMLA  768

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVKPAL NMV+AAK++RT+ A
Sbjct  769   VLECNILWVNPDCGLKTRKYAEVKPALSNMVAAAKRLRTKFA  810



>ref|XP_010528749.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
 ref|XP_010528750.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=762

 Score =  1389 bits (3596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 718/762 (94%), Gaps = 3/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK +A+LR+SIWKQMADA IK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAVTEYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILPIY+EVISELKGAGA+WIQFDEP LVMDL+S +L+AFT AYAELES   GLNVL+
Sbjct  181   LNKILPIYQEVISELKGAGATWIQFDEPQLVMDLDSTKLKAFTDAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +K LT+LKGVTA+GFDL+RGT ++DL+K GFP  KYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAETYKILTSLKGVTAYGFDLVRGTNTLDLVKSGFPKDKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA   S+LK+L+++VGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLA---SSLKTLQELVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKVVE  357

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFS NA AQASRKSSPRVTNE+VQKAAAALKGSDHRR+TNVSARL
Sbjct  358   VNALAKALAGHKDEAFFSDNAMAQASRKSSPRVTNEAVQKAAAALKGSDHRRSTNVSARL  417

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+Y+KAIKEEI KVV LQE+
Sbjct  418   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYIKAIKEEIKKVVDLQED  477

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  478   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPVIYGDVSRPKPMTV  537

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  538   FWSSTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  597

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDII SI
Sbjct  598   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIQSI  657

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMD DVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEE+A+RINKMLA
Sbjct  658   IDMDTDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEMAERINKMLA  717

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EVKPAL+NMV A K IR+QLA
Sbjct  718   VLEKNILWVNPDCGLKTRKYNEVKPALKNMVEATKLIRSQLA  759



>ref|XP_009134741.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2 [Brassica rapa]
Length=765

 Score =  1389 bits (3596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/762 (89%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+A+DL+KVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTADDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALG ETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGAETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVIEELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVTAFGFDLIRGTK+IDLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTAFGFDLIRGTKTIDLIKSSFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +++FFSANA A +SR+SSPRVTN+SVQKAAA LKGSDHRRAT V+ARL
Sbjct  361   VDALAKALAGQTNQSFFSANAEALSSRRSSPRVTNQSVQKAAADLKGSDHRRATEVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QL+
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLS  762



>gb|ABG22095.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
 gb|ABG22096.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=766

 Score =  1389 bits (3596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/763 (89%), Positives = 719/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT AMLGAVP RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGA+WIQFDEP LV+DL+SHQL AF+ AY ELES   GLNVL+
Sbjct  181   LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L  VTA+GFDLIRG+K++DL+K  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLNSVTAYGFDLIRGSKTLDLVKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+AN AAQASR+SSPRVTNE VQKAAAAL+GSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFAANTAAQASRRSSPRVTNEEVQKAAAALRGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISE+EYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEDEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVLAAKLIRTQLA  763



>ref|XP_009131623.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Brassica rapa]
Length=765

 Score =  1389 bits (3595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KS+AEDLQKVSAD+R+ IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLEALEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVY IHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYAIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_006664220.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Oryza brachyantha]
Length=766

 Score =  1389 bits (3594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/763 (90%), Positives = 720/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV EYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL
Sbjct  121   VPELGPNTKFSYSSHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +LP+YKEVI+ELK AGA+WIQFDEP LV+DL+SHQL AF+ AY ELE    GLNVLV
Sbjct  181   LSSVLPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELEPALSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L  VTA+GFDLIRG K++DL+K  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLNSVTAYGFDLIRGAKTLDLVKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLASLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEH FYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHDFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRINKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQLA  763



>ref|XP_004502016.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cicer arietinum]
Length=806

 Score =  1389 bits (3594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/765 (87%), Positives = 723/765 (95%), Gaps = 0/765 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             +  M SHIVGYPR+GPKRELKFALESFWDGKSSA++L+KV+ADLR++IWKQMA+AGI+ I
Sbjct  39    SRAMTSHIVGYPRVGPKRELKFALESFWDGKSSADELKKVAADLRSAIWKQMAEAGIQHI  98

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD VLDTTAMLGAVP RYNW GGEIGFD YFSMARGNASVPAMEMTKWFDTNY
Sbjct  99    PSNTFSYYDQVLDTTAMLGAVPDRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNY  158

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             HFIVPELGPDVKFSYASHKAV EY EAKALGV TVPVLVGPVSYLLLSKPAKGV+KSF L
Sbjct  159   HFIVPELGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVDKSFSL  218

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSL+DKILP+YKEV++ELK AGA+W+QFDEP LV DL++HQL+AF  AY ELES   GLN
Sbjct  219   LSLIDKILPVYKEVVTELKAAGATWVQFDEPTLVKDLDAHQLKAFNYAYEELESTLSGLN  278

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFAD+PAEA+KTLT+LK VTA+GFDL+RGTK++DLIK GFPSGK+LFAGVVDGRN
Sbjct  279   VLIETYFADVPAEAYKTLTSLKAVTAYGFDLVRGTKTLDLIKQGFPSGKFLFAGVVDGRN  338

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWAN+LA SL+TL++L DIVGK+K+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFA+QK
Sbjct  339   IWANNLASSLNTLQALGDIVGKEKVVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFASQK  398

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALAKAL GQKDE FFS+NAAA ASRKSSPRVTNE+VQKAAAALKGSDHRRATNVS
Sbjct  399   VVEVNALAKALSGQKDEVFFSSNAAALASRKSSPRVTNEAVQKAAAALKGSDHRRATNVS  458

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             +RLDAQQKKLNLP+LPTTTIGSFPQT +LRRVRRE+KANKISEE+Y+  IKEEI+ VVK+
Sbjct  459   SRLDAQQKKLNLPILPTTTIGSFPQTADLRRVRREFKANKISEEDYIHFIKEEINNVVKI  518

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP
Sbjct  519   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  578

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA
Sbjct  579   MTVFWSSTAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKA  638

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII
Sbjct  639   GITVIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDII  698

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENSRSDEKLLSVFR+GVKYGAGIGPGVYDIHSPRIP TEEIADRINK
Sbjct  699   HSIIDMDADVITIENSRSDEKLLSVFRDGVKYGAGIGPGVYDIHSPRIPPTEEIADRINK  758

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             MLAVL++NILWVNPDCGLKTRKYTEVKPAL N+V+AAK IR QLA
Sbjct  759   MLAVLESNILWVNPDCGLKTRKYTEVKPALTNVVAAAKLIRNQLA  803



>ref|XP_006297040.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
 gb|EOA29938.1| hypothetical protein CARUB_v10013032mg [Capsella rubella]
Length=765

 Score =  1389 bits (3594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/762 (88%), Positives = 715/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKTSADDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YDHVLDTTAM+GAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDHVLDTTAMIGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQ DEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESALSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDLIRGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLIRGTKTIDLIKAGFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL  L+SLE +VGKDKLV STSCSLLHTAVDL+NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLIALQSLEGVVGKDKLVASTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANANALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ MV AAK IR+QL+
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLS  762



>ref|XP_010492770.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Camelina sativa]
Length=765

 Score =  1388 bits (3593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 716/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR++IWKQM++AG KFIPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSAIWKQMSEAGTKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V F+YASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVISELK AGA+WIQ DEP LVMDLE H+LEAFT AYAELES   GLNVLV
Sbjct  181   LPKVLAVYKEVISELKAAGATWIQLDEPVLVMDLEGHKLEAFTAAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDLIRGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLIRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVS+RL
Sbjct  361   VNALAKALAGHKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSSRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAI EEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAITEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSALAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>emb|CDX70785.1| BnaC03g08690D [Brassica napus]
Length=765

 Score =  1388 bits (3593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSAD+R+ IWKQM++AG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADIRSGIWKQMSEAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF++YD VLDTTAMLGAVPPRY + GGEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK  KGVEKSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAVKGVEKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGA+WIQ DEP LVMDLE H+L+AFT AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVITELKAAGATWIQIDEPVLVMDLEGHKLQAFTGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE +VGK KLVVSTSCSLLHTAVDLVNETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLEALEGVVGKGKLVVSTSCSLLHTAVDLVNETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAAL+GSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALEGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKA+KEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAMKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_002882307.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58566.1| hypothetical protein ARALYDRAFT_477628 [Arabidopsis lyrata subsp. 
lyrata]
Length=765

 Score =  1388 bits (3593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/762 (89%), Positives = 714/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPPRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQ DEP  VMDLE  +L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGQKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKAGFPQGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ MV AAK IR+QL 
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLG  762



>gb|KDO66309.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=765

 Score =  1387 bits (3589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/762 (88%), Positives = 717/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ V+ADLRASIW QMADAGIKFIPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALG+ETVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+SH+L+AF+ AY+EL+S   GLNVL+
Sbjct  181   IDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLDSHKLQAFSDAYSELQSSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTLDLIKTEFPLGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAVDLENETKLDQEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTNE+VQK AAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKPAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA KISE++YVK IKEEI+ VVKLQEE
Sbjct  421   DAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL WAVHSFRITNCGVQ+TTQ+HTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQDFYLKWAVHSFRITNCGVQDTTQVHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             +DMDADVITIENSRSDEKLLSVFREGVKY AGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   MDMDADVITIENSRSDEKLLSVFREGVKYRAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRTQLA  762



>ref|NP_187028.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_850507.1| methionine synthase 2 [Arabidopsis thaliana]
 ref|NP_001118564.1| methionine synthase 2 [Arabidopsis thaliana]
 sp|Q9SRV5.1|METE2_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2; AltName: Full=Cobalamin-independent 
methionine synthase 2; Short=AtMS2 [Arabidopsis thaliana]
 gb|AAF00639.1|AC009540_16 putative methionine synthase [Arabidopsis thaliana]
 gb|AAM61126.1| putative methionine synthase [Arabidopsis thaliana]
 gb|AAN12930.1| putative methionine synthase [Arabidopsis thaliana]
 emb|CAE55864.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
 gb|AEE73989.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73990.1| methionine synthase 2 [Arabidopsis thaliana]
 gb|AEE73991.1| methionine synthase 2 [Arabidopsis thaliana]
Length=765

 Score =  1385 bits (3586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 714/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVP RY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQ DEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDL+NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ MV AAK IR+QL 
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLG  762



>sp|P93263.1|METE_MESCR RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase; AltName: Full=Cobalamin-independent 
methionine synthase isozyme; AltName: Full=Vitamin-B12-independent 
methionine synthase isozyme [Mesembryanthemum crystallinum]
 gb|AAB41896.1| methionine synthase [Mesembryanthemum crystallinum]
Length=765

 Score =  1385 bits (3586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 718/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVSADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEI FD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFSYASHKAVLEYKEAKALGVDTVPVLVGPVSYLLLSKQAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV++ELK AGASWIQFDEP LVMDLESH+L+AF+ AYA+LES   GLNV+V
Sbjct  181   LPKILPIYKEVVAELKEAGASWIQFDEPLLVMDLESHKLQAFSAAYADLESTLSGLNVVV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTL +LKGVT +GFDL+RGTK++DL+K  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVTAEAYKTLISLKGVTGYGFDLVRGTKTLDLVKAEFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL++LE +VGKDKLVVSTSCS LHTAVDL+NETKLD+EIKSWLAFAAQKV+E
Sbjct  301   NDLAASLATLEALEGVVGKDKLVVSTSCSFLHTAVDLINETKLDDEIKSWLAFAAQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAA ASRKSSPRVTNE+VQKAA ALKGSDHRRAT VS+RL
Sbjct  361   VNALAKALSGQKDEAFFSANAAALASRKSSPRVTNEAVQKAATALKGSDHRRATTVSSRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK+EVEDLEKA IN
Sbjct  541   FWSSMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKNEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EH FYL WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHDFYLKWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEE+ADRI KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEELADRIRKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++N+LWVNPDCGLKTRKY EV PAL NMV+AAK++R +LA
Sbjct  721   VLESNVLWVNPDCGLKTRKYGEVNPALSNMVAAAKQLRQELA  762



>emb|CAN70498.1| hypothetical protein VITISV_028551 [Vitis vinifera]
Length=765

 Score =  1385 bits (3585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/763 (88%), Positives = 714/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA DLQKV+ +LRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAXDLQKVATELRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYGWNGGEIGFDAYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV E+KEAK+LG+ETVPV+VGPVSYLLLSKPAKG EKSF LLSL
Sbjct  121   VPELGPNVKFSYASHKAVNEFKEAKSLGIETVPVIVGPVSYLLLSKPAKGXEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEV+SELK  GA+WIQFDEP LV+DL+SH L+AFT AY+ELES   GLNVL+
Sbjct  181   IDKILPIYKEVVSELKEVGATWIQFDEPTLVLDLDSHHLQAFTHAYSELESTVSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGVT FGFDL+RGTK++DLI  GFPSGK LFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGVTGFGFDLVRGTKTLDLIHSGFPSGKQLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TLKSLED VGK  LVVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKV E
Sbjct  301   NDLAASLNTLKSLEDKVGKGNLVVSTSCSLLHTAVDLANETKLDKEIKSWLAFAAQKVHE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQ+DEAFF +NAAA +SRK SPRVTNE+VQKAAA+LKGSDHRRAT+VSARL
Sbjct  361   VNALAKALSGQRDEAFFFSNAAAHSSRKFSPRVTNENVQKAAASLKGSDHRRATDVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKL LPVLPTTTIGSFPQT++LRRVRRE+KA KISE++YVKAIK EI+KVV LQEE
Sbjct  421   DAQQKKLGLPVLPTTTIGSFPQTMDLRRVRREFKAKKISEDDYVKAIKXEINKVVVLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE+A I 
Sbjct  541   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLERAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL WAVHSFRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLEWAVHSFRITNCSVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMV+AAK +RT LA+
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTHLAR  763



>gb|AAK64167.1| putative methionine synthase [Arabidopsis thaliana]
Length=765

 Score =  1385 bits (3585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 714/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVP RY +  GEIG D YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPSRYGFTSGEIGLDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGASWIQ DEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASWIQLDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK+IDLIK GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTIDLIKSGFPQGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE +VGKDKLVVSTSCSLLHTAVDL+NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGVVGKDKLVVSTSCSLLHTAVDLINETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +E+FF+ANA A +SR+SSPRVTNESVQKAAAALKGSDHRR T VSARL
Sbjct  361   VDALAKALAGQTNESFFTANADALSSRRSSPRVTNESVQKAAAALKGSDHRRTTEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+ MV AAK IR+QL 
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKAMVDAAKLIRSQLG  762



>ref|XP_009774960.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Nicotiana sylvestris]
Length=830

 Score =  1385 bits (3584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSS+EDL+KV+ADLR+SIWKQMA+ GIK+IPSN
Sbjct  66    MASHVVGYPRMGPKRELKFALESFWDGKSSSEDLEKVAADLRSSIWKQMAEGGIKYIPSN  125

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YF MARGN SVPAMEMTKWFDTNYH+I
Sbjct  126   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFPMARGNDSVPAMEMTKWFDTNYHYI  185

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKF YA HKAV EYKEAK+LGV+TVPVLVGPVS+LLLSK AKGVEKSFPLLSL
Sbjct  186   VPELGPDVKFCYAYHKAVNEYKEAKSLGVDTVPVLVGPVSFLLLSKAAKGVEKSFPLLSL  245

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEVI+ELK AGASWIQFDEP LV DL+ HQL AF+ AY+ELE+   GLNVL+
Sbjct  246   IDKILPVYKEVIAELKAAGASWIQFDEPTLVKDLDFHQLGAFSHAYSELEASLSGLNVLI  305

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKT+TALKGVTA GFDL+RG+K++DLIK GFPS KYLFAGVVDGRNIWA
Sbjct  306   ETYFADVPAEAFKTVTALKGVTALGFDLVRGSKTLDLIKSGFPSEKYLFAGVVDGRNIWA  365

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLSTL++LE+IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VE
Sbjct  366   NDLASSLSTLQALENIVGKDKLVVSTSCSLLHTAVDLVNETKLDEEIKSWLAFAAQKLVE  425

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQ+DEAFFSANAAA+ SRKSSPRVTNE+VQKAAA+ KGSDHRRATNVSARL
Sbjct  426   VNALAKALAGQRDEAFFSANAAARTSRKSSPRVTNEAVQKAAASWKGSDHRRATNVSARL  485

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             +AQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKANKIS E YVK I EEISKVVKLQE+
Sbjct  486   EAQQKKLNLPLLPTTTIGSFPQTLELRKVRREYKANKISGEGYVKYITEEISKVVKLQED  545

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  546   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  605

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ M+KRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  606   FWSSLAQSMSKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKAGIN  665

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  666   VIQIDEAALREGLPLRKSEEAFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  725

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLS+F EGVKYGAGIGPGVYDIHSPRIPS EEIA+RI+KMLA
Sbjct  726   IDMDADVITIENSRSDEKLLSIFCEGVKYGAGIGPGVYDIHSPRIPSAEEIAERISKMLA  785

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEV PAL NMV+AAK +R  LA
Sbjct  786   VLDTNILWVNPDCGLKTRKYTEVNPALSNMVAAAKLLRAHLA  827



>ref|XP_008680958.1| PREDICTED: LOC100286153 isoform X1 [Zea mays]
Length=793

 Score =  1385 bits (3584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/763 (89%), Positives = 720/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM++AGIK+IPS
Sbjct  28    KMASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIPS  87

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHF
Sbjct  88    NTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHF  147

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGP  KF+YASHKAV+EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLS
Sbjct  148   IVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLS  207

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL  ILPIYKEV+SELK AGASWIQFDEP LV DL+ H+L AF+ AYAELES F GLNVL
Sbjct  208   LLGSILPIYKEVVSELKAAGASWIQFDEPTLVKDLDVHELAAFSSAYAELESAFSGLNVL  267

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
             +ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIW
Sbjct  268   IETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIW  327

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  328   ADDLAASLSTLQSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVV  387

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRAT V+AR
Sbjct  388   EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATTVAAR  447

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QE
Sbjct  448   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQE  507

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  508   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  567

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  568   VFWSKTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  627

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  628   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  687

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  688   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  747

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQL 
Sbjct  748   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLG  790



>ref|XP_004982263.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Setaria italica]
Length=765

 Score =  1385 bits (3584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLR+SIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KFSYASHKAV+EYKEAKALG++TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPSTKFSYASHKAVSEYKEAKALGIDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEV++ELK AGASWIQFDEP LV DL++H+L AF+ AYAELES   GLNVL+
Sbjct  181   LGSILPIYKEVVAELKAAGASWIQFDEPTLVKDLDAHELAAFSSAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SLSTL+SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLSTLQSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAA ASRKSSPRVTN+ VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAALASRKSSPRVTNQEVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPHPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I 
Sbjct  541   FWSKTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLA  762



>ref|XP_008778395.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
 ref|XP_008778396.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =  1384 bits (3582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/763 (88%), Positives = 718/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ADLR SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAQDLQKVAADLRCSIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT+AMLGAVP RY W G EIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTSAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYK+AKALG++TVPV++GPV+YLLLSK AKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYASHKAVAEYKDAKALGIDTVPVIIGPVTYLLLSKHAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +L IYKEVI+ELK AGA+WIQFDEP LVMDL+SHQL+AFT AY+ELES F GLNVL+
Sbjct  181   LGNVLSIYKEVIAELKAAGATWIQFDEPTLVMDLDSHQLQAFTDAYSELESSFSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+TALKGV+ FGFDL+RGT  +DLIK  GFP+GK+LFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTVTALKGVSGFGFDLVRGTNILDLIKSSGFPAGKFLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL++LE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLAASLSTLQALESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQ+DEAFFSANAAAQASRKSSPRVTNE VQKAAA LKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQQDEAFFSANAAAQASRKSSPRVTNEEVQKAAADLKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSTMAQSMTTRPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL WAVHSFRI+NCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLEWAVHSFRISNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP+TEEI DRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPTTEEIVDRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV+AAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVNPALSNMVAAAKVLRTQLA  763



>ref|XP_010420526.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Camelina sativa]
Length=765

 Score =  1384 bits (3581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/762 (88%), Positives = 715/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA++LQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADNLQKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY +  GEIG D +FSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSHYDQVLDTTAMLGAVPPRYGYTSGEIGLDVFFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V F+YASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVISELK AGA+WIQ DEP LVMDLE H+L+AFT AY ELES   GLNVLV
Sbjct  181   LPKILPVYKEVISELKAAGATWIQLDEPVLVMDLEGHKLQAFTGAYDELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIP EA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPTEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             ND A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSW+AFAAQKVVE
Sbjct  301   NDFAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWMAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVS+RL
Sbjct  361   VNALAKALAGHKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSSRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSAMAQSMTTRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  721   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  762



>ref|XP_010031619.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
 gb|KCW50983.1| hypothetical protein EUGRSUZ_J00612 [Eucalyptus grandis]
Length=827

 Score =  1383 bits (3579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/773 (88%), Positives = 727/773 (94%), Gaps = 0/773 (0%)
 Frame = +2

Query  86    QLPLFP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQM  265
             +  L P     MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKV+ADLRASIWKQM
Sbjct  52    RFALRPPPVRAMASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQM  111

Query  266   ADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEM  445
             A AGIK+IPSNTFSYYD VLDTTAMLGAVPPRY W GGEI FDTYFSMARGNASVPAMEM
Sbjct  112   ASAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEM  171

Query  446   TKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAK  625
             TKWFDTNYH+IVPELGPDVKFSYASHKAV E+KEA+ALGV+TVPVLVGPVSYLLLSKPAK
Sbjct  172   TKWFDTNYHYIVPELGPDVKFSYASHKAVDEFKEARALGVDTVPVLVGPVSYLLLSKPAK  231

Query  626   GVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAEL  805
             GVEKSF LLSL+ KI+PIYKEVI+ELK AGA+WIQFDEP LV DL+SHQL+AFT AY+EL
Sbjct  232   GVEKSFSLLSLIGKIVPIYKEVIAELKAAGATWIQFDEPTLVKDLDSHQLQAFTHAYSEL  291

Query  806   ESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLF  985
             ES   GL++L+ETYFAD+PAEA+KTLT+LKG+  FGFDL+RGTK++DL+KGGFPSGKYLF
Sbjct  292   ESSLSGLSILIETYFADVPAEAYKTLTSLKGIAGFGFDLVRGTKTLDLVKGGFPSGKYLF  351

Query  986   AGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKS  1165
             AGVVDGRNIWANDL  SL TL++LE +VGKDK+VVSTSCSLLHTAVDLVNETKLD EIKS
Sbjct  352   AGVVDGRNIWANDLDSSLKTLQALEGVVGKDKVVVSTSCSLLHTAVDLVNETKLDKEIKS  411

Query  1166  WLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSD  1345
             WLAFAAQKVVEVNALA+AL G KDE  FSANAAA ASRKSSPRVTNE+VQKAAAALKGSD
Sbjct  412   WLAFAAQKVVEVNALAQALFGLKDETVFSANAAALASRKSSPRVTNEAVQKAAAALKGSD  471

Query  1346  HRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKE  1525
             HRRATNVSARLDAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA KISE++YVKAIKE
Sbjct  472   HRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKISEDDYVKAIKE  531

Query  1526  EISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIY  1705
             EISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIY
Sbjct  532   EISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIY  591

Query  1706  GDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKD  1885
             GDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKD
Sbjct  592   GDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKD  651

Query  1886  EVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMC  2065
             EVEDLEKA + VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMC
Sbjct  652   EVEDLEKAGVTVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMC  711

Query  2066  YSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE  2245
             YSNFNDIIHSII+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE
Sbjct  712   YSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTE  771

Query  2246  EIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             EIADRINKMLAVL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +R+QLA
Sbjct  772   EIADRINKMLAVLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRSQLA  824



>ref|NP_001152513.1| LOC100286153 [Zea mays]
 gb|ACG47988.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Zea mays]
 tpg|DAA50626.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA50627.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
 tpg|DAA50628.1| TPA: putative methionine synthase family protein isoform 3 [Zea 
mays]
Length=765

 Score =  1383 bits (3579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/762 (89%), Positives = 719/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLR+SIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLEKVASDLRSSIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KF+YASHKAV+EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEV+SELK AGASWIQFDEP LV DL+ H+L AF+ AYAELES F GLNVL+
Sbjct  181   LGSILPIYKEVVSELKAAGASWIQFDEPTLVKDLDVHELAAFSSAYAELESAFSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SLSTL+SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLSTLQSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRAT V+ARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATTVAARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I 
Sbjct  541   FWSKTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQL 
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLG  762



>ref|XP_003554033.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 isoform 1 [Glycine max]
Length=763

 Score =  1383 bits (3579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/763 (89%), Positives = 717/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR+SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRSSIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD +LD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSFYDQLLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGV+T+PVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFTYASHKAVDEYKEAKALGVDTIPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI++LK AGASWIQFDEP LV+DLESH+L+AFT AYAEL      LNVLV
Sbjct  181   LPKVLAVYKEVIADLKAAGASWIQFDEPTLVLDLESHKLQAFTDAYAELAPALSDLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+L GVTA+GFDL+RGT ++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLNGVTAYGFDLVRGTHTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ LE IVGKDKLVVSTS SLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDLAASLTTLQGLEGIVGKDKLVVSTSSSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KD AFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGNKDVAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KANKISEEEYVK+IKEEI KVV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYVKSIKEEIRKVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ  TKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSLAQSFTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVH+FRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAHYLDWAVHAFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKYTEVKPAL NMV+AAK IR +LAK
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRNELAK  763



>ref|XP_006446418.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59658.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=836

 Score =  1382 bits (3578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/762 (88%), Positives = 716/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ V+ADLRASIW QMADAGIKFIPSN
Sbjct  72    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  131

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  132   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  191

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALG+ETVPVLVGPVSYLLLSKPAK VEKSF LLSL
Sbjct  192   VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKAVEKSFSLLSL  251

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+SH+L+AF+ AY+ LES   GLNVL+
Sbjct  252   IDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLDSHKLQAFSDAYSGLESSLSGLNVLI  311

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  312   ETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTLDLIKTEFPLGKYLFAGVVDGRNIWA  371

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKVVE
Sbjct  372   NDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAVDLENETKLDQEIKSWLAFAAQKVVE  431

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  432   VNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  491

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA KISE++YVK IKEEI+ VVKLQEE
Sbjct  492   DAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEE  551

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  552   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  611

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  612   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  671

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL WAVHSFRITNCGVQ+TTQ+HTHMCYSNFNDIIHSI
Sbjct  672   VIQIDEAALREGLPLRKSEQDFYLKWAVHSFRITNCGVQDTTQVHTHMCYSNFNDIIHSI  731

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             +DMDADVITIENSRSDEKLLSVFREGVKY AGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  732   MDMDADVITIENSRSDEKLLSVFREGVKYRAGIGPGVYDIHSPRIPSTEEIADRINKMLA  791

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +RTQLA
Sbjct  792   VLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRTQLA  833



>ref|XP_010932648.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Elaeis guineensis]
Length=766

 Score =  1382 bits (3577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/763 (88%), Positives = 713/763 (93%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DLQKV+ADLR SIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLQKVAADLRFSIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W+G EIGFDTYFSMARGNA VPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPQRYGWSGAEIGFDTYFSMARGNALVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL PD KF+YASHKAV+EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELAPDTKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFATLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +LPIY+EVI ELK AGASWIQFDEP LVMDL++HQLEAFTKAY+ELES F GLNVLV
Sbjct  181   LGNVLPIYQEVIMELKAAGASWIQFDEPTLVMDLDAHQLEAFTKAYSELESSFSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+T L GV+ FGFDL+RGT ++DLIK  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITTLNGVSGFGFDLVRGTNTLDLIKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLS+L  LE IVGKD LVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVV
Sbjct  301   ANDLASSLSSLGVLEAIVGKDNLVVSTSCSLMHTAVDLVNETKLDGEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE VQ AAAALKGSDH RATNVSAR
Sbjct  361   EVNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNEEVQTAAAALKGSDHCRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LP+TTIGSFPQT++LRRVRREYKANKISEEEYV AI+EEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPSTTIGSFPQTMDLRRVRREYKANKISEEEYVNAIREEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSSMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV +TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVNDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R QLA
Sbjct  721   AVLESNILWVNPDCGLKTRKYTEVKPALTNMVAAAKTLRKQLA  763



>ref|XP_008789650.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=766

 Score =  1382 bits (3577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/763 (88%), Positives = 718/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKR+LKFALESFWDGKSSA+DLQKV+ DLR SIWKQM+DAG+K+IPSN
Sbjct  1     MASHVVGYPRMGPKRQLKFALESFWDGKSSADDLQKVAQDLRCSIWKQMSDAGVKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W+GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPQRYGWSGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KF+YASHKAV+EYKEAKALG++T+PVL+GPV+YLLLSKPAKGVEK+F  LSL
Sbjct  121   VPELSPVSKFTYASHKAVSEYKEAKALGIDTIPVLIGPVTYLLLSKPAKGVEKAFSTLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +LP+YKEVI+ELK AGASWIQFDEP LVMDL++HQLEAFTKAY+ELES F GLNVL+
Sbjct  181   LGNVLPVYKEVIAELKAAGASWIQFDEPTLVMDLDAHQLEAFTKAYSELESSFSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+T+L G++ FGFDL+RGTK++DLIK  GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITSLNGISGFGFDLVRGTKTLDLIKSSGFPTGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SL+TL  LE IVGKDKLVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVV
Sbjct  301   ANDLAASLNTLNDLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDAEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDEAFFSANAAAQASRKSSPRVTN+ VQKAAAALKGSDHRRAT+VSAR
Sbjct  361   EVNALAKALAGHKDEAFFSANAAAQASRKSSPRVTNQEVQKAAAALKGSDHRRATDVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQ+KLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYV AIKEEI+KVVKLQE
Sbjct  421   LDAQQQKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVNAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP+PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPRPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSSMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++ TQIHTHMCYSNFNDIIHS
Sbjct  601   KVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDPTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++ ILWVNPDCGLKTRKYTEVKPAL NMVSAAK +R QLA
Sbjct  721   AVLESKILWVNPDCGLKTRKYTEVKPALTNMVSAAKLLREQLA  763



>ref|XP_004489678.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Cicer arietinum]
 ref|XP_004489679.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Cicer arietinum]
 ref|XP_004489680.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X3 [Cicer arietinum]
Length=765

 Score =  1382 bits (3576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/762 (88%), Positives = 712/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKVSADLRASIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVSADLRASIWKQMAAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVP RY W GGEIGFDTYFSM RGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFAYYDQVLDTTAMLGAVPTRYGWTGGEIGFDTYFSMGRGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGV+TVPVLVGPV+YLLLSKPAKGV+ SF LL+L
Sbjct  121   VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVDPSFDLLTL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K++ +YKEV+S+LK AGASWIQFDEP LV+DLESH+L+AFT AY+EL S   GLNV+V
Sbjct  181   LPKVISVYKEVVSDLKAAGASWIQFDEPTLVLDLESHKLQAFTAAYSELASTLSGLNVIV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+L GV+ FGFDLIRG K++DLIKGGFP+GKYLFAG+VDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLPGVSGFGFDLIRGAKTVDLIKGGFPTGKYLFAGIVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TL  LEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE
Sbjct  301   NDLTASLITLNGLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL  QKDEAFFS+NAAAQASRKSSPRVTNE+VQKAAAALKGS+HRRATNVS+RL
Sbjct  361   VNALAKALSDQKDEAFFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSEHRRATNVSSRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYV AIKEEI KVV+LQE+
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVTAIKEEIRKVVELQEQ  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQGMTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+  A YL+WAVHSFRITN GVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSGQAHYLDWAVHSFRITNVGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLL VFR+GVKYGAGIGPGVYDIHSPRIP TEEIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLRVFRDGVKYGAGIGPGVYDIHSPRIPPTEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY EV PAL NMV A K IR QLA
Sbjct  721   VLETNILWVNPDCGLKTRKYGEVNPALTNMVEATKLIRNQLA  762



>ref|XP_008807626.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Phoenix dactylifera]
Length=766

 Score =  1381 bits (3574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/763 (88%), Positives = 713/763 (93%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSA++LQKV+ADLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRIGPKRELKFALESFWDGKSSADNLQKVAADLRRSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD +LDTTAMLGAVP RY W+GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSCYDQMLDTTAMLGAVPQRYGWSGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL PD KF+YASHKAV+EYKEAKALG++TVPVL+GPV+YLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELAPDSKFTYASHKAVSEYKEAKALGIDTVPVLIGPVTYLLLSKPAKGVEKSFATLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  +LP+YKEVI+ELK AGASWIQFDEP LVMDL++HQLEAFTKAY ELES F GLNVLV
Sbjct  181   LGNVLPVYKEVIAELKAAGASWIQFDEPTLVMDLDAHQLEAFTKAYLELESSFSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+T L G++ FGFDL+RGT ++DLIK  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTITTLNGISGFGFDLVRGTNTLDLIKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL +LE IVGKDKLV STSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVV
Sbjct  301   ANDLASSLSTLNALEAIVGKDKLVTSTSCSLMHTAVDLVNETKLDGEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDEA FSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRAT+VSAR
Sbjct  361   EVNALAKALAGHKDEAVFSANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRATDVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYV AIKEEI+ VVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVNAIKEEINNVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSSMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+  AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSGQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEI DRINKML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIIDRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R QLA
Sbjct  721   AVLESNILWVNPDCGLKTRKYTEVKPALTNMVAAAKALRKQLA  763



>ref|XP_008662311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACN28399.1| unknown [Zea mays]
 tpg|DAA47594.1| TPA: putative methionine synthase family protein isoform 1 [Zea 
mays]
 tpg|DAA47595.1| TPA: putative methionine synthase family protein isoform 2 [Zea 
mays]
Length=766

 Score =  1380 bits (3573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/763 (89%), Positives = 719/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK FPLLSL
Sbjct  121   VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV+DL+S +L AF+ AYAELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVLDLDSDKLAAFSAAYAELESVLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLI-KGGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L  VTA+GFDL+RGT+++ L+   GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLVRGTQTLGLVTSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLATSLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL GQKDEA+F+ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRR TNVSAR
Sbjct  361   EVDALAKALAGQKDEAYFAANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRGTNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYV AIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVTAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNC +Q+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCEIQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI+KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRIDKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQLA  763



>ref|XP_010909224.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X1 [Elaeis guineensis]
Length=770

 Score =  1380 bits (3572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/764 (88%), Positives = 715/764 (94%), Gaps = 1/764 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             KMASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKV+ADLR SIWKQMADAGIK+IPS
Sbjct  4     KMASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIPS  63

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVP RY W G EIGFDTYFSMARGNASVPAMEMTKWFDTNYHF
Sbjct  64    NTFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  123

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGP+ KFSYASHKAV EY EAKALG++TVPVL+GPV+YLLLSK AKGV+K+F LLS
Sbjct  124   IVPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVLIGPVTYLLLSKHAKGVKKTFSLLS  183

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL  ++ +YKEVI+ELK AGASWIQFDEP LVMDL+S QL+AFT AY+ELES F GLNVL
Sbjct  184   LLGNVISVYKEVIAELKAAGASWIQFDEPTLVMDLDSRQLQAFTDAYSELESSFSGLNVL  243

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNI  1012
             +ETYFAD+PAEA+KT TALKGV+ FGFDL+RGTK++DLIK  GFP+ K+LFAGVVDGRNI
Sbjct  244   IETYFADVPAEAYKTATALKGVSGFGFDLVRGTKTLDLIKSSGFPASKFLFAGVVDGRNI  303

Query  1013  WANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV  1192
             WANDLA SLSTL++LE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKV
Sbjct  304   WANDLAASLSTLQALESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKV  363

Query  1193  VEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSA  1372
             VEVNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE VQKAAA LKGSDHRRATNVSA
Sbjct  364   VEVNALAKALAGLKDEAFFSANAAAQASRKSSPRVTNEEVQKAAADLKGSDHRRATNVSA  423

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI+KVVKLQ
Sbjct  424   RLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEINKVVKLQ  483

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             EELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPM
Sbjct  484   EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPM  543

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TVFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK EVEDLE A 
Sbjct  544   TVFWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKKEVEDLEAAG  603

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             I VIQIDEAALREGLPL K+E AFYL WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIH
Sbjct  604   IQVIQIDEAALREGLPLHKSEQAFYLEWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIH  663

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SII MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEI DRINKM
Sbjct  664   SIIGMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIVDRINKM  723

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             LAVL+TNILWVNPDCGLKTRKY EV PAL NMV+AAK +RTQLA
Sbjct  724   LAVLETNILWVNPDCGLKTRKYAEVNPALSNMVAAAKVLRTQLA  767



>ref|XP_007161979.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
 gb|ESW33973.1| hypothetical protein PHAVU_001G113800g [Phaseolus vulgaris]
Length=763

 Score =  1379 bits (3570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/763 (88%), Positives = 714/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AE LQ V+A LRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEALQLVAAGLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGVET+PVLVGPV+YLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFTYASHKAVEEYKEAKALGVETIPVLVGPVTYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI++LK AGASWIQFDEP LV+DLESH+L+AFT AYAEL     GLNVL+
Sbjct  181   LPKVLAVYKEVIADLKAAGASWIQFDEPTLVLDLESHKLQAFTDAYAELAPALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+L GVTA+GFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAETYKTLTSLNGVTAYGFDLVRGTKTVDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ LE +VGKDKLVVSTS SLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDLAASLATLQGLEGVVGKDKLVVSTSSSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFSANAAAQASRKSSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGNKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KANKISEEEYV +IKEEI KVV LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYVASIKEEIRKVVVLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ  TKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSLAQSFTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQADYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP +EEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPSEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKYTEVKPAL NMV+AAK+IR +LAK
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVKPALTNMVAAAKQIRNELAK  763



>gb|ADO87039.1| pollen allergen MetE [Amaranthus retroflexus]
Length=757

 Score =  1379 bits (3570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/757 (89%), Positives = 710/757 (94%), Gaps = 0/757 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMAD GIK+IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADVGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KIL IYKEVISELK AGASWIQ DEP LV DL++HQL+AFT AY ELES   GLNV+V
Sbjct  181   LPKILVIYKEVISELKAAGASWIQLDEPLLVRDLDAHQLQAFTDAYTELESTLSGLNVVV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+  EA+KTL +LKGVT FGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVTPEAYKTLVSLKGVTGFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ LE IVGKDKLVVSTSCSLLHTAVDLVN+TKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLATLQGLESIVGKDKLVVSTSCSLLHTAVDLVNKTKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAA ASRKSSPRV NE+VQKAAA LKGSDHRRATNVSARL
Sbjct  361   VNALAKALGGQKDEAFFSANAAAXASRKSSPRVNNEAVQKAAAGLKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPV ILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSSTAQSMTSRPMKGMLTGPVIILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EH FYL WAVHSFRITN GVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHEFYLKWAVHSFRITNVGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP T+EIADRI KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTDEIADRITKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKI  2389
             VL++++LWVNPDCGLKTRKY EV+PAL NMVSAAK I
Sbjct  721   VLESHVLWVNPDCGLKTRKYAEVQPALSNMVSAAKPI  757



>ref|XP_010909225.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like isoform X2 [Elaeis guineensis]
Length=766

 Score =  1379 bits (3568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/763 (88%), Positives = 714/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGK+SA+DLQKV+ADLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKTSAQDLQKVAADLRCSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W G EIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYGWNGEEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EY EAKALG++TVPVL+GPV+YLLLSK AKGV+K+F LLSL
Sbjct  121   VPELGPNTKFSYASHKAVAEYNEAKALGIDTVPVLIGPVTYLLLSKHAKGVKKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ++ +YKEVI+ELK AGASWIQFDEP LVMDL+S QL+AFT AY+ELES F GLNVL+
Sbjct  181   LGNVISVYKEVIAELKAAGASWIQFDEPTLVMDLDSRQLQAFTDAYSELESSFSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT TALKGV+ FGFDL+RGTK++DLIK  GFP+ K+LFAGVVDGRNIW
Sbjct  241   ETYFADVPAEAYKTATALKGVSGFGFDLVRGTKTLDLIKSSGFPASKFLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLSTL++LE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ANDLAASLSTLQALESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDEAFFSANAAAQASRKSSPRVTNE VQKAAA LKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGLKDEAFFSANAAAQASRKSSPRVTNEEVQKAAADLKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK EVEDLE A I
Sbjct  541   VFWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKKEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPL K+E AFYL WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLHKSEQAFYLEWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEI DRINKML
Sbjct  661   IIGMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIVDRINKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV+AAK +RTQLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYAEVNPALSNMVAAAKVLRTQLA  763



>gb|ACO34814.1| Sal k 3 pollen allergen [Salsola kali]
Length=757

 Score =  1379 bits (3568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/757 (89%), Positives = 711/757 (94%), Gaps = 0/757 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLR+SIWKQMADAGIK+IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAEDLKKVAADLRSSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVP RY + GGEIGFD YFSMARGNAS+PAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPARYGFNGGEIGFDLYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKF+Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSFPLLSL
Sbjct  121   VPELGPEVKFAYSSHKAVDEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILP+YKEVI+ELK AGAS IQFDEP LVMDLESHQL+AFT AYA+LES   GLNVLV
Sbjct  181   LPKILPVYKEVIAELKAAGASTIQFDEPTLVMDLESHQLKAFTDAYADLESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+  EA+KTL +L GVTAFGFDL+RGTK++DLIK GFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLTPEAYKTLVSLNGVTAFGFDLVRGTKTLDLIKSGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKV+E
Sbjct  301   NDLAASLATLQSLESIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAA ASRKSSPRVTNE+VQKAAA LKGSDHRRAT VSARL
Sbjct  361   VNALAKALAGQKDEAFFSANAAALASRKSSPRVTNEAVQKAAAGLKGSDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAI+DE EDLEKA IN
Sbjct  541   FWSSLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIEDEAEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+ H FYL WAVHSFRITN G+Q+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSGHGFYLQWAVHSFRITNVGIQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEE+ADRI KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEELADRIRKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKI  2389
             VL++N+LWVNPDCGLKTRKY EV PAL NMV AAK I
Sbjct  721   VLESNVLWVNPDCGLKTRKYNEVNPALSNMVYAAKPI  757



>tpg|DAA47593.1| TPA: putative methionine synthase family protein [Zea mays]
Length=781

 Score =  1377 bits (3564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/770 (88%), Positives = 720/770 (94%), Gaps = 1/770 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK FPLLSL
Sbjct  121   VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV+DL+S +L AF+ AYAELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVLDLDSDKLAAFSAAYAELESVLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLI-KGGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L  VTA+GFDL+RGT+++ L+   GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLVRGTQTLGLVTSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLATSLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL GQKDEA+F+ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRR TNVSAR
Sbjct  361   EVDALAKALAGQKDEAYFAANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRGTNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYV AIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVTAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNC +Q+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCEIQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI+KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRIDKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK*GS*AC  2425
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQLA      C
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQLASANGCGC  770



>ref|XP_007151496.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
 gb|ESW23490.1| hypothetical protein PHAVU_004G051600g [Phaseolus vulgaris]
Length=763

 Score =  1376 bits (3561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/763 (88%), Positives = 713/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV++DLRASIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVASDLRASIWKQMTDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W GGEIGFDT+FSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPARYGWTGGEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPD+ F+YASHKAV EYKEAKALGV+TVPVLVGPV+YL+LSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDMTFTYASHKAVNEYKEAKALGVDTVPVLVGPVTYLVLSKPAKGVDKSFCLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEV+++LK AGA+WIQFDEP LV DL+S +L+A + AYAELES   GLNVL+
Sbjct  181   LPKVLAVYKEVVADLKAAGATWIQFDEPILVTDLDSQKLQAISAAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA++TLT+L  VTAFGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVTAEAYQTLTSLNVVTAFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+LA SL TL SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NNLATSLDTLNSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVS RL
Sbjct  361   VNALAKALAGQKDEAFFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSTRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELR+VRREYKA KISEEEYV AIKEEI KVV+LQE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRKVRREYKATKISEEEYVSAIKEEIRKVVELQEQ  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQANYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKY EV PAL NMV+A K IR QLAK
Sbjct  721   VLERNILWVNPDCGLKTRKYPEVNPALTNMVAATKLIRNQLAK  763



>ref|XP_010031616.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031617.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010031618.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Eucalyptus grandis]
 gb|KCW50984.1| hypothetical protein EUGRSUZ_J00613 [Eucalyptus grandis]
Length=765

 Score =  1375 bits (3560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 720/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAE+LQKV+ADLRASIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDRKSSAEELQKVAADLRASIWKQMASAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEI FDTYFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV E+KEA+ALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVDEFKEARALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             + KI+PIYKEVI+ELK AGA+WIQFDEP LV DL+SHQL+AFT AY+ELES   GL++L+
Sbjct  181   IGKIVPIYKEVIAELKAAGATWIQFDEPTLVKDLDSHQLQAFTHAYSELESSLSGLSILI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKG+  FGFDL+RGTK++DL+KGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLKGIAGFGFDLVRGTKTLDLVKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TL++LE +VGKDK+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLDSSLKTLQALEGVVGKDKVVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA+AL G KDE  FSANAAA ASRK SPRVTNE+VQKAAAALKGSDH RA NVSARL
Sbjct  361   VNALAQALFGLKDETVFSANAAALASRKLSPRVTNEAVQKAAAALKGSDHHRAANVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTT GSFPQT+ELR+VRREYKA KISE++YVKAIKEEISKVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTTGSFPQTMELRKVRREYKAKKISEDDYVKAIKEEISKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA + 
Sbjct  541   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGVT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MD+DVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  661   INMDSDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKY+EVKPAL NMV+AAK +RTQLA
Sbjct  721   VLESNILWVNPDCGLKTRKYSEVKPALSNMVAAAKLLRTQLA  762



>ref|XP_003551089.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006601025.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
Length=765

 Score =  1375 bits (3559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 711/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLRASIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W G EIGFDT+FSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L IYKEV+++LK AGASWIQFDEP LV+DL S  L+A T AYAELES   GLNVL+
Sbjct  181   LPKVLAIYKEVVADLKQAGASWIQFDEPILVLDLGSQTLQALTAAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA++TLTAL GV AFGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYQTLTALNGVAAFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+L  SL TL SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NNLTASLDTLNSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NA AQASRK SPRVTNE+VQKAAAALKGSDHRRATNVS RL
Sbjct  361   VNALAKALSGQKDEAFFSSNADAQASRKFSPRVTNEAVQKAAAALKGSDHRRATNVSTRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYV +IKEEI KVV+LQE 
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVSSIKEEIRKVVELQEN  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVH+FRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQANYLDWAVHAFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP T+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EV PAL NMV+A K IR++L+
Sbjct  721   VLEKNILWVNPDCGLKTRKYPEVNPALTNMVAATKLIRSKLS  762



>ref|NP_001288585.1| LOC541714 [Zea mays]
 ref|XP_008644635.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1 [Zea mays]
 gb|ACL54117.1| unknown [Zea mays]
 gb|AFW68108.1| putative methionine synthase family protein isoform 1 [Zea mays]
 gb|AFW68109.1| putative methionine synthase family protein isoform 2 [Zea mays]
Length=765

 Score =  1375 bits (3558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/762 (88%), Positives = 716/762 (94%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLR+SIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KF+YASHKAV+EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEV++ELK AGASWIQ DEP LV DL++H+L AF+ AYAELES F GLNVL+
Sbjct  181   LGSILPIYKEVVAELKAAGASWIQLDEPTLVKDLDAHELAAFSSAYAELESSFSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SLSTL SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLSTLHSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE +F+ANAAAQASR+SSPRVTNE VQKAAAAL+GSDHRR+T VSARL
Sbjct  361   VNALAKALAGQKDEVYFAANAAAQASRRSSPRVTNEEVQKAAAALRGSDHRRSTTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KI+E+EY+ AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKITEDEYISAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I 
Sbjct  541   FWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+ KMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVEKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLA  762



>gb|AFW68110.1| putative methionine synthase family protein [Zea mays]
Length=812

 Score =  1373 bits (3554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/763 (88%), Positives = 717/763 (94%), Gaps = 0/763 (0%)
 Frame = +2

Query  116   KMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPS  295
             +MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLR+SIWKQM++AGIK+IPS
Sbjct  47    RMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPS  106

Query  296   NTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHF  475
             NTFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHF
Sbjct  107   NTFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKWFDTNYHF  166

Query  476   IVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLS  655
             IVPELGP  KF+YASHKAV+EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLS
Sbjct  167   IVPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLS  226

Query  656   LLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVL  835
             LL  ILPIYKEV++ELK AGASWIQ DEP LV DL++H+L AF+ AYAELES F GLNVL
Sbjct  227   LLGSILPIYKEVVAELKAAGASWIQLDEPTLVKDLDAHELAAFSSAYAELESSFSGLNVL  286

Query  836   VETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
             +ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIW
Sbjct  287   IETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIW  346

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  347   ADDLAASLSTLHSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVV  406

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDE +F+ANAAAQASR+SSPRVTNE VQKAAAAL+GSDHRR+T VSAR
Sbjct  407   EVNALAKALAGQKDEVYFAANAAAQASRRSSPRVTNEEVQKAAAALRGSDHRRSTTVSAR  466

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KI+E+EY+ AIKEEISKVVK+QE
Sbjct  467   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKITEDEYISAIKEEISKVVKIQE  526

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  527   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  586

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I
Sbjct  587   VFWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGI  646

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  647   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  706

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+ KML
Sbjct  707   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVEKML  766

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQLA
Sbjct  767   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLA  809



>ref|XP_003601341.1| Methionine synthase [Medicago truncatula]
 gb|AES71592.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=813

 Score =  1373 bits (3554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/759 (87%), Positives = 711/759 (94%), Gaps = 0/759 (0%)
 Frame = +2

Query  128   HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFS  307
             HIVGYPRMGPKRELKFALESFWDGKSSAE+L++V+A+LR++IWKQMADAGI+ IPSNTFS
Sbjct  52    HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  308   YYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPE  487
             YYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFIVPE
Sbjct  112   YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  488   LGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDK  667
             LGPDVKFSYASHKAV EY EAKALGV TVPVLVGPVSYLLLSKPAKGVEKSF LLSL+DK
Sbjct  172   LGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKSFSLLSLIDK  231

Query  668   ILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETY  847
             ILP+YKEV++ELK AGA+WIQFDEP LV DL++HQL+AF  AYAELES   GLNVLVETY
Sbjct  232   ILPVYKEVVTELKTAGATWIQFDEPTLVKDLDAHQLQAFNYAYAELESTLSGLNVLVETY  291

Query  848   FADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDL  1027
             FAD+PAEA+KTLT+LK VTA+GFDL+RGTK++DLIK GFPSGK LFAG+VDGRNIWAN+L
Sbjct  292   FADVPAEAYKTLTSLKAVTAYGFDLVRGTKTLDLIKQGFPSGKLLFAGIVDGRNIWANNL  351

Query  1028  AGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNA  1207
               SL+TLK L DIVGK+K+VVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQK+VEVNA
Sbjct  352   ESSLNTLKELGDIVGKEKVVVSTSCSLLHTAVDLVNETKLDQEIKSWLAFAAQKIVEVNA  411

Query  1208  LAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQ  1387
             L+KAL GQKDE +FS+NAAA  SRKSSPRVTNE VQKAAAALKGSDHRR T+VS+RLDAQ
Sbjct  412   LSKALSGQKDEVYFSSNAAALVSRKSSPRVTNEDVQKAAAALKGSDHRRVTSVSSRLDAQ  471

Query  1388  QKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDI  1567
             QKKLNLP LPTTTIGSFPQT +LRRVRRE+KA KISEE+Y++ IKEEI+ VVK+QEELDI
Sbjct  472   QKKLNLPSLPTTTIGSFPQTADLRRVRREFKAKKISEEDYIRFIKEEINNVVKIQEELDI  531

Query  1568  DVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  1747
             DVLVHGEPERNDMVEYFGEQLSGF FTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS
Sbjct  532   DVLVHGEPERNDMVEYFGEQLSGFTFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  591

Query  1748  SAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQ  1927
             S AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA I VIQ
Sbjct  592   STAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKAGITVIQ  651

Query  1928  IDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDM  2107
             IDEAALREGLPLRK+E +FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSIIDM
Sbjct  652   IDEAALREGLPLRKSEESFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDM  711

Query  2108  DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLD  2287
             DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLAVL+
Sbjct  712   DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLAVLE  771

Query  2288  TNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             +NILWVNPDCGLKTRKYTEVKPAL NMV AAK IR QLA
Sbjct  772   SNILWVNPDCGLKTRKYTEVKPALTNMVDAAKLIRKQLA  810



>ref|XP_003525709.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X1 [Glycine max]
 ref|XP_006579821.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform X2 [Glycine max]
 gb|KHN36957.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =  1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/762 (88%), Positives = 712/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFW+GKSSA+DLQKV+ADLRASIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWEGKSSADDLQKVAADLRASIWKQMTDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY    GEI FDTYFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGLNNGEIEFDTYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGV+TVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDVNFTYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L IYKEV+++LK AGASW+QFDEP  V+DL+S  L+AF+ AYAELES   GLNVL+
Sbjct  181   LPKVLAIYKEVVADLKEAGASWVQFDEPIFVLDLDSQTLQAFSTAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADI AEA++TLTAL GVTAFGFDL+RGTK++DLIKGGFPSGKY+FAGVVDGRNIWA
Sbjct  241   ETYFADITAEAYQTLTALNGVTAFGFDLVRGTKTLDLIKGGFPSGKYMFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+LA SL TL SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NNLAASLDTLNSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGQKDEAFFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKK NLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYV +IKEEI KVV+LQE 
Sbjct  421   DAQQKKFNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVSSIKEEIRKVVELQEN  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQANYLDWAVHSFRITNIGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFR+GVKYGAGIGPGVYDIHSPRIP T+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFRDGVKYGAGIGPGVYDIHSPRIPPTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EV PAL NMV+A K IR QLA
Sbjct  721   VLEKNILWVNPDCGLKTRKYPEVNPALTNMVAATKLIRNQLA  762



>gb|AAL33589.1| methionine synthase [Zea mays]
Length=766

 Score =  1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/763 (89%), Positives = 717/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEK FPLLSL
Sbjct  121   VPELGPNTKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKGFPLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV+DL+S +L AF+ AYAELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVLDLDSDKLAAFSAAYAELESVLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLI-KGGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L  VTA+GFDL+RGT+++ L+   GFP+GKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLVRGTQTLGLVTSAGFPAGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLATSLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL GQKDEA+F+ANAAAQASRKSSPRVTNE VQKAAAALKGSDHRR TNVSAR
Sbjct  361   EVDALAKALAGQKDEAYFAANAAAQASRKSSPRVTNEEVQKAAAALKGSDHRRGTNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYV AIKEEI+KVVKLQE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVTAIKEEINKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EV DL+   I
Sbjct  541   VFWSKTAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVGDLKAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNC +Q+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCEIQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS EEIADRI+KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSAEEIADRIDKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMVSAAK IRTQ A
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVSAAKLIRTQFA  763



>ref|XP_004144075.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like isoform 2 [Cucumis sativus]
Length=760

 Score =  1372 bits (3552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/762 (87%), Positives = 722/762 (95%), Gaps = 5/762 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKV+ADLR+SIWKQMA+AGIKFIPSN
Sbjct  1     MASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMAEAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTK      H+I
Sbjct  61    TFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKC-----HYI  115

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P+ KF+YASHKAV E+KEAKALGVETVPVLVGPVS+LLLSKPAKGVEKSF LLSL
Sbjct  116   VPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKSFSLLSL  175

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+SELK AGA+WIQFDEP LV DL++H L+AFT+AY+ELES   GLNVL+
Sbjct  176   IDKILPVYKEVVSELKAAGATWIQFDEPTLVKDLDAHHLQAFTQAYSELESTLSGLNVLI  235

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGV+ +GFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIW+
Sbjct  236   ETYFADVPAEAYKTLTSLKGVSGYGFDLVRGTQTVDLIKGGFPSGKYLFAGVVDGRNIWS  295

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  S++TL++LE++VGK+K+VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  296   NDLQASITTLEALENVVGKEKIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  355

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRR+TNVSARL
Sbjct  356   VNALAKALSGHKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRSTNVSARL  415

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE+KA KISEE+YV +IKEEI+KVV+LQEE
Sbjct  416   DAQQKKLNLPMLPTTTIGSFPQTMDLRRVRREFKAKKISEEDYVSSIKEEINKVVQLQEE  475

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  476   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  535

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  536   FWSTMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  595

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  596   VIQIDEAALREGLPLRKSEENFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  655

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  656   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  715

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R+QLA
Sbjct  716   VLESNILWVNPDCGLKTRKYTEVKPALLNMVAAAKLLRSQLA  757



>gb|KHN28122.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=765

 Score =  1372 bits (3551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/762 (88%), Positives = 709/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV++DLRASIWKQM DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVASDLRASIWKQMIDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W G EIGFDT+FSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGEEIGFDTFFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L IY+EV+++LK AGASWIQFDEP LV+DL S  L+A T AYAELES   GLNVL+
Sbjct  181   LPKVLAIYREVVADLKQAGASWIQFDEPILVLDLGSQTLQALTAAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA++TLTAL GV AFGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYQTLTALNGVAAFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+L  SL TL SLE IVGKDKLVVSTSCS LHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NNLTASLDTLNSLEGIVGKDKLVVSTSCSFLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NA AQASRK SPRVTNE+VQKAAAALKGSDHRRATNVS RL
Sbjct  361   VNALAKALSGQKDEAFFSSNADAQASRKFSPRVTNEAVQKAAAALKGSDHRRATNVSTRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYV +IKEEI KVV+LQE 
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVSSIKEEIRKVVELQEN  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVH+FRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQANYLDWAVHAFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP T+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EV PAL NMV+A K IR +L+
Sbjct  721   VLEKNILWVNPDCGLKTRKYPEVNPALTNMVAATKLIRNKLS  762



>gb|KDO66310.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=793

 Score =  1368 bits (3541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/790 (85%), Positives = 717/790 (91%), Gaps = 28/790 (4%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ V+ADLRASIW QMADAGIKFIPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALG+ETVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+SH+L+AF+ AY+EL+S   GLNVL+
Sbjct  181   IDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLDSHKLQAFSDAYSELQSSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTLDLIKTEFPLGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAVDLENETKLDQEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTNE+VQK AAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKPAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANK-----------------------  1489
             DAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA K                       
Sbjct  421   DAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKAKKRVLLLFHILLLNFHHFQIVFHKL  480

Query  1490  -----ISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTAN  1654
                  ISE++YVK IKEEI+ VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT N
Sbjct  481   VFYFRISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVN  540

Query  1655  GWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRN  1834
             GWVQSYGSRCVKPPIIYGDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRN
Sbjct  541   GWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRN  600

Query  1835  DQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFR  2014
             DQPRFETCYQIALAIKDEVEDLEKA I VIQIDEAALREGLPLRK+E  FYL WAVHSFR
Sbjct  601   DQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEQDFYLKWAVHSFR  660

Query  2015  ITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAG  2194
             ITNCGVQ+TTQ+HTHMCYSNFNDIIHSI+DMDADVITIENSRSDEKLLSVFREGVKY AG
Sbjct  661   ITNCGVQDTTQVHTHMCYSNFNDIIHSIMDMDADVITIENSRSDEKLLSVFREGVKYRAG  720

Query  2195  IGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVS  2374
             IGPGVYDIHSPRIPSTEEIADRINKMLAVL++NILWVNPDCGLKTRKY+EVKPAL NMV+
Sbjct  721   IGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYSEVKPALSNMVA  780

Query  2375  AAKKIRTQLA  2404
             AAK +RTQLA
Sbjct  781   AAKLLRTQLA  790



>ref|XP_006826346.1| hypothetical protein AMTR_s00004p00117110 [Amborella trichopoda]
 gb|ERM93583.1| hypothetical protein AMTR_s00004p00117110 [Amborella trichopoda]
Length=765

 Score =  1367 bits (3539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/762 (86%), Positives = 712/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS A DL+KV+ DL+A+IWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSGAHDLEKVAKDLKAAIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFDTYFSMARGNAS+PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDTYFSMARGNASLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGVETVPV+VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVIVGPVSYLLLSKPAKGVEKSFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+P+YKEV++ELK AGA+W+QFDEP LV+D +SH+L+AF +AY ELES   GLNV++
Sbjct  181   LGKIIPVYKEVVTELKAAGATWVQFDEPTLVLDQDSHKLQAFAEAYTELESALSGLNVVI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +KTLT+LKG++ FGFDL+RGTK++DLIK  FPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAETYKTLTSLKGISGFGFDLVRGTKTLDLIKSSFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL SLE IVGKDKLVVSTSCSLLHT+VDL NETKLD+EIKSW AFAAQKVVE
Sbjct  301   NDLATSLTTLHSLESIVGKDKLVVSTSCSLLHTSVDLANETKLDSEIKSWFAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA AL G K+EAFF ANAAAQ SRKSSPRV NE+VQKAAAALKGS+HRRAT VSARL
Sbjct  361   VNALATALSGHKEEAFFDANAAAQDSRKSSPRVNNEAVQKAAAALKGSEHRRATPVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KIS+E+YVKAIKEEISKVVKLQE+
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISQEDYVKAIKEEISKVVKLQED  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQ+ G AFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQMEGIAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             +WSS AQ MT RPMKGMLTGPVTILNWSFVR DQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   YWSSMAQSMTARPMKGMLTGPVTILNWSFVRVDQPRSETCYQIALAIKDEVEDLEKGGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQAHYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP+T+EIADR+NKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPTTDEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKY+EV PAL NMVSAAK +RTQLA
Sbjct  721   VLETNILWVNPDCGLKTRKYSEVVPALTNMVSAAKLLRTQLA  762



>ref|XP_006446419.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
 gb|ESR59659.1| hypothetical protein CICLE_v10014233mg [Citrus clementina]
Length=864

 Score =  1365 bits (3532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/790 (85%), Positives = 716/790 (91%), Gaps = 28/790 (4%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ V+ADLRASIW QMADAGIKFIPSN
Sbjct  72    MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  131

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  132   TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  191

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALG+ETVPVLVGPVSYLLLSKPAK VEKSF LLSL
Sbjct  192   VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKAVEKSFSLLSL  251

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+SH+L+AF+ AY+ LES   GLNVL+
Sbjct  252   IDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLDSHKLQAFSDAYSGLESSLSGLNVLI  311

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  312   ETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTLDLIKTEFPLGKYLFAGVVDGRNIWA  371

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKVVE
Sbjct  372   NDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAVDLENETKLDQEIKSWLAFAAQKVVE  431

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  432   VNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  491

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANK-----------------------  1489
             DAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA K                       
Sbjct  492   DAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKAKKRVLLLFHILLLNFHHFQIVFHKL  551

Query  1490  -----ISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTAN  1654
                  ISE++YVK IKEEI+ VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT N
Sbjct  552   VFYFRISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVN  611

Query  1655  GWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRN  1834
             GWVQSYGSRCVKPPIIYGDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRN
Sbjct  612   GWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRN  671

Query  1835  DQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFR  2014
             DQPRFETCYQIALAIKDEVEDLEKA I VIQIDEAALREGLPLRK+E  FYL WAVHSFR
Sbjct  672   DQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEQDFYLKWAVHSFR  731

Query  2015  ITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAG  2194
             ITNCGVQ+TTQ+HTHMCYSNFNDIIHSI+DMDADVITIENSRSDEKLLSVFREGVKY AG
Sbjct  732   ITNCGVQDTTQVHTHMCYSNFNDIIHSIMDMDADVITIENSRSDEKLLSVFREGVKYRAG  791

Query  2195  IGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVS  2374
             IGPGVYDIHSPRIPSTEEIADRINKMLAVL++NILWVNPDCGLKTRKY+EVKPAL NMV+
Sbjct  792   IGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYSEVKPALSNMVA  851

Query  2375  AAKKIRTQLA  2404
             AAK +RTQLA
Sbjct  852   AAKLLRTQLA  861



>emb|CAJ01713.1| methionine synthase 1 enzyme [Hordeum vulgare subsp. vulgare]
Length=765

 Score =  1364 bits (3530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/763 (88%), Positives = 707/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVP RY+W GGEI   TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPD KFSY+SHKA+ EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121   VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV DLESHQL AF+ AY ELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVKDLESHQLAAFSAAYTELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE++KTLT+L  VTA+GFDL RGTK+++L+K GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLERGTKTLELVKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLATLQSLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAA ASR+SSPRVTNE VQKAA ALKGSDHRRAT VSARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAALASRRSSPRVTNEEVQKAATALKGSDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY  AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYTNAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGF FTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFTFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I 
Sbjct  541   FWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPS EEIADR+NKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPSKEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLDTNILWVNPDCGLKTRKY EVKPAL NMV AAK+IR +LAK
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALTNMVEAAKQIRAELAK  763



>ref|XP_004159344.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Cucumis sativus]
Length=765

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/767 (86%), Positives = 720/767 (94%), Gaps = 10/767 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPR+GPKRELKFALESFWDGKSSA+DLQKV+ADLR+SIWKQMA+AGIKFIPSN
Sbjct  1     MASHIVGYPRIGPKRELKFALESFWDGKSSADDLQKVAADLRSSIWKQMAEAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT  MLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTK      H+I
Sbjct  61    TFSYYDQVLDTATMLGAVPSRYGWNGGEIGFDIYFSMARGNASVPAMEMTKC-----HYI  115

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P+ KF+YASHKAV E+KEAKALGVETVPVLVGPVS+LLLSKPAKGVEKSF LLSL
Sbjct  116   VPELSPEDKFTYASHKAVNEFKEAKALGVETVPVLVGPVSFLLLSKPAKGVEKSFSLLSL  175

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+SELK AGA+WIQFDEP LV DL++H L+AF +AY+ELES   GLNVL+
Sbjct  176   IDKILPVYKEVVSELKAAGATWIQFDEPTLVKDLDAHHLQAFAQAYSELESTLSGLNVLI  235

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+LKGV+ +GFDL+RGT+++DLIKGGFPSGKYLFAGVVDGRNIW+
Sbjct  236   ETYFADVPAEAYKTLTSLKGVSGYGFDLVRGTQTLDLIKGGFPSGKYLFAGVVDGRNIWS  295

Query  1019  NDLAGSLSTLKSLEDIVGK-----DKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAA  1183
             NDL  S++TL++LE++VGK      K+VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAA
Sbjct  296   NDLQASITTLEALENVVGKGACFLTKIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAA  355

Query  1184  QKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATN  1363
             QKVVEVNALAKAL G KDEA+FS+NAAAQASRKSSPRVTNE+VQKAAAALKGSDHRR+TN
Sbjct  356   QKVVEVNALAKALSGHKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRSTN  415

Query  1364  VSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVV  1543
             VSARLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRRE+KA KISEE+YV +IKEEI+KVV
Sbjct  416   VSARLDAQQKKLNLPMLPTTTIGSFPQTMDLRRVRREFKAKKISEEDYVSSIKEEINKVV  475

Query  1544  KLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  1723
             +LQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP
Sbjct  476   QLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRP  535

Query  1724  KPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  1903
             KPMTVFWS+ AQ MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE
Sbjct  536   KPMTVFWSTMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  595

Query  1904  KANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFND  2083
             KA I VIQIDEAALREGLPLRK+E  FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFND
Sbjct  596   KAGITVIQIDEAALREGLPLRKSEENFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFND  655

Query  2084  IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  2263
             IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI
Sbjct  656   IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  715

Query  2264  NKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             NKMLAVL++NILWVNPDCGLKTRKYTEVKPAL NMV+AAK +R+QLA
Sbjct  716   NKMLAVLESNILWVNPDCGLKTRKYTEVKPALLNMVAAAKLLRSQLA  762



>gb|EMS51950.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
 gb|EMT07372.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=765

 Score =  1363 bits (3528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/763 (88%), Positives = 707/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEI   TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSY+SHKA+ EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121   VPELAPSTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV DLESHQL AF+ AYAELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVKDLESHQLSAFSAAYAELESALSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PA+++KTLT+L  VTA+GFDL RGTK+++L+K GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPADSYKTLTSLSSVTAYGFDLERGTKTLELVKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SL+TL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLATLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAA ASR+SSPRVTNE VQKAA ALKGSDHRRAT VSARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAALASRRSSPRVTNEEVQKAATALKGSDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY  AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYTNAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGF FTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFTFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I 
Sbjct  541   FWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPS EEIADR+NKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPSKEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLDTNILWVNPDCGLKTRKY EVKPAL NMV AAK+IR +LAK
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALTNMVEAAKQIRAELAK  763



>emb|CAJ01714.1| methionine synthase 2 enzyme [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =  1362 bits (3526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/763 (88%), Positives = 716/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL +H+L AF+ AYAELES   GLNVL+
Sbjct  181   LDSILPIYKEVVAELKAAGASWIQFDEPTLVKDLAAHELAAFSSAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTVELIKSTGIPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLQSLESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL GQKDEA+F+ANAAAQASR+SSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGQKDEAYFAANAAAQASRRSSPRVNNEEVQKAAAALKGSDHRRATPVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  763



>dbj|BAJ89541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =  1362 bits (3526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/763 (88%), Positives = 716/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNAAVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL +H+L AF+ AYAELES   GLNVL+
Sbjct  181   LDSILPIYKEVVAELKAAGASWIQFDEPTLVKDLAAHELAAFSSAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTVELIKSTGIPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLQSLESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL GQKDEA+F+ANAAAQASR+SSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGQKDEAYFAANAAAQASRRSSPRVNNEEVQKAAAALKGSDHRRATPVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  763



>ref|XP_010236990.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Brachypodium distachyon]
Length=765

 Score =  1361 bits (3523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/762 (88%), Positives = 707/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMA  GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMATTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEI   TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKA+ EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYSSHKAINEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV DL+SHQL AF+ AY ELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVKDLDSHQLAAFSSAYTELESALSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE++KTLT+L  VTA+GFDL RGTK++DL++ GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLERGTKTLDLVRSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SL TL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLITLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDEEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAAQ+SR+SSPRVTN  VQKAA ALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAAQSSRRSSPRVTNAEVQKAATALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEY  AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYTNAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I 
Sbjct  541   FWSKTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRKAEHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPS EEIADR+NKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPSMEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL NMV AAK IR QLA
Sbjct  721   VLDTNILWVNPDCGLKTRKYTEVKPALANMVEAAKLIRKQLA  762



>dbj|BAJ88127.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =  1361 bits (3522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/763 (88%), Positives = 716/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL +H+L AF+ AYAELES   GLNVL+
Sbjct  181   LDSILPIYKEVVAELKAAGASWIQFDEPTLVKDLAAHELAAFSSAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTVELIKSTGIPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A++LA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADNLAASLSTLQSLESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL GQKDEA+F+ANAAAQASR+SSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGQKDEAYFAANAAAQASRRSSPRVNNEEVQKAAAALKGSDHRRATPVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  763



>dbj|BAJ87953.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=766

 Score =  1361 bits (3522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/763 (88%), Positives = 716/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASH+AV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHEAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL +H+L AF+ AYAELES   GLNVL+
Sbjct  181   LDSILPIYKEVVAELKAAGASWIQFDEPTLVKDLAAHELAAFSSAYAELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTVELIKSTGIPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLQSLESVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL GQKDEA+F+ANAAAQASR+SSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGQKDEAYFAANAAAQASRRSSPRVNNEEVQKAAAALKGSDHRRATPVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQSMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  763



>ref|NP_001266005.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase-like 
[Cicer arietinum]
 gb|ACL14488.1| methionine synthase [Cicer arietinum]
Length=763

 Score =  1360 bits (3519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/763 (87%), Positives = 713/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M SHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLRASIWKQM+DAGIK+IPSN
Sbjct  1     MGSHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD TA LGAVPPRY W GGE+GFDTYFSMARGNA++PAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATATLGAVPPRYGWTGGEVGFDTYFSMARGNATIPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F+YASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDVNFTYASHKAVEEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVDKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI++LK AGA +IQFDEP LV+DLESH+L+AFT AYA L   F GL+VLV
Sbjct  181   LPKVLAVYKEVIADLKAAGALFIQFDEPTLVLDLESHKLQAFTDAYAALAPSFSGLHVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+KTLT+L GV A+GFDL+RG K+++LIK GFPS K++FAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKTLTSLSGVAAYGFDLVRGPKTLELIKAGFPSDKWIFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S+STL++L  IVGK+++VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK+VE
Sbjct  301   NDLAASISTLETLASIVGKERIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA A  G KDEAFFSANAAAQASRKSSPRV NE+VQKAA+ALKGSDHRRATNVSARL
Sbjct  361   VNALANAFSGNKDEAFFSANAAAQASRKSSPRVNNEAVQKAASALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KA KISEEEY+KAIKEEI KVV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYIKAIKEEIRKVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQ SGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQSSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ  TKRP KGMLTGPVTILNWSFVR DQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSLAQSFTKRPTKGMLTGPVTILNWSFVRVDQPRSETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHA YL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAHYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKYTEV+PALENMV+AAK+IR +LAK
Sbjct  721   VLEKNILWVNPDCGLKTRKYTEVRPALENMVAAAKQIRNELAK  763



>dbj|BAD34660.1| methionine synthase [Hordeum vulgare subsp. vulgare]
Length=765

 Score =  1359 bits (3518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/763 (88%), Positives = 706/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMA AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMAGAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVP RY+W GGEI   TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFAYYDQVLDTTAMLGAVPDRYSWTGGEINLSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPD KFSY+SHKA+ EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF  LSL
Sbjct  121   VPELGPDTKFSYSSHKAINEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGASWIQFDEP LV DLESHQL AF+ AY ELES   GLNVLV
Sbjct  181   LSSILPVYKEVIAELKAAGASWIQFDEPTLVKDLESHQLAAFSAAYTELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE++KTLT+L  VTA+GFDL RGTK+++L+K GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAESYKTLTSLSSVTAYGFDLERGTKTLELVKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   DDLAASLATLQSLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAA ASR+SSPRVTNE VQKAA ALKGSDH RAT VSARL
Sbjct  361   VNALAKALAGQKDEAYFAANAAALASRRSSPRVTNEEVQKAATALKGSDHPRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY  AIKEEISKVVK+QEE
Sbjct  421   DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYTNAIKEEISKVVKIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGF FTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFTFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I 
Sbjct  541   FWSKMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGIQ  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPS EEIADR+NKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPSKEEIADRVNKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLDTNILWVNPDCGLKTRKY EVKPAL NMV AAK+IR +LAK
Sbjct  721   VLDTNILWVNPDCGLKTRKYAEVKPALTNMVEAAKQIRAELAK  763



>ref|XP_003624677.1| Methionine synthase [Medicago truncatula]
 gb|AES80895.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=803

 Score =  1359 bits (3518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/765 (87%), Positives = 714/765 (93%), Gaps = 0/765 (0%)
 Frame = +2

Query  113   EKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIP  292
             EKMASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVSADLRASIWKQM+D GIK+IP
Sbjct  39    EKMASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIP  98

Query  293   SNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH  472
             SNTF+YYDHVLDTTA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYH
Sbjct  99    SNTFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYH  158

Query  473   FIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLL  652
             FIVPELGP+V F Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LL
Sbjct  159   FIVPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLL  218

Query  653   SLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNV  832
             SLL K+L +YKEVI++LK AGA +IQFDEP LV+DLE+H+L+AFT AYA L   F GL+V
Sbjct  219   SLLPKVLAVYKEVIADLKAAGAQFIQFDEPTLVLDLEAHKLQAFTDAYAALTPSFEGLHV  278

Query  833   LVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNI  1012
             LVETYFADIPAEA+KTLT+L GV A+GFDL+RGTK++DLIK GFPSGK++FAGVVDGRNI
Sbjct  279   LVETYFADIPAEAYKTLTSLSGVAAYGFDLVRGTKTLDLIKAGFPSGKWIFAGVVDGRNI  338

Query  1013  WANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV  1192
             WANDL  SLSTL++L  IVGK+++VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKV
Sbjct  339   WANDLEASLSTLEALAGIVGKERIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKV  398

Query  1193  VEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSA  1372
             VEVNALA AL G KDEA FSA++AAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSA
Sbjct  399   VEVNALANALAGNKDEAIFSASSAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSA  458

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RLDAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KA KISEEEY+KAIKEEI  VV+LQ
Sbjct  459   RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYIKAIKEEIRSVVELQ  518

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK M
Sbjct  519   EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAM  578

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TVFWS+ AQ  TKRPMKGMLTGPVTILNWSFVR DQPR ETCYQIALAIKDEVEDLEK  
Sbjct  579   TVFWSALAQSFTKRPMKGMLTGPVTILNWSFVRVDQPRSETCYQIALAIKDEVEDLEKGG  638

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             I VIQIDEAALREGLPLRK+EHA YL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIH
Sbjct  639   IGVIQIDEAALREGLPLRKSEHAHYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIH  698

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SII+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP T+EIADRINKM
Sbjct  699   SIINMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPPTDEIADRINKM  758

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             LAVL+ N+LWVNPDCGLKTRKYTEVKPAL NMV+AAK+IR +LAK
Sbjct  759   LAVLEKNVLWVNPDCGLKTRKYTEVKPALLNMVAAAKQIRNELAK  803



>gb|AAL73979.1|AF466201_8 methionine synthase protein [Sorghum bicolor]
Length=760

 Score =  1359 bits (3517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/762 (88%), Positives = 713/762 (94%), Gaps = 5/762 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLR+SIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRSSIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTK      HFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPERYSWTGGEIGLSTYFSMARGNATVPAMEMTKC-----HFI  115

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP  KF+YASHKAV+EYKEAKALG++TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  116   VPELGPSTKFTYASHKAVSEYKEAKALGIDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  175

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILPIYKEV++ELK AGASWIQFDEP LV DL++H+L AF+ AYAELES F GLNVL+
Sbjct  176   LGSILPIYKEVVAELKAAGASWIQFDEPTLVKDLDAHELAAFSSAYAELESAFSGLNVLI  235

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE++KTLT+L GVTA+GFDLIRG K++DLI+  FPSGKYLFAGVVDGRNIWA
Sbjct  236   ETYFADIPAESYKTLTSLSGVTAYGFDLIRGAKTLDLIRSSFPSGKYLFAGVVDGRNIWA  295

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             +DLA SLSTL+SLE + GKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  296   DDLAASLSTLQSLEAVAGKDKLVVSTSCSLMHTAVDLVNETKLDDEIKSWLAFAAQKVVE  355

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRAT VS+RL
Sbjct  356   VNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATTVSSRL  415

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPVLPTTTIGSFPQT ELRRVRREYKA KISEEEY+ AIKEEISKVVK+QEE
Sbjct  416   DAQQKKLNLPVLPTTTIGSFPQTPELRRVRREYKAKKISEEEYISAIKEEISKVVKIQEE  475

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTV
Sbjct  476   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTV  535

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE A I 
Sbjct  536   FWSKTAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAAGIQ  595

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  596   VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  655

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP+TEEIADR+NKMLA
Sbjct  656   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPTTEEIADRVNKMLA  715

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VLDTNILWVNPDCGLKTRKYTEVKPAL NMVSA K IRTQLA
Sbjct  716   VLDTNILWVNPDCGLKTRKYTEVKPALTNMVSATKLIRTQLA  757



>ref|XP_003550102.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Glycine max]
Length=765

 Score =  1358 bits (3516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/762 (87%), Positives = 703/762 (92%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSA+DL+KV+ DLRASIWKQM DAGIK+IP+N
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W   EIGFDT+FSMARGNASVP MEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALGV+TVPVL+GPVSYL+LSKPAKGV+KSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L IY+EV+++LK AGASWIQFDEP LV+DL S  L+A T AYAELES   GLNVL+
Sbjct  181   LPKVLAIYREVVADLKQAGASWIQFDEPILVLDLGSQTLQALTAAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIP EA++TLTAL GV AFGFDL+RGTK++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPVEAYQTLTALNGVAAFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             N+L  SL TL SLE IVGKDKLVVSTSCS LHTAVDLVNETKLDNEIKSWLAFAAQK+VE
Sbjct  301   NNLTASLDTLNSLEGIVGKDKLVVSTSCSFLHTAVDLVNETKLDNEIKSWLAFAAQKIVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+NA A+ASRK SPRVTNE+VQKAAAALKGSDHRRATNVS RL
Sbjct  361   VNALAKALSGQKDEAFFSSNADAEASRKFSPRVTNEAVQKAAAALKGSDHRRATNVSTRL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKANKISEEEYV +IKEEI KVV+LQE 
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKANKISEEEYVSSIKEEIRKVVELQEN  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRND PR ET YQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDHPRSETTYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E A YL+W VH+FRITN GVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEQANYLDWVVHAFRITNVGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP T+EIADRINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTDEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKY EV PAL NMV+A K IR +L+
Sbjct  721   VLEKNILWVNPDCGLKTRKYPEVNPALTNMVAATKLIRNKLS  762



>gb|AIE47233.1| vitamin B-12-independent methionine synthase [Pisum sativum]
Length=763

 Score =  1357 bits (3511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/763 (87%), Positives = 708/763 (93%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KVSADLRASIWKQM+DAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLKKVSADLRASIWKQMSDAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLD TA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDATATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV F Y+SHKAV EYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEK+F LLSL
Sbjct  121   VPELGPDVNFVYSSHKAVEEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L IYKEVI++LK AGA +IQFDEP LV+DLESH+L+AFT AYAEL     GL+VLV
Sbjct  181   LPKVLAIYKEVIADLKAAGAQFIQFDEPTLVLDLESHKLQAFTDAYAELTPALSGLHVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTLT+L GV A+GFDL+RG K+IDLIK GFPS K +FAGVVDGRNIWA
Sbjct  241   ETYFADVTAEAYKTLTSLSGVNAYGFDLVRGAKTIDLIKAGFPSDKLIFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL +L  IVGK+++VVSTS SLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLADSLKTLDTLAAIVGKERVVVSTSSSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA A  G KDEAFFSANAAAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALANAFSGNKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEY+KAIKEEI +VV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYIKAIKEEIRQVVQLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ  TKRPMKGMLTGPVTILNWSFVR DQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSALAQSFTKRPMKGMLTGPVTILNWSFVRVDQPRSETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EHA YL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSEHAHYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEEIADRINKMLA
Sbjct  661   INMDADVITIENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPPTEEIADRINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ NILWVNPDCGLKTRKY+EVKPAL N+V+AAK+IR +LAK
Sbjct  721   VLEKNILWVNPDCGLKTRKYSEVKPALTNLVAAAKQIRNELAK  763



>ref|XP_010677810.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase [Beta vulgaris subsp. 
vulgaris]
Length=794

 Score =  1356 bits (3510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/744 (90%), Positives = 702/744 (94%), Gaps = 0/744 (0%)
 Frame = +2

Query  128   HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFS  307
             HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVSADLR+SIWKQM+DAGIK+IPSNTF+
Sbjct  13    HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  308   YYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPE  487
             YYD VLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+IVPE
Sbjct  73    YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  488   LGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDK  667
             LGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSLL K
Sbjct  133   LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFNLLSLLPK  192

Query  668   ILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETY  847
             IL IYKEV++ELK AGAS IQFDEP LVMDL+SH+L+AFT AYAELES   GLNV+VETY
Sbjct  193   ILAIYKEVVTELKAAGASCIQFDEPLLVMDLDSHKLQAFTDAYAELESTLSGLNVIVETY  252

Query  848   FADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDL  1027
             FAD+  EA+KTL +LKGVT FGFDLIRGT+S++LIKGGFPS KYLFAGVVDGRNIWANDL
Sbjct  253   FADVTPEAYKTLISLKGVTGFGFDLIRGTQSLELIKGGFPSDKYLFAGVVDGRNIWANDL  312

Query  1028  AGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNA  1207
             A SL+ L+SL+ +VGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVEVNA
Sbjct  313   AASLALLQSLQGLVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNA  372

Query  1208  LAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQ  1387
             LAKAL GQKDEAFFSANAAAQASRKSSPRV NE+VQKAAA LKGSDHRRATNVSARLDAQ
Sbjct  373   LAKALSGQKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAGLKGSDHRRATNVSARLDAQ  432

Query  1388  QKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDI  1567
             QKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEELDI
Sbjct  433   QKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEELDI  492

Query  1568  DVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  1747
             DVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTVFWS
Sbjct  493   DVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWS  552

Query  1748  SAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQ  1927
             SAAQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA INVIQ
Sbjct  553   SAAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQ  612

Query  1928  IDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDM  2107
             IDEAALREGLPLRK+EH FYL WAVHSFRITN GVQ+T QIHTHMCYSNFNDIIHSIIDM
Sbjct  613   IDEAALREGLPLRKSEHGFYLKWAVHSFRITNVGVQDTCQIHTHMCYSNFNDIIHSIIDM  672

Query  2108  DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLD  2287
             DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEIADRI KMLAVL+
Sbjct  673   DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRIRKMLAVLE  732

Query  2288  TNILWVNPDCGLKTRKYTEVKPAL  2359
             +N+LWVNPDCGLKTRKY EV+P L
Sbjct  733   SNVLWVNPDCGLKTRKYGEVQPXL  756



>ref|XP_006371184.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48981.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=738

 Score =  1355 bits (3508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/762 (87%), Positives = 697/762 (91%), Gaps = 27/762 (4%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLQAFTGAYSALESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+LKGVTAFGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEQYKTLTSLKGVTAFGFDLVRGTKTLDLIKGDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S STL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASFSTLETLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE  FSANAAA ASRKSSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEEIFSANAAALASRKSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE++YVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEDDYVKAIKEEIRKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIKDE          
Sbjct  541   FWSTLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKDE----------  590

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
                              +E AFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDII SI
Sbjct  591   -----------------SEQAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIQSI  633

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  634   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  693

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEVKPAL+NMV AAK +RTQLA
Sbjct  694   VLETNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLLRTQLA  735



>gb|EMT31101.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Aegilops tauschii]
Length=766

 Score =  1355 bits (3508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/763 (88%), Positives = 715/763 (94%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFS+ARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSIARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL +H+L AF+ AYA LES   GLNVL+
Sbjct  181   LDSILPIYKEVVTELKAAGASWIQFDEPTLVKDLAAHELAAFSSAYAALESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAE++KTLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADVPAESYKTLTSLSGVTAYGFDLVRGTKTLELIKSAGIPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNAL KAL G KDEA+F+ANAAAQASR+SSPRV NE VQKAAAALKGSDHRRAT VSAR
Sbjct  361   EVNALGKALAGLKDEAYFAANAAAQASRRSSPRVNNEEVQKAAAALKGSDHRRATPVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISEEEYV AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISEEEYVSAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKMAQDMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             II+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIADR+NKML
Sbjct  661   IINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIADRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  721   AVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  763



>gb|KEH25580.1| cobalamin-independent methionine synthase [Medicago truncatula]
Length=765

 Score =  1353 bits (3501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/762 (86%), Positives = 706/762 (93%), Gaps = 0/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KV+ADLRASIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLEKVAADLRASIWKQMSSAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VL+TTAM+GAVPPRY W GGEIGFDTYFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLNTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKF+YASHKAV EYKEAKALGV+T+PVLVGPVSYLLLSK A GV+ SF LL+L
Sbjct  121   VPELGPDVKFTYASHKAVNEYKEAKALGVDTIPVLVGPVSYLLLSKLANGVDPSFDLLTL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K++ +YKEV+++LK AGASWIQFDEP+LV+DLES +L AFT AY++L S   GLNVLV
Sbjct  181   LPKVIAVYKEVVADLKAAGASWIQFDEPSLVLDLESPKLNAFTAAYSDLASSLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+K LT L GVTAFGFDL+RG K++DLIKGGFPSGKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKILTGLAGVTAFGFDLVRGAKTVDLIKGGFPSGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TL  LE+IVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE
Sbjct  301   NDLTSSLITLNGLEEIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFS+N+AA ASRKSSPRVTNE VQKA AALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEAFFSSNSAALASRKSSPRVTNEGVQKATAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             +AQQKKLNLPVLPTTTIGSFPQT ELRRVRREYKA K+SEEEYVK++KEEI +VV+LQE+
Sbjct  421   EAQQKKLNLPVLPTTTIGSFPQTPELRRVRREYKATKVSEEEYVKSMKEEIRQVVELQEK  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+  A YL+WAVHSFRITN GVQ+TTQIHTHMCYS+FNDIIHSI
Sbjct  601   VIQIDEAALREGLPLRKSGQADYLDWAVHSFRITNVGVQDTTQIHTHMCYSHFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLL VFR+GVKYGAGIGPGVYDIHSPRIP TEEIA+RINKMLA
Sbjct  661   IDMDADVITIENSRSDEKLLRVFRDGVKYGAGIGPGVYDIHSPRIPPTEEIAERINKMLA  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ N+LWVNPDCGLKTRKYTEV PAL  MV A K+IR QLA
Sbjct  721   VLEKNVLWVNPDCGLKTRKYTEVNPALTAMVEATKRIRNQLA  762



>dbj|BAE07181.1| methionine synthase [Beta vulgaris]
Length=794

 Score =  1352 bits (3498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/744 (89%), Positives = 700/744 (94%), Gaps = 0/744 (0%)
 Frame = +2

Query  128   HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFS  307
             HIVGYPRMGPKRELKFALESFWDGKSSA+DL+KVSADLR+SIWKQM+DAGIK+IPSNTF+
Sbjct  13    HIVGYPRMGPKRELKFALESFWDGKSSADDLKKVSADLRSSIWKQMSDAGIKYIPSNTFA  72

Query  308   YYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPE  487
             YYD VLDTTAMLGAVPPRY W GGEI FD YFSMARGNA+VPAMEMTKWFDTNYH+IVPE
Sbjct  73    YYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNATVPAMEMTKWFDTNYHYIVPE  132

Query  488   LGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDK  667
             LGPDVKFSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSLL K
Sbjct  133   LGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFNLLSLLPK  192

Query  668   ILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETY  847
             IL IYKEV++ELK AGAS IQFDEP LVMDL+SH+L+AFT AYAELES   GLNV+VETY
Sbjct  193   ILAIYKEVVTELKAAGASCIQFDEPLLVMDLDSHKLQAFTDAYAELESTLSGLNVIVETY  252

Query  848   FADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDL  1027
             FAD+  EA+KTL +LKGVT FGFDLIRGT+S++LIKGGFPS KYLFAGVVDGRNIWANDL
Sbjct  253   FADVTPEAYKTLISLKGVTGFGFDLIRGTQSLELIKGGFPSDKYLFAGVVDGRNIWANDL  312

Query  1028  AGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNA  1207
             A SL+ L+SL+ +VGKDKLVVS SCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVEVNA
Sbjct  313   AASLALLQSLQGLVGKDKLVVSASCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNA  372

Query  1208  LAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQ  1387
             LAKAL GQKDEAFFSANAAAQASRKSSPRV NE+VQKAAA LKGSDHRRATNVSARLDAQ
Sbjct  373   LAKALSGQKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAGLKGSDHRRATNVSARLDAQ  432

Query  1388  QKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDI  1567
             QKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEELDI
Sbjct  433   QKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEELDI  492

Query  1568  DVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  1747
             DVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP PMTVFWS
Sbjct  493   DVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWS  552

Query  1748  SAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQ  1927
             SAAQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKA INVIQ
Sbjct  553   SAAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQ  612

Query  1928  IDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDM  2107
             IDEAALREGLPLRK+EH FYL WAVHSFRITN GVQ+T QIHTHMCYSNFNDIIHSIIDM
Sbjct  613   IDEAALREGLPLRKSEHGFYLKWAVHSFRITNVGVQDTCQIHTHMCYSNFNDIIHSIIDM  672

Query  2108  DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLD  2287
             DADVITIENSRSDEKLLSVFREGVKYGAGIGPG YDIHSPRIP TEEIADRI KMLAVL+
Sbjct  673   DADVITIENSRSDEKLLSVFREGVKYGAGIGPGFYDIHSPRIPPTEEIADRIRKMLAVLE  732

Query  2288  TNILWVNPDCGLKTRKYTEVKPAL  2359
             +N+LWVNPDCGLKTR+Y EV+P L
Sbjct  733   SNVLWVNPDCGLKTRRYGEVQPGL  756



>emb|CAN73135.1| hypothetical protein VITISV_018473 [Vitis vinifera]
Length=734

 Score =  1339 bits (3465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/762 (87%), Positives = 695/762 (91%), Gaps = 31/762 (4%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLRASIWKQMADAG K+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRASIWKQMADAGTKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEI FD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIEFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EY+EAKALGV+TVPV VGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVFVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIYKEV++ELK AGAS IQFDEP L                              
Sbjct  181   LDKILPIYKEVVAELKAAGASSIQFDEPTL------------------------------  210

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+P+EAFKTLT+LKGVT FGFDL+RGTK++DLIK GFP+GKYLFAGVVDGRNIWA
Sbjct  211   -TYFADVPSEAFKTLTSLKGVTGFGFDLVRGTKTLDLIKXGFPTGKYLFAGVVDGRNIWA  269

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L+ LE IVGKDKLVVSTSCSLLHTAVDL+NE KLD EIKSWLAFAAQK+VE
Sbjct  270   NDLAASLSVLQELESIVGKDKLVVSTSCSLLHTAVDLINEPKLDQEIKSWLAFAAQKIVE  329

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G K+EAFFS NA AQASRKSSPRVTNE+VQKAA+ALKGSDHRRAT+VSARL
Sbjct  330   VNALAKALAGHKEEAFFSDNAXAQASRKSSPRVTNEAVQKAASALKGSDHRRATDVSARL  389

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQ KL LPVLPTTTIGSFPQT++LRRVRREYKA KISEE+YVKAIKEEI+KVVKLQEE
Sbjct  390   DAQQXKLKLPVLPTTTIGSFPQTMDLRRVRREYKAKKISEEDYVKAIKEEINKVVKLQEE  449

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  450   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  509

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA I 
Sbjct  510   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIT  569

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+EH FYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  570   VIQIDEAALREGLPLRKSEHDFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  629

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA
Sbjct  630   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  689

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+TNILWVNPDCGLKTRKYTEV PAL+NMV+AAK +RT+LA
Sbjct  690   VLETNILWVNPDCGLKTRKYTEVMPALKNMVAAAKLLRTELA  731



>ref|XP_003624679.1| Methionine synthase [Medicago truncatula]
Length=753

 Score =  1331 bits (3445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/753 (86%), Positives = 702/753 (93%), Gaps = 0/753 (0%)
 Frame = +2

Query  149   MGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFSYYDHVLD  328
             MGPKRELKFALESFWD KSSAEDL+KVSADLRASIWKQM+D GIK+IPSNTF+YYDHVLD
Sbjct  1     MGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIPSNTFTYYDHVLD  60

Query  329   TTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKF  508
             TTA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFIVPELGP+V F
Sbjct  61    TTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPELGPEVNF  120

Query  509   SYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKE  688
              Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSLL K+L +YKE
Sbjct  121   VYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSLLPKVLAVYKE  180

Query  689   VISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAE  868
             VI++LK AGA +IQFDEP LV+DLE+H+L+AFT AYA L   F GL+VLVETYFADIPAE
Sbjct  181   VIADLKAAGAQFIQFDEPTLVLDLEAHKLQAFTDAYAALTPSFEGLHVLVETYFADIPAE  240

Query  869   AFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTL  1048
             A+KTLT+L GV A+GFDL+RGTK++DLIK GFPSGK++FAGVVDGRNIWANDL  SLSTL
Sbjct  241   AYKTLTSLSGVAAYGFDLVRGTKTLDLIKAGFPSGKWIFAGVVDGRNIWANDLEASLSTL  300

Query  1049  KSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCG  1228
             ++L  IVGK+++VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVEVNALA AL G
Sbjct  301   EALAGIVGKERIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALANALAG  360

Query  1229  QKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLP  1408
              KDEA FSA++AAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARLDAQQKKLNLP
Sbjct  361   NKDEAIFSASSAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLP  420

Query  1409  VLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGE  1588
             +LPTTTIGSFPQTVELRRVRRE+KA KISEEEY+KAIKEEI  VV+LQEELDIDVLVHGE
Sbjct  421   ILPTTTIGSFPQTVELRRVRREFKAKKISEEEYIKAIKEEIRSVVELQEELDIDVLVHGE  480

Query  1589  PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMT  1768
             PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTVFWS+ AQ  T
Sbjct  481   PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSALAQSFT  540

Query  1769  KRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALR  1948
             KRPMKGMLTGPVTILNWSFVR DQPR ETCYQIALAIKDEVEDLEK  I VIQIDEAALR
Sbjct  541   KRPMKGMLTGPVTILNWSFVRVDQPRSETCYQIALAIKDEVEDLEKGGIGVIQIDEAALR  600

Query  1949  EGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITI  2128
             EGLPLRK+EHA YL+WAVHSFRITN GVQ++TQIHTHMCYSNFNDIIHSII+MDADVITI
Sbjct  601   EGLPLRKSEHAHYLDWAVHSFRITNVGVQDSTQIHTHMCYSNFNDIIHSIINMDADVITI  660

Query  2129  ENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVN  2308
             ENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP T+EIADRINKMLAVL+ N+LWVN
Sbjct  661   ENSRSDEKLLSVFREGVVYGAGIGPGVYDIHSPRIPPTDEIADRINKMLAVLEKNVLWVN  720

Query  2309  PDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             PDCGLKTRKYTEVKPAL NMV+AAK+IR +LAK
Sbjct  721   PDCGLKTRKYTEVKPALLNMVAAAKQIRNELAK  753



>gb|ABR17712.1| unknown [Picea sitchensis]
Length=766

 Score =  1325 bits (3429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/763 (84%), Positives = 705/763 (92%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ V+  LRASIWKQM  AG+K IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY++AGGEIGFDTYFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61    TFSFYDQVLDTTAMLGAVPPRYSFAGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KF+Y+SHKAV EYKEAK LG++TVPV+VGPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVAKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYK+V+SEL+ AGA+++QFDEP+LVMDLE+HQLEAF+KAY+ L++   G+N+LV
Sbjct  181   LDAILPIYKQVVSELEAAGATFVQFDEPSLVMDLEAHQLEAFSKAYSYLDAASLGVNLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIP E +KT+T LKG++A GFD IRG+K++ LIK  GFP+ K LFAGVVDGRNIW
Sbjct  241   ETYFADIPVETYKTITGLKGISAIGFDFIRGSKTLGLIKEAGFPADKVLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLS L+SLE+IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK++
Sbjct  301   ANDLADSLSVLESLENIVGKDKLVVSTSCSLLHTAVDLVNETKLDSEIKSWLAFAAQKLI  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL GQKDEAFF+ANAAA ASR++SPRVTNE+VQKAAAALK SDHRR T V+ R
Sbjct  361   EVDALAKALAGQKDEAFFAANAAALASRRASPRVTNEAVQKAAAALKTSDHRRVTPVNVR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L+ QQKKLNLP+LPTTTIGSFPQTVELRRVRREYK NKISE+EYV +IKEEI+KVVKLQE
Sbjct  421   LEQQQKKLNLPILPTTTIGSFPQTVELRRVRREYKINKISEDEYVSSIKEEIAKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +LDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPP+IYGDVSRPKPMT
Sbjct  481   DLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPVIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETC QIALAIKDEVEDLE   I
Sbjct  541   VFWSKVAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETCMQIALAIKDEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHA+YL+WAVH FRITN GVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAYYLDWAVHGFRITNSGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI+KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRISKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV+AAK +R QLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYPEVVPALTNMVAAAKLLRAQLA  763



>pdb|1U1H|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1J|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U1U|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
 pdb|1U22|A Chain A, A. Thaliana Cobalamine Independent Methionine Synthase
Length=765

 Score =  1325 bits (3429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/761 (87%), Positives = 700/761 (92%), Gaps = 0/761 (0%)
 Frame = +2

Query  122   ASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNT  301
             ASHIVGYPR GPKRELKFALESFWDGKS+AEDLQKVSADLR+SIWKQ + AG KFIPSNT
Sbjct  2     ASHIVGYPRXGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQXSAAGTKFIPSNT  61

Query  302   FSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIV  481
             F++YD VLDTTA LGAVPPRY + GGEIG D YFS ARGNASVPA E TKWFDTNYH+IV
Sbjct  62    FAHYDQVLDTTAXLGAVPPRYGYTGGEIGLDVYFSXARGNASVPAXEXTKWFDTNYHYIV  121

Query  482   PELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLL  661
             PELGP+V FSYASHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSLL
Sbjct  122   PELGPEVNFSYASHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFELLSLL  181

Query  662   DKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVE  841
              KILPIYKEVI+ELK AGA+WIQ DEP LV DLE  +L+AFT AYAELES   GLNVLVE
Sbjct  182   PKILPIYKEVITELKAAGATWIQLDEPVLVXDLEGQKLQAFTGAYAELESTLSGLNVLVE  241

Query  842   TYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWAN  1021
             TYFADIPAEA+KTLT+LKGVTAFGFDL+RGTK++DL+K GFP GKYLFAGVVDGRNIWAN
Sbjct  242   TYFADIPAEAYKTLTSLKGVTAFGFDLVRGTKTLDLVKAGFPEGKYLFAGVVDGRNIWAN  301

Query  1022  DLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEV  1201
             D A SLSTL++LE IVGKDKLVVSTSCSLLHTAVDL+NETKLD+EIKSW AFAAQKVVEV
Sbjct  302   DFAASLSTLQALEGIVGKDKLVVSTSCSLLHTAVDLINETKLDDEIKSWXAFAAQKVVEV  361

Query  1202  NALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLD  1381
             NALAKAL GQKDEA FSANAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARLD
Sbjct  362   NALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARLD  421

Query  1382  AQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEEL  1561
             AQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA K+SEE+YVKAIKEEI KVV LQEEL
Sbjct  422   AQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEEL  481

Query  1562  DIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVF  1741
             DIDVLVHGEPERND VEYFGEQLSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPK  TVF
Sbjct  482   DIDVLVHGEPERNDXVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAXTVF  541

Query  1742  WSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINV  1921
             WS+ AQ  T RP KG LTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I V
Sbjct  542   WSAXAQSXTSRPXKGXLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIGV  601

Query  1922  IQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSII  2101
             IQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ++TQIHTH CYS+FNDIIHSII
Sbjct  602   IQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHXCYSHFNDIIHSII  661

Query  2102  DMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAV  2281
             D DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NK LAV
Sbjct  662   DXDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKXLAV  721

Query  2282  LDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             L+ NILWVNPDCGLKTRKYTEVKPAL+N V AAK IR+QLA
Sbjct  722   LEQNILWVNPDCGLKTRKYTEVKPALKNXVDAAKLIRSQLA  762



>emb|CDY50662.1| BnaC05g48040D [Brassica napus]
Length=753

 Score =  1325 bits (3428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/762 (86%), Positives = 692/762 (91%), Gaps = 28/762 (4%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSDIWKQMSSAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VK SY+SHKAV EYKE KALGVETVPVLVGPVSYLLLSK AKGV+KSF LLS+
Sbjct  121   VPELGPEVKLSYSSHKAVNEYKETKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSV  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+LPIYKEVI+ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLN   
Sbjct  181   LPKVLPIYKEVIAELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLN---  237

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
                                GVTAFGFDLIRGTK+IDLIK  FP GKYLFAGVVDGRNIWA
Sbjct  238   -------------------GVTAFGFDLIRGTKTIDLIKSSFPQGKYLFAGVVDGRNIWA  278

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  279   NDLAASLITLQSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  338

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQK+E+FFSANAAA +SR+SSPRVTNESVQKAAAALKGSDHRRAT V+ARL
Sbjct  339   VDALAKALAGQKNESFFSANAAALSSRRSSPRVTNESVQKAAAALKGSDHRRATEVNARL  398

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELR+VRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  399   DAQQKKLNLPILPTTTIGSFPQTVELRKVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  458

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  459   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  518

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  519   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  578

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLP      +FYL+WAVHSFRITNCGVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  579   VIQIDEAALREGLP------SFYLDWAVHSFRITNCGVQDSTQIHTHMCYSNFNDIIHSI  632

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPST+EIADRINKMLA
Sbjct  633   IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTDEIADRINKMLA  692

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             VL+ NILWVNPDCGLKTRKYTEVKPAL+NMV AAK IR+QLA
Sbjct  693   VLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLA  734



>ref|XP_011090233.1| PREDICTED: LOW QUALITY PROTEIN: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Sesamum indicum]
Length=811

 Score =  1323 bits (3424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/782 (83%), Positives = 705/782 (90%), Gaps = 4/782 (1%)
 Frame = +2

Query  83    EQLPLFP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQ  262
             + L  F  +   MASHIVGYPR+GPKRELKFALESFWDGKSSAE+LQKV+A LR SIWKQ
Sbjct  29    KSLVCFKFQIRSMASHIVGYPRVGPKRELKFALESFWDGKSSAEELQKVAAGLRVSIWKQ  88

Query  263   MADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAME  442
             MADAGIK+IPSNTFSYYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAME
Sbjct  89    MADAGIKYIPSNTFSYYDQVLDTTAMLGAVPSRYGWGGGEIGFDIYFSMARGNASVPAME  148

Query  443   MTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPA  622
             MTKWFDTNYH+IVPELGPDVKFSYASHKAV EYKEAKALG++TVPVL+GPVSYLLLSK A
Sbjct  149   MTKWFDTNYHYIVPELGPDVKFSYASHKAVQEYKEAKALGIDTVPVLIGPVSYLLLSKLA  208

Query  623   KGVE----KSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTK  790
             KGVE    +SF L + L  +    +EV++ELK AGASW+QFDEP LVMDL+SH+L AFT 
Sbjct  209   KGVECLQVRSFYLEAKLYSLTLPXREVVAELKAAGASWVQFDEPTLVMDLDSHKLSAFTH  268

Query  791   AYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPS  970
             AY ELES   GLNVL ETYFAD+P EA+  +T+LKGVTA GFDL+RG+K++DLIK GFPS
Sbjct  269   AYKELESSVSGLNVLTETYFADLPTEAYNIVTSLKGVTAVGFDLVRGSKTLDLIKNGFPS  328

Query  971   GKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLD  1150
             GKYLFAG+VDGRNIWANDL  SLSTL++LE +VGKDKLVVSTSCSLLHTAVDLVNETKLD
Sbjct  329   GKYLFAGIVDGRNIWANDLDASLSTLRTLEGVVGKDKLVVSTSCSLLHTAVDLVNETKLD  388

Query  1151  NEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAA  1330
              E+KSWLAFAAQK++EVNALAKAL G KDEAFFSANAAAQASRKSSPRV NE+VQKA AA
Sbjct  389   KELKSWLAFAAQKLLEVNALAKALAGLKDEAFFSANAAAQASRKSSPRVNNEAVQKATAA  448

Query  1331  LKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYV  1510
             +KGSDHRRAT+VS RL+AQ +KLNLP+LPTTTIGSFPQT+ LR+VRREYKA+KISEEEY 
Sbjct  449   VKGSDHRRATSVSTRLEAQHEKLNLPMLPTTTIGSFPQTLGLRKVRREYKASKISEEEYH  508

Query  1511  KAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVK  1690
             KAIKEEI +VVKLQEEL IDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVK
Sbjct  509   KAIKEEIQEVVKLQEELGIDVLVHGEPERNDMVEYFGEQLSGFAFTINGWVQSYGSRCVK  568

Query  1691  PPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIA  1870
             PPIIYGDVSRPK MTVFWS+ AQ MT  PMKGMLTGPVTILNWSFVRNDQPRFETCYQIA
Sbjct  569   PPIIYGDVSRPKAMTVFWSTLAQSMTNSPMKGMLTGPVTILNWSFVRNDQPRFETCYQIA  628

Query  1871  LAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQI  2050
             LAIKDEVEDLEK  INVIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNC VQ+TTQI
Sbjct  629   LAIKDEVEDLEKVGINVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCDVQDTTQI  688

Query  2051  HTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPR  2230
             HTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLS+F EGVKYGAGIGPGVYDIHSPR
Sbjct  689   HTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSIFHEGVKYGAGIGPGVYDIHSPR  748

Query  2231  IPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK*  2410
             IPSTEEIA+RINKML VLD+ ILWVNPDCGLKTRKY+EVKPAL NMV+AAK  R QLA  
Sbjct  749   IPSTEEIAERINKMLGVLDSKILWVNPDCGLKTRKYSEVKPALSNMVAAAKLARMQLAAT  808

Query  2411  GS  2416
             G+
Sbjct  809   GA  810



>gb|EYU35999.1| hypothetical protein MIMGU_mgv1a001741mg [Erythranthe guttata]
Length=766

 Score =  1318 bits (3412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/763 (84%), Positives = 699/763 (92%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+GPKRELKFALESFWDGKS+AE+L KV++DLR SIWKQMADAGIK+IPSN
Sbjct  1     MASHVVGYPRIGPKRELKFALESFWDGKSNAEELHKVASDLRVSIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W+GG+IGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPSRYGWSGGDIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELG + +FSYAS KAV EYKEA+ALG++TVPVLVGPVSYLLLSKPAKGV KSF LLSL
Sbjct  121   VPELGLETEFSYASRKAVQEYKEARALGIDTVPVLVGPVSYLLLSKPAKGVGKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LDKILPIY EV++ELK AGASWIQFDEP LVMDL+SH+L AFT AY ELES   GLNVL+
Sbjct  181   LDKILPIYMEVVAELKAAGASWIQFDEPTLVMDLDSHKLHAFTHAYKELESSVSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+ T+TALKGVTA GFDL+RG+ ++DLIK G+P GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADLPAEAYNTVTALKGVTAIGFDLVRGSNTLDLIKNGYPLGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SLSTL++LE +VGKDKLVVSTSCSLLHT VDLVNETKLD E+KSWLAFAAQK++E
Sbjct  301   NDLDASLSTLQALEGVVGKDKLVVSTSCSLLHTVVDLVNETKLDEELKSWLAFAAQKLLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VN LAKAL GQKDEAF+SANAAA ASR+SSPRVT+E VQ A AALKGSDHRRATNVSARL
Sbjct  361   VNGLAKALSGQKDEAFYSANAAAHASRRSSPRVTDEDVQIATAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             ++Q +KLNLP++PTTTIGSFPQT+ELR++RREYKA+KISEE+YVKAIKEEI+ VVKLQEE
Sbjct  421   ESQHEKLNLPIIPTTTIGSFPQTLELRKIRREYKASKISEEDYVKAIKEEIAAVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LGIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS  AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK+EVEDLEKA I 
Sbjct  541   FWSKLAQSMTQRPMKGMLTGPVTILNWSFVRNDQPRNETCYQIALAIKNEVEDLEKAGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVHSFRITN  VQ++TQIHTHMCYSNFNDII SI
Sbjct  601   VIQIDEAALREGLPLRKSEQQFYLDWAVHSFRITNSAVQDSTQIHTHMCYSNFNDIIDSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFRE-GVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             I+MDADVITIENSRS+EKLLSVFRE GVKY AG+GPGVYDIHSPRIPSTEEI DR+NKML
Sbjct  661   IEMDADVITIENSRSNEKLLSVFREGGVKYAAGMGPGVYDIHSPRIPSTEEIVDRVNKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
              VLD+  LWVNPDCGLKTRKY+EVKPAL NMV+AAK  R  LA
Sbjct  721   TVLDSKFLWVNPDCGLKTRKYSEVKPALSNMVAAAKLARNNLA  763



>gb|EPS74353.1| methionine synthase [Genlisea aurea]
Length=829

 Score =  1315 bits (3402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/760 (84%), Positives = 703/760 (93%), Gaps = 2/760 (0%)
 Frame = +2

Query  128   HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFS  307
             H+VGYPR+GPKRELKFALESFWDGKS+AE+L+KV+ADLRASIWKQM+DAGIK+IPSNTFS
Sbjct  60    HVVGYPRIGPKRELKFALESFWDGKSTAEELEKVAADLRASIWKQMSDAGIKYIPSNTFS  119

Query  308   YYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPE  487
             +YD VLDTTAMLGAVPPRY W GGEIGF TYFSMARGNAS PAMEMTKWFDTNYHFIVPE
Sbjct  120   FYDQVLDTTAMLGAVPPRYGWTGGEIGFGTYFSMARGNASAPAMEMTKWFDTNYHFIVPE  179

Query  488   LGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDK  667
             LGPDVKFSYASHKAV EY+EAKALGVETVPVL+GPV+YLLLSKPAKGVEK+F LLSLLDK
Sbjct  180   LGPDVKFSYASHKAVDEYQEAKALGVETVPVLIGPVTYLLLSKPAKGVEKNFSLLSLLDK  239

Query  668   ILPIYKEVISELKGAGA-SWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVET  844
             ILP+Y+EVISELK AGA SWIQFDEP LV+DL+S +LEAFT+AYA+LE    GL+VL+ET
Sbjct  240   ILPVYREVISELKSAGAASWIQFDEPALVLDLDSRELEAFTRAYADLEPSLSGLDVLIET  299

Query  845   YFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWAND  1024
             YFAD+P  A++ LT+L GV+ +GFDL+RG KSI+LI+ GFPSGKYLFAGVVDGRN+WAND
Sbjct  300   YFADVPEPAYQVLTSLSGVSGYGFDLVRGRKSIELIESGFPSGKYLFAGVVDGRNVWAND  359

Query  1025  LAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVN  1204
             L  SL+TL+SLE IVGKDKLVVSTS SLLHTAVDLVNE KLD EIKSWLAFA QK+VEVN
Sbjct  360   LDSSLATLQSLESIVGKDKLVVSTSSSLLHTAVDLVNEPKLDEEIKSWLAFALQKIVEVN  419

Query  1205  ALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDA  1384
             ALAKAL G KDEAFFSAN+ A+ASRKSSPRV NE+VQKAAAALKGSDHRRATNVS+RLDA
Sbjct  420   ALAKALSGDKDEAFFSANSEARASRKSSPRVNNEAVQKAAAALKGSDHRRATNVSSRLDA  479

Query  1385  QQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELD  1564
             Q+KKLNLPVLPTTTIGSFPQTVELRRVRREYKA+KISEEEYV  IKEEI K+V+LQE+LD
Sbjct  480   QRKKLNLPVLPTTTIGSFPQTVELRRVRREYKADKISEEEYVSCIKEEIRKIVRLQEDLD  539

Query  1565  IDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFW  1744
             IDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPI+YGDVSRP+ MTV W
Sbjct  540   IDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIVYGDVSRPELMTVSW  599

Query  1745  SSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVI  1924
             S+AAQG TKRP+KGMLTGPVTILNWSFVR+D+PR ETCYQI LAIKDEVEDLE+A I  I
Sbjct  600   SAAAQGYTKRPVKGMLTGPVTILNWSFVRDDRPRLETCYQITLAIKDEVEDLERAGIPAI  659

Query  1925  QIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIID  2104
             QIDEAALREGLPLR+ + AFYL+WAV +FR+TN  VQ+TTQIHTHMCYSNFNDII SI+D
Sbjct  660   QIDEAALREGLPLRREDRAFYLDWAVRAFRVTNSAVQDTTQIHTHMCYSNFNDIIGSIVD  719

Query  2105  MDADVITIENSRSDEKLLSVFRE-GVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAV  2281
             MDADVITIENSRSDEKLLSVFRE GVKYGAGIGPGVYD+HSPRIPS EEIADR++KML V
Sbjct  720   MDADVITIENSRSDEKLLSVFREGGVKYGAGIGPGVYDVHSPRIPSKEEIADRVDKMLGV  779

Query  2282  LDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
             L +NILWVNPDCGLKTRKY EVKPALENMV+AAK +R +L
Sbjct  780   LGSNILWVNPDCGLKTRKYEEVKPALENMVAAAKLLRARL  819



>gb|ADE75603.1| unknown [Picea sitchensis]
Length=766

 Score =  1313 bits (3398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/763 (83%), Positives = 701/763 (92%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA DL+ V+  LRASIWKQM  AG+K IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSAADLEAVAKGLRASIWKQMVAAGVKLIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS+YD VLDTTAMLGAVPPRY++ GGEIGFDTYFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  61    TFSFYDQVLDTTAMLGAVPPRYSFVGGEIGFDTYFSMARGNATLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KF+Y+SHKAV EYKEAK LG++TVPV+VGPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPEIKFAYSSHKAVAEYKEAKELGIDTVPVIVGPVSYLLLSKPAKGVAKTFNLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYK+V+SEL+ AGA+++QFDEP+LVMDLE+HQLEAF+KAY+ L++   G+N+LV
Sbjct  181   LDAILPIYKQVVSELEAAGATFVQFDEPSLVMDLEAHQLEAFSKAYSYLDAASLGVNLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIP E +KT+T LKG++A GFD IRG+K++ LIK  GFP+ K LFAGVVDGRNIW
Sbjct  241   ETYFADIPVETYKTITGLKGISAIGFDFIRGSKTLGLIKEAGFPADKVLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SLS L+SLE+IVGKDKLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK++
Sbjct  301   ANDLADSLSVLESLENIVGKDKLVVSTSCSLLHTAVDLVNETKLDSEIKSWLAFAAQKLI  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ALAKAL  QKDEAFF+ANAAA ASR++SPRVTNE+VQKAAAALK SDHRR T V+ R
Sbjct  361   EVDALAKALADQKDEAFFAANAAALASRRASPRVTNEAVQKAAAALKTSDHRRVTPVNVR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L+ QQKKLNLP+LPTTTIGSFPQTVELR VRREYK NKISE+EYV +IKEEI+KVVKLQE
Sbjct  421   LEQQQKKLNLPILPTTTIGSFPQTVELRWVRREYKINKISEDEYVSSIKEEIAKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +LDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPP+IYGDVSRPKPMT
Sbjct  481   DLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPVIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETC QIALAIKDEVEDLE   I
Sbjct  541   VFWSKVAQSMTARPMKGMLTGPVTILNWSFVRNDQPRSETCMQIALAIKDEVEDLEAGGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAEHA+YL+WAVH FR TN GVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEHAYYLDWAVHGFRTTNSGVQDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI+KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRISKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV+AAK +R QLA
Sbjct  721   AVLETNILWVNPDCGLKTRKYPEVVPALTNMVAAAKLLRAQLA  763



>ref|XP_006400670.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
 gb|ESQ42123.1| hypothetical protein EUTSA_v10012712mg [Eutrema salsugineum]
Length=812

 Score =  1309 bits (3388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/763 (82%), Positives = 690/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+ AE+LQ V+A+LR SIWK MADAGIK+IPSN
Sbjct  49    MSSHIVGYPRIGPKRELKFALESFWDGKTGAEELQNVAANLRNSIWKHMADAGIKYIPSN  108

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  109   TFSYYDQMLDTTAMLGAVPPRYGWESGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHYI  168

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  169   VPELGPDVKFSYASHKAVDEFKEAKALGIDTVPVLIGPITYLLLSKPAKGVEKSFSLLSL  228

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  229   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFYDAYSHMESSLAGLNVLI  288

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+ TLT+LK VT FGFDL+RG ++IDLIK  FP GK LFAGVVDGRNIWA
Sbjct  289   ATYFADVPAEAYNTLTSLKCVTGFGFDLVRGLETIDLIKVNFPRGKLLFAGVVDGRNIWA  348

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ S+ TL++LEDIVGK+KLVVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  349   NDLSASIKTLQTLEDIVGKEKLVVSTSCSLLHTAVDLVNEVKLDKELKSWLAFAAQKVVE  408

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKA  G KDEA F++N+  QASR+SSPRVTN +VQ+  AALK SDHRR+T VS RL
Sbjct  409   VNALAKAFSGAKDEALFASNSMRQASRRSSPRVTNAAVQQDVAALKKSDHRRSTEVSVRL  468

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE KA KISE EYV+AIKEE  KVVKLQEE
Sbjct  469   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRRECKAKKISEVEYVQAIKEEFEKVVKLQEE  528

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  529   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVTRPKAMTV  588

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA I 
Sbjct  589   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGIT  648

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR++E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  649   VIQIDEAALREGLPLRRSEQNFYLDWAVHAFRITNCNVQDTTQIHTHMCYSNFNDIIHSI  708

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS EEIA+RINKMLA
Sbjct  709   INMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSAEEIAERINKMLA  768

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK IR QL K
Sbjct  769   VLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLIRAQLNK  811



>ref|XP_010541663.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Tarenaya hassleriana]
Length=859

 Score =  1307 bits (3383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/764 (82%), Positives = 698/764 (91%), Gaps = 1/764 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGKSSA++LQKV+ADLRASIWKQMA+AGIK+IPSN
Sbjct  95    MSSHIVGYPRIGPKRELKFALESFWDGKSSADELQKVAADLRASIWKQMAEAGIKYIPSN  154

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGE+GFD YFSMARGNAS PAMEMTKWFDTNYH+I
Sbjct  155   TFSYYDQVLDTTAMLGAVPPRYDWEGGEVGFDIYFSMARGNASAPAMEMTKWFDTNYHYI  214

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV+E+ EAKALG++T+PVL+GPV+YLLLSKPAKGVEKSF LLSL
Sbjct  215   VPELGPDVKFSYASHKAVSEFMEAKALGIDTIPVLLGPVTYLLLSKPAKGVEKSFSLLSL  274

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             ++KILP+Y+EV+++LK AGA WIQFDEP LVMDL+++QL+AF+ AY+++ES   GLNVLV
Sbjct  275   INKILPVYQEVLAKLKSAGARWIQFDEPALVMDLDTNQLQAFSDAYSQMESSLAGLNVLV  334

Query  839   ETYFADIPA-EAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIW  1015
              TYFAD+P+ EA+K LT+LK VT  GFDL+RGTK++DLIK  FP G+ LFAGVVDGRN+W
Sbjct  335   ATYFADVPSPEAYKMLTSLKCVTGSGFDLVRGTKTLDLIKENFPPGRLLFAGVVDGRNVW  394

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDL+ SL TL++LE I+G++K+VVSTSCSLLHTAVDL NET+LD E+KSWLAFAAQKVV
Sbjct  395   ANDLSASLKTLQTLEGIIGEEKVVVSTSCSLLHTAVDLANETRLDRELKSWLAFAAQKVV  454

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL G KDE  FS N+ AQASR+SSPRVTN SVQ+AAAALK +DHRRAT VSAR
Sbjct  455   EVNALAKALSGLKDEGLFSVNSMAQASRRSSPRVTNASVQQAAAALKRNDHRRATEVSAR  514

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L AQQKKLN P LPTTTIGSFPQT ++RR+R++YK  KISE +YV+AIKE I KVVKLQE
Sbjct  515   LQAQQKKLNFPALPTTTIGSFPQTPDVRRIRKDYKTKKISEIDYVQAIKENIQKVVKLQE  574

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             EL IDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDV+RPK MT
Sbjct  575   ELGIDVLVHGEPERNDMVEYFGEQLSGFAFTLNGWVQSYGSRCVKPPIIYGDVTRPKAMT  634

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIA+AIKDEV DLEKA I
Sbjct  635   VFWSSMAQKMTKRPMKGMLTGPVTILNWSFVRNDQPRNETCYQIAMAIKDEVRDLEKAGI  694

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHS
Sbjct  695   TVIQIDEAALREGLPLRKSEQDFYLDWAVHAFRITNCDVQDTTQIHTHMCYSNFNDIIHS  754

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPSTEEIADRI KML
Sbjct  755   IIDMDADVITIENSRSDEKLLSVFHEGVKYDAGIGPGVYDIHSPRIPSTEEIADRIKKML  814

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
              VL +N+LWVNPDCGLKTRKY+EVKPAL NMV+AAK IR+QL K
Sbjct  815   EVLASNVLWVNPDCGLKTRKYSEVKPALSNMVAAAKLIRSQLDK  858



>ref|XP_009346240.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Pyrus x bretschneideri]
Length=808

 Score =  1306 bits (3379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/765 (82%), Positives = 703/765 (92%), Gaps = 0/765 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             T  +ASHIVG PR+GPKRELKFALESFWDGKSSAE+LQK +A LR+SIWKQ+ADAGI++I
Sbjct  38    TRAVASHIVGLPRIGPKRELKFALESFWDGKSSAEELQKAAAGLRSSIWKQLADAGIQYI  97

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD +LDTTAMLGAVPPRY W   EIGF+TYFSMARGN +VPAMEMTKWFDTNY
Sbjct  98    PSNTFSYYDQMLDTTAMLGAVPPRYGWKHSEIGFETYFSMARGNVNVPAMEMTKWFDTNY  157

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGP ++FSYASHKAV E+KEAKALGV+T+PVL+GPVSYLLLSKPA+G+E+SFP 
Sbjct  158   HYIVPELGPHIRFSYASHKAVDEFKEAKALGVDTIPVLIGPVSYLLLSKPARGIEQSFPP  217

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSLL  ILP+YKEV++ELK AGA+W+QFDEP LV+DL+++QLEAFT  Y+ELES F GLN
Sbjct  218   LSLLRYILPVYKEVMAELKAAGATWVQFDEPALVLDLDANQLEAFTHTYSELESSFSGLN  277

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYF+D+ AEA+KT+T+LKGVT +GFDL+RG K +DLIKGGFP GK+LFAGVVDGRN
Sbjct  278   VLIETYFSDVTAEAYKTITSLKGVTGYGFDLVRGAKILDLIKGGFPIGKHLFAGVVDGRN  337

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWANDLA S++ L++LE IVGKDK+VVSTSCSLLHTAVDL NET LD +IK WLAFAAQK
Sbjct  338   IWANDLASSVNILQALESIVGKDKIVVSTSCSLLHTAVDLENETNLDKDIKPWLAFAAQK  397

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             V+EVNALAKAL GQKDEAFF+ANAAAQASRKSSPRVTNE+VQKA AALKGSDHRR TNVS
Sbjct  398   VIEVNALAKALSGQKDEAFFTANAAAQASRKSSPRVTNEAVQKAVAALKGSDHRRPTNVS  457

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
              RLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYK  KISEE+YVKA+KEEI+KVVKL
Sbjct  458   TRLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKDKKISEEDYVKAMKEEINKVVKL  517

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSRP P
Sbjct  518   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSRPDP  577

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQGMTKRPMKGMLTGPVT++NWSFVRNDQPRFETCYQIALA+KDEVEDLEKA
Sbjct  578   MTVFWSSLAQGMTKRPMKGMLTGPVTLMNWSFVRNDQPRFETCYQIALAMKDEVEDLEKA  637

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I VIQIDE ALREGLPLRKAE + YL+WAVHSFRITNC VQ+TTQIHTHMCYSNFNDII
Sbjct  638   GITVIQIDEPALREGLPLRKAEQSLYLDWAVHSFRITNCSVQDTTQIHTHMCYSNFNDII  697

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENS+SDE+LLSV  EG+K+G+GIGPGVYD+HSPRIPS  E++ +I  
Sbjct  698   HSIIDMDADVITIENSKSDERLLSVLPEGLKFGSGIGPGVYDVHSPRIPSDMELSVKIEN  757

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             ++ VL+ NI+WVNPDCGLKTRKY+EV+PAL NMV+AAK  R  LA
Sbjct  758   IVKVLEKNIIWVNPDCGLKTRKYSEVQPALNNMVTAAKYNRKMLA  802



>ref|XP_007207630.1| hypothetical protein PRUPE_ppa021650mg [Prunus persica]
 gb|EMJ08829.1| hypothetical protein PRUPE_ppa021650mg [Prunus persica]
Length=765

 Score =  1299 bits (3362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/763 (82%), Positives = 698/763 (91%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVG PR+GPKRELKFALESFWDGKSSAE+LQ V+A LR+ IWKQ+ADAGIK+IPSN
Sbjct  1     MASHIVGLPRIGPKRELKFALESFWDGKSSAEELQNVAAGLRSCIWKQLADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W  GE+G +TYFSMARGNA V AMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGWKSGEVGLETYFSMARGNAHVRAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP ++FSYASHKAV E+KEAKALG++TVPVL+GPVSYLLLSKPA+G E+SFP LSL
Sbjct  121   VPELGPHIRFSYASHKAVDEFKEAKALGLDTVPVLIGPVSYLLLSKPARGTEQSFPPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEV++ELK AGA+WIQFDEP LV DL+++QL AF  AY+ELES   GLNVL+
Sbjct  181   LRYILPVYKEVVAELKAAGATWIQFDEPTLVWDLDANQLHAFAHAYSELESSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+ AEA+KTLT+LKGVT +GFDLIRG K++DLI  GFPSGK+LFAGVVDGRNIWA
Sbjct  241   ETYFADVTAEAYKTLTSLKGVTGYGFDLIRGEKTLDLINDGFPSGKHLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL++LE IVGKDK+VVSTSCSLLHTAVD+VNET+LD E+KSWLAFAAQKVVE
Sbjct  301   NDLASSLRTLQALEGIVGKDKIVVSTSCSLLHTAVDIVNETELDKEVKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G KDEAFFS NAAAQASRKSSP+VTNE+VQKAAAALKGSD RRATNV+ARL
Sbjct  361   VNALAKALSGHKDEAFFSINAAAQASRKSSPKVTNEAVQKAAAALKGSDLRRATNVTARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+++RRVRRE+K  KISEE+YV A+KEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIDVRRVRREFKDKKISEEDYVNAMKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQGMTKRP+KGMLTGPVTILNWSFVRNDQPRF+TCYQIALAIKDEVEDLEKA I 
Sbjct  541   FWSSLAQGMTKRPIKGMLTGPVTILNWSFVRNDQPRFKTCYQIALAIKDEVEDLEKAGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDE ALREGLPLRKAE A YL WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  601   VIQIDEPALREGLPLRKAEQALYLGWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENS+SDEKLLSV  EG+K+G+GIGPGVYD+HSPRIPS  E+  +I  ++ 
Sbjct  661   IDMDADVITIENSKSDEKLLSVLPEGLKFGSGIGPGVYDVHSPRIPSDTELCVKIKNIIK  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VL+ N++WVNPDCGLKTRKY+EV+PAL NMV+AAK  R  L +
Sbjct  721   VLENNMVWVNPDCGLKTRKYSEVQPALSNMVAAAKYNRQMLRR  763



>gb|KFK26314.1| hypothetical protein AALP_AA8G231500 [Arabis alpina]
Length=837

 Score =  1299 bits (3361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/763 (81%), Positives = 689/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S E+LQ V+A+LR SIWK M+DAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVEELQNVAANLRKSIWKHMSDAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNA+VPAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDNYFSMARGNATVPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVKFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+ +LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLDDLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTLT+LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKTLTSLKCVTGFGFDLVRGLETLDLIKLNFPRGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SL TL++LE+IVGKDK+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLFSSLKTLQTLEEIVGKDKVVVSTSCSLLHTAVDLVNEMKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDE  F++N+  QASR+SSPRVTN +VQ+  A +K SDHRR+T VS RL
Sbjct  408   VNALAKSFSGVKDETLFASNSVRQASRRSSPRVTNPAVQQNVAEVKKSDHRRSTEVSVRL  467

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KI E EYV+AIKEEI KVVKLQEE
Sbjct  468   QAQQKKLNLPTLPTTTIGSFPQTADLRRIRREFKAKKILEIEYVQAIKEEIEKVVKLQEE  527

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  528   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  587

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVE+LE+A + 
Sbjct  588   FWSSMAQKMTHRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEELERAGVA  647

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  648   VIQIDEAALREGLPLRKSEQEFYLDWAVHAFRITNCSVQDTTQIHTHMCYSNFNDIIHSI  707

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS EEIADRINKMLA
Sbjct  708   INMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSAEEIADRINKMLA  767

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK IR+QL K
Sbjct  768   VLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLIRSQLNK  810



>ref|XP_008230954.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Prunus mume]
Length=804

 Score =  1296 bits (3354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/766 (81%), Positives = 697/766 (91%), Gaps = 0/766 (0%)
 Frame = +2

Query  110   TEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFI  289
             T  MASHIVG PR+GPKRELKFALESFWDGKSSAE+LQ V+A LR+ IWKQ+ADAGIK+I
Sbjct  37    TRAMASHIVGLPRIGPKRELKFALESFWDGKSSAEELQNVAAGLRSCIWKQLADAGIKYI  96

Query  290   PSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNY  469
             PSNTFSYYD +LDTTAMLGAVPPRY W   E+G +TYFSMARGNA VPAMEMTKWFDTNY
Sbjct  97    PSNTFSYYDQMLDTTAMLGAVPPRYGWKSSEVGLETYFSMARGNAHVPAMEMTKWFDTNY  156

Query  470   HFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPL  649
             H+IVPELGP ++FSYASHKAV E+KEAKALG++TVPVL+GPVSYLLLSKPA+G E+SFP 
Sbjct  157   HYIVPELGPHIRFSYASHKAVDEFKEAKALGLDTVPVLIGPVSYLLLSKPARGTEQSFPP  216

Query  650   LSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLN  829
             LSLL  ILP+YKEV++ELK AGA+WIQFDEP LV DL+++QL+AF  AY+ELES   GLN
Sbjct  217   LSLLRYILPVYKEVVAELKAAGATWIQFDEPTLVWDLDANQLQAFAHAYSELESSLSGLN  276

Query  830   VLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRN  1009
             VL+ETYFAD+ AEA+KTLT+LKGVT +GFDLIRG K++DLI  GFPSGK+LFAGVVDGRN
Sbjct  277   VLIETYFADVTAEAYKTLTSLKGVTGYGFDLIRGEKTLDLINDGFPSGKHLFAGVVDGRN  336

Query  1010  IWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQK  1189
             IWANDLA SL TL++LE IVGKDK+VVSTSCSLLHTAVD+VNET+LD E+KSWLAF AQK
Sbjct  337   IWANDLASSLRTLQALEGIVGKDKIVVSTSCSLLHTAVDIVNETELDKEVKSWLAFGAQK  396

Query  1190  VVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVS  1369
             VVEVNALA AL G KDEAFFS NAAAQASRKSSP VTNE+VQKAAAALKGSD RRATNV+
Sbjct  397   VVEVNALANALSGHKDEAFFSTNAAAQASRKSSPNVTNEAVQKAAAALKGSDLRRATNVT  456

Query  1370  ARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKL  1549
             ARLDAQQKKLNLP+LPTTTIGSFPQT+++RRVRRE+K  KISEE+YV A++EEI+KVVKL
Sbjct  457   ARLDAQQKKLNLPILPTTTIGSFPQTIDVRRVRREFKDKKISEEDYVNAMEEEINKVVKL  516

Query  1550  QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKP  1729
             QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSRPKP
Sbjct  517   QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSRPKP  576

Query  1730  MTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA  1909
             MTVFWSS AQGMTKRP+KGMLTGPVTILNWSFVRNDQPRF+TCYQIALAIKDEVEDLEKA
Sbjct  577   MTVFWSSLAQGMTKRPIKGMLTGPVTILNWSFVRNDQPRFKTCYQIALAIKDEVEDLEKA  636

Query  1910  NINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDII  2089
              I +IQIDE ALREGLPLRKAE A YL WAVHSFRITNCGV++TTQIHTHMCYSNFNDII
Sbjct  637   GITIIQIDEPALREGLPLRKAEQALYLGWAVHSFRITNCGVRDTTQIHTHMCYSNFNDII  696

Query  2090  HSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINK  2269
             HSIIDMDADVITIENS+SDEKLLSV  EG+K+G+GIGPGVYD+HSPRIPS  E+  +I  
Sbjct  697   HSIIDMDADVITIENSKSDEKLLSVLPEGLKFGSGIGPGVYDVHSPRIPSDTELCVKIKN  756

Query  2270  MLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             ++ VL+ N++WVNPDCGLKTRKY+EV+PAL NMV+AAK  R  L +
Sbjct  757   IIKVLENNMVWVNPDCGLKTRKYSEVQPALSNMVAAAKYNRQMLRR  802



>emb|CDX88830.1| BnaA03g08190D [Brassica napus]
Length=815

 Score =  1295 bits (3350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/763 (81%), Positives = 692/763 (91%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK++A+DLQ V+A+LR SIWK MADAGIK+IPSN
Sbjct  52    MSSHIVGYPRIGPKRELKFALESFWDGKTAADDLQTVAANLRNSIWKHMADAGIKYIPSN  111

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W  GEIGFD YFSMARGN SVPAMEMTKWFDTNYH+I
Sbjct  112   TFSYYDQMLDTTAMLGAVPPRYGWKSGEIGFDVYFSMARGNESVPAMEMTKWFDTNYHYI  171

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGV+KSF LLSL
Sbjct  172   VPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVDKSFCLLSL  231

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEV  +LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   GLNVL+
Sbjct  232   IDKILPIYKEVFDDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLAGLNVLI  291

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTLT+LK VT FGFD +RG +++DLIKGGFP GK LFAGVVDGRNIWA
Sbjct  292   ATYFADVPAEAYKTLTSLKCVTGFGFDFVRGLETLDLIKGGFPRGKLLFAGVVDGRNIWA  351

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL+SLE+IVGKDK+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  352   NDLSASLKTLQSLEEIVGKDKVVVSTSCSLLHTAVDLVNEVKLDKELKSWLAFAAQKVVE  411

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ+  AA+K SDHRR+T VSARL
Sbjct  412   VNALAKSFSGVKDEALFSSNSMGQASRRSSPRVTNAAVQQDVAAVKKSDHRRSTEVSARL  471

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
               QQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KIS+ +YV+AIK E  KV+KLQEE
Sbjct  472   QTQQKKLNLPALPTTTIGSFPQTADLRRIRREFKAKKISDIDYVQAIKVEFEKVIKLQEE  531

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  532   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  591

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+ PMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA I 
Sbjct  592   FWSSMAQKMTQHPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGIT  651

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR++E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  652   VIQIDEAALREGLPLRRSEQEFYLDWAVHAFRITNCDVQDTTQIHTHMCYSNFNDIIHSI  711

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVF+EGVKY AGIGPGVYDIHSPRIPS EEIA+RINKMLA
Sbjct  712   INMDADVITIENSRSDEKLLSVFQEGVKYCAGIGPGVYDIHSPRIPSAEEIAERINKMLA  771

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK +R++L K
Sbjct  772   VLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLVRSELIK  814



>ref|XP_010454417.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X3 [Camelina sativa]
Length=811

 Score =  1294 bits (3348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/763 (81%), Positives = 686/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++T PVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFCDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKALMSLKCVTGFGFDLVRGLETLDLIKENFPPGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN SVQ+  AA+K SDHRR+T VS RL
Sbjct  408   VNALAKSFSGVKDEALFSSNSMRQASRRSSPRVTNVSVQQDVAAVKESDHRRSTEVSVRL  467

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQEE
Sbjct  468   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQTIKEEYEKVVKLQEE  527

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  528   LGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  587

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA + 
Sbjct  588   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGVT  647

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  648   VIQIDEAALREGLPLRNSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  707

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPS EEIA+RI KMLA
Sbjct  708   IDMDADVITIENSRSDEKLLSVFHEGVKYSAGIGPGVYDIHSPRIPSAEEIAERIKKMLA  767

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR YTEVK AL NMV+AAK IR+QL K
Sbjct  768   VLDSKVLWVNPDCGLKTRNYTEVKAALSNMVAAAKLIRSQLNK  810



>ref|XP_008775707.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Phoenix dactylifera]
Length=819

 Score =  1294 bits (3348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/767 (82%), Positives = 698/767 (91%), Gaps = 1/767 (0%)
 Frame = +2

Query  107   RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKF  286
             R   +ASHIVGYPR+GPKRELKFALESFWDG+SSAEDL+KV+ DLR SIWKQMADAG KF
Sbjct  50    RVRAVASHIVGYPRIGPKRELKFALESFWDGRSSAEDLEKVAKDLRMSIWKQMADAGTKF  109

Query  287   IPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTN  466
             IPSNTFSYYDH+LDTT MLGAVP RY W GGEIGFD YFSMARG+A++PAMEMTKWFDTN
Sbjct  110   IPSNTFSYYDHILDTTVMLGAVPHRYGWTGGEIGFDVYFSMARGDATLPAMEMTKWFDTN  169

Query  467   YHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFP  646
             YH+IVPELGPD+KFS ASHKAV EYKEAK LG+ET+PVLVGPVSYLLLSK A+G+EK F 
Sbjct  170   YHYIVPELGPDLKFSCASHKAVNEYKEAKELGIETIPVLVGPVSYLLLSKLAEGIEKPFS  229

Query  647   LLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGL  826
             LLSLL KI+P+YKEV+SELK AGA+W+Q DEP LV+DL+S QL+AFT AY +LE    GL
Sbjct  230   LLSLLQKIIPVYKEVVSELKAAGATWVQLDEPTLVLDLDSDQLKAFTDAYTQLEESLHGL  289

Query  827   NVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDG  1003
             NVLVETYFAD+PA+A++ +T L+GV+A GFDL+ G K+++LI+   FPS KYLFAGVVDG
Sbjct  290   NVLVETYFADVPADAYRVVTGLRGVSAIGFDLVHGEKTLELIQDLSFPSDKYLFAGVVDG  349

Query  1004  RNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAA  1183
             RNIWANDL+ SL TLK+LE IVGKDKLVVSTSCSLLHT VDLVNETKLD EIKSWLAFAA
Sbjct  350   RNIWANDLSASLRTLKTLEGIVGKDKLVVSTSCSLLHTPVDLVNETKLDGEIKSWLAFAA  409

Query  1184  QKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATN  1363
             QK+VEVN LAKAL G+K+EAFFSANAAAQASRKSSPRV +++VQ+AA+AL+GSDHRRAT 
Sbjct  410   QKIVEVNELAKALRGEKNEAFFSANAAAQASRKSSPRVNDKAVQEAASALRGSDHRRATP  469

Query  1364  VSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVV  1543
             V++RLDAQQKKLNLP+LPTTTIGSFPQT  LRR+RREYK +KISE EYVKAIKEEISKVV
Sbjct  470   VTSRLDAQQKKLNLPILPTTTIGSFPQTRYLRRIRREYKESKISEAEYVKAIKEEISKVV  529

Query  1544  KLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  1723
             +LQEELDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRP
Sbjct  530   RLQEELDIDVLVHGEPERNDMVEYFGEQLKGFAFTVNGWVQSYGSRCVKPPIIYGDVSRP  589

Query  1724  KPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  1903
             KPMTVFWS+AAQ MT RP+KGMLTGPVTIL+WSFVRNDQPRFETCYQIALAIK+EVEDLE
Sbjct  590   KPMTVFWSTAAQSMTTRPIKGMLTGPVTILSWSFVRNDQPRFETCYQIALAIKNEVEDLE  649

Query  1904  KANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFND  2083
              A I VIQIDEAALREGLPL K+E AFYL WAVH+FRIT+CGVQ+TTQIHTHMCYSNFN+
Sbjct  650   AAGIPVIQIDEAALREGLPLCKSEQAFYLEWAVHAFRITSCGVQDTTQIHTHMCYSNFNN  709

Query  2084  IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  2263
             IIHSIIDMDADV+TIENSRS +KLLSVFREGV+Y AGIGPGVYDIHSPRIPS E+I +RI
Sbjct  710   IIHSIIDMDADVVTIENSRSADKLLSVFREGVRYHAGIGPGVYDIHSPRIPSAEDIGNRI  769

Query  2264  NKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             NKMLAVL+ N LWVNPDCGLKTRKY+EV PAL NMV+AAK +RTQLA
Sbjct  770   NKMLAVLEKNALWVNPDCGLKTRKYSEVIPALTNMVAAAKLLRTQLA  816



>ref|XP_010242374.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 2-like [Nelumbo nucifera]
Length=805

 Score =  1293 bits (3345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/764 (83%), Positives = 697/764 (91%), Gaps = 2/764 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK +A++LQKV+ DLR S+WK+MA AG +FIPSN
Sbjct  39    MSSHIVGYPRIGPKRELKFALESFWDGKINADELQKVAKDLRVSMWKKMASAGTRFIPSN  98

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY W GG++GFD YFSMARGNA++PAMEMTKWFDTNYH+I
Sbjct  99    TFSYYDQVLDTTAMLGAVPERYGWTGGDVGFDIYFSMARGNATLPAMEMTKWFDTNYHYI  158

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL PD+KF+Y+SHKAV EY EAK  G+ETVPV++GP+SYLLLSKPAKGV KSF LLSL
Sbjct  159   VPELSPDLKFTYSSHKAVAEYNEAKETGIETVPVILGPISYLLLSKPAKGVGKSFSLLSL  218

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEV++ELK  GA+W+QFDEP LV+DL++ QL+AFT AY +L     GLNVLV
Sbjct  219   LGKIIPIYKEVLAELKAVGATWVQFDEPMLVLDLDAEQLKAFTDAYEQLGESSSGLNVLV  278

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPA+A+KT+T+LKGV+A G DL+RG KS+DLIK  GFPS KYLFAG+VDGRNIW
Sbjct  279   ETYFADIPADAYKTITSLKGVSAIGLDLVRGGKSLDLIKSTGFPSDKYLFAGIVDGRNIW  338

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDL  SL TL +LE IVGK+KLVVSTSCSLLHTAVDL+NETKLD EI SWLAFAAQKV+
Sbjct  339   ANDLEASLETLITLEGIVGKEKLVVSTSCSLLHTAVDLMNETKLDKEIMSWLAFAAQKVL  398

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAA-LKGSDHRRATNVSA  1372
             EVNALAKAL G+KDEA+FSA+ AAQASR SSPRV +E+++KAAAA L+GSDHRRAT VSA
Sbjct  399   EVNALAKALAGEKDEAYFSASVAAQASRSSSPRVNDEAIKKAAAAALRGSDHRRATPVSA  458

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RLDAQ+KKLNLP LPTTTIGSFPQT++LRRVRREYKANKISEEEYVKAIKEEI KV+KLQ
Sbjct  459   RLDAQKKKLNLPFLPTTTIGSFPQTMDLRRVRREYKANKISEEEYVKAIKEEIGKVIKLQ  518

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             EEL IDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPM
Sbjct  519   EELGIDVLVHGEPERNDMVEYFGEQLKGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPM  578

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TVFWS+ AQ MT  PMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE   
Sbjct  579   TVFWSTTAQSMTSCPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEAVG  638

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             I VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGV++TTQIHTHMCYSNFNDIIH
Sbjct  639   IQVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVKDTTQIHTHMCYSNFNDIIH  698

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP+ EEIA+RI KM
Sbjct  699   SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPTKEEIAERIKKM  758

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             LAVL+ N+LWVNPDCGLKTRKYTEVKPAL NMV+AAK IR+QLA
Sbjct  759   LAVLEMNVLWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRSQLA  802



>ref|XP_010493215.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =  1292 bits (3343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/763 (81%), Positives = 684/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFCDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKALMSLKCVTGFGFDLVRGLETLDLIKENFPPGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDL NE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLANEIKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ   AALK  DHRR+T VS RL
Sbjct  408   VNALAKSFSGAKDEALFSSNSMRQASRRSSPRVTNPAVQHGVAALKKFDHRRSTKVSVRL  467

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQEE
Sbjct  468   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQTIKEEYEKVVKLQEE  527

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  528   LGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  587

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR +TC+QIALAIKDEVEDLEKA + 
Sbjct  588   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHDTCFQIALAIKDEVEDLEKAGVT  647

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  648   VIQIDEAALREGLPLRNSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  707

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPS EEIA+RI KMLA
Sbjct  708   IDMDADVITIENSRSDEKLLSVFHEGVKYSAGIGPGVYDIHSPRIPSAEEIAERIKKMLA  767

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR YTEVK AL NMV+AAK IR+QL K
Sbjct  768   VLDSKVLWVNPDCGLKTRNYTEVKAALSNMVAAAKLIRSQLNK  810



>ref|XP_006286361.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 ref|XP_006286362.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19259.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
 gb|EOA19260.1| hypothetical protein CARUB_v10000244mg [Capsella rubella]
Length=814

 Score =  1291 bits (3342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/763 (81%), Positives = 688/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  51    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  110

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  111   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  170

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  171   VPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  230

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEV+++LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+
Sbjct  231   IDKILPIYKEVLTDLKSAGARWIQFDEPVLVMDLDTSQLQAFSDAYSHMESSLAGLNVLI  290

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  291   ATYFADVPAEAYKALISLKCVTGFGFDLVRGLETLDLIKESFPRGKLLFAGVVDGRNIWA  350

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LED VGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  351   NDLSASLKTLQTLEDTVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFAAQKVVE  410

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKA  G KDEA FS+N+  QASR+SSPRVTN +VQ+  AALK SDH R+T VS RL
Sbjct  411   VNALAKAFSGAKDEALFSSNSMRQASRRSSPRVTNPAVQQDVAALKKSDHHRSTEVSVRL  470

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV++IKEE  KV+KLQEE
Sbjct  471   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQSIKEEYEKVIKLQEE  530

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPP+IYGD++RPK MTV
Sbjct  531   LGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPVIYGDITRPKAMTV  590

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRND PR ETC+QIALAIKDEVEDLEKA + 
Sbjct  591   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDLPRHETCFQIALAIKDEVEDLEKAGVT  650

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  651   VIQIDEAALREGLPLRTSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  710

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGV+YGAGIGPGVYDIHSPRIPS EEIA+RI KMLA
Sbjct  711   IDMDADVITIENSRSDEKLLSVFHEGVRYGAGIGPGVYDIHSPRIPSAEEIAERIKKMLA  770

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR Y EVK AL+NMV+AAK+IR+QL K
Sbjct  771   VLDSKVLWVNPDCGLKTRNYFEVKAALKNMVAAAKQIRSQLNK  813



>ref|XP_009131831.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic [Brassica rapa]
Length=815

 Score =  1291 bits (3340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/763 (81%), Positives = 691/763 (91%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK++A DLQ V+A+LR SIWK MADAGIK+IPSN
Sbjct  52    MSSHIVGYPRIGPKRELKFALESFWDGKTAANDLQTVAANLRNSIWKHMADAGIKYIPSN  111

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W  GEIGFD YFSMARGN SVPAMEMTKWFDTNYH+I
Sbjct  112   TFSYYDQMLDTTAMLGAVPSRYGWKSGEIGFDVYFSMARGNDSVPAMEMTKWFDTNYHYI  171

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGV+KSF LLSL
Sbjct  172   VPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVLIGPITYLLLSKPAKGVDKSFCLLSL  231

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEV  +LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   GLNVL+
Sbjct  232   IDKILPIYKEVFDDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLAGLNVLI  291

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTLT+LK VT FGFD +RG +++DLIKGGFP GK LFAGVVDGRNIWA
Sbjct  292   ATYFADVPAEAYKTLTSLKCVTGFGFDFVRGLETLDLIKGGFPRGKLLFAGVVDGRNIWA  351

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL+SLE+IVGKDK+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  352   NDLSASLKTLQSLEEIVGKDKVVVSTSCSLLHTAVDLVNEVKLDKELKSWLAFAAQKVVE  411

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ+  AA+K SDHRR+T VSARL
Sbjct  412   VNALAKSFSGVKDEALFSSNSMGQASRRSSPRVTNAAVQQDVAAVKKSDHRRSTEVSARL  471

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              +QQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KIS+ +YV+AIK E  KV+KLQEE
Sbjct  472   RSQQKKLNLPALPTTTIGSFPQTADLRRIRREFKAKKISDIDYVQAIKVEFEKVIKLQEE  531

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  532   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  591

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+ PMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA I 
Sbjct  592   FWSSMAQKMTQHPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGIT  651

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR++E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  652   VIQIDEAALREGLPLRRSEQEFYLDWAVHAFRITNCDVQDTTQIHTHMCYSNFNDIIHSI  711

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVF+EGVKY AGIGPGVYDIHSPRIPS EEIA+RINKMLA
Sbjct  712   INMDADVITIENSRSDEKLLSVFQEGVKYCAGIGPGVYDIHSPRIPSAEEIAERINKMLA  771

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK +R++L K
Sbjct  772   VLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLVRSELIK  814



>ref|XP_010454415.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X1 [Camelina sativa]
Length=813

 Score =  1290 bits (3337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/765 (81%), Positives = 686/765 (90%), Gaps = 2/765 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++T PVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFCDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKALMSLKCVTGFGFDLVRGLETLDLIKENFPPGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKA--AAALKGSDHRRATNVSA  1372
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN SVQ+    AA+K SDHRR+T VS 
Sbjct  408   VNALAKSFSGVKDEALFSSNSMRQASRRSSPRVTNVSVQQDQDVAAVKESDHRRSTEVSV  467

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RL AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQ
Sbjct  468   RLQAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQTIKEEYEKVVKLQ  527

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             EEL IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK M
Sbjct  528   EELGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAM  587

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TVFWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA 
Sbjct  588   TVFWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAG  647

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             + VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIH
Sbjct  648   VTVIQIDEAALREGLPLRNSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIH  707

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SIIDMDADVITIENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPS EEIA+RI KM
Sbjct  708   SIIDMDADVITIENSRSDEKLLSVFHEGVKYSAGIGPGVYDIHSPRIPSAEEIAERIKKM  767

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             LAVLD+ +LWVNPDCGLKTR YTEVK AL NMV+AAK IR+QL K
Sbjct  768   LAVLDSKVLWVNPDCGLKTRNYTEVKAALSNMVAAAKLIRSQLNK  812



>ref|XP_010454416.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic isoform X2 [Camelina sativa]
Length=812

 Score =  1289 bits (3336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/764 (81%), Positives = 686/764 (90%), Gaps = 1/764 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++T PVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVEFSYASHKAVVEFKEAKALGIDTFPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFCDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKALMSLKCVTGFGFDLVRGLETLDLIKENFPPGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKA-AAALKGSDHRRATNVSAR  1375
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN SVQ+   AA+K SDHRR+T VS R
Sbjct  408   VNALAKSFSGVKDEALFSSNSMRQASRRSSPRVTNVSVQQDDVAAVKESDHRRSTEVSVR  467

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQE
Sbjct  468   LQAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQTIKEEYEKVVKLQE  527

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             EL IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MT
Sbjct  528   ELGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMT  587

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA +
Sbjct  588   VFWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGV  647

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHS
Sbjct  648   TVIQIDEAALREGLPLRNSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHS  707

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPS EEIA+RI KML
Sbjct  708   IIDMDADVITIENSRSDEKLLSVFHEGVKYSAGIGPGVYDIHSPRIPSAEEIAERIKKML  767

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             AVLD+ +LWVNPDCGLKTR YTEVK AL NMV+AAK IR+QL K
Sbjct  768   AVLDSKVLWVNPDCGLKTRNYTEVKAALSNMVAAAKLIRSQLNK  811



>ref|XP_010420946.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like [Camelina sativa]
Length=811

 Score =  1288 bits (3334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/761 (81%), Positives = 684/761 (90%), Gaps = 0/761 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A+LR SIW+ MADAGIK+IPSN
Sbjct  48    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANLRKSIWRHMADAGIKYIPSN  107

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W GGEIGFD YFSMARGNAS PAMEMTKWFDTNYH+I
Sbjct  108   TFSYYDQMLDTTAMLGAVPSRYGWEGGEIGFDVYFSMARGNASAPAMEMTKWFDTNYHYI  167

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  168   VPELGPDVEFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  227

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF  AY+ +ES   GLNVL+
Sbjct  228   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFCDAYSHMESSLAGLNVLI  287

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+K L +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  288   ATYFADVPAEAYKALMSLKCVTGFGFDLVRGLETLDLIKENFPPGKLLFAGVVDGRNIWA  347

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDL NE KLD E+KSWLAFAAQKVVE
Sbjct  348   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLANEIKLDKELKSWLAFAAQKVVE  407

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN SVQ+  AALK SDHRR+T VSARL
Sbjct  408   VNALAKSFSGAKDEALFSSNSMRQASRRSSPRVTNPSVQQDVAALKKSDHRRSTKVSARL  467

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQE+
Sbjct  468   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEIDYVQTIKEEYEKVVKLQED  527

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVEYF EQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  528   LGIDVLVHGEAERNDMVEYFSEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  587

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA + 
Sbjct  588   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRNETCFQIALAIKDEVEDLEKAGVT  647

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR +E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  648   VIQIDEAALREGLPLRNSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  707

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVIT+ENSRSDEKLLSVF EGVKY AGIGPGVYDIHSPRIPS EEIA+RI KMLA
Sbjct  708   IDMDADVITVENSRSDEKLLSVFHEGVKYSAGIGPGVYDIHSPRIPSAEEIAERIKKMLA  767

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQL  2401
             VLD+ +LWVNPDCGLKTR YTEVK AL NMV+AAK IR++L
Sbjct  768   VLDSKVLWVNPDCGLKTRNYTEVKAALSNMVAAAKLIRSEL  808



>emb|CDX70955.1| BnaC03g10390D [Brassica napus]
Length=815

 Score =  1287 bits (3331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/763 (81%), Positives = 689/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFW+GK+   DLQ V+A+LR SIWK MADAGIK+IPSN
Sbjct  52    MSSHIVGYPRIGPKRELKFALESFWEGKTGVGDLQTVAANLRNSIWKHMADAGIKYIPSN  111

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W  GEIGFD YFSMARGN SVPAMEMTKWFDTNYH+I
Sbjct  112   TFSYYDQMLDTTAMLGAVPSRYGWKNGEIGFDVYFSMARGNDSVPAMEMTKWFDTNYHYI  171

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGV+KSF  LSL
Sbjct  172   VPELGPDVEFSYASHKAVDEFKEAKALGIDTVPVLIGPLTYLLLSKPAKGVDKSFCTLSL  231

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILPIYKEV  +LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   GLNVL+
Sbjct  232   IDKILPIYKEVFDDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLAGLNVLI  291

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTLT+LK VT FGFD +RG +++DLIKGGFP GK LFAGVVDGRNIWA
Sbjct  292   ATYFADVPAEAYKTLTSLKCVTGFGFDFVRGLETLDLIKGGFPRGKLLFAGVVDGRNIWA  351

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL+SLE+IVGKDK+V+STSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  352   NDLSASLKTLQSLEEIVGKDKVVISTSCSLLHTAVDLVNEVKLDKELKSWLAFAAQKVVE  411

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+L G KDEA FSAN+  QASR+SSPRVTN +VQ+  AA+K SDHRR+T VSARL
Sbjct  412   VNALAKSLSGVKDEALFSANSMGQASRRSSPRVTNSAVQQDVAAVKKSDHRRSTEVSARL  471

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KIS+ +YV+AIK E  KVVKLQEE
Sbjct  472   QAQQKKLNLPALPTTTIGSFPQTADLRRIRREFKAKKISDIDYVQAIKVEFEKVVKLQEE  531

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVEYFGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDV+RPK MTV
Sbjct  532   LGIDVLVHGEAERNDMVEYFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVTRPKAMTV  591

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+ PMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA I 
Sbjct  592   FWSSMAQKMTQHPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGIT  651

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLR++E  FYL+WAVH+FRITNC VQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  652   VIQIDEAALREGLPLRRSEQEFYLDWAVHAFRITNCDVQDTTQIHTHMCYSNFNDIIHSI  711

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+MDADVITIENSRSDEKLLSVF+EGVKY AGIGPGVYDIHSPRIPS EEIA+RINKMLA
Sbjct  712   INMDADVITIENSRSDEKLLSVFQEGVKYCAGIGPGVYDIHSPRIPSAEEIAERINKMLA  771

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK +R++L K
Sbjct  772   VLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLVRSELIK  814



>ref|NP_197598.2| methionine synthase 3 [Arabidopsis thaliana]
 ref|NP_001078611.1| methionine synthase 3 [Arabidopsis thaliana]
 sp|Q0WNZ5.1|METE3_ARATH RecName: Full=5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic; AltName: Full=Cobalamin-independent 
methionine synthase 3; Short=AtMS3; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAF01154.1| 5-methyltetrahydropteroyltriglutamate- homocysteine S-methyltransferase 
- like protein [Arabidopsis thaliana]
 gb|AED92915.1| methionine synthase 3 [Arabidopsis thaliana]
 gb|AED92916.1| methionine synthase 3 [Arabidopsis thaliana]
Length=812

 Score =  1286 bits (3328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/763 (80%), Positives = 685/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK++ +DLQ V+A+LR SIWK MA AGIK+IPSN
Sbjct  49    MSSHIVGYPRIGPKRELKFALESFWDGKTNVDDLQNVAANLRKSIWKHMAHAGIKYIPSN  108

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W  GEIGFD YFSMARGNAS  AMEMTKWFDTNYH+I
Sbjct  109   TFSYYDQMLDTTAMLGAVPSRYGWESGEIGFDVYFSMARGNASAHAMEMTKWFDTNYHYI  168

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  169   VPELGPDVNFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  228

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+
Sbjct  229   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSHMESSLAGLNVLI  288

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTL +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  289   ATYFADVPAEAYKTLMSLKCVTGFGFDLVRGLETLDLIKMNFPRGKLLFAGVVDGRNIWA  348

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  349   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEMKLDKELKSWLAFAAQKVVE  408

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ+   A+K SDH R+T VS RL
Sbjct  409   VNALAKSFSGAKDEALFSSNSMRQASRRSSPRVTNAAVQQDVDAVKKSDHHRSTEVSVRL  468

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KV+KLQEE
Sbjct  469   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEVDYVQTIKEEYEKVIKLQEE  528

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGD++RPK MTV
Sbjct  529   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDITRPKAMTV  588

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA + 
Sbjct  589   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGVT  648

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  649   VIQIDEAALREGLPLRKSEQKFYLDWAVHAFRITNSGVQDSTQIHTHMCYSNFNDIIHSI  708

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPSTEEIA+RINKMLA
Sbjct  709   IDMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSTEEIAERINKMLA  768

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR Y+EVK AL NMV+AAK IR+QL K
Sbjct  769   VLDSKVLWVNPDCGLKTRNYSEVKSALSNMVAAAKLIRSQLNK  811



>ref|XP_002874026.1| hypothetical protein ARALYDRAFT_489009 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50285.1| hypothetical protein ARALYDRAFT_489009 [Arabidopsis lyrata subsp. 
lyrata]
Length=810

 Score =  1286 bits (3327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/763 (80%), Positives = 687/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGK+S +DLQ V+A++R SIWK MAD GIK+IPSN
Sbjct  47    MSSHIVGYPRIGPKRELKFALESFWDGKTSVDDLQNVAANVRKSIWKHMADTGIKYIPSN  106

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W  GEIGFD YFSMARGNAS  AMEMTKWFDTNYH+I
Sbjct  107   TFSYYDQMLDTTAMLGAVPSRYGWESGEIGFDIYFSMARGNASAHAMEMTKWFDTNYHYI  166

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV E+KEAKALG+++VPVL+GP++YLLLSKPAKGV+KSF LLSL
Sbjct  167   VPELGPNVKFSYASHKAVVEFKEAKALGIDSVPVLIGPMTYLLLSKPAKGVDKSFCLLSL  226

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +D+ILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+
Sbjct  227   IDRILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSYMESSLAGLNVLI  286

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAE++KTL +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  287   ATYFADVPAESYKTLMSLKCVTGFGFDLVRGLETLDLIKMNFPRGKLLFAGVVDGRNIWA  346

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  347   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFAAQKVVE  406

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ+  AALK SDH R+T VS RL
Sbjct  407   VNALAKSFSGAKDEALFSSNSMRQASRRSSPRVTNAAVQQDVAALKKSDHHRSTEVSVRL  466

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KVVKLQEE
Sbjct  467   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEVDYVQTIKEEYEKVVKLQEE  526

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGD++RPK MTV
Sbjct  527   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDITRPKAMTV  586

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+ PMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA + 
Sbjct  587   FWSSMAQKMTQHPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGVT  646

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITNCGVQ+TTQIHTHMCYSNFNDIIHSI
Sbjct  647   VIQIDEAALREGLPLRKSEQKFYLDWAVHAFRITNCGVQDTTQIHTHMCYSNFNDIIHSI  706

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPSTEE+A+RINKMLA
Sbjct  707   IDMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSTEEMAERINKMLA  766

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR Y+EVK AL NMV+AAK IR+QL K
Sbjct  767   VLDSKVLWVNPDCGLKTRNYSEVKSALSNMVAAAKLIRSQLNK  809



>ref|XP_010933712.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Elaeis guineensis]
Length=838

 Score =  1285 bits (3325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/767 (80%), Positives = 698/767 (91%), Gaps = 1/767 (0%)
 Frame = +2

Query  107   RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKF  286
             R   +ASHIVGYPR+GP+RELKFALESFWDG+SSAEDL+KV+ DLR S+WKQMADAG KF
Sbjct  70    RVRAVASHIVGYPRIGPRRELKFALESFWDGRSSAEDLEKVANDLRLSVWKQMADAGTKF  129

Query  287   IPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTN  466
             IPSNTFSYYDH+LDTT+MLGAVP RY W GGEIGFD YFSMARGNA++ AMEMTKWFDTN
Sbjct  130   IPSNTFSYYDHILDTTSMLGAVPHRYGWTGGEIGFDVYFSMARGNATLRAMEMTKWFDTN  189

Query  467   YHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFP  646
             YH+IVPELGPD+KFSYASHK V EYKEAK LG+ET+PVL+GPVSYLLLSK A+GVE SF 
Sbjct  190   YHYIVPELGPDLKFSYASHKTVAEYKEAKELGIETIPVLIGPVSYLLLSKLAEGVEISFS  249

Query  647   LLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGL  826
             LLSLL KI+P+YKEV+SELK AGA+W+QFDEP LV+DL+S QL+AFT AY +LE    GL
Sbjct  250   LLSLLQKIIPVYKEVVSELKAAGATWVQFDEPTLVLDLDSDQLKAFTDAYTQLEESLHGL  309

Query  827   NVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDG  1003
             NVLVETYFAD+P++A++ +T L+GV+A GFDL+ G K++ LI+  GFP  KYLFAGVVDG
Sbjct  310   NVLVETYFADVPSDAYRVVTGLRGVSAIGFDLVHGEKTLKLIQNLGFPPNKYLFAGVVDG  369

Query  1004  RNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAA  1183
             RNIWANDL+ SL TLK+LE I GK+KLVVSTSCSLLHT VDLVNETKLD+EIKSWLAFAA
Sbjct  370   RNIWANDLSASLRTLKTLEGIAGKEKLVVSTSCSLLHTPVDLVNETKLDSEIKSWLAFAA  429

Query  1184  QKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATN  1363
             QK++EVN LAKAL  +K+EAFFSANA AQASRKSSPRV +++VQ+AA+AL GSDH+R T 
Sbjct  430   QKIMEVNELAKALRVEKNEAFFSANAVAQASRKSSPRVNDKAVQEAASALMGSDHQRPTP  489

Query  1364  VSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVV  1543
             V++RLDAQQKKLNLP+LPTTTIGSFPQT++LRR+RREYK +KISE EYVKAIKEEISKVV
Sbjct  490   VTSRLDAQQKKLNLPILPTTTIGSFPQTMDLRRIRREYKESKISEAEYVKAIKEEISKVV  549

Query  1544  KLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  1723
             + QEELDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRP
Sbjct  550   QFQEELDIDVLVHGEPERNDMVEYFGEQLKGFAFTVNGWVQSYGSRCVKPPIIYGDVSRP  609

Query  1724  KPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLE  1903
             KPMTVFWS+AAQ MT RP+KGMLTGPVTILNWSFVRND+ RFETCYQIALA+K+EVEDLE
Sbjct  610   KPMTVFWSTAAQSMTTRPIKGMLTGPVTILNWSFVRNDRLRFETCYQIALAMKNEVEDLE  669

Query  1904  KANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFND  2083
              A I+VIQIDEAALREGLPLRK+E AFYL+WAVH+FRIT+C V++TTQIHTHMCYSNFND
Sbjct  670   AAGISVIQIDEAALREGLPLRKSEQAFYLDWAVHAFRITSCYVKDTTQIHTHMCYSNFND  729

Query  2084  IIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRI  2263
             IIHSIIDMDADV+TIENSRS EKLLSVFREGV+Y AGIGPGVYDIHSPRIPSTEEI D I
Sbjct  730   IIHSIIDMDADVVTIENSRSAEKLLSVFREGVRYHAGIGPGVYDIHSPRIPSTEEIGDSI  789

Query  2264  NKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             NKMLAVL+ N+LWVNPDCGLKTRK++EVKPAL NMV+AA+ +RTQLA
Sbjct  790   NKMLAVLEKNVLWVNPDCGLKTRKFSEVKPALANMVAAAQLLRTQLA  836



>gb|ABR16134.1| unknown [Picea sitchensis]
Length=766

 Score =  1285 bits (3324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/763 (81%), Positives = 684/763 (90%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ V+ DLR + WKQMADAG+ +IPSN
Sbjct  1     MASHVVGYPRIAPKRELKFALESFWDGKSSAAELQNVAKDLRVATWKQMADAGLTYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVPPRY W GGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KF Y+SHKAV EYKEAK +G+ETVPV++GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPEIKFKYSSHKAVDEYKEAKKIGIETVPVIIGPVSYLLLSKPAKGVPKTFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKEV+ ELK AGA+WIQFDEP LVMDLE+H L+AF+KAY+ LE    G+ +LV
Sbjct  181   LDAILPVYKEVLGELKQAGATWIQFDEPALVMDLEAHHLDAFSKAYSFLEEVLVGIKLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFADIP E ++T+  LK ++A G DLIRGTK++ L+K  GFP  KYLFAGV+DGRNIW
Sbjct  241   ETYFADIPVETYRTIIQLKAISAIGLDLIRGTKTLSLVKTVGFPGDKYLFAGVIDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S S LK LE IVGK K+VVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV+
Sbjct  301   ANDLAASFSILKDLETIVGKGKIVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVL  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV ALAKAL GQ D+ +F+ANAAA +SRK+SPRV NE+VQKAA ALKGSDHRRAT V AR
Sbjct  361   EVVALAKALIGQADQPYFAANAAAISSRKTSPRVNNEAVQKAAEALKGSDHRRATPVIAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQKKLNLP+LPTTTIGSFPQTVELRRVRREYK+NKISE +Y+++I++EI+KVVK+QE
Sbjct  421   LDEQQKKLNLPILPTTTIGSFPQTVELRRVRREYKSNKISEADYIQSIQQEIAKVVKMQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +LDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPP+IYGDVSRPKPMT
Sbjct  481   DLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPVIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ +T RPMKGMLTGPVTILNWSFVR+DQPR ET  QIALAIK+EVEDLE + I
Sbjct  541   VFWSKYAQSLTARPMKGMLTGPVTILNWSFVRDDQPRSETSMQIALAIKEEVEDLEASGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAE A YL WAVH FRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEQAHYLEWAVHGFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLL VF+EGVKYGAGIGPGVYDIHSPRIP TEEIADRI K+L
Sbjct  661   IIDMDADVITIENSRSDEKLLRVFQEGVKYGAGIGPGVYDIHSPRIPDTEEIADRIRKIL  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV++AK +RT+LA
Sbjct  721   AVLETNILWVNPDCGLKTRKYNEVVPALTNMVASAKLLRTELA  763



>emb|CAE55865.1| cobalamin-independent methionine synthase [Arabidopsis thaliana]
Length=812

 Score =  1284 bits (3323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/763 (80%), Positives = 684/763 (90%), Gaps = 0/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M+SHIVGYPR+GPKRELKFALESFWDGKS+ +DLQ V+A+LR SIWK MA AGIK+IPSN
Sbjct  49    MSSHIVGYPRIGPKRELKFALESFWDGKSNVDDLQNVAANLRKSIWKHMAHAGIKYIPSN  108

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVP RY W  GEIGFD YFSMARGNAS  AMEMTKWFDTNYH+I
Sbjct  109   TFSYYDQMLDTTAMLGAVPSRYGWESGEIGFDVYFSMARGNASAHAMEMTKWFDTNYHYI  168

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAKGVEKSF LLSL
Sbjct  169   VPELGPDVNFSYASHKAVVEFKEAKALGIDTVPVLIGPMTYLLLSKPAKGVEKSFCLLSL  228

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKILP+YKEV+++LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+
Sbjct  229   IDKILPVYKEVLADLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSHMESSLAGLNVLI  288

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
              TYFAD+PAEA+KTL +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWA
Sbjct  289   ATYFADVPAEAYKTLMSLKCVTGFGFDLVRGLETLDLIKMNFPRGKLLFAGVVDGRNIWA  348

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVE
Sbjct  349   NDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEMKLDKELKSWLAFAAQKVVE  408

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAK+  G KDEA FS+N+  QASR+SSPRVTN +VQ+   A+K SDH R+T VS RL
Sbjct  409   VNALAKSFSGAKDEALFSSNSMRQASRRSSPRVTNAAVQQDVDAVKKSDHHRSTEVSVRL  468

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KV+KLQEE
Sbjct  469   QAQQKKLNLPALPTTTIGSFPQTTDLRRIRREFKAKKISEVDYVQTIKEEYEKVIKLQEE  528

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             L IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGD++RPK MTV
Sbjct  529   LGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDITRPKAMTV  588

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIAL IKDEVEDLEKA + 
Sbjct  589   FWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALGIKDEVEDLEKAGVT  648

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITN GVQ++TQIHTHMCYSNFNDIIHSI
Sbjct  649   VIQIDEAALREGLPLRKSEQKFYLDWAVHAFRITNSGVQDSTQIHTHMCYSNFNDIIHSI  708

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPSTEEIA+RINKMLA
Sbjct  709   IDMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSTEEIAERINKMLA  768

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VLD+ +LWVNPDCGLKTR Y+EVK AL NMV+AAK IR+QL K
Sbjct  769   VLDSKVLWVNPDCGLKTRNYSEVKSALSNMVAAAKLIRSQLNK  811



>gb|EMS50887.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Triticum urartu]
Length=740

 Score =  1284 bits (3322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/769 (85%), Positives = 687/769 (89%), Gaps = 39/769 (5%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ADLRASIWKQM++AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSEAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVP RY+W GGEIG  TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPDRYSWTGGEIGHSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL P  KFSYASHKAV+EYKEAKALGV+TVPVLVGPVSYLLLSK AKGVEKSF LLSL
Sbjct  121   VPELSPATKFSYASHKAVSEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILPIYKEV++ELK AGASWIQFDEP LV DL  H+L A                   
Sbjct  181   LDSILPIYKEVVAELKAAGASWIQFDEPTLVKDLAVHELAA-------------------  221

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
                          TLT+L GVTA+GFDL+RGTK+++LIK  G PSGKYLFAGVVDGRNIW
Sbjct  222   -------------TLTSLSGVTAYGFDLVRGTKTLELIKSAGIPSGKYLFAGVVDGRNIW  268

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SLSTL+SLE +VGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  269   ADDLAASLSTLQSLEAVVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  328

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKA------AAALKGSDHRRA  1357
             EVNAL KAL G KDEA+F+ANAAAQASR+SSPRV NE VQKA      AAALKGSDHRRA
Sbjct  329   EVNALGKALAGLKDEAYFAANAAAQASRRSSPRVNNEEVQKAEVHFLQAAALKGSDHRRA  388

Query  1358  TNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISK  1537
             T VSARLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISEEEYV AIKEEISK
Sbjct  389   TPVSARLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISEEEYVSAIKEEISK  448

Query  1538  VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVS  1717
             VVK+QEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVS
Sbjct  449   VVKIQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVS  508

Query  1718  RPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED  1897
             RP PMTVFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVED
Sbjct  509   RPNPMTVFWSKMAQDMTPRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVED  568

Query  1898  LEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNF  2077
             LE   I VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNF
Sbjct  569   LEAGGIQVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNF  628

Query  2078  NDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIAD  2257
             NDIIHSII+MDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIPSTEEIAD
Sbjct  629   NDIIHSIINMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPSTEEIAD  688

Query  2258  RINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             R+NKMLAVLDTNILWVNPDCGLKTRKYTEVKPAL NMV+AAK IRTQLA
Sbjct  689   RVNKMLAVLDTNILWVNPDCGLKTRKYTEVKPALTNMVAAAKLIRTQLA  737



>ref|XP_010521311.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 1-like [Tarenaya hassleriana]
Length=727

 Score =  1283 bits (3319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/764 (84%), Positives = 680/764 (89%), Gaps = 42/764 (5%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQK +A+LR+SIWKQMADA IK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKAAAELRSSIWKQMADADIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAVTEYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVTEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+KILPIY+EVISELKGAGA+WIQFDEP LVMDL+S +L+AFT AYAELES   GLNVL+
Sbjct  181   LNKILPIYQEVISELKGAGATWIQFDEPQLVMDLDSTKLKAFTDAYAELESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +K LT+LKGVTA+GFDL+RGT ++DL+K GFP  KYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAETYKILTSLKGVTAYGFDLVRGTNTLDLVKSGFPKDKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKD--KLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV  1192
             NDLA SL TL+ LE IVG++  KLVVSTSCSLLHTAVDL+NETKLD+EIKSWLAFAAQKV
Sbjct  301   NDLASSLKTLQELEGIVGRERYKLVVSTSCSLLHTAVDLINETKLDDEIKSWLAFAAQKV  360

Query  1193  VEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSA  1372
             VEVNALAKAL G KDEAFFS NA AQASRKSSPRVTNE+VQKAAAALKGSDHRR+TNVSA
Sbjct  361   VEVNALAKALAGHKDEAFFSDNAMAQASRKSSPRVTNEAVQKAAAALKGSDHRRSTNVSA  420

Query  1373  RLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQ  1552
             RLDAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+Y+KAIKEEI KVV LQ
Sbjct  421   RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYIKAIKEEIKKVVDLQ  480

Query  1553  EELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM  1732
             E+LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPP+IYGDVSRPKPM
Sbjct  481   EDLDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPVIYGDVSRPKPM  540

Query  1733  TVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAN  1912
             TV                                         +IALAIKDEVEDLEKA 
Sbjct  541   TVL----------------------------------------RIALAIKDEVEDLEKAG  560

Query  1913  INVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIH  2092
             INVIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ+TTQIHTHMCYSNFNDII 
Sbjct  561   INVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIQ  620

Query  2093  SIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKM  2272
             SIIDMD DVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEE+A+RINKM
Sbjct  621   SIIDMDTDVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEMAERINKM  680

Query  2273  LAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             LAVL+ NILWVNPDCGLKTRKY EVKPAL+NMV A K IR+QLA
Sbjct  681   LAVLEKNILWVNPDCGLKTRKYNEVKPALKNMVEATKLIRSQLA  724



>ref|XP_006842129.1| hypothetical protein AMTR_s00078p00112410 [Amborella trichopoda]
 gb|ERN03804.1| hypothetical protein AMTR_s00078p00112410 [Amborella trichopoda]
Length=804

 Score =  1282 bits (3317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/763 (80%), Positives = 692/763 (91%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+GPKRELKFALESFWDG+SSAEDLQKV+ +LR S+WKQM+D GIK+IP N
Sbjct  39    MASHVVGYPRIGPKRELKFALESFWDGRSSAEDLQKVAKELRHSMWKQMSDVGIKYIPCN  98

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYDHVLDTTAMLGAVPPRY W GGEIGFD YFSMARGNA++PAMEMTKWFDTNYH++
Sbjct  99    TFSYYDHVLDTTAMLGAVPPRYGWMGGEIGFDVYFSMARGNATLPAMEMTKWFDTNYHYL  158

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPD+KFSY+SHKAV+EYKEAK LG ETVPVLVGPVSYLLLSKP K V++ F LLSL
Sbjct  159   VPELGPDIKFSYSSHKAVSEYKEAKELGFETVPVLVGPVSYLLLSKPTKSVDRPFSLLSL  218

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KI+PIYKEV++ELK AGA W+QFDEP LV+DL+SHQ +AFT+AY ELE  F GL V+V
Sbjct  219   LGKIIPIYKEVLAELKAAGAKWVQFDEPTLVLDLDSHQRKAFTEAYTELEESFSGLRVVV  278

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFAD+PAEA+KT+ ALKG++  GFDL+RG K++DLI+  GFPSGK+L AGVVDGRNIW
Sbjct  279   ETYFADVPAEAYKTIIALKGISGIGFDLVRGEKTLDLIQNVGFPSGKFLIAGVVDGRNIW  338

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DL  S+S LK+LE IVGK+KLVVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQK++
Sbjct  339   ASDLGASMSILKALEGIVGKEKLVVSTSCSLLHTAVDLVNETKLDSEIKSWLAFAAQKIL  398

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV+ LAKAL G+KDEAFF ANAAA +SRKSS RV NE+V+ +A ALKGSDH RAT VS R
Sbjct  399   EVSTLAKALAGKKDEAFFMANAAAISSRKSSSRVNNEAVKISALALKGSDHHRATPVSTR  458

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQK+LNLP+LPTTTIGSFPQT++LRRVRREYKAN I+EEEY++AIKEEI KVVKLQE
Sbjct  459   LDVQQKELNLPILPTTTIGSFPQTMDLRRVRREYKANNITEEEYMRAIKEEICKVVKLQE  518

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +L IDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRP+PMT
Sbjct  519   DLGIDVLVHGEPERNDMVEYFGEQLHGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPRPMT  578

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             +FWS AAQ MT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIK+EVEDLE A I
Sbjct  579   IFWSKAAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKNEVEDLEDAGI  638

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+E  FYL+WAVH+FRITN GV++TTQIHTHMCYSNFNDII S
Sbjct  639   QVIQIDEAALREGLPLRKSEQPFYLDWAVHAFRITNYGVKDTTQIHTHMCYSNFNDIILS  698

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             I+DMDADVITIENSRS+EKLLSVFREG+KYGAGIGPGVYDIHSPRIP+TEEI +R+ KML
Sbjct  699   IMDMDADVITIENSRSNEKLLSVFREGIKYGAGIGPGVYDIHSPRIPTTEEIEERVRKML  758

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
              VL+ +++WVNPDCGLKTRKY+EV P+L NMV+A K +R +LA
Sbjct  759   GVLEPSMVWVNPDCGLKTRKYSEVIPSLSNMVAATKLLRIELA  801



>gb|ABR18027.1| unknown [Picea sitchensis]
Length=766

 Score =  1277 bits (3305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/763 (80%), Positives = 679/763 (89%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ V+ DLR + WKQM DAG+ +IPSN
Sbjct  1     MASHVVGYPRIAPKRELKFALESFWDGKSSAAELQNVAKDLRVATWKQMDDAGLTYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVPPRY W GGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KF Y+SHKAV EYKEAK +G+ETVPV+VGPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPEIKFKYSSHKAVDEYKEAKKIGIETVPVIVGPVSYLLLSKPAKGVPKTFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKEVI ELK AGA+WIQFDEP LVMDLE+H L+AF+KAY+ LE    G+ +LV
Sbjct  181   LDAILPVYKEVIGELKQAGATWIQFDEPALVMDLEAHHLDAFSKAYSFLEEVLVGIKLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFADIP E ++T+  LK ++A G DLIRGTK++ L+K  GFP  KYLFAGV+DGRNIW
Sbjct  241   ETYFADIPVETYRTIVQLKAISAIGLDLIRGTKTLSLVKTVGFPGDKYLFAGVIDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S S LK LE IVGK K+VVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV+
Sbjct  301   ANDLAASFSILKDLETIVGKGKIVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVL  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV ALAKAL GQ D+ +F+AN AA +SRK+SPRV NE+VQKAA ALKGSDHRR T V+AR
Sbjct  361   EVVALAKALIGQADQPYFAANVAAISSRKTSPRVNNEAVQKAAEALKGSDHRRVTPVTAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQK LNLP+LPTTTIGSFPQTVELRRVRREYK+NKI E +Y+++I++EI+KVVK+QE
Sbjct  421   LDEQQKNLNLPILPTTTIGSFPQTVELRRVRREYKSNKILEADYIQSIQQEIAKVVKMQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +LDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   DLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ +T RPMKGMLTGPVTILNWSFVR+DQPR ET  QIALAIK+EVEDLE + I
Sbjct  541   VFWSKYAQSLTARPMKGMLTGPVTILNWSFVRDDQPRSETSMQIALAIKEEVEDLEASGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAE A YL WAVH FRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEQAHYLEWAVHGFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLL VF+EGVKYGAGIGPGVYDIHSPRIP  EEIADRI K+L
Sbjct  661   IIDMDADVITIENSRSDEKLLRVFQEGVKYGAGIGPGVYDIHSPRIPDIEEIADRIRKIL  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV++AK +RT+LA
Sbjct  721   AVLETNILWVNPDCGLKTRKYNEVVPALTNMVASAKLLRTELA  763



>emb|CDX92419.1| BnaA10g14580D [Brassica napus]
Length=876

 Score =  1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/769 (79%), Positives = 688/769 (89%), Gaps = 0/769 (0%)
 Frame = +2

Query  101   P*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGI  280
             P R   M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ V+ADLR SIWK MA  GI
Sbjct  107   PLRPRPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGI  166

Query  281   KFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFD  460
             K+IPSNTFSYYD +LDTTAMLGAVP RY W  GE+GFD YFSMARGN SVPAMEMTKWFD
Sbjct  167   KYIPSNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFD  226

Query  461   TNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKS  640
             TNYH+IVPELGP VKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAK V+KS
Sbjct  227   TNYHYIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKS  286

Query  641   FPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFG  820
             F LLSL+DKILP+YKEV+++LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   
Sbjct  287   FCLLSLIDKILPVYKEVLTDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLA  346

Query  821   GLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVD  1000
             GLNVL+ TYFAD+PAEA+K LT+LK VT FGFDL+RG +++DLIK  FP GK LFAGVVD
Sbjct  347   GLNVLIATYFADVPAEAYKALTSLKCVTGFGFDLVRGLETLDLIKVDFPRGKLLFAGVVD  406

Query  1001  GRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFA  1180
             GRNIWANDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFA
Sbjct  407   GRNIWANDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFA  466

Query  1181  AQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRAT  1360
             AQKVVEVNALA++  G KDEA F++N+  QASR+SSPRVTN ++Q   AA+  SDHRR+T
Sbjct  467   AQKVVEVNALARSFSGVKDEALFASNSMRQASRRSSPRVTNATIQHNVAAVIKSDHRRST  526

Query  1361  NVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKV  1540
              VSARL AQQKKLNLP LPTTTIGSFPQT +LRR+R+E+KA KISE +YV+AIK E  KV
Sbjct  527   KVSARLQAQQKKLNLPPLPTTTIGSFPQTPDLRRIRKEFKARKISEIDYVQAIKVEFEKV  586

Query  1541  VKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSR  1720
             VKLQEEL IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSR
Sbjct  587   VKLQEELGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSR  646

Query  1721  PKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL  1900
             PK MTVFWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR+ETC+QIALAIKDEV+DL
Sbjct  647   PKAMTVFWSSMAQKMTQRPMKGMLTGPVTILNWSFVRNDQPRYETCFQIALAIKDEVKDL  706

Query  1901  EKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFN  2080
             EKA I VIQIDEAALREGLPLR++E   YL+WAVH+FRITNC V++TTQIHTHMCYSNFN
Sbjct  707   EKAGITVIQIDEAALREGLPLRRSEQELYLDWAVHAFRITNCDVRDTTQIHTHMCYSNFN  766

Query  2081  DIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR  2260
             DII+SII+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS EEIA+R
Sbjct  767   DIINSIINMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSAEEIAER  826

Query  2261  INKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             INKMLAVLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK IR+QL K
Sbjct  827   INKMLAVLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLIRSQLNK  875



>ref|XP_010036242.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=767

 Score =  1273 bits (3295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/762 (82%), Positives = 682/762 (90%), Gaps = 3/762 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGP+RELKFALESFWDGKSS EDLQKV+ADLR+S WKQMADAGIK++PSN
Sbjct  1     MASHVVGYPRMGPQRELKFALESFWDGKSSTEDLQKVAADLRSSTWKQMADAGIKYVPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYDHVLDTTAMLGAVP RY W GGEIG D YF MARGNASVPAMEM KWFD++YH+I
Sbjct  61    TFSYYDHVLDTTAMLGAVPTRYGWEGGEIGLDVYFLMARGNASVPAMEMAKWFDSSYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL PDV+FSYAS KAV EYKE K LGV+TVPVL+GPVSYLLLSKPAKGVEKSF  LSL
Sbjct  121   VPELAPDVEFSYASAKAVNEYKEVKKLGVDTVPVLLGPVSYLLLSKPAKGVEKSFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIY+EV+SELK AGASWIQFDEP LV+DL+SH+L+AFT+AY+ELESC  G+NVLV
Sbjct  181   LHKILPIYREVVSELKAAGASWIQFDEPTLVLDLDSHRLQAFTEAYSELESCLSGVNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             +TYFAD+PAEA++ LT+LKGV  FGFDL+RGTK++DLIKGGFP  KYLFAGVVDGRNIWA
Sbjct  241   QTYFADVPAEAYRVLTSLKGVAGFGFDLVRGTKTLDLIKGGFPKEKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL++LE IVGKDKLVVSTSCSLLHT VDL NET+LD EIKSWLAFAAQKVVE
Sbjct  301   NDLAQSLGTLRALESIVGKDKLVVSTSCSLLHTPVDLFNETELDEEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFSANAA+QASRKSSPRVTNE+VQKA AAL G DH RAT VSARL
Sbjct  361   VNALAKALAGKKDEAFFSANAASQASRKSSPRVTNEAVQKATAALTGYDHHRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPV+PTTTIGSFPQ+ ELRRV R YK  K+S EEYVKAIK EI KV+KLQEE
Sbjct  421   DAQQKKLNLPVIPTTTIGSFPQSEELRRVHRGYKDKKMSWEEYVKAIKVEIKKVIKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERN+MVEYFGEQLSG  FT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNNMVEYFGEQLSGLVFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  541   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDE ALREGLPLRK+E +FYL WAVHSFRITNCGV++TTQIHTH+CY + +DII SI
Sbjct  601   VIQIDEEALREGLPLRKSEQSFYLEWAVHSFRITNCGVKDTTQIHTHVCYCHIDDIIPSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             +D+DADVITIENSRSDEKLLSV  EGVKYGAGI P VYDIHS  IPS EEIADR  KML 
Sbjct  661   LDVDADVITIENSRSDEKLLSVSHEGVKYGAGIVPSVYDIHSLIIPSAEEIADRTIKMLT  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
                TNILW NPD  LKTRK+T VK AL+ MV AAK +RT+LA
Sbjct  721   ---TNILWFNPDFVLKTRKHTGVKRALKIMVVAAKLLRTELA  759



>ref|XP_009120742.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120743.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120744.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
 ref|XP_009120745.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X1 [Brassica 
rapa]
Length=833

 Score =  1273 bits (3293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/769 (79%), Positives = 687/769 (89%), Gaps = 0/769 (0%)
 Frame = +2

Query  101   P*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGI  280
             P R   M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ V+ADLR SIWK MA  G 
Sbjct  64    PLRPRPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGN  123

Query  281   KFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFD  460
             K+IPSNTFSYYD +LDTTAMLGAVP RY W  GE+GFD YFSMARGN SVPAMEMTKWFD
Sbjct  124   KYIPSNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFD  183

Query  461   TNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKS  640
             TNYH+IVPELGP VKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAK V+KS
Sbjct  184   TNYHYIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKS  243

Query  641   FPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFG  820
             F LLSL+DKILP+YKEV+++LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   
Sbjct  244   FCLLSLIDKILPVYKEVLTDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLA  303

Query  821   GLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVD  1000
             GLNVL+ TYFAD+PAEA+K LT+LK VT FGFDL+RG +++DLIK  FP GK LFAGVVD
Sbjct  304   GLNVLIATYFADVPAEAYKALTSLKCVTGFGFDLVRGLETLDLIKVDFPRGKLLFAGVVD  363

Query  1001  GRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFA  1180
             GRNIWANDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFA
Sbjct  364   GRNIWANDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFA  423

Query  1181  AQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRAT  1360
             AQKVVEVNALA++  G KDEA F++N+  QASR+SSPRVTN ++Q   AA+  SDHRR+T
Sbjct  424   AQKVVEVNALARSFSGVKDEALFASNSMRQASRRSSPRVTNATIQHNVAAVIKSDHRRST  483

Query  1361  NVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKV  1540
              VSARL AQQKKLNLP LPTTTIGSFPQT +LRR+R+E+KA KISE +YV+AIK E  KV
Sbjct  484   KVSARLQAQQKKLNLPPLPTTTIGSFPQTPDLRRIRKEFKARKISEIDYVQAIKVEFEKV  543

Query  1541  VKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSR  1720
             VKLQEEL IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSR
Sbjct  544   VKLQEELGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSR  603

Query  1721  PKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL  1900
             PK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR+ETC+QIALAIKDEV+DL
Sbjct  604   PKAMTVFWSSMAQKMTKRPMKGMLTGPVTILNWSFVRNDQPRYETCFQIALAIKDEVKDL  663

Query  1901  EKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFN  2080
             EKA I VIQIDEAALREGLPLR++E   YL+WAVH+FRITNC V++TTQIHTHMCYSNFN
Sbjct  664   EKAGITVIQIDEAALREGLPLRRSEQELYLDWAVHAFRITNCDVRDTTQIHTHMCYSNFN  723

Query  2081  DIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR  2260
             DII+SII+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS EEIA+R
Sbjct  724   DIINSIINMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSAEEIAER  783

Query  2261  INKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             INKMLAVLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK IR+QL K
Sbjct  784   INKMLAVLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLIRSQLNK  832



>emb|CDY16584.1| BnaC09g36890D [Brassica napus]
Length=945

 Score =  1272 bits (3292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/769 (79%), Positives = 687/769 (89%), Gaps = 0/769 (0%)
 Frame = +2

Query  101   P*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGI  280
             P R   M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ V+ADLR SIWK MA  GI
Sbjct  176   PLRPRAMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGI  235

Query  281   KFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFD  460
             K+IPSNTFSYYD +LDTTAMLGAVP RY W  GE+GFD YFSMARGN SVPAMEMTKWFD
Sbjct  236   KYIPSNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFD  295

Query  461   TNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKS  640
             TNYH+IVPELGP VKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAK V+KS
Sbjct  296   TNYHYIVPELGPSVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKS  355

Query  641   FPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFG  820
             F LLSL+DKILP+YKEV+++LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   
Sbjct  356   FCLLSLIDKILPVYKEVLTDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLA  415

Query  821   GLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVD  1000
             GLNVL+ TYFAD+PAEA+K LT+LK VT FGFDL+RG +++DLIK  FP GK LFAGVVD
Sbjct  416   GLNVLIATYFADVPAEAYKALTSLKCVTGFGFDLVRGLETLDLIKVDFPRGKLLFAGVVD  475

Query  1001  GRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFA  1180
             GRNIWANDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDL+NE KLD E+KSWLAFA
Sbjct  476   GRNIWANDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLLNEIKLDKELKSWLAFA  535

Query  1181  AQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRAT  1360
             AQKVVEV ALA++  G KDEA F++N+  QASR+SSPRVTN ++Q   AA+  SDHRR+T
Sbjct  536   AQKVVEVYALARSFSGVKDEAMFASNSMRQASRRSSPRVTNATIQHNVAAVMKSDHRRST  595

Query  1361  NVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKV  1540
              VSARL AQQKKLNLP LPTTTIGSFPQT +LRR+R+E+KA KISE +YV+A+K E  KV
Sbjct  596   KVSARLQAQQKKLNLPPLPTTTIGSFPQTADLRRIRKEFKARKISEIDYVQAVKVEFEKV  655

Query  1541  VKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSR  1720
             VKLQEEL IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSR
Sbjct  656   VKLQEELGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSR  715

Query  1721  PKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL  1900
             PK MTVFWSS AQ MT+RPMKGMLTGPVTILNWSFVRNDQPR+ETC+QIALAIKDEV+DL
Sbjct  716   PKAMTVFWSSMAQKMTERPMKGMLTGPVTILNWSFVRNDQPRYETCFQIALAIKDEVKDL  775

Query  1901  EKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFN  2080
             EKA I VIQIDEAALREGLPLR++E   YL+WAVH+FRITNC V++TTQIHTHMCYSNFN
Sbjct  776   EKAGITVIQIDEAALREGLPLRRSEQELYLDWAVHAFRITNCDVRDTTQIHTHMCYSNFN  835

Query  2081  DIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR  2260
             DII+SII+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS+EEIA+R
Sbjct  836   DIINSIINMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSSEEIAER  895

Query  2261  INKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             INKMLAVLD+ +LWVNPDCGLKTRKY+EVK AL NMV+A K IR+QL K
Sbjct  896   INKMLAVLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAATKLIRSQLNK  944



>ref|XP_009120746.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase 3, chloroplastic-like isoform X2 [Brassica 
rapa]
Length=808

 Score =  1272 bits (3291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/769 (79%), Positives = 687/769 (89%), Gaps = 0/769 (0%)
 Frame = +2

Query  101   P*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGI  280
             P R   M+SHIVGYPR+GPKRELKFALESFWDGK+ AEDLQ V+ADLR SIWK MA  G 
Sbjct  39    PLRPRPMSSHIVGYPRIGPKRELKFALESFWDGKTGAEDLQNVAADLRRSIWKHMAGVGN  98

Query  281   KFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFD  460
             K+IPSNTFSYYD +LDTTAMLGAVP RY W  GE+GFD YFSMARGN SVPAMEMTKWFD
Sbjct  99    KYIPSNTFSYYDQMLDTTAMLGAVPSRYGWESGEVGFDVYFSMARGNDSVPAMEMTKWFD  158

Query  461   TNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKS  640
             TNYH+IVPELGP VKFSYASHKAV E+KEAKALG++TVPVL+GP++YLLLSKPAK V+KS
Sbjct  159   TNYHYIVPELGPHVKFSYASHKAVEEFKEAKALGIDTVPVLIGPMTYLLLSKPAKDVDKS  218

Query  641   FPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFG  820
             F LLSL+DKILP+YKEV+++LK AGA WIQFDEP LVMDL+++QL+AF+ AY+ +ES   
Sbjct  219   FCLLSLIDKILPVYKEVLTDLKSAGARWIQFDEPILVMDLDTNQLQAFSDAYSHMESSLA  278

Query  821   GLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVD  1000
             GLNVL+ TYFAD+PAEA+K LT+LK VT FGFDL+RG +++DLIK  FP GK LFAGVVD
Sbjct  279   GLNVLIATYFADVPAEAYKALTSLKCVTGFGFDLVRGLETLDLIKVDFPRGKLLFAGVVD  338

Query  1001  GRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFA  1180
             GRNIWANDL+ SL TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFA
Sbjct  339   GRNIWANDLSASLKTLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEIKLDKELKSWLAFA  398

Query  1181  AQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRAT  1360
             AQKVVEVNALA++  G KDEA F++N+  QASR+SSPRVTN ++Q   AA+  SDHRR+T
Sbjct  399   AQKVVEVNALARSFSGVKDEALFASNSMRQASRRSSPRVTNATIQHNVAAVIKSDHRRST  458

Query  1361  NVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKV  1540
              VSARL AQQKKLNLP LPTTTIGSFPQT +LRR+R+E+KA KISE +YV+AIK E  KV
Sbjct  459   KVSARLQAQQKKLNLPPLPTTTIGSFPQTPDLRRIRKEFKARKISEIDYVQAIKVEFEKV  518

Query  1541  VKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSR  1720
             VKLQEEL IDVLVHGE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGDVSR
Sbjct  519   VKLQEELGIDVLVHGEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDVSR  578

Query  1721  PKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL  1900
             PK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR+ETC+QIALAIKDEV+DL
Sbjct  579   PKAMTVFWSSMAQKMTKRPMKGMLTGPVTILNWSFVRNDQPRYETCFQIALAIKDEVKDL  638

Query  1901  EKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFN  2080
             EKA I VIQIDEAALREGLPLR++E   YL+WAVH+FRITNC V++TTQIHTHMCYSNFN
Sbjct  639   EKAGITVIQIDEAALREGLPLRRSEQELYLDWAVHAFRITNCDVRDTTQIHTHMCYSNFN  698

Query  2081  DIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR  2260
             DII+SII+MDADVITIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPS EEIA+R
Sbjct  699   DIINSIINMDADVITIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSAEEIAER  758

Query  2261  INKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             INKMLAVLD+ +LWVNPDCGLKTRKY+EVK AL NMV+AAK IR+QL K
Sbjct  759   INKMLAVLDSKVLWVNPDCGLKTRKYSEVKSALSNMVAAAKLIRSQLNK  807



>emb|CCC42221.1| vitamin-b12 independent methionine synthase [Pinus pinaster]
Length=766

 Score =  1257 bits (3252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/763 (80%), Positives = 681/763 (89%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+ PKRELKFALESFWDGKSSA +LQ V+ +LRA+ WKQMADAG+ +IPSN
Sbjct  1     MASHVVGYPRIAPKRELKFALESFWDGKSSATELQNVAKNLRAATWKQMADAGLTYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVPPRY W GGEIGFDTYFSMARGNA +PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPPRYGWTGGEIGFDTYFSMARGNAKLPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP++KF Y+SHKAV EYKEAK +G+ETVPV++GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPEIKFKYSSHKAVDEYKEAKEIGIETVPVIIGPVSYLLLSKPAKGVPKTFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKEV+ ELK AGA+WIQFDEP+LVMDLE+H L AF KAY+ LE    G  +LV
Sbjct  181   LDSILPVYKEVLGELKEAGATWIQFDEPSLVMDLEAHHLNAFCKAYSFLEEVLVGTKLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKG-GFPSGKYLFAGVVDGRNIW  1015
             ETYFADIP E ++T+  LK ++A G DL+RGTK+++L+K  GFP  KYLFAGV+DGRNIW
Sbjct  241   ETYFADIPVETYRTIIQLKAISAIGLDLVRGTKTLNLVKTVGFPGDKYLFAGVIDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S S L+ L+  V K K+VVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKV+
Sbjct  301   ANDLAASFSILRDLQTSVDKGKIVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVL  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV ALAKAL GQ D A+F+ANAAA +SRK+SPRV N++VQKAA ALKGSDHRRAT V  R
Sbjct  361   EVVALAKALIGQADRAYFAANAAAISSRKTSPRVNNKAVQKAAEALKGSDHRRATPVVVR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQKKLNLP+LPTTTIGSFPQTVELRRVRREYK+NKISE +Y+++I++EI+KVVKLQE
Sbjct  421   LDKQQKKLNLPILPTTTIGSFPQTVELRRVRREYKSNKISEADYIQSIQQEIAKVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             +LDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRPKPMT
Sbjct  481   DLDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ +T RPMKGMLTGPVTILNWSFVR+DQPR ET  QIALAIKDEVEDLE A I
Sbjct  541   VFWSKYAQSLTARPMKGMLTGPVTILNWSFVRDDQPRSETSMQIALAIKDEVEDLEAAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRKAE A YL WAVH FRITNCGV++TTQIHTHMCYSNFNDIIHS
Sbjct  601   QVIQIDEAALREGLPLRKAEQAHYLEWAVHGFRITNCGVKDTTQIHTHMCYSNFNDIIHS  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLL VF+EGVKYGAGIGPGVYDIHSPRIP TEEIADRI K+L
Sbjct  661   IIDMDADVITIENSRSDEKLLRVFQEGVKYGAGIGPGVYDIHSPRIPDTEEIADRIRKLL  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL+TNILWVNPDCGLKTRKY EV PAL NMV++AK +RT+LA
Sbjct  721   AVLETNILWVNPDCGLKTRKYDEVVPALTNMVASAKLLRTELA  763



>ref|XP_003592244.1| Methionine synthase [Medicago truncatula]
Length=765

 Score =  1248 bits (3230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/759 (81%), Positives = 663/759 (87%), Gaps = 48/759 (6%)
 Frame = +2

Query  128   HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFS  307
             HIVGYPRMGPKRELKFALESFWDGKSSAE+L++V+A+LR++IWKQMADAGI+ IPSNTFS
Sbjct  52    HIVGYPRMGPKRELKFALESFWDGKSSAEELKQVAANLRSAIWKQMADAGIQHIPSNTFS  111

Query  308   YYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPE  487
             YYD VLDTTAMLGAVP RY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFIVPE
Sbjct  112   YYDQVLDTTAMLGAVPDRYKWNGGEIGFDIYFSMARGNASVPAMEMTKWFDTNYHFIVPE  171

Query  488   LGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDK  667
             LGPDVKFSYASHKAV EY EAKALGV TVPVLVGPVSYLLLSKPAKGVEKSF LLSL+DK
Sbjct  172   LGPDVKFSYASHKAVDEYNEAKALGVNTVPVLVGPVSYLLLSKPAKGVEKSFSLLSLIDK  231

Query  668   ILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETY  847
             ILP+YKEV++ELK AGA+WIQFDEP LV DL++HQL+AF  AYAELES   GLNVLVETY
Sbjct  232   ILPVYKEVVTELKTAGATWIQFDEPTLVKDLDAHQLQAFNYAYAELESTLSGLNVLVETY  291

Query  848   FADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDL  1027
             FAD+PAEA+KTLT+LK VTA+GFDL+RGTK++DLIK GFPSGK LFAG+VDGRNIWAN+L
Sbjct  292   FADVPAEAYKTLTSLKAVTAYGFDLVRGTKTLDLIKQGFPSGKLLFAGIVDGRNIWANNL  351

Query  1028  AGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNA  1207
               SL+TLK L DIVGK+K+VVSTSCSLLHTAVDL                  QK+VEVNA
Sbjct  352   ESSLNTLKELGDIVGKEKVVVSTSCSLLHTAVDL-----------------QQKIVEVNA  394

Query  1208  LAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQ  1387
             L+KAL GQKDE +FS+NAAA  SRKSSPRVTNE VQKAAAALKGSDHRR T+VS+RLDAQ
Sbjct  395   LSKALSGQKDEVYFSSNAAALVSRKSSPRVTNEDVQKAAAALKGSDHRRVTSVSSRLDAQ  454

Query  1388  QKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDI  1567
             QKKLNLP LPTTTIGSFPQT +LRRVRRE+KA KISEE+Y++ IKEEI+ VVK+QEELDI
Sbjct  455   QKKLNLPSLPTTTIGSFPQTADLRRVRREFKAKKISEEDYIRFIKEEINNVVKIQEELDI  514

Query  1568  DVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  1747
             DVLVHGEPERNDMVEYFGEQLSGF FTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS
Sbjct  515   DVLVHGEPERNDMVEYFGEQLSGFTFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWS  574

Query  1748  SAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQ  1927
             S AQ +TKRPMKGMLTGPVTILNWSFVR+DQPRFETCYQIALAIKDEVEDLEKA I VIQ
Sbjct  575   STAQSLTKRPMKGMLTGPVTILNWSFVRDDQPRFETCYQIALAIKDEVEDLEKAGITVIQ  634

Query  1928  IDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDM  2107
             IDEAALREGLPLRK+E +FYLNWAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSIIDM
Sbjct  635   IDEAALREGLPLRKSEESFYLNWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDM  694

Query  2108  DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLD  2287
             DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEEI            
Sbjct  695   DADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEI------------  742

Query  2288  TNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
                                VKPAL NMV AAK IR QLA
Sbjct  743   -------------------VKPALTNMVDAAKLIRKQLA  762



>ref|XP_010036240.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=767

 Score =  1236 bits (3199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/763 (80%), Positives = 677/763 (89%), Gaps = 3/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGY RMGPKRELKFALESFWDGKS+A+DLQKV ADLR+SIWKQMA A IK++PSN
Sbjct  1     MASHVVGYTRMGPKRELKFALESFWDGKSTAKDLQKVGADLRSSIWKQMASACIKYVPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSY+D VLD TAMLGAV  +Y W GGEIGFD YF MARG  SVPAMEM KWFDTNYH++
Sbjct  61    TFSYFDQVLDATAMLGAVSAQYGWNGGEIGFDVYFPMARGTVSVPAMEMAKWFDTNYHYV  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV+FSYAS KAVTEY+EA+ LGV+TVPVL+GPVSYLLLSKPAKGVE +F  LSL
Sbjct  121   VPELGPDVRFSYASRKAVTEYREAQKLGVDTVPVLIGPVSYLLLSKPAKGVETTFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEV+SELK AGASWIQFDEP LV+DL+S QL+AFT+AY ELESC  G+NVLV
Sbjct  181   LGKILPIYKEVVSELKAAGASWIQFDEPTLVLDLDSPQLQAFTEAYLELESCLSGVNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             +TYFAD+PAEA++ LT+LKGVT FGFDL+ G K+++LIKGGFP+G YLFAGVVDGRNIWA
Sbjct  241   QTYFADVPAEAYEVLTSLKGVTGFGFDLVSGIKTLELIKGGFPTGMYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA +LSTL +LE IVGKDK+VVS SCSLLHTAVDLVNET+LD EIKSWLAFA+QKV+E
Sbjct  301   NDLAETLSTLHALESIVGKDKVVVSISCSLLHTAVDLVNETELDEEIKSWLAFASQKVLE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQKDEAFFSANAAAQASRKSSPRVTNE+VQKAAAAL+G DHRRAT VSARL
Sbjct  361   VSALAKALAGQKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALRGFDHRRATTVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQ  L LPV+PTT IGSFPQT ELR+V  EYK  KISEEEYV AIKEEI+KVVKLQEE
Sbjct  421   GAQQTTLTLPVIPTTIIGSFPQTEELRKVHSEYKDKKISEEEYVMAIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERN MVEYF EQL GFAFT NGWVQSYGS CVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNGMVEYFAEQLLGFAFTVNGWVQSYGSHCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGML GP+TILN SFVRNDQPRFETCYQIALAIKDEV+DLEKA IN
Sbjct  541   FWSTTAQSMTARPMKGMLIGPITILNCSFVRNDQPRFETCYQIALAIKDEVKDLEKAGIN  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             +IQIDEAALREGLPLRK+E + YL+WAVHSFRIT+CG+++TTQIHTH+CYS+FNDII SI
Sbjct  601   IIQIDEAALREGLPLRKSEQSLYLDWAVHSFRITHCGIKDTTQIHTHLCYSHFNDIILSI  660

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVIT ENS SDEKLLSVFR+GV+YGAGIGP VYDI+S  IPS EEIA+R  KML 
Sbjct  661   IDMDADVITRENSGSDEKLLSVFRKGVQYGAGIGPSVYDINSLMIPSAEEIAERTTKMLT  720

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
                TN+LW NPD  LKTRK+T VK AL+  V+AA+ + T+LA+
Sbjct  721   ---TNVLWFNPDFVLKTRKHTGVKLALKIFVAAAELLCTRLAE  760



>gb|ABG22093.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=716

 Score =  1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/683 (90%), Positives = 644/683 (94%), Gaps = 1/683 (0%)
 Frame = +2

Query  359   RYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTE  538
             RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFIVPELGP+ KFSY+SHKAV E
Sbjct  31    RYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFIVPELGPNTKFSYSSHKAVNE  90

Query  539   YKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGA  718
             YKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSLL  ILP+YKEVI+ELK AGA
Sbjct  91    YKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSLLSSILPVYKEVIAELKAAGA  150

Query  719   SWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKG  898
             +WIQFDEP LV+DL+SHQL AF+ AY ELES   GLNVL+ETYFADIPAE++KTLT+L  
Sbjct  151   TWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLIETYFADIPAESYKTLTSLNS  210

Query  899   VTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGK  1075
             VTA+GFDLIRG K++DLIK  GFPSGKYLFAGVVDGRNIWA+DLA SL+TL+SLE IVGK
Sbjct  211   VTAYGFDLIRGAKTLDLIKSAGFPSGKYLFAGVVDGRNIWADDLAASLTTLESLEAIVGK  270

Query  1076  DKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsa  1255
             DKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVVEVNALAKAL GQKDEA+F+A
Sbjct  271   DKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVVEVNALAKALAGQKDEAYFAA  330

Query  1256  naaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGS  1435
             NAAAQASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGS
Sbjct  331   NAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGS  390

Query  1436  FPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEY  1615
             FPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QEELDIDVLVHGEPERNDMVEY
Sbjct  391   FPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQEELDIDVLVHGEPERNDMVEY  450

Query  1616  FGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLT  1795
             FGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMTVFWS  AQ MT RPMKGMLT
Sbjct  451   FGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWSKLAQSMTSRPMKGMLT  510

Query  1796  GPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAE  1975
             GPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I VIQIDEAALREGLPLRKAE
Sbjct  511   GPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGIQVIQIDEAALREGLPLRKAE  570

Query  1976  HAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKL  2155
             HAFYL+WAVHSFRITNCGVQ+TTQIHTHMCYSNFNDIIHSII+MDADVITIENSRSDEKL
Sbjct  571   HAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKL  630

Query  2156  LSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRK  2335
             LSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADR+NKMLAVLDTNILWVNPDCGLKTRK
Sbjct  631   LSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRVNKMLAVLDTNILWVNPDCGLKTRK  690

Query  2336  YTEVKPALENMVSAAKKIRTQLA  2404
             Y EVKPAL NMVSAAK IRTQLA
Sbjct  691   YNEVKPALTNMVSAAKLIRTQLA  713



>emb|CBI31233.3| unnamed protein product [Vitis vinifera]
Length=669

 Score =  1221 bits (3158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/666 (89%), Positives = 636/666 (95%), Gaps = 0/666 (0%)
 Frame = +2

Query  407   MARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLV  586
             MARGNASVPAMEMTKWFDTNYH+IVPELGP+VKFSYASHKAV EY+EAKALGV+TVPV V
Sbjct  1     MARGNASVPAMEMTKWFDTNYHYIVPELGPEVKFSYASHKAVKEYQEAKALGVDTVPVFV  60

Query  587   GPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLES  766
             GPVSYLLLSKPAKGVEKSF LLSLLDKILPIYKEV++ELK AGAS IQFDEP LVMDL+S
Sbjct  61    GPVSYLLLSKPAKGVEKSFSLLSLLDKILPIYKEVVAELKAAGASSIQFDEPTLVMDLDS  120

Query  767   HQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSID  946
             H+L+AFT AY+ELE+   GLNV+VETYFAD+P+EAFKTLT+LKGVT FGFDL+RGTK++D
Sbjct  121   HKLQAFTHAYSELEASCSGLNVIVETYFADVPSEAFKTLTSLKGVTGFGFDLVRGTKTLD  180

Query  947   LIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVD  1126
             LIK GFP+GKYLFAGVVDGRNIWANDLA SLS L+ LE IVGKDKLVVSTSCSLLHTAVD
Sbjct  181   LIKVGFPTGKYLFAGVVDGRNIWANDLAASLSVLQELESIVGKDKLVVSTSCSLLHTAVD  240

Query  1127  LVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNE  1306
             L+NE KLD EIKSWLAFAAQK+VEVNALAKAL G K+EAFFS NA+AQASRKSSPRVTNE
Sbjct  241   LINEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKEEAFFSDNASAQASRKSSPRVTNE  300

Query  1307  SVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAN  1486
             +VQKAA+ALKGSDHRRAT+VSARLDAQQ+KL LPVLPTTTIGSFPQT++LRRVRREYKA 
Sbjct  301   AVQKAASALKGSDHRRATDVSARLDAQQRKLKLPVLPTTTIGSFPQTMDLRRVRREYKAK  360

Query  1487  KISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQ  1666
             KISEE+YVKAIKEEI+KVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQ
Sbjct  361   KISEEDYVKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQ  420

Query  1667  SYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPR  1846
             SYGSRCVKPPIIYGDVSRPKPMTVFWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR
Sbjct  421   SYGSRCVKPPIIYGDVSRPKPMTVFWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPR  480

Query  1847  FETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNC  2026
             FETCYQIALAIKDEVEDLEKA I VIQIDEAALREGLPLRK+EHAFYL+WAVHSFRITNC
Sbjct  481   FETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNC  540

Query  2027  GVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG  2206
             GVQ+TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG
Sbjct  541   GVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG  600

Query  2207  VYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKK  2386
             VYDIHSPRIPSTEEIADRINKMLAVL+TNILWVNPDCGLKTRKYTEV PAL+NMV+AAK 
Sbjct  601   VYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVMPALKNMVAAAKL  660

Query  2387  IRTQLA  2404
             +RT+LA
Sbjct  661   LRTELA  666



>gb|KCW47766.1| hypothetical protein EUGRSUZ_K01515 [Eucalyptus grandis]
Length=749

 Score =  1219 bits (3154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/762 (80%), Positives = 664/762 (87%), Gaps = 21/762 (3%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGP+RELKFALESFWDGKSS EDLQKV+ADLR+S WKQMADAGIK++PSN
Sbjct  1     MASHVVGYPRMGPQRELKFALESFWDGKSSTEDLQKVAADLRSSTWKQMADAGIKYVPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYDHVLDTTAMLGAVP RY W GGEIG D YF MARGNASVPAMEM KWFD++Y+  
Sbjct  61    TFSYYDHVLDTTAMLGAVPTRYGWEGGEIGLDVYFLMARGNASVPAMEMAKWFDSSYYLF  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             +         SYA  +          LGV+TVPVL+GPVSYLLLSKPAKGVEKSF  LSL
Sbjct  121   LN--------SYAKFQ----------LGVDTVPVLLGPVSYLLLSKPAKGVEKSFSPLSL  162

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIY+EV+SELK AGASWIQFDEP LV+DL+SH+L+AFT+AY+ELESC  G+NVLV
Sbjct  163   LHKILPIYREVVSELKAAGASWIQFDEPTLVLDLDSHRLQAFTEAYSELESCLSGVNVLV  222

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             +TYFAD+PAEA++ LT+LKGV  FGFDL+RGTK++DLIKGGFP  KYLFAGVVDGRNIWA
Sbjct  223   QTYFADVPAEAYRVLTSLKGVAGFGFDLVRGTKTLDLIKGGFPKEKYLFAGVVDGRNIWA  282

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL++LE IVGKDKLVVSTSCSLLHT VDL NET+LD EIKSWLAFAAQKVVE
Sbjct  283   NDLAQSLGTLRALESIVGKDKLVVSTSCSLLHTPVDLFNETELDEEIKSWLAFAAQKVVE  342

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDEAFFSANAA+QASRKSSPRVTNE+VQKA AAL G DH RAT VSARL
Sbjct  343   VNALAKALAGKKDEAFFSANAASQASRKSSPRVTNEAVQKATAALTGYDHHRATTVSARL  402

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLPV+PTTTIGSFPQ+ ELRRV R YK  K+S EEYVKAIK EI KV+KLQEE
Sbjct  403   DAQQKKLNLPVIPTTTIGSFPQSEELRRVHRGYKDKKMSWEEYVKAIKVEIKKVIKLQEE  462

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERN+MVEYFGEQLSG  FT NGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  463   LDIDVLVHGEPERNNMVEYFGEQLSGLVFTVNGWVQSYGSRCVKPPIIYGDVSRPKPMTV  522

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKA IN
Sbjct  523   FWSTMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGIN  582

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDE ALREGLPLRK+E +FYL WAVHSFRITNCGV++TTQIHTH+CY + +DII SI
Sbjct  583   VIQIDEEALREGLPLRKSEQSFYLEWAVHSFRITNCGVKDTTQIHTHVCYCHIDDIIPSI  642

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             +D+DADVITIENSRSDEKLLSV  EGVKYGAGI P VYDIHS  IPS EEIADR  KML 
Sbjct  643   LDVDADVITIENSRSDEKLLSVSHEGVKYGAGIVPSVYDIHSLIIPSAEEIADRTIKMLT  702

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
                TNILW NPD  LKTRK+T VK AL+ MV AAK +RT+LA
Sbjct  703   ---TNILWFNPDFVLKTRKHTGVKRALKIMVVAAKLLRTELA  741



>gb|KCW45140.1| hypothetical protein EUGRSUZ_L01249 [Eucalyptus grandis]
Length=765

 Score =  1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/762 (80%), Positives = 661/762 (87%), Gaps = 8/762 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPR+GP RELKFALESFW   S+AEDL +  A L++SIWKQMA   IK+IPSN
Sbjct  1     MASHVVGYPRVGPNRELKFALESFWHRMSTAEDLLEAGAHLKSSIWKQMAAVNIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFS YD VLD TAMLGAVPPRY W GG+IGFD YFSMARG ASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSCYDQVLDITAMLGAVPPRYGWNGGKIGFDVYFSMARGTASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYAS KAV E KEAK LGV+TVPVL+GPVSYLLLSKPAKGVE +F  LSL
Sbjct  121   VPELGPDVNFSYASRKAVKECKEAKKLGVDTVPVLLGPVSYLLLSKPAKGVETTFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K  P    V+SELK AGASWIQFDEP LV+DL+SHQL+AFT+AY+ELESC   +NVLV
Sbjct  181   LRKYFP--STVVSELKAAGASWIQFDEPALVLDLDSHQLQAFTEAYSELESCLSSVNVLV  238

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+K LT+LKGVT FGFDL+RGT  +DLIKGGFP+GKYLFAGVVDGRNIWA
Sbjct  239   ETYFADVPAEAYKVLTSLKGVTGFGFDLVRGTDILDLIKGGFPTGKYLFAGVVDGRNIWA  298

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLAGSLSTL +LE IVGKDKLVVSTSCSLLHT VDLVNET+LD EIKSW AFAAQKVVE
Sbjct  299   NDLAGSLSTLHALESIVGKDKLVVSTSCSLLHTPVDLVNETELDEEIKSWFAFAAQKVVE  358

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL G+KDE FFSANAAAQASRKSSPRVTNE+VQKAAAAL+GSDH RAT VSARL
Sbjct  359   VNALAKALAGEKDEEFFSANAAAQASRKSSPRVTNEAVQKAAAALRGSDHCRATTVSARL  418

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
              AQQKKLNLPVLPTTTIGSFPQT+ELRRVRREYKA KISEEEYVKAIKEEI+KVVKLQEE
Sbjct  419   HAQQKKLNLPVLPTTTIGSFPQTIELRRVRREYKAKKISEEEYVKAIKEEINKVVKLQEE  478

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERND++EYFGEQL GFAFT NGWVQSYGS CVKPPI+YGDVSRPKPMTV
Sbjct  479   LDIDVLVHGEPERNDIIEYFGEQLLGFAFTMNGWVQSYGSHCVKPPIVYGDVSRPKPMTV  538

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RP+KGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEV+DLEKA IN
Sbjct  539   FWSTMAQSMTARPVKGMLTGPVTILNWSFVRNDQPRSETCYQIALAIKDEVDDLEKAGIN  598

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             VIQIDEAALREGLPLRK+E  FYL+WAVHSFRITNCGV++TTQIHTH+CYS+FNDI   I
Sbjct  599   VIQIDEAALREGLPLRKSEQTFYLDWAVHSFRITNCGVKDTTQIHTHVCYSHFNDISRLI  658

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             IDMDADVIT EN   D KLL +  EGV+Y A IGP      S RI S EEIAD I K   
Sbjct  659   IDMDADVITTENVSPDGKLLLISCEGVEYLARIGP------SLRITSAEEIADGITKTFD  712

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
               +   +WV PDC LKTR+YTEVKPAL NMV+A K +R QLA
Sbjct  713   WREPKRVWVIPDCLLKTREYTEVKPALANMVTATKHVRAQLA  754



>ref|XP_001757366.1| predicted protein [Physcomitrella patens]
 gb|EDQ77851.1| predicted protein [Physcomitrella patens]
Length=762

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/764 (77%), Positives = 668/764 (87%), Gaps = 3/764 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALES WDGK+ A DL++V+ DLRASIWKQMA+AG+  IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESMWDGKTQAADLEQVAKDLRASIWKQMAEAGVSMIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVP RY W GGEIG D YFSMARGN + PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPARYEWTGGEIGHDVYFSMARGNKTKPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL  + KF Y+S KAV+EYKEAKALGV+TVPVLVGPV+YLLLSK  K   K F  LSL
Sbjct  121   VPELSSETKFMYSSRKAVSEYKEAKALGVDTVPVLVGPVTYLLLSKGDKSAPKGFDTLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKEVI+ELK AGASWIQ DEP LVMDLE+ Q EAF KAYA L     G+ +L+
Sbjct  181   LDAILPVYKEVITELKEAGASWIQLDEPKLVMDLEAAQYEAFKKAYAVLGE-LSGVKLLL  239

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLI-KGGFPSGKYLFAGVVDGRNIW  1015
             ETYF D+PAEA+KTL  L  ++ FG DL+RG+K++ +I + G P+GK LFAGVVDGRNIW
Sbjct  240   ETYFTDLPAEAYKTLCGLP-ISGFGVDLVRGSKTLSIIHEQGLPAGKTLFAGVVDGRNIW  298

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S++ ++ L+  +GK+ +VVSTSCSLLH+AVDL NETKLD+E+KSW+AFAAQK++
Sbjct  299   ANDLAASVAVVEELQAKLGKENVVVSTSCSLLHSAVDLKNETKLDSELKSWMAFAAQKLL  358

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV A+AKA+ G+KDE FFSANAAAQASR++SPRV N++V++ AA+L GS+HRRAT VS+R
Sbjct  359   EVVAIAKAVSGEKDEEFFSANAAAQASRRNSPRVHNKAVKELAASLAGSEHRRATPVSSR  418

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQK LNLP+LPTTTIGSFPQT ELRRVRRE K+ KISEE+Y KAIK EI  VVKLQE
Sbjct  419   LDQQQKHLNLPILPTTTIGSFPQTPELRRVRREVKSKKISEEDYDKAIKAEIDSVVKLQE  478

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQL GF F+ANGWVQSYGSRCVKPPII+GDVSRPK MT
Sbjct  479   ELDIDVLVHGEPERNDMVEYFGEQLDGFCFSANGWVQSYGSRCVKPPIIFGDVSRPKAMT  538

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             V+WS+ AQ +TKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQI+LAIKDEVEDLEKANI
Sbjct  539   VYWSTYAQSVTKRPMKGMLTGPVTILNWSFVRNDQPRSETCYQISLAIKDEVEDLEKANI  598

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHA YL WAVH FRIT CGV++TTQIHTHMCYSNFNDIIHS
Sbjct  599   TVIQIDEAALREGLPLRKSEHADYLRWAVHGFRITTCGVKDTTQIHTHMCYSNFNDIIHS  658

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEE+ADR  KML
Sbjct  659   IIDMDADVITIENSRSDEKLLSVFREGVHYGAGIGPGVYDIHSPRIPPTEEMADRARKML  718

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             AVL++ +LW+NPDCGLKTRKY EV PAL NMV+AAK++R +LAK
Sbjct  719   AVLESKVLWINPDCGLKTRKYGEVVPALTNMVNAAKQLRAELAK  762



>ref|XP_001758527.1| predicted protein [Physcomitrella patens]
 gb|EDQ76505.1| predicted protein [Physcomitrella patens]
Length=762

 Score =  1204 bits (3115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/764 (77%), Positives = 662/764 (87%), Gaps = 3/764 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALES WDGK+ A DL++V+ DLRASIWKQM++AG+  IPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESMWDGKTQAADLEQVAKDLRASIWKQMSEAGVSMIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVP RY W GGEIG D YFSMARGN + PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPSRYEWTGGEIGHDVYFSMARGNKTKPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL  + KF Y+S KAV+EY EAKALG++TVPVLVGPV+YLLLSK  K   K F  LSL
Sbjct  121   VPELSGETKFVYSSRKAVSEYNEAKALGIDTVPVLVGPVTYLLLSKGDKSAPKGFNTLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKE I+ELKGAGASWIQ DEP LVMDLES Q EAF KAYA L S   G+ +LV
Sbjct  181   LDAILPVYKEAITELKGAGASWIQLDEPKLVMDLESAQYEAFKKAYAVL-SEVSGVKLLV  239

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYF D+P EA+KTL  L  +  FG DL+RG+K++ +IK    P+GK LFAGVVDGRNIW
Sbjct  240   ETYFTDLPVEAYKTLCDLP-IAGFGVDLVRGSKTLAVIKEHALPTGKTLFAGVVDGRNIW  298

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S++T+K L+  +GKD +VVSTSCSLLH+AVDL NETKLDNE+KSW+AFAAQK+V
Sbjct  299   ANDLAASVNTVKELQASLGKDNVVVSTSCSLLHSAVDLKNETKLDNELKSWMAFAAQKLV  358

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV A+A A+ G KDE +F+ANAAAQASR++SPRV N++V++ AA L GS+HRRAT VS R
Sbjct  359   EVVAIANAVSGNKDEEYFAANAAAQASRRNSPRVHNKAVKELAAGLAGSEHRRATPVSTR  418

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L+ QQK LNLP+LPTTTIGSFPQT ELRRVRRE K+ KISEE+Y KAIK EI  VVKLQE
Sbjct  419   LEEQQKYLNLPILPTTTIGSFPQTPELRRVRREVKSKKISEEDYDKAIKAEIDSVVKLQE  478

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQL GF F+ANGWVQSYGSRCVKPPII+GDVSRPK MT
Sbjct  479   ELDIDVLVHGEPERNDMVEYFGEQLDGFCFSANGWVQSYGSRCVKPPIIFGDVSRPKAMT  538

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             V+WSS AQ +TKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQI+LAIKDEVEDLEKANI
Sbjct  539   VYWSSYAQSVTKRPMKGMLTGPVTILNWSFVRNDQPRSETCYQISLAIKDEVEDLEKANI  598

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHA YL WAVH FRIT CGV++TTQIHTHMCYSNFNDIIHS
Sbjct  599   TVIQIDEAALREGLPLRKSEHADYLRWAVHGFRITTCGVKDTTQIHTHMCYSNFNDIIHS  658

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEE+ADR  KML
Sbjct  659   IIDMDADVITIENSRSDEKLLSVFREGVHYGAGIGPGVYDIHSPRIPPTEEMADRARKML  718

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             AVL++ +LW+NPDCGLKTRKY EV PAL NMV+AAK++R +LAK
Sbjct  719   AVLESKVLWINPDCGLKTRKYGEVVPALTNMVNAAKQLRAELAK  762



>ref|XP_002993286.1| hypothetical protein SELMODRAFT_162950 [Selaginella moellendorffii]
 gb|EFJ05611.1| hypothetical protein SELMODRAFT_162950 [Selaginella moellendorffii]
Length=766

 Score =  1199 bits (3103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/763 (78%), Positives = 664/763 (87%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHI GYPRMGPKRELKFALESFWDGKSSA DL+K + DLRASIWKQM+DAG+ FIPSN
Sbjct  1     MASHIAGYPRMGPKRELKFALESFWDGKSSAADLEKTAKDLRASIWKQMSDAGVSFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVPPRY W GG++ FDTYFSMARGNA  PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPPRYGWTGGDVAFDTYFSMARGNAKQPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKF+ +S K + EY EAK LG+ETVPVLVGP +YL L+KPAKGV K F LL L
Sbjct  121   VPELGPEVKFTLSSRKVLEEYTEAKELGIETVPVLVGPFTYLSLAKPAKGVAKDFDLLGL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+ +LP+YKEVI ELK AGA WIQFDEP LV+DLESH+ + F KAY++L   FG L +LV
Sbjct  181   LEDLLPVYKEVIGELKSAGAKWIQFDEPALVLDLESHKYDVFKKAYSDLAPSFGDLKLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
              TYFAD+PA A++ LT L+ V   G DL+RGTK+++LIK  GFPS K LFAGVVDGRNIW
Sbjct  241   VTYFADLPAPAYELLTGLECVDGVGLDLVRGTKTVELIKVAGFPSSKKLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SL+ L  LE  +GK  +VVSTS SLLHTAVDL NETKLD E+KSWLAFAAQK+V
Sbjct  301   ANDLASSLTLLGELESKLGKGNVVVSTSSSLLHTAVDLKNETKLDAELKSWLAFAAQKIV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV +LA AL G+KDE FF+ANA+AQASRK+SPRV N+ V+KAAAAL+GS+HRRAT V+ R
Sbjct  361   EVVSLAGALGGKKDEEFFAANASAQASRKTSPRVHNDEVKKAAAALQGSEHRRATPVADR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQK L LP+LPTTTIGSFPQT +LRRVRR+ K+ KISEEEYVKAIK EI+ VVKLQE
Sbjct  421   LDEQQKHLKLPILPTTTIGSFPQTADLRRVRRDVKSKKISEEEYVKAIKSEIASVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             V WSS +Q +TKRPMKGMLTGPVTILNWSFVRNDQPR +T YQIAL+IK+EVEDLEKA I
Sbjct  541   VEWSSYSQSLTKRPMKGMLTGPVTILNWSFVRNDQPREKTTYQIALSIKEEVEDLEKAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
             +VIQIDEAALREGLPLRK+E A YLNWAVH FRIT+CGV++TTQIHTHMCYS+FNDII +
Sbjct  601   HVIQIDEAALREGLPLRKSEQAAYLNWAVHGFRITSCGVKDTTQIHTHMCYSHFNDIITA  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEE+A+RI KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPDTEEMAERIRKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++ +LWVNPDCGLKTRKY EV PAL NMV AAK +R +LA
Sbjct  721   AVLESKVLWVNPDCGLKTRKYGEVLPALTNMVKAAKILRAELA  763



>gb|KHN34672.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Glycine soja]
Length=667

 Score =  1198 bits (3099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/667 (89%), Positives = 627/667 (94%), Gaps = 0/667 (0%)
 Frame = +2

Query  407   MARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLV  586
             MARGNA+VPAMEMTKWFDTNYHFIVPELGPDV F+YASHKAV EYKEAKALGV+T+PVLV
Sbjct  1     MARGNATVPAMEMTKWFDTNYHFIVPELGPDVNFTYASHKAVDEYKEAKALGVDTIPVLV  60

Query  587   GPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLES  766
             GPV+YLLLSKPAKGVEKSF LLSLL K+L +YKEVI++LK AGASWIQFDEP LV+DLES
Sbjct  61    GPVTYLLLSKPAKGVEKSFSLLSLLPKVLAVYKEVIADLKAAGASWIQFDEPTLVLDLES  120

Query  767   HQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSID  946
             H+L+AFT AYAEL      LNVLVETYFADIPAEA+KTLT+L GVTA+GFDL+RGT ++D
Sbjct  121   HKLQAFTDAYAELAPALSDLNVLVETYFADIPAEAYKTLTSLNGVTAYGFDLVRGTHTLD  180

Query  947   LIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVD  1126
             LIKGGFPSGKYLFAGVVDGRNIWANDLA SL+TL+ LE IVGKDKLVVSTS SLLHTAVD
Sbjct  181   LIKGGFPSGKYLFAGVVDGRNIWANDLAASLTTLQGLEGIVGKDKLVVSTSSSLLHTAVD  240

Query  1127  LVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNE  1306
             LVNETKLD+EIKSWLAFAAQK+VEVNALAKAL G KD AFFSANAAAQASRKSSPRVTNE
Sbjct  241   LVNETKLDDEIKSWLAFAAQKIVEVNALAKALSGNKDVAFFSANAAAQASRKSSPRVTNE  300

Query  1307  SVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAN  1486
             +VQKAAAALKGSDHRRATNVSARLD+QQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KAN
Sbjct  301   AVQKAAAALKGSDHRRATNVSARLDSQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAN  360

Query  1487  KISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQ  1666
             KISEEEYVK+IKEEI KVV+LQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQ
Sbjct  361   KISEEEYVKSIKEEIRKVVELQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQ  420

Query  1667  SYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPR  1846
             SYGSRCVKPPIIYGDVSRPKPMTVFWSS AQ  TKRPMKGMLTGPVTILNWSFVRNDQPR
Sbjct  421   SYGSRCVKPPIIYGDVSRPKPMTVFWSSLAQSFTKRPMKGMLTGPVTILNWSFVRNDQPR  480

Query  1847  FETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNC  2026
              ET YQIAL+IKDEVEDLEKA I VIQIDEAALREGLPLRK+E A YL+WAVH+FRITN 
Sbjct  481   SETTYQIALSIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEQAHYLDWAVHAFRITNV  540

Query  2027  GVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG  2206
             GVQ+TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG
Sbjct  541   GVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPG  600

Query  2207  VYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKK  2386
             VYDIHSPRIP TEEIADRINKMLAVL+ NILWVNPDCGLKTRKYTEVKPAL NMV+AAK 
Sbjct  601   VYDIHSPRIPPTEEIADRINKMLAVLEKNILWVNPDCGLKTRKYTEVKPALTNMVAAAKL  660

Query  2387  IRTQLAK  2407
             IR +LAK
Sbjct  661   IRNELAK  667



>ref|XP_002969765.1| hypothetical protein SELMODRAFT_171028 [Selaginella moellendorffii]
 gb|EFJ28889.1| hypothetical protein SELMODRAFT_171028 [Selaginella moellendorffii]
Length=766

 Score =  1198 bits (3099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/763 (78%), Positives = 663/763 (87%), Gaps = 1/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHI GYPRMGPKRELKFALESFWDGKSSA DL+K + DLRASIWKQM+DAG+ FIPSN
Sbjct  1     MASHIAGYPRMGPKRELKFALESFWDGKSSAADLEKTAKDLRASIWKQMSDAGVSFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVPPRY W GG++ FDTYFSMARGNA  PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPPRYGWTGGDVAFDTYFSMARGNAKQPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKF+ +S K + EY EAK LG+ETVPVLVGP +YL L+KPAKGV K F LL L
Sbjct  121   VPELGPEVKFTLSSRKVLEEYTEAKELGIETVPVLVGPFTYLSLAKPAKGVAKDFDLLGL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L+ +LP+YKEVI ELK AGA WIQFDEP LV+DLESH+ + F KAY++L   FG L +LV
Sbjct  181   LEDLLPVYKEVIGELKSAGAKWIQFDEPALVLDLESHKYDVFKKAYSDLAPSFGDLKLLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
              TYFAD+PA A++ LT L+ V   G DL+RGTK+++LIK  GFPS K LFAGVVDGRNIW
Sbjct  241   VTYFADLPAPAYELLTGLECVDGVGLDLVRGTKTVELIKVAGFPSSKKLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA SL+ L  LE  +GK  +VVSTS SLLHTAVDL NETKLD E+KSWLAFAAQK+V
Sbjct  301   ANDLASSLTLLGELESKLGKGNVVVSTSSSLLHTAVDLKNETKLDAELKSWLAFAAQKIV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV +LA AL G+KDE FF+ANA+AQASRK+SPRV N+ V+KAAAAL+GS+HRRAT V+ R
Sbjct  361   EVVSLAGALGGKKDEEFFAANASAQASRKTSPRVHNDEVKKAAAALQGSEHRRATPVADR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LD QQK L LP+LPTTTIGSFPQT +LRRVRR+ K+ KISEEEYV AIK EI+ VVKLQE
Sbjct  421   LDEQQKHLKLPILPTTTIGSFPQTADLRRVRRDVKSKKISEEEYVTAIKSEIASVVKLQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQL GFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLQGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             V WSS +Q +TKRPMKGMLTGPVTILNWSFVRNDQPR +T YQIAL+IK+EVEDLEKA I
Sbjct  541   VEWSSYSQSLTKRPMKGMLTGPVTILNWSFVRNDQPREKTTYQIALSIKEEVEDLEKAGI  600

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
             +VIQIDEAALREGLPLRK+E A YLNWAVH FRIT+CGV++TTQIHTHMCYS+FNDII +
Sbjct  601   HVIQIDEAALREGLPLRKSEQAAYLNWAVHGFRITSCGVKDTTQIHTHMCYSHFNDIITA  660

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEE+A+RI KML
Sbjct  661   IIDMDADVITIENSRSDEKLLSVFREGVTYGAGIGPGVYDIHSPRIPDTEEMAERIRKML  720

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++ +LWVNPDCGLKTRKY EV PAL NMV AAK +R +LA
Sbjct  721   AVLESKVLWVNPDCGLKTRKYGEVLPALTNMVKAAKILRAELA  763



>ref|XP_001784286.1| predicted protein [Physcomitrella patens]
 gb|EDQ50892.1| predicted protein [Physcomitrella patens]
Length=762

 Score =  1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/763 (77%), Positives = 662/763 (87%), Gaps = 3/763 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             M SH+VGYPRMGPKRELKFALES WDGK+ A DL++V+ DLRASIWKQM++AG+  IPSN
Sbjct  1     MTSHVVGYPRMGPKRELKFALESMWDGKTQAADLEQVAKDLRASIWKQMSEAGVSMIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAM+GAVP RY W GGEIG D YFSMARGN + PAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMVGAVPARYGWTGGEIGHDVYFSMARGNKTKPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPEL  + KF Y+S KAV+EYKEAK LGV+TVPVL+GPV+YLLLSK  K   K F  LSL
Sbjct  121   VPELSGETKFVYSSRKAVSEYKEAKELGVDTVPVLIGPVTYLLLSKGDKSAPKGFNTLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             LD ILP+YKEVI+ELK AGASWIQ DEP LVMDLE+ Q EAF KAYA L      + +LV
Sbjct  181   LDAILPVYKEVITELKEAGASWIQLDEPKLVMDLEASQYEAFKKAYAVLGEV-AQVKLLV  239

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYF D+PAEA+KTL  L  +  FG DL+RG K++ LIK  G P GK LFAGVVDGRNIW
Sbjct  240   ETYFTDLPAEAYKTLCDLP-IAGFGVDLVRGNKTLSLIKEHGLPEGKTLFAGVVDGRNIW  298

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             ANDLA S++ ++ L+  +GKD +VVSTSCSLLH+AVDL NETKLD+E+KSW+AFAAQK++
Sbjct  299   ANDLAASVAVVEELQAKLGKDNVVVSTSCSLLHSAVDLKNETKLDSELKSWMAFAAQKLL  358

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EV A+AKA+ GQKDEAFF+ANA+AQ SR++SPRV N++V++AAAAL GS+HRR+T VS+R
Sbjct  359   EVVAVAKAVSGQKDEAFFAANASAQESRRNSPRVHNKAVKEAAAALAGSEHRRSTPVSSR  418

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             L+ QQK LNLP+LPTTTIGSFPQT ELRRVRRE K+ KISEE+Y KAIK EI  VVKLQE
Sbjct  419   LEQQQKYLNLPILPTTTIGSFPQTPELRRVRREVKSKKISEEDYDKAIKAEIDSVVKLQE  478

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQL GF F+ANGWVQSYGSRCVKPPII+GDVSRPK MT
Sbjct  479   ELDIDVLVHGEPERNDMVEYFGEQLDGFCFSANGWVQSYGSRCVKPPIIFGDVSRPKAMT  538

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             V+WS+ AQ +TKRP+KGMLTGPVTILNWSFVRNDQPR ETCYQI+LAIKDEVEDLEKANI
Sbjct  539   VYWSTYAQSVTKRPIKGMLTGPVTILNWSFVRNDQPRSETCYQISLAIKDEVEDLEKANI  598

Query  1916  NVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHS  2095
              VIQIDEAALREGLPLRK+EHA YL WAVH FRIT CGV++TTQIHTHMCYSNFNDIIHS
Sbjct  599   TVIQIDEAALREGLPLRKSEHADYLRWAVHGFRITTCGVKDTTQIHTHMCYSNFNDIIHS  658

Query  2096  IIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKML  2275
             IIDMDADVITIENSRSDEKLLSVFREGV YGAGIGPGVYDIHSPRIP TEE+ADR  KML
Sbjct  659   IIDMDADVITIENSRSDEKLLSVFREGVHYGAGIGPGVYDIHSPRIPPTEEMADRARKML  718

Query  2276  AVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
             AVL++ +LW+NPDCGLKTRKY EV PAL NMV+AAK++R +LA
Sbjct  719   AVLESKVLWINPDCGLKTRKYAEVVPALTNMVNAAKQLRAELA  761



>ref|XP_006371191.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
 gb|ERP48988.1| hypothetical protein POPTR_0019s05430g [Populus trichocarpa]
Length=655

 Score =  1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/647 (89%), Positives = 608/647 (94%), Gaps = 0/647 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKV+ADLR SIWKQMAD GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVAADLRESIWKQMADTGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD +LDTTAMLGAVPPRY W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQMLDTTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAKALGV+TVPVL+GPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKALGVDTVPVLIGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDLESH+L+AFT AY+ LES   GLNVL+
Sbjct  181   LGKILPIYKEVISELKEAGASWIQFDEPTLVMDLESHKLQAFTGAYSALESTLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAE +KTLT+LKGVTAFGFDL+RGTK++DLIKG FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADIPAEQYKTLTSLKGVTAFGFDLVRGTKTLDLIKGDFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA S STL++LE IVGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASFSTLETLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDKEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE  FSANAAA ASRKSSPRV NE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEEIFSANAAALASRKSSPRVNNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELR+VRREYKA K+SE++YVKAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTMELRKVRREYKAKKVSEDDYVKAIKEEIRKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
              DIDVLVHGEPERNDMVEYFGEQLSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   FDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPKSMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+ AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSTLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRYETCYQIALAIKDEVEDLEKNGIT  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTH  2059
             VIQIDEAALREGLPLRK+E AFYL+WAVHSFRITNCGVQ+TTQ++ H
Sbjct  601   VIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNCGVQDTTQVYPH  647



>ref|XP_010036243.1| PREDICTED: 5-methyltetrahydropteroyltriglutamate--homocysteine 
methyltransferase-like [Eucalyptus grandis]
Length=761

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/762 (78%), Positives = 656/762 (86%), Gaps = 9/762 (1%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+ GYP +GP+RELKFALESFWDGKSSAE+LQKV+ DLR  IWKQM  AGI+++PSN
Sbjct  1     MASHVAGYPHIGPRRELKFALESFWDGKSSAEELQKVAVDLRTYIWKQMTGAGIEYVPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTT MLGAVP RY W GGEIGFD YFSMARGNASVPAMEM +WFDTNY ++
Sbjct  61    TFSYYDQVLDTTMMLGAVPARYGWNGGEIGFDVYFSMARGNASVPAMEMARWFDTNYQYV  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             + ELGPDV FSYAS KAVT+Y+EAK LGV+TVPVL+GPVSYLLLSK A+GV+++F  LSL
Sbjct  121   MSELGPDVNFSYASRKAVTDYREAKELGVDTVPVLLGPVSYLLLSKHAEGVDRAFSPLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIY+EV+SELK AGASWIQFDEP LV+DL+SHQL+AFT+AY+ELES   G+NV+V
Sbjct  181   LGKILPIYREVVSELKAAGASWIQFDEPTLVLDLDSHQLQAFTEAYSELESSLYGVNVVV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEA+K LT+LKGVT FGFDL+ GT+++DLIKGGFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAYKVLTSLKGVTGFGFDLVHGTQTLDLIKGGFPTGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLAGSLSTL +LE IVGKDKLVVSTSCSLLH  VDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAGSLSTLLALEIIVGKDKLVVSTSCSLLHVPVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEAFFSANAAAQASRKSSPRVTNE+VQKAAAAL+GSDHRRAT VSAR 
Sbjct  361   VNALAKALAGQKDEAFFSANAAAQASRKSSPRVTNEAVQKAAAALRGSDHRRATTVSARF  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNL V+P  TI S  +  ELR    +YKA KISEEEY+KAIKEEI KVVKLQEE
Sbjct  421   DAQQKKLNL-VMPAATIDSIAK--ELRSPHSQYKAKKISEEEYIKAIKEEIDKVVKLQEE  477

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLV+GEPERNDMVEYFGEQLSGFA T NGWVQSYGSRCVKPPIIYGDVSRPK   V
Sbjct  478   LDIDVLVYGEPERNDMVEYFGEQLSGFALTINGWVQSYGSRCVKPPIIYGDVSRPKLPYV  537

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWS+A Q M   PMKGML GPVTILNWSFVRNDQPR +TCYQIALAIKDEVEDLEKA I+
Sbjct  538   FWSTAVQSMATGPMKGMLPGPVTILNWSFVRNDQPRSDTCYQIALAIKDEVEDLEKAGID  597

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSI  2098
             V QIDE ALR+GLPLRK E A YL+W VHSFRITNCGVQ+TTQIHTH  YS FND   SI
Sbjct  598   VFQIDELALRDGLPLRKFEQASYLDWTVHSFRITNCGVQDTTQIHTHTYYSQFNDFPLSI  657

Query  2099  IDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLA  2278
             I+ DADVITIEN R DE   SVFREGV YGAG+GPGV+D HSP IPS E+IAD I K LA
Sbjct  658   INTDADVITIENCRFDE---SVFREGVNYGAGVGPGVHDFHSPSIPSAEQIADSITKKLA  714

Query  2279  VLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLA  2404
                 NI+  NPD   KT ++  VK ALENMV+A + +R +L+
Sbjct  715   ---RNIVSFNPDYKFKTCEHAGVKRALENMVAAVELLRAELS  753



>ref|XP_006408262.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408263.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 ref|XP_006408264.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49715.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49716.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
 gb|ESQ49717.1| hypothetical protein EUTSA_v10020127mg [Eutrema salsugineum]
Length=652

 Score =  1167 bits (3018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/648 (88%), Positives = 608/648 (94%), Gaps = 0/648 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVSADLR+ IWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSDIWKQMSAAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYD VLDTTAMLGAVPPRY W  GEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFAYYDQVLDTTAMLGAVPPRYGWNSGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+VKFSYASHKAV EYKEAKALGVETVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVKFSYASHKAVNEYKEAKALGVETVPVLVGPVSYLLLSKLAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVI+ELKGAGA+WIQFDEP  VMDLE H+L+AF+ AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVIAELKGAGATWIQFDEPLFVMDLEGHKLQAFSGAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAFKTLT+LKGVT+FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFKTLTSLKGVTSFGFDLIRGTKTLDLIKSSFPKGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL TL+SLE  VGKDKLVVSTSCSLLHTAVDLVNETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLITLQSLEGAVGKDKLVVSTSCSLLHTAVDLVNETKLDAEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             V+ALAKAL GQ +EAFFSANAAA +SR+SSPRVTNESVQKAAAALKGSDHRRAT VSARL
Sbjct  361   VDALAKALVGQTNEAFFSANAAALSSRRSSPRVTNESVQKAAAALKGSDHRRATEVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRREYKA KISEE+YVKAIKEEI KVV +QEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEDYVKAIKEEIKKVVDIQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANIN  1918
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEK  I 
Sbjct  541   FWSSTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIG  600

Query  1919  VIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHM  2062
             VIQIDEAALREGLPLRKAEH+FYL+WAVHSFRITNCGV+++TQ++ H+
Sbjct  601   VIQIDEAALREGLPLRKAEHSFYLDWAVHSFRITNCGVEDSTQVNIHL  648



>ref|XP_010103482.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
 gb|EXB96085.1| 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 
[Morus notabilis]
Length=749

 Score =  1106 bits (2860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/720 (78%), Positives = 602/720 (84%), Gaps = 62/720 (9%)
 Frame = +2

Query  401   FSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPV  580
             FSMARGN+SVPAMEMTKWFDTNYHFI+PELGP+V FSYASHKAV EYKEAK++GV+TVPV
Sbjct  37    FSMARGNSSVPAMEMTKWFDTNYHFIIPELGPNVTFSYASHKAVDEYKEAKSIGVDTVPV  96

Query  581   LVGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDL  760
             L+GPVSYLLLSKPAK +  +F  LSLLDKILPIYKEVISELK AG +WI FDEP LV+DL
Sbjct  97    LIGPVSYLLLSKPAKSIGNTFSFLSLLDKILPIYKEVISELKVAGVTWIHFDEPTLVLDL  156

Query  761   ESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKS  940
             +SH+ EAF  AYA LES   GLNVLVETYF D+ AEA+KT++ LKGVTA+GFD +RGT +
Sbjct  157   DSHKYEAFKNAYAALESTLSGLNVLVETYFTDVTAEAYKTISELKGVTAYGFDFVRGTNT  216

Query  941   IDLIK--------------------------------------------------GGFPS  970
             IDL+K                                                  GGFP 
Sbjct  217   IDLVKESTLSGLNVLVETYFTDVTAEAYKTISELKGVTAYGFDFVRGTTTIDLVKGGFPH  276

Query  971   GKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLD  1150
             GKYLFAGVVDGRNIW NDL  SLSTLKSLE IVGKDKLVVSTSCSLLHTAVDLVNETKLD
Sbjct  277   GKYLFAGVVDGRNIWTNDLDASLSTLKSLEGIVGKDKLVVSTSCSLLHTAVDLVNETKLD  336

Query  1151  NEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAA  1330
              EIKSWLAFAAQK+VE NALA AL GQKDEA+FS NAAAQASR+SSPRVTNE+VQKAAAA
Sbjct  337   KEIKSWLAFAAQKIVEFNALANALAGQKDEAYFSNNAAAQASRRSSPRVTNEAVQKAAAA  396

Query  1331  LKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIG-----SFPQTVELRRVRREYKANKIS  1495
             L+GSDHRRATNVS RLDAQQKKLNLP+LPTTTIG     +F   +    +R       IS
Sbjct  397   LRGSDHRRATNVSTRLDAQQKKLNLPILPTTTIGCKVGVNFSLRIGTVLLR-------IS  449

Query  1496  EEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYG  1675
             E+ YVKAIK EISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYG
Sbjct  450   EDVYVKAIKVEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYG  509

Query  1676  SRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFET  1855
             SRCVKPPIIYGDVSRP  MTVFWSSAAQ  T RPMKGMLTGPVTILNWSFVRNDQPRFET
Sbjct  510   SRCVKPPIIYGDVSRPNLMTVFWSSAAQSFTARPMKGMLTGPVTILNWSFVRNDQPRFET  569

Query  1856  CYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQ  2035
             C QIALAIKDEVEDLEKA INVIQIDEAALREGLPLRK+E AFYL+WAVHSFRITN GVQ
Sbjct  570   CDQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEQAFYLDWAVHSFRITNYGVQ  629

Query  2036  NTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYD  2215
             +TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRS+EKLLSVFREGVKY AGIGPGVYD
Sbjct  630   DTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSNEKLLSVFREGVKYDAGIGPGVYD  689

Query  2216  IHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMVSAAKKIRT  2395
             IHSPRIPST+EIADRINKMLAVL+TNILWVNP+CGLKTRKY+EVKPAL+NMV AAK +RT
Sbjct  690   IHSPRIPSTKEIADRINKMLAVLETNILWVNPNCGLKTRKYSEVKPALKNMVDAAKLLRT  749



>gb|ABG22097.1| 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=607

 Score =  1063 bits (2749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/602 (88%), Positives = 562/602 (93%), Gaps = 1/602 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+KV+ DLRASIWKQMADAGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVATDLRASIWKQMADAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDT AMLGAVP RY+W GGEIGF TYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTAAMLGAVPERYSWTGGEIGFSTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+ KFSY+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPNTKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVSYLLLSKPAKGVEKSFALLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L  ILP+YKEVI+ELK AGA+WIQFDEP LV+DL+SHQL AF+ AY ELES   GLNVL+
Sbjct  181   LSSILPVYKEVIAELKAAGATWIQFDEPTLVLDLDSHQLAAFSAAYTELESALSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIK-GGFPSGKYLFAGVVDGRNIW  1015
             ETYFADIPAE++KTLT+L  VTA+GFDLIRG K++DLIK  GFPSGKYLFAGVVDGRNIW
Sbjct  241   ETYFADIPAESYKTLTSLNSVTAYGFDLIRGAKTLDLIKSAGFPSGKYLFAGVVDGRNIW  300

Query  1016  ANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVV  1195
             A+DLA SL+TL+SLE IVGKDKLVVSTSCSL+HTAVDLVNETKLD+EIKSWLAFAAQKVV
Sbjct  301   ADDLAASLTTLESLEAIVGKDKLVVSTSCSLMHTAVDLVNETKLDSEIKSWLAFAAQKVV  360

Query  1196  EVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSAR  1375
             EVNALAKAL GQKDEA+F+ANAAAQASR+SSPRVTNE VQKAAAALKGSDHRRATNVSAR
Sbjct  361   EVNALAKALAGQKDEAYFAANAAAQASRRSSPRVTNEEVQKAAAALKGSDHRRATNVSAR  420

Query  1376  LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQE  1555
             LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKA KISEEEY+ AIKEEISKVVK+QE
Sbjct  421   LDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKAKKISEEEYISAIKEEISKVVKIQE  480

Query  1556  ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMT  1735
             ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP PMT
Sbjct  481   ELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMT  540

Query  1736  VFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANI  1915
             VFWS  AQ MT RPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIK EVEDLE   I
Sbjct  541   VFWSKLAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKKEVEDLEAGGI  600

Query  1916  NV  1921
              V
Sbjct  601   QV  602



>ref|XP_006443470.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56710.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=586

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/577 (90%), Positives = 548/577 (95%), Gaps = 0/577 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLR+SIWKQM+ AGIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSQAGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRYNW GGEIGFD YFSMARGNASVPAMEMTKWFDTNYHFI
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDVKFSYASHKAVTEYKEAK LGVETVPVL+GPVSYLLLSKPAKGV K+F LLSL
Sbjct  121   VPELGPDVKFSYASHKAVTEYKEAKGLGVETVPVLIGPVSYLLLSKPAKGVAKTFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L KILPIYKEVISELK AGASWIQFDEP LVMDL+SH+L AF++AYAELES   GLNVLV
Sbjct  181   LPKILPIYKEVISELKAAGASWIQFDEPLLVMDLDSHKLHAFSEAYAELESTLSGLNVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAEAF+TLT+LKGVTA+GFDL+RGTK+++LIK GFP+GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAEAFQTLTSLKGVTAYGFDLVRGTKTLELIKSGFPAGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SLS L+ LE +VGKDKLVVSTSCSLLHTAVDLVNE KLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLAASLSVLRGLEGVVGKDKLVVSTSCSLLHTAVDLVNENKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDE FFSANAAAQASRKSSPRVTNE VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALAGQKDEGFFSANAAAQASRKSSPRVTNERVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQT+ELRRVRREYKA KISEEEYV +IKEEI+KVVKLQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTIELRRVRREYKAKKISEEEYVASIKEEINKVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRF  1849
             FWSS AQ MT RPMKGMLTGPVTILNWSFVRNDQPR+
Sbjct  541   FWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRY  577



>ref|XP_007015562.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33181.1| Cobalamin-independent synthase family protein isoform 2 [Theobroma 
cacao]
Length=632

 Score =  1034 bits (2674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/588 (86%), Positives = 546/588 (93%), Gaps = 0/588 (0%)
 Frame = +2

Query  83    EQLPLFP*RTEKMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQ  262
              +L L P     MASHIVGYPRMGPKRELKFALESFWDGKSSAE+LQKV+ADLR+SIW+Q
Sbjct  45    RRLTLRPFSLRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEELQKVAADLRSSIWRQ  104

Query  263   MADAGIKFIPSNTFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAME  442
             M++AGIK+IPSNTFSYYD +LD TAMLGAVPPRY W GGEIGFD YFSMARGNASVPAME
Sbjct  105   MSEAGIKYIPSNTFSYYDQMLDNTAMLGAVPPRYGWNGGEIGFDVYFSMARGNASVPAME  164

Query  443   MTKWFDTNYHFIVPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPA  622
             MTKWFDTNYH+IVPELGPDVKFSYASHKAV EYKEAKALGV+TVPVL+GPVSYLLLSKPA
Sbjct  165   MTKWFDTNYHYIVPELGPDVKFSYASHKAVDEYKEAKALGVDTVPVLIGPVSYLLLSKPA  224

Query  623   KGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAE  802
             KGVEKSF LLSL+ KILPIYKEV++ELK AGA+WIQFDEP L++DLESHQL+AFT AY+E
Sbjct  225   KGVEKSFSLLSLIGKILPIYKEVVAELKAAGATWIQFDEPTLILDLESHQLQAFTHAYSE  284

Query  803   LESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYL  982
             LES   GLNVL+ETYFAD+P E +K LT+LKGVT FGFDL+RGTK++DLIK GFPS KYL
Sbjct  285   LESSLSGLNVLIETYFADVPVETYKKLTSLKGVTGFGFDLVRGTKTLDLIKSGFPSDKYL  344

Query  983   FAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIK  1162
             FAGVVDGRNIWANDLA SLSTL++LE IVGK+K+VVSTSCSLLHTAVDLVNETKLD E+K
Sbjct  345   FAGVVDGRNIWANDLASSLSTLQALEGIVGKEKVVVSTSCSLLHTAVDLVNETKLDKELK  404

Query  1163  SWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGS  1342
             SWLAFAAQK+VEVNALAKAL GQKDEAFF++NA A ASRKSSPRVTNE+VQKAAAAL+GS
Sbjct  405   SWLAFAAQKIVEVNALAKALVGQKDEAFFASNATAHASRKSSPRVTNEAVQKAAAALRGS  464

Query  1343  DHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIK  1522
             DHRRATNVSARLDAQQKKLNLP+LPTTTIGSFPQT++LRRVRREYKA KISE +YV AIK
Sbjct  465   DHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTMDLRRVRREYKAKKISETDYVNAIK  524

Query  1523  EEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPII  1702
             EEI+KVVKLQE LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPII
Sbjct  525   EEINKVVKLQEVLDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPII  584

Query  1703  YGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPR  1846
             +GDVSRPK MTVFWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR
Sbjct  585   FGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPR  632



>gb|KDO66311.1| hypothetical protein CISIN_1g003819mg [Citrus sinensis]
Length=595

 Score =  1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/576 (87%), Positives = 539/576 (94%), Gaps = 0/576 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASH+VGYPRMGPKRELKFALESFWDGKSSA++LQ V+ADLRASIW QMADAGIKFIPSN
Sbjct  1     MASHVVGYPRMGPKRELKFALESFWDGKSSADELQNVAADLRASIWNQMADAGIKFIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TFSYYD VLDTTAMLGAVPPRY+W GGEIGFD YFSMARGNASVPAMEMTKWFDTNYH+I
Sbjct  61    TFSYYDQVLDTTAMLGAVPPRYSWNGGEIGFDVYFSMARGNASVPAMEMTKWFDTNYHYI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGPDV FSYASHKAV EYKEAKALG+ETVPVLVGPVSYLLLSKPAKGVEKSF LLSL
Sbjct  121   VPELGPDVNFSYASHKAVQEYKEAKALGMETVPVLVGPVSYLLLSKPAKGVEKSFSLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             +DKI+P+YKEV++ELK AGA+WIQFDEP LV+DL+SH+L+AF+ AY+EL+S   GLNVL+
Sbjct  181   IDKIIPVYKEVVAELKAAGATWIQFDEPTLVLDLDSHKLQAFSDAYSELQSSLSGLNVLI  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFAD+PAE +K LT+LKGVT FGFDLIRGTK++DLIK  FP GKYLFAGVVDGRNIWA
Sbjct  241   ETYFADVPAETYKILTSLKGVTGFGFDLIRGTKTLDLIKTEFPLGKYLFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDLA SL+TL+ L   VGKDK+VVSTSCSLLHTAVDL NETKLD EIKSWLAFAAQKVVE
Sbjct  301   NDLASSLTTLQDLAGTVGKDKVVVSTSCSLLHTAVDLENETKLDQEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALAKAL GQKDEA+FS+NAAAQASRKSSPRVTNE+VQK AAALKGSDHRRATNVSARL
Sbjct  361   VNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKPAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP LPTTTIGSFPQT++LRRVRRE+KA KISE++YVK IKEEI+ VVKLQEE
Sbjct  421   DAQQKKLNLPNLPTTTIGSFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPR  1846
             FWSS AQ MTKRPMKGMLTGPVTILNWSFVRNDQPR
Sbjct  541   FWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQPR  576



>ref|XP_006443468.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
 gb|ESR56708.1| hypothetical protein CICLE_v10018965mg [Citrus clementina]
Length=554

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/551 (91%), Positives = 528/551 (96%), Gaps = 0/551 (0%)
 Frame = +2

Query  752   MDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRG  931
             MDL+SH+L AF++AYAELES   GLNVLVETYFAD+PAEAF+TLT+LKGVTA+GFDL+RG
Sbjct  1     MDLDSHKLHAFSEAYAELESTLSGLNVLVETYFADVPAEAFQTLTSLKGVTAYGFDLVRG  60

Query  932   TKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLL  1111
             TK+++LIK GFP+GKYLFAGVVDGRNIWANDLA SLS L+ LE +VGKDKLVVSTSCSLL
Sbjct  61    TKTLELIKSGFPAGKYLFAGVVDGRNIWANDLAASLSVLRGLEGVVGKDKLVVSTSCSLL  120

Query  1112  HTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssP  1291
             HTAVDLVNE KLD+EIKSWLAFAAQKVVEVNALAKAL GQKDE FFSANAAAQASRKSSP
Sbjct  121   HTAVDLVNENKLDDEIKSWLAFAAQKVVEVNALAKALAGQKDEGFFSANAAAQASRKSSP  180

Query  1292  RVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRR  1471
             RVTNE VQKAAAALKGSDHRRATNVSARLDAQQKKLNLP+LPTTTIGSFPQT+ELRRVRR
Sbjct  181   RVTNERVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTIELRRVRR  240

Query  1472  EYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTA  1651
             EYKA KISEEEYV +IKEEI+KVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTA
Sbjct  241   EYKAKKISEEEYVASIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTA  300

Query  1652  NGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVR  1831
             NGWVQSYGSRCVKPPIIYGDVSRPK MTVFWSS AQ MT RPMKGMLTGPVTILNWSFVR
Sbjct  301   NGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVR  360

Query  1832  NDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSF  2011
             NDQPR ETCYQIALAIKDEVEDLEKA INVIQIDEAALREGLPLRK+EHAFYL+WAVHSF
Sbjct  361   NDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSF  420

Query  2012  RITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA  2191
             RITNCGVQ+TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA
Sbjct  421   RITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA  480

Query  2192  GIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMV  2371
             GIGPGVYDIHSPRIPSTEEIADRINKMLAVL+TNILWVNPDCGLKTRKYTEVKPAL NMV
Sbjct  481   GIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMV  540

Query  2372  SAAKKIRTQLA  2404
             +AAK +RTQLA
Sbjct  541   AAAKLLRTQLA  551



>gb|AES80897.2| cobalamin-independent methionine synthase [Medicago truncatula]
Length=650

 Score =  1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/606 (83%), Positives = 550/606 (91%), Gaps = 2/606 (0%)
 Frame = +2

Query  119   MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSN  298
             MASHIVGYPRMGPKRELKFALESFWD KSSAEDL+KVSADLRASIWKQM+D GIK+IPSN
Sbjct  1     MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIPSN  60

Query  299   TFSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFI  478
             TF+YYDHVLDTTA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFI
Sbjct  61    TFTYYDHVLDTTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFI  120

Query  479   VPELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSL  658
             VPELGP+V F Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSL
Sbjct  121   VPELGPEVNFVYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSL  180

Query  659   LDKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLV  838
             L K+L +YKEVI++LK AGA +IQFDEP LV+DLE+H+L+AFT AYA L   F GL+VLV
Sbjct  181   LPKVLAVYKEVIADLKAAGAQFIQFDEPTLVLDLEAHKLQAFTDAYAALTPSFEGLHVLV  240

Query  839   ETYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWA  1018
             ETYFADIPAEA+KTLT+L GV A+GFDL+RGTK++DLIK GFPSGK++FAGVVDGRNIWA
Sbjct  241   ETYFADIPAEAYKTLTSLSGVAAYGFDLVRGTKTLDLIKAGFPSGKWIFAGVVDGRNIWA  300

Query  1019  NDLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVE  1198
             NDL  SLSTL++L  IVGK+++VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVE
Sbjct  301   NDLEASLSTLEALAGIVGKERIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVE  360

Query  1199  VNALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARL  1378
             VNALA AL G KDEA FSA++AAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARL
Sbjct  361   VNALANALAGNKDEAIFSASSAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARL  420

Query  1379  DAQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEE  1558
             DAQQKKLNLP+LPTTTIGSFPQTVELRRVRRE+KA KISEEEY+KAIKEEI  VV+LQEE
Sbjct  421   DAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYIKAIKEEIRSVVELQEE  480

Query  1559  LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTV  1738
             LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTV
Sbjct  481   LDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTV  540

Query  1739  FWSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRF--ETCYQIALAIKDEVEDLEKAN  1912
             FWS+ AQ  TKRPMKGMLTGPVTILNWSFVR DQPR+  +  Y I   ++    + E  +
Sbjct  541   FWSALAQSFTKRPMKGMLTGPVTILNWSFVRVDQPRYKLDPPYNITGKVQHTELNKEMIS  600

Query  1913  INVIQI  1930
             I++I +
Sbjct  601   IHIIYL  606



>gb|ABK93849.1| unknown [Populus trichocarpa]
Length=554

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/551 (89%), Positives = 519/551 (94%), Gaps = 0/551 (0%)
 Frame = +2

Query  752   MDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGFDLIRG  931
             MDLESH+LEAFT+AY+ELES   GLNVL+ETYFADIPA+ +KTLT+LKGVTA GFDL+RG
Sbjct  1     MDLESHKLEAFTEAYSELESTVSGLNVLIETYFADIPAKQYKTLTSLKGVTALGFDLVRG  60

Query  932   TKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVSTSCSLL  1111
             TK++DLIKG FP GKYLFAGVVDGRNIWANDLA SLSTL +LE IVGKDKLVVSTSCSLL
Sbjct  61    TKTLDLIKGEFPKGKYLFAGVVDGRNIWANDLAASLSTLVALEGIVGKDKLVVSTSCSLL  120

Query  1112  HTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqasrkssP  1291
             HTAVDLVNETKLD EIKSWLAFAAQKVVEVNALAKAL G+KDE FFSAN AA  SRKSSP
Sbjct  121   HTAVDLVNETKLDKEIKSWLAFAAQKVVEVNALAKALAGEKDEEFFSANVAAHTSRKSSP  180

Query  1292  RVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVELRRVRR  1471
             RV NE+VQKAAAALKGSDHRR TNVSARLDAQQKKLNLP+LPTTTIGSFPQT+ELR+VRR
Sbjct  181   RVNNEAVQKAAAALKGSDHRRVTNVSARLDAQQKKLNLPILPTTTIGSFPQTMELRKVRR  240

Query  1472  EYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTA  1651
             EYKA K+SE +YV+AIK+EISKVVKLQEE DIDVLVHGEPERNDMVEYFGEQLSGF F+A
Sbjct  241   EYKAKKVSEVDYVEAIKKEISKVVKLQEEFDIDVLVHGEPERNDMVEYFGEQLSGFVFSA  300

Query  1652  NGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILNWSFVR  1831
             NGWVQSYGSRCVKPPIIYGDVSRPK MTVFWS+ AQ MT RPMKGMLTGPVTILNWSFVR
Sbjct  301   NGWVQSYGSRCVKPPIIYGDVSRPKSMTVFWSALAQSMTSRPMKGMLTGPVTILNWSFVR  360

Query  1832  NDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNWAVHSF  2011
             NDQPRFETCYQIALAIKDEVEDLEK  I VIQIDEAALREGLPLRK+E AFYL+WAVHSF
Sbjct  361   NDQPRFETCYQIALAIKDEVEDLEKNGITVIQIDEAALREGLPLRKSEQAFYLDWAVHSF  420

Query  2012  RITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA  2191
             RITNCGVQ+TTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA
Sbjct  421   RITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGA  480

Query  2192  GIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPALENMV  2371
             GIGPGVYDIHSPRIPSTEEIADRINKMLAVL+TNILWVNPDCGLKTRKY+EVKPAL+NMV
Sbjct  481   GIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYSEVKPALKNMV  540

Query  2372  SAAKKIRTQLA  2404
              AAK +RTQLA
Sbjct  541   DAAKLLRTQLA  551



>ref|XP_003624678.1| Methionine synthase [Medicago truncatula]
Length=640

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/596 (82%), Positives = 540/596 (91%), Gaps = 2/596 (0%)
 Frame = +2

Query  149   MGPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNTFSYYDHVLD  328
             MGPKRELKFALESFWD KSSAEDL+KVSADLRASIWKQM+D GIK+IPSNTF+YYDHVLD
Sbjct  1     MGPKRELKFALESFWDKKSSAEDLKKVSADLRASIWKQMSDVGIKYIPSNTFTYYDHVLD  60

Query  329   TTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKF  508
             TTA LGAVPPRY W GGEIGFDTYFSMARGNA+VPAMEMTKWFDTNYHFIVPELGP+V F
Sbjct  61    TTATLGAVPPRYGWTGGEIGFDTYFSMARGNATVPAMEMTKWFDTNYHFIVPELGPEVNF  120

Query  509   SYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKE  688
              Y+SHKAV EYKEAKALGV+TVPVLVGPVSYLLLSK AKGV+KSF LLSLL K+L +YKE
Sbjct  121   VYSSHKAVEEYKEAKALGVDTVPVLVGPVSYLLLSKAAKGVDKSFDLLSLLPKVLAVYKE  180

Query  689   VISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAE  868
             VI++LK AGA +IQFDEP LV+DLE+H+L+AFT AYA L   F GL+VLVETYFADIPAE
Sbjct  181   VIADLKAAGAQFIQFDEPTLVLDLEAHKLQAFTDAYAALTPSFEGLHVLVETYFADIPAE  240

Query  869   AFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTL  1048
             A+KTLT+L GV A+GFDL+RGTK++DLIK GFPSGK++FAGVVDGRNIWANDL  SLSTL
Sbjct  241   AYKTLTSLSGVAAYGFDLVRGTKTLDLIKAGFPSGKWIFAGVVDGRNIWANDLEASLSTL  300

Query  1049  KSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCG  1228
             ++L  IVGK+++VVSTSCSLLHTAVDLVNETKLD+EIKSWLAFAAQKVVEVNALA AL G
Sbjct  301   EALAGIVGKERIVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALANALAG  360

Query  1229  QKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLP  1408
              KDEA FSA++AAQASRKSSPRVTNE+VQKAAAALKGSDHRRATNVSARLDAQQKKLNLP
Sbjct  361   NKDEAIFSASSAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLP  420

Query  1409  VLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGE  1588
             +LPTTTIGSFPQTVELRRVRRE+KA KISEEEY+KAIKEEI  VV+LQEELDIDVLVHGE
Sbjct  421   ILPTTTIGSFPQTVELRRVRREFKAKKISEEEYIKAIKEEIRSVVELQEELDIDVLVHGE  480

Query  1589  PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMT  1768
             PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTVFWS+ AQ  T
Sbjct  481   PERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSALAQSFT  540

Query  1769  KRPMKGMLTGPVTILNWSFVRNDQPRF--ETCYQIALAIKDEVEDLEKANINVIQI  1930
             KRPMKGMLTGPVTILNWSFVR DQPR+  +  Y I   ++    + E  +I++I +
Sbjct  541   KRPMKGMLTGPVTILNWSFVRVDQPRYKLDPPYNITGKVQHTELNKEMISIHIIYL  596



>gb|KCW45141.1| hypothetical protein EUGRSUZ_L01250 [Eucalyptus grandis]
Length=653

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/747 (70%), Positives = 567/747 (76%), Gaps = 110/747 (15%)
 Frame = +2

Query  137   GYPRM-----GPKRELKFALESFWDGKSSAEDLQKVSADLRASIWKQMADAGIKFIPSNT  301
             G PR      GP+RELKFALESFWDGKSS EDLQ V+ADLR+S WKQMADAGIK++PSNT
Sbjct  10    GIPRRRISSHGPQRELKFALESFWDGKSSTEDLQNVAADLRSSTWKQMADAGIKYVPSNT  69

Query  302   FSYYDHVLDTTAMLGAVPPRYNWAGGEIGFDTYFSMARGNASVPAMEMTKWFDTNYHFIV  481
             FSYYDHVLDTTAMLGAVP RY W GG+IG D YF MARGNASVPAMEM KWFD++YH+IV
Sbjct  70    FSYYDHVLDTTAMLGAVPTRYGWEGGDIGLDVYFLMARGNASVPAMEMAKWFDSSYHYIV  129

Query  482   PELGPDVKFSYASHKAVTEYKEAKALGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLL  661
             PEL PDV+FSYAS KAV EYKE K LGV+TVPVL+GPVSYLLLS+PAKGVEK+F  LSLL
Sbjct  130   PELAPDVEFSYASAKAVNEYKEVKKLGVDTVPVLLGPVSYLLLSEPAKGVEKNFSPLSLL  189

Query  662   DKILPIYKEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVE  841
              KILPIY+EV+SELK AGASWIQFDEP LV+DL+SH+L+AFT+AY+ELESC  G+NVLV+
Sbjct  190   HKILPIYREVVSELKAAGASWIQFDEPTLVLDLDSHRLQAFTEAYSELESCLSGVNVLVQ  249

Query  842   TYFADIPAEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWAN  1021
             TYFAD+PAEA++ LT+LKGV  FGFDL+RGTK++DLIKGGFP  KYLFAGVVDGRNIWAN
Sbjct  250   TYFADVPAEAYRVLTSLKGVAGFGFDLVRGTKTLDLIKGGFPKEKYLFAGVVDGRNIWAN  309

Query  1022  DLAGSLSTLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEV  1201
             DLA SL TL++LE IVGKDKLVVSTSCSLLHT VDL NET+LD EIKSWLAFAAQKVVEV
Sbjct  310   DLAQSLGTLRALESIVGKDKLVVSTSCSLLHTPVDLFNETELDEEIKSWLAFAAQKVVEV  369

Query  1202  NALAKALCGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLD  1381
             NALAKAL G+KDEAFFSANA AQASRKSSPRVTNE+VQKA AAL+G DHRRAT VSARLD
Sbjct  370   NALAKALAGKKDEAFFSANATAQASRKSSPRVTNEAVQKATAALRGYDHRRATTVSARLD  429

Query  1382  AQQKKLNLPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEEL  1561
             AQQKKLNLP                                   AIK EI  VVKLQEEL
Sbjct  430   AQQKKLNLP-----------------------------------AIKVEIKGVVKLQEEL  454

Query  1562  DIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVF  1741
             DIDVLVHGEPERNDMVEYFG+QLSG AFT NGW                      PMTVF
Sbjct  455   DIDVLVHGEPERNDMVEYFGQQLSGLAFTVNGW----------------------PMTVF  492

Query  1742  WSSAAQGMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINV  1921
             WS+ AQ MT  PMKGMLTGPVTILN         RFET YQIALAIKD+VEDLEKA INV
Sbjct  493   WSTMAQSMTACPMKGMLTGPVTILN---------RFETRYQIALAIKDKVEDLEKAGINV  543

Query  1922  IQIDEAALREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSII  2101
             IQIDE  LREGLPLRK+E +FYL+WAVHSFRIT                           
Sbjct  544   IQIDEEVLREGLPLRKSEQSFYLDWAVHSFRIT---------------------------  576

Query  2102  DMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAV  2281
                       NSRSDEKLL VF +GVKYGAGI PGVYDIHS  IPS EEIADR  KML  
Sbjct  577   ---------VNSRSDEKLLPVFHKGVKYGAGIVPGVYDIHSLIIPSAEEIADRTIKMLT-  626

Query  2282  LDTNILWVNPDCGLKTRKYTEVKPALE  2362
               TNILW NPD  LKT K+T +K AL+
Sbjct  627   --TNILWFNPDFVLKTCKHTGIKHALK  651



>dbj|BAF01079.1| 5-methyltetrahydropteroyltriglutamate- homocysteine S-methyltransferase 
- like protein [Arabidopsis thaliana]
Length=589

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/575 (79%), Positives = 513/575 (89%), Gaps = 0/575 (0%)
 Frame = +2

Query  683   KEVISELKGAGASWIQFDEPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIP  862
             +EV+++LK AGA WIQFDEP LVMDL++ QL+AF+ AY+ +ES   GLNVL+ TYFAD+P
Sbjct  14    REVLADLKSAGARWIQFDEPILVMDLDTSQLQAFSDAYSHMESSLAGLNVLIATYFADVP  73

Query  863   AEAFKTLTALKGVTAFGFDLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLS  1042
             AEA+KTL +LK VT FGFDL+RG +++DLIK  FP GK LFAGVVDGRNIWANDL+ SL 
Sbjct  74    AEAYKTLMSLKCVTGFGFDLVRGLETLDLIKMNFPRGKLLFAGVVDGRNIWANDLSASLK  133

Query  1043  TLKSLEDIVGKDKLVVSTSCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKAL  1222
             TL++LEDIVGK+K+VVSTSCSLLHTAVDLVNE KLD E+KSWLAFAAQKVVEVNALAK+ 
Sbjct  134   TLQTLEDIVGKEKVVVSTSCSLLHTAVDLVNEMKLDKELKSWLAFAAQKVVEVNALAKSF  193

Query  1223  CGQKDEaffsanaaaqasrkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLN  1402
              G KDEA FS+N+  QASR+SSPRVTN +VQ+   A+K SDH R+T VS RL AQQKKLN
Sbjct  194   SGAKDEALFSSNSMRQASRRSSPRVTNAAVQQDVDAVKKSDHHRSTEVSVRLQAQQKKLN  253

Query  1403  LPVLPTTTIGSFPQTVELRRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVH  1582
             LP LPTTTIGSFPQT +LRR+RRE+KA KISE +YV+ IKEE  KV+KLQEEL IDVLVH
Sbjct  254   LPALPTTTIGSFPQTTDLRRIRREFKAKKISEVDYVQTIKEEYEKVIKLQEELGIDVLVH  313

Query  1583  GEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQG  1762
             GE ERNDMVE+FGEQLSGFAFT+NGWVQSYGSRCVKPPIIYGD++RPK MTVFWSS AQ 
Sbjct  314   GEAERNDMVEFFGEQLSGFAFTSNGWVQSYGSRCVKPPIIYGDITRPKAMTVFWSSMAQK  373

Query  1763  MTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAA  1942
             MT+RPMKGMLTGPVTILNWSFVRNDQPR ETC+QIALAIKDEVEDLEKA + VIQIDEAA
Sbjct  374   MTQRPMKGMLTGPVTILNWSFVRNDQPRHETCFQIALAIKDEVEDLEKAGVTVIQIDEAA  433

Query  1943  LREGLPLRKAEHAFYLNWAVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVI  2122
             LREGLPLRK+E  FYL+WAVH+FRITN GVQ++TQIHTHMCYSNFNDIIHSIIDMDADVI
Sbjct  434   LREGLPLRKSEQKFYLDWAVHAFRITNSGVQDSTQIHTHMCYSNFNDIIHSIIDMDADVI  493

Query  2123  TIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILW  2302
             TIENSRSDEKLLSVF EGVKYGAGIGPGVYDIHSPRIPSTEEIA+RINKMLAVLD+ +LW
Sbjct  494   TIENSRSDEKLLSVFHEGVKYGAGIGPGVYDIHSPRIPSTEEIAERINKMLAVLDSKVLW  553

Query  2303  VNPDCGLKTRKYTEVKPALENMVSAAKKIRTQLAK  2407
             VNPDCGLKTR Y+EVK AL NMV+AAK IR+QL K
Sbjct  554   VNPDCGLKTRNYSEVKSALSNMVAAAKLIRSQLNK  588



>gb|KCW47763.1| hypothetical protein EUGRSUZ_K01511 [Eucalyptus grandis]
Length=888

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/616 (78%), Positives = 529/616 (86%), Gaps = 9/616 (1%)
 Frame = +2

Query  557   LGVETVPVLVGPVSYLLLSKPAKGVEKSFPLLSLLDKILPIYKEVISELKGAGASWIQFD  736
             LGV+TVPVL+GPVSYLLLSK A+GV+++F  LSLL KILPIY+EV+SELK AGASWIQFD
Sbjct  274   LGVDTVPVLLGPVSYLLLSKHAEGVDRAFSPLSLLGKILPIYREVVSELKAAGASWIQFD  333

Query  737   EPNLVMDLESHQLEAFTKAYAELESCFGGLNVLVETYFADIPAEAFKTLTALKGVTAFGF  916
             EP LV+DL+SHQL+AFT+AY+ELES   G+NV+VETYFAD+PAEA+K LT+LKGVT FGF
Sbjct  334   EPTLVLDLDSHQLQAFTEAYSELESSLYGVNVVVETYFADVPAEAYKVLTSLKGVTGFGF  393

Query  917   DLIRGTKSIDLIKGGFPSGKYLFAGVVDGRNIWANDLAGSLSTLKSLEDIVGKDKLVVST  1096
             DL+ GT+++DLIKGGFP+GKYLFAGVVDGRNIWANDLAGSLSTL +LE IVGKDKLVVST
Sbjct  394   DLVHGTQTLDLIKGGFPTGKYLFAGVVDGRNIWANDLAGSLSTLLALEIIVGKDKLVVST  453

Query  1097  SCSLLHTAVDLVNETKLDNEIKSWLAFAAQKVVEVNALAKALCGQKDEaffsanaaaqas  1276
             SCSLLH  VDLVNETKLD+EIKSWLAFAAQKVVEVNALAKAL GQKDEAFFSANAAAQAS
Sbjct  454   SCSLLHVPVDLVNETKLDDEIKSWLAFAAQKVVEVNALAKALAGQKDEAFFSANAAAQAS  513

Query  1277  rkssPRVTNESVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPVLPTTTIGSFPQTVEL  1456
             RKSSPRVTNE+VQKAAAAL+GSDHRRAT VSAR DAQQKKLNL V+P  TI S  +  EL
Sbjct  514   RKSSPRVTNEAVQKAAAALRGSDHRRATTVSARFDAQQKKLNL-VMPAATIDSIAK--EL  570

Query  1457  RRVRREYKANKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSG  1636
             R    +YKA KISEEEY+KAIKEEI KVVKLQEELDIDVLV+GEPERNDMVEYFGEQLSG
Sbjct  571   RSPHSQYKAKKISEEEYIKAIKEEIDKVVKLQEELDIDVLVYGEPERNDMVEYFGEQLSG  630

Query  1637  FAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSSAAQGMTKRPMKGMLTGPVTILN  1816
             FA T NGWVQSYGSRCVKPPIIYGDVSRPK   VFWS+A Q M   PMKGML GPVTILN
Sbjct  631   FALTINGWVQSYGSRCVKPPIIYGDVSRPKLPYVFWSTAVQSMATGPMKGMLPGPVTILN  690

Query  1817  WSFVRNDQPRFETCYQIALAIKDEVEDLEKANINVIQIDEAALREGLPLRKAEHAFYLNW  1996
             WSFVRNDQPR +TCYQIALAIKDEVEDLEKA I+V QIDE ALR+GLPLRK E A YL+W
Sbjct  691   WSFVRNDQPRSDTCYQIALAIKDEVEDLEKAGIDVFQIDELALRDGLPLRKFEQASYLDW  750

Query  1997  AVHSFRITNCGVQNTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREG  2176
              VHSFRITNCGVQ+TTQIHTH  YS FND   SII+ DADVITIEN R DE   SVFREG
Sbjct  751   TVHSFRITNCGVQDTTQIHTHTYYSQFNDFPLSIINTDADVITIENCRFDE---SVFREG  807

Query  2177  VKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYTEVKPA  2356
             V YGAG+GPGV+D HSP IPS E+IAD I K LA    NI+  NPD   KT ++  VK A
Sbjct  808   VNYGAGVGPGVHDFHSPSIPSAEQIADSITKKLA---RNIVSFNPDYKFKTCEHAGVKRA  864

Query  2357  LENMVSAAKKIRTQLA  2404
             LENMV+A + +R +L+
Sbjct  865   LENMVAAVELLRAELS  880



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10932615188768