BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24877_g3_i1 len=1411 path=[4987:0-610 5598:611-660 5648:661-703
5690:704-737 11232:738-739 5726:740-850 5837:851-875 7716:876-1016
7857:1017-1069 2638:1070-1098 1465:1099-1138 1505:1139-1410]

Length=1411
                                                                      Score     E

ref|XP_011096982.1|  PREDICTED: probable serine/threonine-protein...    469   9e-159   
ref|XP_006343333.1|  PREDICTED: probable serine/threonine-protein...    462   2e-156   
ref|XP_009773233.1|  PREDICTED: probable serine/threonine-protein...    461   9e-156   
ref|XP_004253237.1|  PREDICTED: probable serine/threonine-protein...    460   1e-155   
ref|XP_009804656.1|  PREDICTED: probable serine/threonine-protein...    460   2e-155   
ref|XP_009597877.1|  PREDICTED: probable serine/threonine-protein...    459   2e-155   
ref|XP_006340004.1|  PREDICTED: probable serine/threonine-protein...    459   4e-155   
ref|XP_004234513.1|  PREDICTED: probable serine/threonine-protein...    459   4e-155   
ref|XP_009601926.1|  PREDICTED: probable serine/threonine-protein...    452   2e-152   
ref|XP_006467073.1|  PREDICTED: probable serine/threonine-protein...    452   2e-152   
ref|XP_006425293.1|  hypothetical protein CICLE_v10025699mg             451   1e-151   
ref|XP_006425292.1|  hypothetical protein CICLE_v10025699mg             449   3e-151   
gb|KDP43763.1|  hypothetical protein JCGZ_22390                         449   3e-151   
ref|XP_002521714.1|  serine/threonine-protein kinase cx32, putative     449   4e-151   Ricinus communis
emb|CDP01798.1|  unnamed protein product                                444   3e-149   
ref|XP_002280326.3|  PREDICTED: probable serine/threonine-protein...    441   5e-148   Vitis vinifera
ref|XP_011013448.1|  PREDICTED: probable serine/threonine-protein...    440   2e-147   
ref|XP_006376784.1|  hypothetical protein POPTR_0012s06370g             440   3e-147   
gb|EYU43737.1|  hypothetical protein MIMGU_mgv1a007465mg                438   6e-147   
ref|XP_008241951.1|  PREDICTED: probable serine/threonine-protein...    436   4e-146   
ref|XP_007202257.1|  hypothetical protein PRUPE_ppa007710mg             430   1e-144   
ref|XP_006598681.1|  PREDICTED: protein kinase isoform X1               428   4e-143   
ref|XP_003533415.1|  PREDICTED: probable serine/threonine-protein...    427   5e-143   
ref|XP_010029583.1|  PREDICTED: probable serine/threonine-protein...    427   5e-143   
ref|XP_002307210.1|  hypothetical protein POPTR_0005s10390g             429   6e-143   Populus trichocarpa [western balsam poplar]
gb|KHN38873.1|  Putative serine/threonine-protein kinase Cx32, ch...    428   2e-142   
ref|XP_004509435.1|  PREDICTED: probable serine/threonine-protein...    425   2e-142   
ref|XP_010247082.1|  PREDICTED: probable serine/threonine-protein...    426   3e-142   
ref|XP_007046513.1|  Kinase superfamily protein, 32                     427   9e-142   
gb|KHN07820.1|  Putative serine/threonine-protein kinase Cx32, ch...    425   9e-142   
ref|XP_004509434.1|  PREDICTED: probable serine/threonine-protein...    424   1e-141   
ref|XP_009344675.1|  PREDICTED: probable serine/threonine-protein...    424   2e-141   
ref|XP_006422428.1|  hypothetical protein CICLE_v10028539mg             422   7e-141   
ref|XP_010266182.1|  PREDICTED: probable serine/threonine-protein...    421   3e-140   
ref|XP_006379372.1|  hypothetical protein POPTR_0009s16860g             421   3e-140   
gb|AET03604.2|  Serine/Threonine-kinase Cx32, related protein           420   4e-140   
ref|XP_006422427.1|  hypothetical protein CICLE_v10028539mg             421   4e-140   
ref|XP_011022164.1|  PREDICTED: probable serine/threonine-protein...    421   6e-140   
ref|XP_003629128.1|  Serine/threonine protein kinase BIK1               420   7e-140   
ref|XP_002312803.2|  hypothetical protein POPTR_0009s16860g             420   8e-140   Populus trichocarpa [western balsam poplar]
ref|XP_007156235.1|  hypothetical protein PHAVU_003G269700g             419   2e-139   
ref|XP_010526844.1|  PREDICTED: probable serine/threonine-protein...    419   3e-139   
ref|XP_010918257.1|  PREDICTED: probable serine/threonine-protein...    418   6e-139   
ref|XP_010941423.1|  PREDICTED: probable serine/threonine-protein...    418   7e-139   
ref|XP_009395361.1|  PREDICTED: protein kinase APK1B, chloroplast...    416   2e-138   
gb|KHG09399.1|  hypothetical protein F383_14054                         416   3e-138   
ref|XP_011000883.1|  PREDICTED: probable serine/threonine-protein...    416   3e-138   
ref|XP_008367929.1|  PREDICTED: probable serine/threonine-protein...    415   4e-138   
ref|XP_009392329.1|  PREDICTED: probable serine/threonine-protein...    416   5e-138   
ref|XP_006384848.1|  kinase family protein                              415   8e-138   
ref|XP_008393454.1|  PREDICTED: probable serine/threonine-protein...    415   8e-138   
ref|XP_010233714.1|  PREDICTED: probable serine/threonine-protein...    415   1e-137   
gb|AFW66750.1|  putative protein kinase superfamily protein             414   3e-137   
ref|XP_002451394.1|  hypothetical protein SORBIDRAFT_04g001360          414   3e-137   Sorghum bicolor [broomcorn]
ref|XP_011000882.1|  PREDICTED: probable serine/threonine-protein...    414   3e-137   
ref|XP_011040800.1|  PREDICTED: probable serine/threonine-protein...    414   4e-137   
ref|XP_002279800.2|  PREDICTED: probable serine/threonine-protein...    413   4e-137   Vitis vinifera
ref|XP_007043058.1|  Serine/threonine-protein kinase cx32 isoform 2     413   6e-137   
ref|XP_010935290.1|  PREDICTED: probable serine/threonine-protein...    413   7e-137   
dbj|BAD28317.1|  putative protein kinase                                413   1e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008663506.1|  PREDICTED: probable serine/threonine-protein...    416   2e-136   
ref|XP_002527153.1|  serine/threonine-protein kinase cx32, putative     412   2e-136   Ricinus communis
ref|NP_001147123.1|  serine/threonine-protein kinase Cx32               412   2e-136   Zea mays [maize]
ref|XP_007043057.1|  Serine/threonine-protein kinase cx32 isoform 1     414   2e-136   
emb|CBI37741.3|  unnamed protein product                                412   4e-136   
ref|XP_009397897.1|  PREDICTED: probable serine/threonine-protein...    410   6e-136   
ref|XP_009382066.1|  PREDICTED: probable serine/threonine-protein...    411   6e-136   
gb|EMT24247.1|  Putative serine/threonine-protein kinase Cx32, ch...    410   7e-136   
ref|XP_009345926.1|  PREDICTED: probable serine/threonine-protein...    410   9e-136   
ref|XP_008653727.1|  PREDICTED: probable serine/threonine-protein...    410   1e-135   
ref|XP_008235964.1|  PREDICTED: probable serine/threonine-protein...    409   1e-135   
gb|EAY87019.1|  hypothetical protein OsI_08416                          411   1e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_007199945.1|  hypothetical protein PRUPE_ppa006347mg             409   1e-135   
ref|XP_008382436.1|  PREDICTED: probable serine/threonine-protein...    409   1e-135   
ref|XP_003538908.2|  PREDICTED: probable serine/threonine-protein...    407   2e-135   
ref|XP_008809115.1|  PREDICTED: probable serine/threonine-protein...    408   2e-135   
ref|NP_001047694.1|  Os02g0670100                                       410   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41825.1|  Putative serine/threonine-protein kinase Cx32, ch...    405   3e-135   
ref|XP_008812270.1|  PREDICTED: probable serine/threonine-protein...    408   4e-135   
ref|XP_004976505.1|  PREDICTED: probable serine/threonine-protein...    408   7e-135   
ref|XP_008781319.1|  PREDICTED: probable serine/threonine-protein...    407   7e-135   
gb|KHG23247.1|  hypothetical protein F383_30094                         407   8e-135   
ref|NP_001147720.1|  serine/threonine-protein kinase Cx32               408   1e-134   Zea mays [maize]
gb|AFW59201.1|  putative protein kinase superfamily protein             412   1e-134   
dbj|BAJ91759.1|  predicted protein                                      406   1e-134   
gb|KDP42038.1|  hypothetical protein JCGZ_03101                         407   2e-134   
ref|XP_010064951.1|  PREDICTED: probable serine/threonine-protein...    405   2e-134   
emb|CAH66747.1|  H0409D10.5                                             408   3e-134   Oryza sativa [red rice]
ref|XP_009392862.1|  PREDICTED: probable serine/threonine-protein...    405   5e-134   
ref|XP_010530999.1|  PREDICTED: probable serine/threonine-protein...    405   8e-134   
ref|XP_010530998.1|  PREDICTED: probable serine/threonine-protein...    405   8e-134   
ref|XP_004512261.1|  PREDICTED: probable serine/threonine-protein...    404   1e-133   
ref|XP_009337112.1|  PREDICTED: probable serine/threonine-protein...    404   1e-133   
ref|XP_009392863.1|  PREDICTED: probable serine/threonine-protein...    404   1e-133   
ref|XP_007018056.1|  Kinase superfamily protein                         405   1e-133   
ref|XP_006656517.1|  PREDICTED: probable serine/threonine-protein...    404   1e-133   
emb|CDP14494.1|  unnamed protein product                                404   2e-133   
gb|AAM61685.1|  putative protein kinase                                 403   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813320.1|  PREDICTED: protein kinase APK1B, chloroplast...    402   3e-133   
ref|NP_565408.1|  putative serine/threonine-specific protein kina...    403   3e-133   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ24138.1|  hypothetical protein OsJ_07878                          405   3e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008448468.1|  PREDICTED: probable serine/threonine-protein...    402   5e-133   
ref|NP_001045693.1|  Os02g0118200                                       403   5e-133   Oryza sativa Japonica Group [Japonica rice]
ref|NP_973478.1|  putative serine/threonine-specific protein kina...    402   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088714.1|  PREDICTED: probable serine/threonine-protein...    403   6e-133   
ref|XP_009788445.1|  PREDICTED: probable serine/threonine-protein...    402   7e-133   
ref|XP_011088711.1|  PREDICTED: probable serine/threonine-protein...    403   7e-133   
ref|XP_008448469.1|  PREDICTED: probable serine/threonine-protein...    402   8e-133   
ref|XP_008364420.1|  PREDICTED: probable serine/threonine-protein...    400   8e-133   
ref|XP_009788446.1|  PREDICTED: probable serine/threonine-protein...    402   9e-133   
ref|XP_006646791.1|  PREDICTED: probable serine/threonine-protein...    402   1e-132   
ref|XP_006342141.1|  PREDICTED: probable serine/threonine-protein...    402   1e-132   
ref|XP_006409336.1|  hypothetical protein EUTSA_v10022708mg             401   1e-132   
emb|CAE03087.2|  OSJNBa0017B10.2                                        404   1e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009373402.1|  PREDICTED: probable serine/threonine-protein...    401   2e-132   
ref|XP_004146212.1|  PREDICTED: probable serine/threonine-protein...    400   3e-132   
ref|NP_001058637.1|  Os06g0727400                                       400   3e-132   Oryza sativa Japonica Group [Japonica rice]
gb|KCW70322.1|  hypothetical protein EUGRSUZ_F03566                     398   4e-132   
ref|XP_009593137.1|  PREDICTED: probable serine/threonine-protein...    400   4e-132   
ref|XP_002886105.1|  hypothetical protein ARALYDRAFT_480605             400   5e-132   
ref|XP_010111698.1|  putative serine/threonine-protein kinase Cx32      401   5e-132   
gb|AES95298.2|  Serine/Threonine-kinase Cx32, related protein           399   6e-132   
ref|NP_001235086.1|  protein kinase                                     400   6e-132   
gb|KCW70323.1|  hypothetical protein EUGRSUZ_F03566                     398   6e-132   
ref|XP_003581530.2|  PREDICTED: probable serine/threonine-protein...    405   7e-132   
ref|XP_010240264.1|  PREDICTED: probable serine/threonine-protein...    405   7e-132   
ref|XP_004159758.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    399   8e-132   
ref|XP_007157997.1|  hypothetical protein PHAVU_002G115800g             397   8e-132   
ref|XP_008372852.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    400   1e-131   
gb|ACJ84370.1|  unknown                                                 399   1e-131   Medicago truncatula
ref|XP_003572799.1|  PREDICTED: probable serine/threonine-protein...    400   1e-131   
ref|XP_010690221.1|  PREDICTED: probable serine/threonine-protein...    399   1e-131   
gb|KGN55604.1|  hypothetical protein Csa_3G001760                       399   1e-131   
gb|KHG23246.1|  hypothetical protein F383_30094                         399   1e-131   
emb|CDY31372.1|  BnaA07g03070D                                          399   1e-131   
ref|XP_009121148.1|  PREDICTED: probable serine/threonine-protein...    399   1e-131   
ref|XP_006590748.1|  PREDICTED: probable serine/threonine-protein...    397   2e-131   
dbj|BAK06515.1|  predicted protein                                      400   2e-131   
ref|XP_010515435.1|  PREDICTED: probable serine/threonine-protein...    399   2e-131   
ref|XP_010489347.1|  PREDICTED: probable serine/threonine-protein...    398   3e-131   
ref|XP_006590747.1|  PREDICTED: probable serine/threonine-protein...    397   3e-131   
ref|XP_010515408.1|  PREDICTED: probable serine/threonine-protein...    398   3e-131   
ref|XP_003538909.1|  PREDICTED: probable serine/threonine-protein...    397   4e-131   
ref|XP_004231098.1|  PREDICTED: probable serine/threonine-protein...    397   4e-131   
ref|XP_004287732.1|  PREDICTED: probable serine/threonine-protein...    397   5e-131   
emb|CDX71350.1|  BnaC07g06290D                                          397   5e-131   
ref|XP_009396689.1|  PREDICTED: probable serine/threonine-protein...    397   5e-131   
ref|XP_010489344.1|  PREDICTED: probable serine/threonine-protein...    397   6e-131   
ref|XP_003612340.1|  Serine/threonine protein kinase                    399   7e-131   
ref|XP_009765256.1|  PREDICTED: probable serine/threonine-protein...    397   9e-131   
ref|XP_006364355.1|  PREDICTED: probable serine/threonine-protein...    397   9e-131   
ref|XP_009792375.1|  PREDICTED: probable serine/threonine-protein...    397   9e-131   
ref|XP_009792373.1|  PREDICTED: probable serine/threonine-protein...    397   1e-130   
ref|XP_009792374.1|  PREDICTED: probable serine/threonine-protein...    397   1e-130   
ref|XP_010663976.1|  PREDICTED: probable serine/threonine-protein...    397   2e-130   
ref|XP_010663975.1|  PREDICTED: probable serine/threonine-protein...    397   2e-130   
ref|XP_009765257.1|  PREDICTED: probable serine/threonine-protein...    396   2e-130   
gb|EMT33274.1|  Protein kinase APK1A, chloroplastic                     395   2e-130   
ref|XP_002510681.1|  serine/threonine-protein kinase cx32, putative     396   3e-130   Ricinus communis
ref|XP_009112418.1|  PREDICTED: probable serine/threonine-protein...    395   4e-130   
ref|XP_009622682.1|  PREDICTED: probable serine/threonine-protein...    396   5e-130   
ref|XP_009622683.1|  PREDICTED: probable serine/threonine-protein...    395   5e-130   
ref|XP_009622684.1|  PREDICTED: probable serine/threonine-protein...    395   6e-130   
emb|CDY47489.1|  BnaA09g08980D                                          394   7e-130   
ref|XP_008663505.1|  PREDICTED: probable serine/threonine-protein...    400   8e-130   
gb|KFK40107.1|  hypothetical protein AALP_AA3G331300                    394   1e-129   
ref|NP_001174044.1|  Os04g0563900                                       399   1e-129   
gb|KFK40106.1|  hypothetical protein AALP_AA3G331300                    394   1e-129   
emb|CDY26797.1|  BnaC09g09240D                                          394   1e-129   
gb|KFK30195.1|  hypothetical protein AALP_AA7G230500                    394   2e-129   
gb|KDP36787.1|  hypothetical protein JCGZ_08078                         394   2e-129   
ref|XP_008663503.1|  PREDICTED: probable serine/threonine-protein...    399   2e-129   
ref|XP_008663504.1|  PREDICTED: probable serine/threonine-protein...    399   2e-129   
ref|XP_003519694.1|  PREDICTED: probable serine/threonine-protein...    392   4e-129   
gb|KHN09350.1|  Putative serine/threonine-protein kinase Cx32, ch...    392   4e-129   
gb|EYU38037.1|  hypothetical protein MIMGU_mgv1a007214mg                392   6e-129   
ref|XP_004955142.1|  PREDICTED: protein kinase APK1B, chloroplast...    394   8e-129   
ref|XP_010320466.1|  PREDICTED: probable serine/threonine-protein...    392   8e-129   
ref|XP_002452769.1|  hypothetical protein SORBIDRAFT_04g032190          394   8e-129   Sorghum bicolor [broomcorn]
ref|XP_004966517.1|  PREDICTED: probable serine/threonine-protein...    392   1e-128   
emb|CBI40720.3|  unnamed protein product                                394   1e-128   
ref|XP_004144887.1|  PREDICTED: probable serine/threonine-protein...    391   1e-128   
ref|XP_008447840.1|  PREDICTED: probable serine/threonine-protein...    391   1e-128   
ref|XP_010446903.1|  PREDICTED: probable serine/threonine-protein...    391   2e-128   
dbj|BAK05598.1|  predicted protein                                      392   2e-128   
ref|XP_010437452.1|  PREDICTED: probable serine/threonine-protein...    390   3e-128   
ref|XP_010437451.1|  PREDICTED: probable serine/threonine-protein...    390   4e-128   
gb|KDP43762.1|  hypothetical protein JCGZ_22389                         389   5e-128   
emb|CDP07284.1|  unnamed protein product                                391   5e-128   
ref|XP_004238436.1|  PREDICTED: probable serine/threonine-protein...    390   5e-128   
ref|XP_004290061.1|  PREDICTED: probable serine/threonine-protein...    390   6e-128   
ref|XP_010437450.1|  PREDICTED: probable serine/threonine-protein...    390   7e-128   
ref|XP_006412084.1|  hypothetical protein EUTSA_v10025265mg             389   1e-127   
ref|XP_010530963.1|  PREDICTED: probable serine/threonine-protein...    389   1e-127   
ref|XP_010437449.1|  PREDICTED: probable serine/threonine-protein...    389   1e-127   
gb|KGN43339.1|  hypothetical protein Csa_7G024130                       391   1e-127   
ref|XP_006855749.1|  hypothetical protein AMTR_s00044p00168360          403   2e-127   
emb|CDX69153.1|  BnaC01g03000D                                          389   3e-127   
emb|CDX75515.1|  BnaA01g01870D                                          388   3e-127   
ref|XP_008781318.1|  PREDICTED: probable serine/threonine-protein...    386   5e-127   
ref|XP_009151452.1|  PREDICTED: probable serine/threonine-protein...    387   5e-127   
ref|XP_006283798.1|  hypothetical protein CARUB_v10004888mg             387   8e-127   
ref|XP_003563244.1|  PREDICTED: probable serine/threonine-protein...    386   1e-126   
ref|XP_002307794.2|  hypothetical protein POPTR_0005s27330g             387   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010066335.1|  PREDICTED: probable serine/threonine-protein...    386   1e-126   
ref|XP_002439066.1|  hypothetical protein SORBIDRAFT_10g030880          386   1e-126   Sorghum bicolor [broomcorn]
ref|XP_010548159.1|  PREDICTED: probable serine/threonine-protein...    386   1e-126   
dbj|BAE71262.1|  putative protein kinase APK1A                          385   2e-126   Trifolium pratense [peavine clover]
ref|XP_010536475.1|  PREDICTED: probable serine/threonine-protein...    387   4e-126   
ref|XP_011074087.1|  PREDICTED: probable serine/threonine-protein...    385   6e-126   
ref|NP_001148215.1|  protein kinase APK1B                               386   1e-125   Zea mays [maize]
ref|XP_009764652.1|  PREDICTED: probable serine/threonine-protein...    383   1e-125   
ref|XP_010094560.1|  putative serine/threonine-protein kinase Cx32      385   1e-125   
ref|XP_007142571.1|  hypothetical protein PHAVU_008G292000g             384   2e-125   
emb|CAB80276.1|  protein kinase-like protein                            383   2e-125   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81341.1|  hypothetical protein OsI_24527                          399   3e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_010663977.1|  PREDICTED: protein kinase APK1B, chloroplastic     383   3e-125   
ref|XP_002300641.2|  hypothetical protein POPTR_0002s01040g             384   4e-125   Populus trichocarpa [western balsam poplar]
gb|KEH39440.1|  kinase 1B                                               382   4e-125   
ref|XP_004500869.1|  PREDICTED: probable serine/threonine-protein...    381   4e-125   
ref|XP_003523529.1|  PREDICTED: protein kinase APK1B, chloroplast...    380   6e-125   
ref|XP_004500870.1|  PREDICTED: probable serine/threonine-protein...    380   6e-125   
ref|NP_001190928.1|  putative serine/threonine-protein kinase Cx32      382   7e-125   
gb|KCW55673.1|  hypothetical protein EUGRSUZ_I01524                     381   7e-125   
ref|XP_004500872.1|  PREDICTED: probable serine/threonine-protein...    380   8e-125   
ref|NP_195285.3|  putative serine/threonine-protein kinase Cx32         382   8e-125   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43900.1|  unknown                                                 381   8e-125   
ref|XP_011041221.1|  PREDICTED: probable serine/threonine-protein...    382   9e-125   
gb|AFW63337.1|  putative protein kinase superfamily protein             383   1e-124   
ref|XP_007157998.1|  hypothetical protein PHAVU_002G115900g             380   2e-124   
emb|CAA20030.1|  protein kinase - like protein                          378   3e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CBI40719.3|  unnamed protein product                                380   3e-124   
ref|XP_003548810.2|  PREDICTED: probable serine/threonine-protein...    380   4e-124   
ref|XP_010028844.1|  PREDICTED: probable serine/threonine-protein...    380   5e-124   
ref|XP_006435368.1|  hypothetical protein CICLE_v10001177mg             380   6e-124   
ref|XP_010428693.1|  PREDICTED: probable serine/threonine-protein...    381   7e-124   
ref|XP_010679959.1|  PREDICTED: probable serine/threonine-protein...    379   1e-123   
ref|XP_010416552.1|  PREDICTED: probable serine/threonine-protein...    382   1e-123   
ref|XP_008237981.1|  PREDICTED: probable serine/threonine-protein...    379   1e-123   
ref|XP_011092993.1|  PREDICTED: probable serine/threonine-protein...    378   2e-123   
ref|XP_010416550.1|  PREDICTED: probable serine/threonine-protein...    380   2e-123   
ref|XP_002869077.1|  connexin 32                                        378   3e-123   
ref|XP_010471786.1|  PREDICTED: probable serine/threonine-protein...    379   3e-123   
ref|XP_004146213.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    375   4e-123   
ref|XP_006473798.1|  PREDICTED: probable serine/threonine-protein...    378   5e-123   
ref|NP_001234409.1|  protein kinase 1b                                  377   5e-123   
ref|XP_004159759.1|  PREDICTED: probable serine/threonine-protein...    375   6e-123   
ref|XP_004301978.1|  PREDICTED: protein kinase 2A, chloroplastic-...    378   6e-123   
ref|XP_010040704.1|  PREDICTED: probable serine/threonine-protein...    378   8e-123   
ref|XP_006302239.1|  hypothetical protein CARUB_v10020265mg             378   1e-122   
emb|CDX72549.1|  BnaC07g45710D                                          377   1e-122   
ref|XP_009138380.1|  PREDICTED: probable serine/threonine-protein...    376   2e-122   
ref|XP_010061181.1|  PREDICTED: probable serine/threonine-protein...    376   3e-122   
ref|XP_011016043.1|  PREDICTED: probable serine/threonine-protein...    377   5e-122   
ref|XP_002468577.1|  hypothetical protein SORBIDRAFT_01g048300          374   6e-122   Sorghum bicolor [broomcorn]
ref|XP_006390207.1|  hypothetical protein EUTSA_v10018510mg             376   6e-122   
gb|AAF16665.1|AC012394_14  putative protein kinase; 59396-62219         375   6e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142572.1|  hypothetical protein PHAVU_008G292000g             375   6e-122   
gb|KHN20110.1|  Putative serine/threonine-protein kinase NAK            371   8e-122   
ref|XP_003527639.1|  PREDICTED: probable serine/threonine-protein...    372   8e-122   
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    374   8e-122   
gb|EYU36568.1|  hypothetical protein MIMGU_mgv1a007211mg                374   9e-122   
ref|NP_177762.3|  putative protein kinase                               376   1e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       374   1e-121   
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             374   2e-121   Populus trichocarpa [western balsam poplar]
gb|KDP20446.1|  hypothetical protein JCGZ_05291                         373   2e-121   
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplast...    372   2e-121   
ref|XP_007210594.1|  hypothetical protein PRUPE_ppa016837mg             369   2e-121   
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     372   3e-121   
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    372   3e-121   
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             372   3e-121   
gb|KEH36322.1|  Serine/Threonine kinase family protein                  372   3e-121   
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    372   4e-121   
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   372   5e-121   
gb|EMS52039.1|  putative serine/threonine-protein kinase Cx32, ch...    372   5e-121   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    372   5e-121   
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    372   5e-121   
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     371   6e-121   
dbj|BAK03372.1|  predicted protein                                      371   9e-121   
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     371   9e-121   
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    371   1e-120   
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       370   1e-120   
ref|XP_009109286.1|  PREDICTED: probable serine/threonine-protein...    371   1e-120   
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                370   1e-120   
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     370   1e-120   
ref|XP_007204164.1|  hypothetical protein PRUPE_ppa017617mg             369   1e-120   
emb|CDY41645.1|  BnaC03g62390D                                          371   2e-120   
ref|XP_007016403.1|  Kinase 1B isoform 1                                370   2e-120   
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             370   3e-120   
emb|CDP09060.1|  unnamed protein product                                369   4e-120   
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    369   6e-120   
emb|CBI16124.3|  unnamed protein product                                369   6e-120   
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    369   6e-120   
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       368   8e-120   
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     370   8e-120   
gb|EPS70761.1|  hypothetical protein M569_03998                         367   8e-120   
ref|XP_009128175.1|  PREDICTED: probable serine/threonine-protein...    370   9e-120   
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             369   9e-120   
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    369   1e-119   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    367   1e-119   
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               368   1e-119   
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    367   2e-119   
gb|KHN09344.1|  Putative serine/threonine-protein kinase Cx32, ch...    366   2e-119   
ref|XP_008645103.1|  PREDICTED: probable serine/threonine-protein...    367   2e-119   
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     367   2e-119   
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    367   3e-119   
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    367   3e-119   
ref|XP_009104679.1|  PREDICTED: probable serine/threonine-protein...    368   4e-119   
gb|KDP35639.1|  hypothetical protein JCGZ_09077                         366   5e-119   
ref|XP_004144241.1|  PREDICTED: probable serine/threonine-protein...    365   5e-119   
ref|XP_006846202.1|  hypothetical protein AMTR_s00012p00221000          366   7e-119   
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    366   9e-119   
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    366   9e-119   
ref|XP_003548807.2|  PREDICTED: probable serine/threonine-protein...    365   1e-118   
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    365   1e-118   
ref|XP_009106296.1|  PREDICTED: probable serine/threonine-protein...    367   1e-118   
gb|AET01074.2|  Serine/Threonine kinase family protein                  365   1e-118   
gb|EYU40476.1|  hypothetical protein MIMGU_mgv1a006634mg                366   1e-118   
ref|XP_007136021.1|  hypothetical protein PHAVU_009G011400g             364   2e-118   
ref|XP_004985841.1|  PREDICTED: probable serine/threonine-protein...    364   2e-118   
gb|ADN33987.1|  serine/threonine-protein kinase cx32                    363   2e-118   
emb|CDP06608.1|  unnamed protein product                                365   3e-118   
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    365   3e-118   
emb|CDY39519.1|  BnaC04g15180D                                          364   3e-118   
ref|XP_003618113.1|  Protein kinase 2B                                  364   3e-118   
gb|EPS71474.1|  hypothetical protein M569_03280                         364   3e-118   
ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           365   3e-118   
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          363   3e-118   
ref|XP_003618114.1|  Protein kinase 2B                                  364   3e-118   
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    365   3e-118   
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     364   4e-118   
ref|XP_010106485.1|  Protein kinase APK1A                               364   4e-118   
ref|XP_008465651.1|  PREDICTED: probable serine/threonine-protein...    361   7e-118   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    363   7e-118   
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     370   8e-118   
emb|CDY40618.1|  BnaA03g53450D                                          363   8e-118   
ref|NP_001242670.1|  uncharacterized protein LOC100798404               364   8e-118   
gb|KFK42056.1|  hypothetical protein AALP_AA2G205700                    365   9e-118   
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    363   9e-118   
ref|XP_002889077.1|  hypothetical protein ARALYDRAFT_476789             367   1e-117   
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    363   1e-117   
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    364   1e-117   
ref|NP_001151952.1|  LOC100285589                                       363   1e-117   
dbj|BAC43515.1|  putative protein kinase                                360   1e-117   
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    362   1e-117   
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    363   1e-117   
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    362   1e-117   
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    362   1e-117   
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    362   2e-117   
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    362   2e-117   
ref|XP_003616403.1|  Serine/threonine protein kinase                    363   2e-117   
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    362   2e-117   
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    362   2e-117   
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     362   3e-117   
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                362   3e-117   
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     362   3e-117   
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       361   4e-117   
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    362   4e-117   
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     361   4e-117   
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    362   5e-117   
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    362   5e-117   
gb|AAA18853.1|  protein kinase                                          360   6e-117   
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             361   6e-117   
ref|NP_001140469.1|  uncharacterized LOC100272528                       361   6e-117   
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     361   6e-117   
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    361   6e-117   
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     362   6e-117   
dbj|BAJ95924.1|  predicted protein                                      362   6e-117   
emb|CDY09904.1|  BnaC08g45470D                                          361   8e-117   
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    361   8e-117   
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     361   8e-117   
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             361   9e-117   
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    361   1e-116   
ref|NP_001051730.1|  Os03g0821900                                       361   1e-116   
gb|AAO18450.1|  putative protein kinase                                 360   1e-116   
ref|XP_003567536.1|  PREDICTED: probable serine/threonine-protein...    360   1e-116   
ref|NP_001031439.1|  protein kinase APK1B                               360   1e-116   
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             360   1e-116   
ref|NP_172237.1|  protein kinase APK1A                                  360   2e-116   
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    361   2e-116   
ref|XP_004142761.1|  PREDICTED: protein kinase APK1A, chloroplast...    360   2e-116   
ref|NP_001031440.1|  protein kinase APK1B                               360   2e-116   
emb|CDY06715.1|  BnaA10g04940D                                          360   2e-116   
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    359   2e-116   
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    359   2e-116   
emb|CDX77220.1|  BnaC04g40150D                                          360   3e-116   
gb|AGP76187.1|  MLPK                                                    360   3e-116   
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             359   3e-116   
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    360   3e-116   
ref|XP_004500871.1|  PREDICTED: probable serine/threonine-protein...    358   3e-116   
emb|CDY31741.1|  BnaA04g16770D                                          360   3e-116   
emb|CDY10453.1|  BnaCnng03540D                                          358   3e-116   
ref|NP_180459.2|  protein kinase APK1B                                  360   4e-116   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    359   4e-116   
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     359   4e-116   
emb|CDX87609.1|  BnaA07g32640D                                          360   4e-116   
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    359   4e-116   
emb|CDX95143.1|  BnaC05g05280D                                          359   4e-116   
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    358   4e-116   
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          359   4e-116   
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   358   5e-116   
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            362   5e-116   
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             359   5e-116   
gb|EEC78387.1|  hypothetical protein OsI_18165                          358   5e-116   
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    359   6e-116   
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    359   6e-116   
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    359   6e-116   
emb|CDX72550.1|  BnaC07g45720D                                          358   6e-116   
ref|NP_001184929.1|  protein kinase APK1A                               359   7e-116   
ref|XP_010096366.1|  Protein kinase 2B                                  359   7e-116   
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    358   8e-116   
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    358   8e-116   
emb|CDY40347.1|  BnaA10g27210D                                          358   8e-116   
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    358   8e-116   
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             358   8e-116   
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    358   9e-116   
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    357   1e-115   
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             358   1e-115   
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             354   1e-115   
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                358   1e-115   
ref|XP_010692535.1|  PREDICTED: probable serine/threonine-protein...    358   1e-115   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             358   1e-115   
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             358   1e-115   
emb|CCI55428.1|  PH01B031C15.11                                         357   1e-115   
ref|XP_010063131.1|  PREDICTED: probable serine/threonine-protein...    360   1e-115   
ref|NP_001054444.1|  Os05g0110900                                       357   1e-115   
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    357   1e-115   
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             358   1e-115   
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             358   1e-115   
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    357   1e-115   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    358   1e-115   
ref|XP_008241543.1|  PREDICTED: probable LRR receptor-like serine...    368   2e-115   
ref|XP_008241544.1|  PREDICTED: probable LRR receptor-like serine...    368   2e-115   
ref|NP_001045548.1|  Os01g0973500                                       357   2e-115   
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    358   2e-115   
ref|XP_004171473.1|  PREDICTED: probable serine/threonine-protein...    357   2e-115   
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    358   2e-115   
gb|EEC72262.1|  hypothetical protein OsI_05407                          357   2e-115   
ref|XP_011035315.1|  PREDICTED: protein kinase APK1B, chloroplast...    355   2e-115   
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    357   2e-115   
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    357   2e-115   
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    357   2e-115   
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     357   3e-115   
ref|XP_006300039.1|  hypothetical protein CARUB_v10016265mg             356   3e-115   
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    357   3e-115   
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             357   3e-115   
ref|XP_002315799.1|  KINASE 2B family protein                           357   3e-115   
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    357   3e-115   
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             357   3e-115   
ref|XP_009362864.1|  PREDICTED: probable serine/threonine-protein...    358   3e-115   
gb|ACU19261.1|  unknown                                                 356   3e-115   
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             357   3e-115   
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    356   3e-115   
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             356   3e-115   
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           357   4e-115   
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    357   4e-115   
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    356   4e-115   
ref|XP_004491643.1|  PREDICTED: probable serine/threonine-protein...    355   4e-115   
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    357   5e-115   
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    357   5e-115   
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    356   5e-115   
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             356   5e-115   
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    356   6e-115   
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    356   6e-115   
emb|CDY24816.1|  BnaA08g14940D                                          355   6e-115   
emb|CDY48100.1|  BnaC02g03570D                                          355   6e-115   
gb|KHG05340.1|  Protein kinase APK1A, chloroplastic -like protein       356   6e-115   
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    356   6e-115   
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    356   7e-115   
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    354   7e-115   
ref|XP_010258573.1|  PREDICTED: protein kinase 2B, chloroplastic-...    356   7e-115   
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             355   7e-115   
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     355   7e-115   
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    355   9e-115   
ref|XP_010652320.1|  PREDICTED: protein kinase 2B, chloroplastic ...    356   1e-114   
ref|XP_010258572.1|  PREDICTED: protein kinase 2B, chloroplastic-...    355   1e-114   
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    355   1e-114   
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    355   1e-114   
gb|ACF83789.1|  unknown                                                 354   1e-114   
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    355   1e-114   
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    355   1e-114   
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    353   1e-114   
ref|XP_006651008.1|  PREDICTED: probable serine/threonine-protein...    352   2e-114   
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          355   2e-114   
emb|CDP16537.1|  unnamed protein product                                353   2e-114   
ref|XP_011025834.1|  PREDICTED: protein kinase 2B, chloroplastic-...    355   2e-114   
ref|XP_002277256.1|  PREDICTED: protein kinase 2B, chloroplastic ...    355   2e-114   
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    354   2e-114   
emb|CDX85943.1|  BnaC06g21910D                                          355   3e-114   
ref|XP_011025841.1|  PREDICTED: protein kinase 2B, chloroplastic-...    355   3e-114   
ref|XP_010683239.1|  PREDICTED: protein kinase 2B, chloroplastic-...    355   3e-114   
gb|KDP21209.1|  hypothetical protein JCGZ_21680                         354   3e-114   
gb|AEK05513.1|  serine/threonine-protein kinase                         351   3e-114   
ref|NP_001235430.1|  protein kinase                                     352   3e-114   
ref|XP_007046178.1|  Kinase 2B isoform 1                                355   3e-114   
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    354   3e-114   
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    354   3e-114   
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    354   3e-114   
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     353   3e-114   
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    354   3e-114   



>ref|XP_011096982.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Sesamum indicum]
Length=418

 Score =   469 bits (1206),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 241/372 (65%), Positives = 282/372 (76%), Gaps = 9/372 (2%)
 Frame = +3

Query  294   MGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLE  473
             MGN  GS  A   +   PS+   ST  +  S  G+ R  S+    GG  +A    +  L 
Sbjct  1     MGNCFGSEPA---ADPKPSSTNLSTP-TKQSTPGTSRDYSS----GGGLSATS-SSAGLS  51

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
              +S+A S+D+   G ILP PNLK YS A+L  AT NFK DMVLG GGFGTV+KGWVDE T
Sbjct  52    RFSAALSDDACLAGEILPIPNLKTYSFADLRNATRNFKSDMVLGVGGFGTVYKGWVDEKT  111

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
             L PS+ G+GM+VAIKKL   S+QGFEEW+SEV  LG   HPN++KLLGYCWE  +LLLVY
Sbjct  112   LMPSKIGTGMMVAIKKLNPESMQGFEEWQSEVNFLGRLCHPNLVKLLGYCWEDKELLLVY  171

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLFR+N   + LSWDLRL IAIG ARGLAFLH S++QVI RD K+SNILL
Sbjct  172   EFMQKGSLENHLFRRNAAIEPLSWDLRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILL  231

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D +YNAKISDFGLAKLGPSG +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  232   DGSYNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLL  291

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EMLTGLR+LD + PSGQH LV W+KP+L Q  KLKS MD R+EGQYSS+A LQA+QLTLR
Sbjct  292   EMLTGLRALDTRRPSGQHNLVDWLKPLLPQRRKLKSYMDARIEGQYSSKAALQASQLTLR  351

Query  1374  CLESQPEKRPSM  1409
             CLE +P KRPSM
Sbjct  352   CLEGEPRKRPSM  363



>ref|XP_006343333.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=414

 Score =   462 bits (1190),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 278/360 (77%), Gaps = 5/360 (1%)
 Frame = +3

Query  336   GALPSNNKGSTAFSALSRIGSYRQLSAAESEGG--NANAKCLPTPNLEIYSSAESEDSNA  509
             GA  SN+K S+ + + S   S    S + S G   +A +  +   N   +S+A SED+  
Sbjct  6     GAKLSNSKSSSTYPSFSARPSTPDTSKSYSNGVGYSATSGSIGCSN---FSAAASEDTCL  62

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             NG ILP PNLK+YS ++L+++T NFK D VLG GGFGTV+KGWVDE TL P++PG+GMIV
Sbjct  63    NGEILPIPNLKIYSFSDLKLSTKNFKPDSVLGIGGFGTVYKGWVDEKTLTPTKPGTGMIV  122

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL   S QGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLVYE+M  GSLENHL
Sbjct  123   AIKKLNSESTQGFEEWQSEVNFLGRLSHPNLVKLLGYCHEDKELLLVYEFMPKGSLENHL  182

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR++   + LSWDLRL IAIG ARGLAFLH SE++VI RD K+SNILLD NYNAKISDFG
Sbjct  183   FRRSAAIEPLSWDLRLKIAIGAARGLAFLHTSEKKVIYRDFKASNILLDGNYNAKISDFG  242

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPSG +SHVTTRV+GT GY APEY+ETG+LYVKSDVY FGV++LE+LTGLR+LD K
Sbjct  243   LAKLGPSGSDSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVVLELLTGLRALDTK  302

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+GQ  LV WVKPMLS + KLKSIMD RMEGQYSS+A   AAQ+TL CLE  P+ RPSM
Sbjct  303   RPNGQEKLVDWVKPMLSNKRKLKSIMDARMEGQYSSKAATLAAQITLECLEGDPKNRPSM  362



>ref|XP_009773233.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana sylvestris]
Length=418

 Score =   461 bits (1186),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 234/373 (63%), Positives = 279/373 (75%), Gaps = 12/373 (3%)
 Frame = +3

Query  294   MGNFVGSRTADS-ISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNL  470
             MGN  G++ ++S  S   PS +   +         S    SA  S  GN++         
Sbjct  1     MGNCFGAKLSNSNPSSTHPSFSARPSTPDTSKNYSSGVGYSATSSSIGNSH---------  51

Query  471   EIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDEN  650
               +S+A S+D+  NG ILPTPNLK+++ ++L++AT NFK D VLG GGFGTV+KGWVDE 
Sbjct  52    --FSAAASDDTCLNGEILPTPNLKIFNFSDLKLATKNFKSDSVLGVGGFGTVYKGWVDEK  109

Query  651   TLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLV  830
             TLAP++ G GMIVAIKKL   S QGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLV
Sbjct  110   TLAPAKAGIGMIVAIKKLNSESTQGFEEWQSEVNFLGRLSHPNLVKLLGYCREDKELLLV  169

Query  831   YEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNIL  1010
             YE+MQ GSLENHLFR++   + LSW+LRL I IG ARGLAFLH SE++VI RD K+SNIL
Sbjct  170   YEFMQKGSLENHLFRRSAAIEPLSWNLRLKIVIGAARGLAFLHSSEKKVIYRDFKASNIL  229

Query  1011  LDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLL  1190
             LD NYNAKISDFGLAKLGPSG NSHVTTRV+GT GY APEY+ETG+LYVKSDVY FGV+L
Sbjct  230   LDGNYNAKISDFGLAKLGPSGGNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVL  289

Query  1191  LEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             LEMLTGLR+LD K PSGQ  LV WVKPMLS + KLKSIMD R+EGQYSS+    AAQ+TL
Sbjct  290   LEMLTGLRALDTKRPSGQQKLVDWVKPMLSNKRKLKSIMDARLEGQYSSKGATLAAQITL  349

Query  1371  RCLESQPEKRPSM  1409
             +CLE  P+ RPSM
Sbjct  350   KCLEGDPKNRPSM  362



>ref|XP_004253237.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=415

 Score =   460 bits (1184),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 259/311 (83%), Gaps = 0/311 (0%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A SEDS +NG ILPTPNLK YS ++L+ AT NFK D VLG GGFGTVFKGWVDE TL
Sbjct  50    FSAAASEDSCSNGEILPTPNLKTYSFSDLKAATRNFKSDTVLGVGGFGTVFKGWVDEKTL  109

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P++ G+GM+VAIKKL   S+QGFEEW++EV  LG  SHPN++KLLGYCWE  +LLLVYE
Sbjct  110   TPTKVGTGMVVAIKKLNSESMQGFEEWQAEVNFLGRLSHPNLVKLLGYCWEDKELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLFR++   + LSW+LRL IAIG ARGLAFLH SE+Q+I RD K+SNILLD
Sbjct  170   FMPKGSLENHLFRRSTAIEPLSWELRLKIAIGAARGLAFLHSSEKQIIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y+AK+SDFGLAK+GPS  NSHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  230   GSYHAKLSDFGLAKVGPSAGNSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD K P GQH LV W+KPMLS + KLKSIMD RMEGQYSS+A +  AQLT++C
Sbjct  290   LLTGLRALDTKRPGGQHNLVDWMKPMLSNKRKLKSIMDARMEGQYSSKAAILTAQLTIKC  349

Query  1377  LESQPEKRPSM  1409
             LE +P+KRPSM
Sbjct  350   LEGEPKKRPSM  360



>ref|XP_009804656.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana sylvestris]
Length=414

 Score =   460 bits (1183),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 258/311 (83%), Gaps = 0/311 (0%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+  SEDS  NG ILPTPNLK YS ++L+ AT NFK D VLG GGFGTVFKGWVDE TL
Sbjct  49    FSATASEDSYFNGEILPTPNLKTYSFSDLKAATRNFKSDTVLGVGGFGTVFKGWVDEKTL  108

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P++ G+GM+VAIKKL   S+QGFEEW++EV  LG  SHPN++KL+GYCWE  +LLLVYE
Sbjct  109   TPTKVGTGMVVAIKKLNSESMQGFEEWQAEVNFLGRLSHPNLVKLMGYCWEDKELLLVYE  168

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLFR++   + LSW+LRL IAIG ARGLAFLH SE+Q+I RD K+SNILLD
Sbjct  169   FMPKGSLENHLFRRSTAIEPLSWELRLKIAIGAARGLAFLHSSEKQIIYRDFKASNILLD  228

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              NY+AK+SDFGLAK+GPS  NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  229   GNYHAKLSDFGLAKVGPSAGNSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  288

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD K P+GQH LV WVKPMLS + KL+S+MD RMEGQYSS+A L AAQL+L+C
Sbjct  289   LLTGLRALDTKRPNGQHNLVDWVKPMLSNKRKLRSVMDARMEGQYSSKAALVAAQLSLKC  348

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  349   LEGEPKNRPSM  359



>ref|XP_009597877.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=409

 Score =   459 bits (1182),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 219/311 (70%), Positives = 257/311 (83%), Gaps = 0/311 (0%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A S+D+  NG ILPTPNLK+Y  ++L++AT NFK D VLG GGFGTV+KGWVDE TL
Sbjct  54    FSAAASDDTCLNGEILPTPNLKIYCFSDLKLATKNFKSDSVLGIGGFGTVYKGWVDEKTL  113

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP++ G GMIVAIKKL   S QGFEEW+SEV  LG  SHPN++KLLGYC E  +LLL+YE
Sbjct  114   APTKAGIGMIVAIKKLNSESTQGFEEWQSEVNFLGRLSHPNLVKLLGYCREDKELLLIYE  173

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLFR++   + L+WDLRL I IG ARGLAFLH SE++VI RD K+SNILLD
Sbjct  174   FMQKGSLENHLFRRSAAIEPLTWDLRLKIVIGAARGLAFLHTSEKKVIYRDFKASNILLD  233

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              NYNAKISDFGLAKLGPSG NSHVTTRV+GT GY APEY+ETG+LYVKSDVY FGV+LLE
Sbjct  234   GNYNAKISDFGLAKLGPSGGNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVLLE  293

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD K PSGQ  LV WVKPMLS + KLKSIMD R+EGQYSS+  + AAQ+TL+C
Sbjct  294   ILTGLRALDTKRPSGQQKLVDWVKPMLSNKRKLKSIMDARLEGQYSSKGAMLAAQITLKC  353

Query  1377  LESQPEKRPSM  1409
             LE  P+ RPSM
Sbjct  354   LEGDPKNRPSM  364



>ref|XP_006340004.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=415

 Score =   459 bits (1181),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 217/311 (70%), Positives = 256/311 (82%), Gaps = 0/311 (0%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A SEDS  NG ILPTPNLK YS ++L+ AT NFK D VLG GGFGTVFKGWVDE TL
Sbjct  50    FSVAASEDSCLNGEILPTPNLKTYSFSDLKAATRNFKSDTVLGVGGFGTVFKGWVDEKTL  109

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P++ G+GM+VAIKKL   S+QGFEEW++EV  LG  SHPN++KLLGYCWE  +LLLVYE
Sbjct  110   TPTKVGTGMVVAIKKLNSESVQGFEEWQAEVNFLGRLSHPNLVKLLGYCWEDKELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLFR++   + LSW+LRL IAIG ARGLAFLH SE+Q+I RD K+SNILLD
Sbjct  170   FMPKGSLENHLFRRSTAIEPLSWELRLKIAIGAARGLAFLHSSEKQIIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y+AK+SDFGLAK+GPS  NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  230   GSYHAKLSDFGLAKVGPSAGNSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD K P GQH LV W+KPMLS + KLKSIMD RMEGQYSS+A    AQLT++C
Sbjct  290   LLTGLRALDTKRPGGQHNLVDWMKPMLSNKRKLKSIMDARMEGQYSSKAATLTAQLTMKC  349

Query  1377  LESQPEKRPSM  1409
             LE +P+KRPSM
Sbjct  350   LEGEPKKRPSM  360



>ref|XP_004234513.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=418

 Score =   459 bits (1181),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 277/360 (77%), Gaps = 5/360 (1%)
 Frame = +3

Query  336   GALPSNNKGSTAFSALSRIGSYRQLSAAESEGG--NANAKCLPTPNLEIYSSAESEDSNA  509
             GA  SN+K S+ + + S   S    S + S G   +A +  +   N   +S+A SED   
Sbjct  6     GAKLSNSKSSSTYPSFSARPSTPDTSKSYSTGVGYSATSGSIGCSN---FSAAASEDICL  62

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             NG ILP PNLK+YS ++L+++T NFK D VLG GGFGTV+KGWVDE TLAP++ G+GMIV
Sbjct  63    NGEILPIPNLKIYSFSDLKLSTKNFKSDSVLGIGGFGTVYKGWVDEKTLAPTKAGTGMIV  122

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL   S QGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLVYE+M  GSLENHL
Sbjct  123   AIKKLNSESTQGFEEWQSEVNFLGRLSHPNLVKLLGYCHEDKELLLVYEFMPKGSLENHL  182

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR++   + LSWDLRL IAIG ARGLAFLH SE++VI RD K+SNILLD NYNAKISDFG
Sbjct  183   FRRSAAIEPLSWDLRLKIAIGAARGLAFLHTSEKKVIYRDFKASNILLDGNYNAKISDFG  242

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPSG NSHVTTRV+GT GY APEY+ETG+LYVKSDVY FGV++LE+LTGLR+LD K
Sbjct  243   LAKLGPSGSNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVVLELLTGLRALDTK  302

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+ Q  LV WVKPMLS + KLKSIMD RMEGQYSS+A   AAQ+TL+CLE  P+ RPSM
Sbjct  303   RPNRQEKLVDWVKPMLSNKRKLKSIMDARMEGQYSSKAATLAAQITLKCLEVDPKNRPSM  362



>ref|XP_009601926.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009601927.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=409

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/311 (69%), Positives = 255/311 (82%), Gaps = 0/311 (0%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+  SEDS  NG ILPTPNLK YS ++L+ AT NFK D VLG GGFGTVFKGWVDE T 
Sbjct  49    FSATASEDSYFNGEILPTPNLKTYSFSDLKAATRNFKSDTVLGIGGFGTVFKGWVDEKTH  108

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P++ G+GM+VAIKKL   S+QGFEEW++EV  LG  SHPN++KL+GYCWE  +LLLVYE
Sbjct  109   TPTKVGTGMVVAIKKLNSESMQGFEEWQAEVNFLGRLSHPNLVKLMGYCWEDKELLLVYE  168

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLFR++   + L W+LRL IAIG ARGLAFLH SE+Q+I RD K+SNILLD
Sbjct  169   FMSKGSLENHLFRRSTAIEPLPWELRLKIAIGAARGLAFLHSSEKQIIYRDFKASNILLD  228

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              NY+AK+SDFGLAK+GPS  NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  229   GNYHAKLSDFGLAKVGPSDGNSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  288

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD K PSGQ+ LV WVKPML  + KL+SIMD RMEGQYSS+A L AAQL+L+C
Sbjct  289   LLTGLRALDTKRPSGQNNLVDWVKPMLCNKRKLRSIMDARMEGQYSSKAALVAAQLSLKC  348

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  349   LEGEPKNRPSM  359



>ref|XP_006467073.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
Length=419

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 266/342 (78%), Gaps = 7/342 (2%)
 Frame = +3

Query  384   SRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAEL  563
             ++ G   ++SA  S  G +          +  S A  E+++ NG IL TP+LKV+S  +L
Sbjct  32    NKYGHTMEISATSSSAGKSQFS-------QAISEAGVEEASPNGQILETPDLKVFSFLDL  84

Query  564   EVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWES  743
             + AT NFK D +LG GGFG V+KGWVD+ TLAPS+ G GM+VAIKKL   S+QGFEEW+S
Sbjct  85    KSATKNFKPDSLLGEGGFGRVYKGWVDDKTLAPSKTGLGMVVAIKKLNPESMQGFEEWQS  144

Query  744   EVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNI  923
             EV  LG  SHPN++KLLGYCWE  +LLLVYEYMQ GSLENHLFR+N   + LSWD+RL I
Sbjct  145   EVNFLGRLSHPNLVKLLGYCWEDKELLLVYEYMQRGSLENHLFRRNPSIQPLSWDIRLKI  204

Query  924   AIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVL  1103
             AIG ARGL FLH SE++VI RD K+SNILLD NYNAKISDFGLAKLGP+G  SHVTTRV+
Sbjct  205   AIGAARGLGFLHTSEKKVIYRDFKASNILLDGNYNAKISDFGLAKLGPAGGESHVTTRVM  264

Query  1104  GTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQ  1283
             GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+LD K P+GQ  LV W+KPMLSQ
Sbjct  265   GTYGYAAPEYVATGHLYVKSDVYGFGVVLLELLTGLRALDTKRPTGQQNLVEWLKPMLSQ  324

Query  1284  EGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             + KLK+IMD R+EGQYSS A LQAAQLTL CLES P++RPSM
Sbjct  325   KKKLKTIMDARIEGQYSSNAALQAAQLTLMCLESDPKRRPSM  366



>ref|XP_006425293.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
 gb|ESR38533.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
Length=419

 Score =   451 bits (1159),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/342 (65%), Positives = 265/342 (77%), Gaps = 7/342 (2%)
 Frame = +3

Query  384   SRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAEL  563
             ++ G   ++SA  S  G +          +  S A  E+++ NG IL TP+LKV+S  +L
Sbjct  32    NKYGHTMEISATSSSAGKSQFS-------QAISEAGVEEASPNGQILETPDLKVFSFLDL  84

Query  564   EVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWES  743
             + AT NFK D +LG GGFG V+KGWVD+ TLAPS+ G GM VAIKKL   S+QGFEEW+S
Sbjct  85    KSATKNFKPDSLLGEGGFGRVYKGWVDDKTLAPSKTGLGMAVAIKKLNPESMQGFEEWQS  144

Query  744   EVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNI  923
             EV  LG  SHPN++KLLGYCWE  +LLLVYEYMQ GSLENHLFR+N   + LSWD+RL I
Sbjct  145   EVNFLGRLSHPNLVKLLGYCWEDKELLLVYEYMQRGSLENHLFRRNPSIQPLSWDIRLKI  204

Query  924   AIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVL  1103
             AIG ARGL FLH SE++VI RD K+SNILLD NYNAKISDFGLAKLGP+G  SHVTTRV+
Sbjct  205   AIGAARGLGFLHTSEKKVIYRDFKASNILLDGNYNAKISDFGLAKLGPAGGESHVTTRVM  264

Query  1104  GTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQ  1283
             GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+LD K P+GQ  LV W+KPMLSQ
Sbjct  265   GTYGYAAPEYVATGHLYVKSDVYGFGVVLLELLTGLRALDTKRPTGQQNLVEWLKPMLSQ  324

Query  1284  EGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             + KLK+IMD R+EGQYSS A LQAAQLTL CLES P++RPSM
Sbjct  325   KKKLKTIMDARIEGQYSSNAALQAAQLTLMCLESDPKRRPSM  366



>ref|XP_006425292.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
 gb|ESR38532.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
Length=406

 Score =   449 bits (1155),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 218/310 (70%), Positives = 254/310 (82%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S A  E+++ NG IL TP+LKV+S  +L+ AT NFK D +LG GGFG V+KGWVD+ TLA
Sbjct  44    SEAGVEEASPNGQILETPDLKVFSFLDLKSATKNFKPDSLLGEGGFGRVYKGWVDDKTLA  103

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ G GM VAIKKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYEY
Sbjct  104   PSKTGLGMAVAIKKLNPESMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEY  163

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLFR+N   + LSWD+RL IAIG ARGL FLH SE++VI RD K+SNILLD 
Sbjct  164   MQRGSLENHLFRRNPSIQPLSWDIRLKIAIGAARGLGFLHTSEKKVIYRDFKASNILLDG  223

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NYNAKISDFGLAKLGP+G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+
Sbjct  224   NYNAKISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEL  283

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD K P+GQ  LV W+KPMLSQ+ KLK+IMD R+EGQYSS A LQAAQLTL CL
Sbjct  284   LTGLRALDTKRPTGQQNLVEWLKPMLSQKKKLKTIMDARIEGQYSSNAALQAAQLTLMCL  343

Query  1380  ESQPEKRPSM  1409
             ES P++RPSM
Sbjct  344   ESDPKRRPSM  353



>gb|KDP43763.1| hypothetical protein JCGZ_22390 [Jatropha curcas]
Length=412

 Score =   449 bits (1155),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/383 (60%), Positives = 274/383 (72%), Gaps = 31/383 (8%)
 Frame = +3

Query  294   MGNFVGSRTADSISGAL-----------PSNNKGSTAFSALSRIGSYRQLSAAESEGGNA  440
             MGN  GS + D+   ++            SNN  +  FSA S      Q SAA SE    
Sbjct  1     MGNCFGSSSHDANPSSIITSTTNPPTPGSSNNYTTMEFSATSSSAGKSQFSAAASE----  56

Query  441   NAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFG  620
                              +ED N+NG IL  PNLK ++ A+L+ AT NF+ D VLG GGFG
Sbjct  57    ----------------MNEDGNSNGQILVAPNLKEFTFADLKGATRNFRSDSVLGEGGFG  100

Query  621   TVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGY  800
              VFKGW+DE T APS+ G+G+ VAIKKL   S+QGF+EW+SEV  LG  SHPN++KLLGY
Sbjct  101   KVFKGWIDEKTYAPSKTGTGLPVAIKKLNSESMQGFQEWQSEVNFLGRLSHPNLVKLLGY  160

Query  801   CWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVI  980
             CWE  +LLLVYE+MQ GSLENHLFR+N   + LSWDLRL IAIG ARGLAFLH SE+QVI
Sbjct  161   CWEDKELLLVYEFMQKGSLENHLFRRNPNIEPLSWDLRLKIAIGAARGLAFLHTSEKQVI  220

Query  981   CRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVK  1160
              RD K+SNILLD NYNAKISDFGLAKLGPSG +SHVTTR++GT GY APEY+ TG+LYVK
Sbjct  221   YRDFKASNILLDGNYNAKISDFGLAKLGPSGGDSHVTTRIMGTYGYAAPEYIATGHLYVK  280

Query  1161  SDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSE  1340
             SDVY FGV+LLE+LTG R+LD + P+GQ  LV W+KP+L  + KLK+ MDVR+EGQYSS+
Sbjct  281   SDVYGFGVVLLELLTGSRALDTRRPNGQQNLVEWLKPILPYKKKLKAKMDVRIEGQYSSK  340

Query  1341  AELQAAQLTLRCLESQPEKRPSM  1409
             A LQAAQLTL CLE  P+ RPSM
Sbjct  341   AMLQAAQLTLNCLEPDPKSRPSM  363



>ref|XP_002521714.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF40701.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=420

 Score =   449 bits (1155),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 266/352 (76%), Gaps = 20/352 (6%)
 Frame = +3

Query  354   NKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTP  533
             N  +  FSA S      Q SAA SE                     ++D+N NG IL  P
Sbjct  37    NTTTMDFSATSSSAGKSQFSAAVSE--------------------MNDDANPNGQILEVP  76

Query  534   NLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRG  713
             N+K ++ A+L+ AT NF+ D +LG GGFG VFKGW+DE T APS+ G GM+VAIKKL   
Sbjct  77    NMKEFTFADLKSATKNFRADTLLGEGGFGKVFKGWIDEKTYAPSKTGIGMVVAIKKLNSE  136

Query  714   SLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRK  893
             S+QGF+EW+SEV  LG  SHPN++KL+GYCWE  +LLLVYE+MQ GSLENHLFRKN   +
Sbjct  137   SMQGFQEWQSEVNFLGRLSHPNLVKLIGYCWEDKELLLVYEFMQKGSLENHLFRKNPAVE  196

Query  894   ALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSG  1073
              LSW+LRL IAIG ARGLAFLH S+++VI RD K+SNILLD NYNAKISDFGLAKLGPSG
Sbjct  197   PLSWELRLKIAIGAARGLAFLHTSDKKVIYRDFKASNILLDGNYNAKISDFGLAKLGPSG  256

Query  1074  ENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWL  1253
              +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE++TGLR+LD K P+GQ  L
Sbjct  257   GDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIMTGLRALDTKRPNGQQNL  316

Query  1254  VGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             + W+KP+LSQ+ KLK+IMDVR+EGQYSS+A   AAQLTL+CLES P+ RPSM
Sbjct  317   IEWLKPILSQKRKLKNIMDVRIEGQYSSKAMQLAAQLTLKCLESDPKSRPSM  368



>emb|CDP01798.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   444 bits (1143),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 234/372 (63%), Positives = 283/372 (76%), Gaps = 10/372 (3%)
 Frame = +3

Query  294   MGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLE  473
             MGN  GS++  +    + S+N      +  S +G+    S   S GG  +A    +    
Sbjct  1     MGNCFGSKSVSTSPSTINSSN-----LTKPSSVGT----SNYYSNGGGLSATS-SSAGQS  50

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
              +S+A SE+  + G ILPTPNLK+YS A+L+ AT NF+ D VLG GGFGTVFKGWVDE T
Sbjct  51    RFSAAISEEPLSPGEILPTPNLKMYSFADLKSATRNFRSDTVLGVGGFGTVFKGWVDEKT  110

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
             LAP++ GSGMIVAIKKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVY
Sbjct  111   LAPAKFGSGMIVAIKKLNPESMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVY  170

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLFR++   + LSWD RL IAIG ARGLAFLH SE+QVI RD K+SNILL
Sbjct  171   EFMQRGSLENHLFRRSSAVEPLSWDTRLKIAIGAARGLAFLHSSEKQVIYRDFKASNILL  230

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D NYNAK++DFGLAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  231   DGNYNAKLADFGLAKLGPSGGMSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLL  290

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EMLTGLR+LD + P GQ  LV + KP++S + KLK+IMD R+EGQYSS+A LQAAQL LR
Sbjct  291   EMLTGLRALDTRRPGGQQNLVDYAKPLISHKRKLKTIMDARIEGQYSSKAALQAAQLALR  350

Query  1374  CLESQPEKRPSM  1409
             CLE++P+KRPSM
Sbjct  351   CLEAEPKKRPSM  362



>ref|XP_002280326.3| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Vitis vinifera]
Length=426

 Score =   441 bits (1135),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 254/334 (76%), Gaps = 7/334 (2%)
 Frame = +3

Query  408   LSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFK  587
             LS   S  GN      P       +S   +++   G ILPTPNLK++S A+L+ AT NFK
Sbjct  46    LSITSSSAGNGRLSAAP-------ASESHDEAFPEGQILPTPNLKIFSFADLKTATRNFK  98

Query  588   RDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMF  767
              D VLG GGFGTVFKG VDE TLAP + G+GM+VAIKKL   SLQGF+EW+SEV  LG  
Sbjct  99    SDNVLGIGGFGTVFKGSVDEKTLAPCKAGTGMVVAIKKLNPESLQGFQEWQSEVNFLGRL  158

Query  768   SHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGL  947
             SHPN++KLLGYCW+  +LLLVYE+MQ GSLENHLFR+N   + LSW LRL IAIG ARGL
Sbjct  159   SHPNLVKLLGYCWDDKELLLVYEFMQKGSLENHLFRRNPSIEPLSWQLRLKIAIGAARGL  218

Query  948   AFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAP  1127
             AFLH S++QVI RD K+SNILLD  YNAKISDFGLAKLGPSG  SHVTTRV+GT GY AP
Sbjct  219   AFLHTSDKQVIYRDFKASNILLDGEYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAP  278

Query  1128  EYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIM  1307
             EY+ TG+LYVKSDVY F V+LLEMLTGLR+LD K P+GQ  LV W +P LS + KLK+IM
Sbjct  279   EYIATGHLYVKSDVYGFRVVLLEMLTGLRALDTKRPNGQQSLVDWTRPSLSSKRKLKNIM  338

Query  1308  DVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             D R+EGQYS +A  +AAQLTL+CL S P+ RPSM
Sbjct  339   DARVEGQYSPKAAFEAAQLTLKCLGSDPKSRPSM  372



>ref|XP_011013448.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=435

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 255/318 (80%), Gaps = 7/318 (2%)
 Frame = +3

Query  477   YSSAESED------SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGW  638
             +S A S D      +N NG IL +PNLK ++ ++L+  T NFK D +LG GGFG V+KGW
Sbjct  53    FSEAVSHDEGNEATNNQNGQILESPNLKEFTFSDLKSTTKNFKSDTLLGEGGFGKVYKGW  112

Query  639   VDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
             +DE T APS+ GSGM+VAIKKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCWE  +
Sbjct  113   IDERTYAPSKSGSGMVVAIKKLNPESMQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDKE  172

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+MQ GSLENHLFRKN   + LSWD+RL IAIG ARGL FLH S+++VI RD K+
Sbjct  173   LLLVYEFMQKGSLENHLFRKNPNIEPLSWDIRLKIAIGAARGLTFLHTSDKKVIYRDFKA  232

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD NYNAKISDFGLAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY F
Sbjct  233   SNILLDGNYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGF  292

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLK-SIMDVRMEGQYSSEAELQA  1355
             GV+LLEML+G R+LD K P+GQ  L+ W+KP+LSQ+ KLK ++MD R+EGQYSS+A LQA
Sbjct  293   GVVLLEMLSGQRALDTKRPAGQQNLIEWLKPLLSQKKKLKNTVMDARIEGQYSSKAMLQA  352

Query  1356  AQLTLRCLESQPEKRPSM  1409
             AQLTL+CLE+ P+ RPSM
Sbjct  353   AQLTLKCLEADPKNRPSM  370



>ref|XP_006376784.1| hypothetical protein POPTR_0012s06370g [Populus trichocarpa]
 gb|ERP54581.1| hypothetical protein POPTR_0012s06370g [Populus trichocarpa]
Length=431

 Score =   440 bits (1131),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 255/318 (80%), Gaps = 7/318 (2%)
 Frame = +3

Query  477   YSSAESED------SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGW  638
             +S A S D      +N NG IL +PNLK ++ A+L+  T NFK D +LG GGFG V+KGW
Sbjct  53    FSEAVSHDEGNEATNNPNGQILESPNLKEFTFADLKSTTKNFKSDTLLGEGGFGKVYKGW  112

Query  639   VDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
             +DE T APS+ GSGM+VAIKKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCWE  +
Sbjct  113   IDERTYAPSKSGSGMVVAIKKLNPESVQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDKE  172

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+MQ GSLENHLFRKN   + LSWD+RL IA+G ARGL FLH S+++VI RD K+
Sbjct  173   LLLVYEFMQKGSLENHLFRKNPNIEPLSWDIRLKIAVGAARGLTFLHTSDKKVIYRDFKA  232

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD NYNAKISDFGLAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY F
Sbjct  233   SNILLDGNYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGF  292

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLK-SIMDVRMEGQYSSEAELQA  1355
             GV+LLEML+G R+LD K P+GQ  L+ W+KP+LSQ+ KLK +IMD R+EGQYSS+A +QA
Sbjct  293   GVVLLEMLSGRRALDTKRPTGQQNLIEWLKPLLSQKKKLKTTIMDARIEGQYSSKAMVQA  352

Query  1356  AQLTLRCLESQPEKRPSM  1409
             AQLTL+CLE+ P+ RPSM
Sbjct  353   AQLTLKCLEADPKNRPSM  370



>gb|EYU43737.1| hypothetical protein MIMGU_mgv1a007465mg [Erythranthe guttata]
Length=406

 Score =   438 bits (1126),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 226/377 (60%), Positives = 274/377 (73%), Gaps = 22/377 (6%)
 Frame = +3

Query  294   MGNFVGSRTADSISGALPSNNKGSTAFSALSR---IGSYRQLSAAESEGGNANAKCLPTP  464
             MGN  GS          P  N  ST  S L+R    G+ R  S  +   G +        
Sbjct  1     MGNCFGSELP------APDPNPSSTNPSNLTRPSTAGTSRSYSNGDGVSGASQ-------  47

Query  465   NLEIYSSAESEDS--NANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGW  638
                 +S+A S+D+     G IL   NLK+YS ++L  AT  FK + VLG GGFGTV+KGW
Sbjct  48    ----FSAALSDDTCQGVGGDILAISNLKIYSYSDLRSATGGFKSNTVLGVGGFGTVYKGW  103

Query  639   VDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
             VDE TLAP +PG+G++VAIKKL   S+QGF EW+SEV  LG  SHPN++KLLGYCWE  +
Sbjct  104   VDEKTLAPCKPGTGILVAIKKLNHESIQGFAEWQSEVNFLGRLSHPNLVKLLGYCWEDKE  163

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+MQ GSLENHLFR+    + LSWDLRL I+IG ARGLAFLH SE+Q+I RD K+
Sbjct  164   LLLVYEFMQKGSLENHLFRRIGAVEPLSWDLRLKISIGAARGLAFLHTSEKQIIYRDFKA  223

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD +YNAKISDFGLAKLGPSG +SHVTTRV+GT GY APEY+ TG+LYVKSDVY F
Sbjct  224   SNILLDGSYNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGF  283

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAA  1358
             GV+LLEMLTGLR+LD   PS +H LV WVKP LSQ+ +LK+IMD R++GQYS++A L AA
Sbjct  284   GVVLLEMLTGLRALDTTRPSNRHNLVEWVKPFLSQKRRLKTIMDARIQGQYSTKASLAAA  343

Query  1359  QLTLRCLESQPEKRPSM  1409
             QL+LRCLE++ +KRPSM
Sbjct  344   QLSLRCLENEQKKRPSM  360



>ref|XP_008241951.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Prunus mume]
Length=414

 Score =   436 bits (1121),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 214/355 (60%), Positives = 261/355 (74%), Gaps = 7/355 (2%)
 Frame = +3

Query  345   PSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTIL  524
             P+ N  ST  ++ +   S    S   S  G +      +P +E       E    NG IL
Sbjct  16    PNTNISSTTGTSGNHSSSRNIFSNTSSSAGRSQFSEASSPRME-------EPQQTNGQIL  68

Query  525   PTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
              +PNL+V++ AE+  AT NFK D VLG GGFG VFKGWVDE TLAPS+ G GM+VAIKKL
Sbjct  69    DSPNLRVFTFAEMRAATRNFKSDSVLGEGGFGRVFKGWVDEKTLAPSKVGIGMMVAIKKL  128

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                S+QGF+EW+SEV  LG  SHPN++KLLGYCW+  +LLLVYE+MQ GSLENHLFR++ 
Sbjct  129   NPESVQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDEKELLLVYEFMQKGSLENHLFRRSA  188

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
             G + LSWD RL IAIG ARGLAFLH SE+Q+I RD K+SNILLD N+NAKISDFGLAKLG
Sbjct  189   GIEPLSWDRRLKIAIGAARGLAFLHGSEKQIIYRDFKASNILLDGNFNAKISDFGLAKLG  248

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             P+G  SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+LD K P  Q
Sbjct  249   PAGGESHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGLRALDTKRPKEQ  308

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
               LV W KP+L  + KLK+I+DVRMEGQY+ +A LQAAQ+T +CL   P+ RPSM
Sbjct  309   QQLVEWAKPLLLHKRKLKNILDVRMEGQYAFKAALQAAQITQKCLAPDPKSRPSM  363



>ref|XP_007202257.1| hypothetical protein PRUPE_ppa007710mg [Prunus persica]
 gb|EMJ03456.1| hypothetical protein PRUPE_ppa007710mg [Prunus persica]
Length=358

 Score =   430 bits (1106),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 244/305 (80%), Gaps = 0/305 (0%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E    NG IL +PNL+ ++ AE++ AT NFK D VLG GGFG VFKGWVDE TLAPS+ G
Sbjct  3     EPQQTNGQILDSPNLRFFTFAEMKAATRNFKSDAVLGEGGFGRVFKGWVDEKTLAPSKVG  62

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
              GM+VAIKKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCW+  +LLLVYE+MQ GS
Sbjct  63    IGMMVAIKKLNPESVQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDDKELLLVYEFMQKGS  122

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFR++ G + LSWD RL IAIG ARGLAFLH SE+Q+I RD K+SNILLD N+NAK
Sbjct  123   LENHLFRRSAGIEPLSWDRRLKIAIGAARGLAFLHGSEKQIIYRDFKASNILLDGNFNAK  182

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGP+G  SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR
Sbjct  183   ISDFGLAKLGPAGGESHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGLR  242

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD K P  Q  LV W KP+L  + KLK+I+DVRMEGQY+ +A LQAAQ+T +CL   P+
Sbjct  243   ALDMKRPKEQQQLVEWAKPLLLHKRKLKNILDVRMEGQYAFKAALQAAQITQKCLAPDPK  302

Query  1395  KRPSM  1409
              RPSM
Sbjct  303   SRPSM  307



>ref|XP_006598681.1| PREDICTED: protein kinase isoform X1 [Glycine max]
Length=406

 Score =   428 bits (1101),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/354 (59%), Positives = 261/354 (74%), Gaps = 11/354 (3%)
 Frame = +3

Query  348   SNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILP  527
             S +  +  FSA +      Q S   S   N++   LP P             + +G IL 
Sbjct  28    STDTKNVGFSATTSSAGKSQFSEIASGSINSSQGSLPLPL-----------PSPDGQILE  76

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
              PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW+DE TL+P++ GSGM+VAIKKL 
Sbjct  77    RPNLKVFSFGDLKSATKSFKSDTLLGEGGFGRVYKGWLDEKTLSPAKAGSGMVVAIKKLN  136

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QGF+EW+SEV  LG  SHPN++KLLGYCW+ ++LLLVYE++  GSLENHLFR+N  
Sbjct  137   PESTQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDDDELLLVYEFLPKGSLENHLFRRNPN  196

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              + LSW+ RL IAIG ARGLAFLH SE+QVI RD K+SNILLD N+NAKISDFGLAKLGP
Sbjct  197   IEPLSWNTRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDLNFNAKISDFGLAKLGP  256

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
             SG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG+R+LD K P+GQ 
Sbjct  257   SGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRALDTKRPTGQQ  316

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+LS + KLK+IMD ++ GQYS +A  QAAQLT++CLE  P++RPSM
Sbjct  317   NLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLEHDPKQRPSM  370



>ref|XP_003533415.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Glycine max]
Length=397

 Score =   427 bits (1099),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/354 (59%), Positives = 260/354 (73%), Gaps = 13/354 (4%)
 Frame = +3

Query  348   SNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILP  527
             S +  +  FSA +      Q S   S   +++   LP P+              +G IL 
Sbjct  21    STDSKNVGFSATTSSAGKSQFSEIASGSIDSSQGSLPLPS-------------PHGQILE  67

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
              PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW+DE TL+P++ GSGM+VAIKKL 
Sbjct  68    RPNLKVFSFGDLKSATKSFKSDTLLGEGGFGRVYKGWLDEKTLSPAKAGSGMVVAIKKLN  127

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QGF+EW+SEV  LG  SHPN++KLLGYCW+ ++LLLVYE++  GSLENHLFR+N  
Sbjct  128   PQSTQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDDDELLLVYEFLPKGSLENHLFRRNPN  187

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              + LSW+ R  IAIG ARGLAFLH SE+Q+I RD K+SNILLD N+NAKISDFGLAKLGP
Sbjct  188   IEPLSWNTRFKIAIGAARGLAFLHASEKQIIYRDFKASNILLDVNFNAKISDFGLAKLGP  247

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
             SG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG+R+LD K P+GQ 
Sbjct  248   SGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRALDTKRPTGQQ  307

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+LS + KLK+IMD ++ GQYS +A  QAAQLTL+CLE  P++RPSM
Sbjct  308   NLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTLKCLEHDPKQRPSM  361



>ref|XP_010029583.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Eucalyptus grandis]
 gb|KCW56505.1| hypothetical protein EUGRSUZ_I02227 [Eucalyptus grandis]
Length=385

 Score =   427 bits (1098),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 249/310 (80%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +SA  + ++ NG IL TPNLKV+S ++L+ +T NFK D +LG GGFG V+KGWVDE TLA
Sbjct  45    ASASPDGADLNGEILETPNLKVFSFSDLKSSTKNFKSDNLLGEGGFGKVYKGWVDEKTLA  104

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ GSGM+VAIKKL   S+QGF++W+SEV  LG  SHPN++KLLGYCWE  +LLLVYEY
Sbjct  105   PSKMGSGMVVAIKKLNPESVQGFDQWQSEVNFLGRLSHPNLVKLLGYCWEEKELLLVYEY  164

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             +  GSLENHLFR+N   + LSWD RL IAIG ARGL+FLH SE+++I RD K+SNILLD 
Sbjct  165   IPKGSLENHLFRRNPAVEPLSWDSRLKIAIGAARGLSFLHSSEKKIIYRDFKASNILLDW  224

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             + NAKI+DFGLAKLGPS   SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+
Sbjct  225   HDNAKIADFGLAKLGPSSGESHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEL  284

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD K PSGQ  LV W KP+LSQ GKLK+I+D RME QYS +A LQ AQLTL+CL
Sbjct  285   LTGLRALDTKRPSGQQNLVDWTKPILSQRGKLKNIIDHRMEDQYSFKAVLQTAQLTLKCL  344

Query  1380  ESQPEKRPSM  1409
              ++P  RP M
Sbjct  345   AAEPRHRPCM  354



>ref|XP_002307210.1| hypothetical protein POPTR_0005s10390g [Populus trichocarpa]
 gb|EEE94206.1| hypothetical protein POPTR_0005s10390g [Populus trichocarpa]
Length=437

 Score =   429 bits (1103),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 252/318 (79%), Gaps = 7/318 (2%)
 Frame = +3

Query  477   YSSAESED------SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGW  638
             +S A S D      SNANG IL + NL+ ++ ++L+ AT NFK D +LG GGFG V+KGW
Sbjct  52    FSEAASHDEGNEVISNANGQILESSNLEEFTFSDLKRATKNFKSDTLLGEGGFGKVYKGW  111

Query  639   VDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
             +D+ T APS+ GSGM+VAIKKL  GS+QG EEW+SEV  LG  SHPN++KLLG+CWE  +
Sbjct  112   IDQKTYAPSKSGSGMVVAIKKLNSGSMQGLEEWQSEVNFLGRLSHPNLVKLLGFCWEDKE  171

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+M  GSLENHLFR     + LSWD+RL IAIG ARGLAFLH SE+QVI RD K+
Sbjct  172   LLLVYEFMPKGSLENHLFRSKRNIEPLSWDIRLKIAIGAARGLAFLHASEKQVIYRDFKA  231

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD  YNAKISDFGLAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY F
Sbjct  232   SNILLDGKYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGF  291

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLK-SIMDVRMEGQYSSEAELQA  1355
             GV+LLEML+G R+LD K P+GQ  LV W+KP+LS + KLK +IMD R+EGQYS++A +QA
Sbjct  292   GVVLLEMLSGQRALDRKRPTGQQNLVEWLKPLLSHKKKLKTTIMDSRIEGQYSAKAMVQA  351

Query  1356  AQLTLRCLESQPEKRPSM  1409
             AQLTL+CL++ P+ RPSM
Sbjct  352   AQLTLKCLKADPKNRPSM  369



>gb|KHN38873.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=454

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/346 (60%), Positives = 257/346 (74%), Gaps = 13/346 (4%)
 Frame = +3

Query  372   FSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYS  551
             FSA +      Q S   S   N++   LP P+              +G IL  PNLKV+S
Sbjct  86    FSATTSSAGKSQFSEIASGSINSSQGSLPLPS-------------PHGQILERPNLKVFS  132

Query  552   LAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFE  731
               +L+ AT +FK D +LG GGFG V+KGW+DE TL+P++ GSGM+VAIKKL   S QGF+
Sbjct  133   FGDLKSATKSFKSDTLLGEGGFGRVYKGWLDEKTLSPAKAGSGMVVAIKKLNPQSTQGFQ  192

Query  732   EWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDL  911
             EW+SEV  LG  SHPN++KLLGYCW+ ++LLLVYE++  GSLENHLFR+N   + LSW+ 
Sbjct  193   EWQSEVNFLGRLSHPNLVKLLGYCWDDDELLLVYEFLPKGSLENHLFRRNPNIEPLSWNT  252

Query  912   RLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVT  1091
             R  IAIG ARGLAFLH SE+Q+I RD K+SNILLD N+NAKISDFGLAKLGPSG  SHVT
Sbjct  253   RFKIAIGAARGLAFLHASEKQIIYRDFKASNILLDVNFNAKISDFGLAKLGPSGGQSHVT  312

Query  1092  TRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKP  1271
             TRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG+R+LD K P+GQ  LV W KP
Sbjct  313   TRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRALDTKRPTGQQNLVEWTKP  372

Query  1272  MLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +LS + KLK+IMD ++ GQYS +A  QAAQLTL+CLE  P++RPSM
Sbjct  373   LLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTLKCLEHDPKQRPSM  418



>ref|XP_004509435.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=382

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 256/334 (77%), Gaps = 0/334 (0%)
 Frame = +3

Query  408   LSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFK  587
              SA  S  G +    + + ++E  +       + NG IL  PNLKV+S  +L+ AT NF+
Sbjct  9     FSATTSSAGRSQFSEITSGSIEDTTEGSLSFHSPNGEILERPNLKVFSFVDLKSATRNFR  68

Query  588   RDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMF  767
              D +LG GGFG V+KGW+DE  L P++PGSG++VAIKKL   S QGF+EW+SEV  LG  
Sbjct  69    PDTLLGEGGFGRVYKGWLDEKNLTPAKPGSGIMVAIKKLNSESTQGFQEWQSEVNFLGRL  128

Query  768   SHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGL  947
             SHPN++KLLGYCW+  +LLLVYE+M  GSLENHLFR+N   + LSW+ R+ IAIG ARGL
Sbjct  129   SHPNLVKLLGYCWDDEELLLVYEFMAKGSLENHLFRRNPNIEPLSWNTRIKIAIGAARGL  188

Query  948   AFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAP  1127
             AFLH SE+QVI RD K+SNILLD ++NAKISDFGLAKLGPSGE SHVTTRV+GT GY AP
Sbjct  189   AFLHDSEKQVIYRDFKASNILLDGSFNAKISDFGLAKLGPSGEQSHVTTRVMGTYGYAAP  248

Query  1128  EYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIM  1307
             EY+ TG+LYVKSDVY FGV+LLEML+G+R+LD   P GQ  LV W KP+LS + KLK+IM
Sbjct  249   EYIATGHLYVKSDVYGFGVVLLEMLSGMRALDRTRPPGQQNLVEWGKPLLSNKKKLKNIM  308

Query  1308  DVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             D ++EGQYS +A +QAAQL+L+CLE+ P++RPSM
Sbjct  309   DGKIEGQYSQKAAIQAAQLSLKCLENDPKQRPSM  342



>ref|XP_010247082.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nelumbo 
nucifera]
Length=422

 Score =   426 bits (1096),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 249/312 (80%), Gaps = 1/312 (0%)
 Frame = +3

Query  477   YSSAESEDSN-ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             YS+++S D    NG ILP+PNLKV++ AEL+ AT NF+ D VLG GGFG VFKGW+DE T
Sbjct  46    YSTSKSLDEKFPNGHILPSPNLKVFTFAELKAATRNFRSDTVLGEGGFGRVFKGWIDEKT  105

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
              APS+ G+GM+VA+KKL   SLQG+EEW+SEV  LG  SHPN++KLLGYC+E N+LLLVY
Sbjct  106   FAPSKIGNGMVVAVKKLNSESLQGYEEWQSEVTFLGRLSHPNLVKLLGYCYEDNELLLVY  165

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ G+LENHLFR+    + L W+LRL IA G A+GLAFLH SE+QVI RD K+SNIL+
Sbjct  166   EFMQKGNLENHLFRRGSAVQPLPWNLRLKIATGAAKGLAFLHTSEKQVIYRDFKASNILM  225

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D N+NAKISDFGLAK GP+  NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  226   DANFNAKISDFGLAKNGPAAGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLL  285

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EMLTGLR+LD   PSGQH LV W+KP L  + KLK+++D R+EGQ+  +  +Q AQLTL 
Sbjct  286   EMLTGLRALDTNRPSGQHNLVEWLKPSLHDKRKLKTMIDSRLEGQFPMKGAVQLAQLTLS  345

Query  1374  CLESQPEKRPSM  1409
             CL S+P+ RPSM
Sbjct  346   CLGSEPKSRPSM  357



>ref|XP_007046513.1| Kinase superfamily protein, 32 [Theobroma cacao]
 gb|EOX90670.1| Kinase superfamily protein, 32 [Theobroma cacao]
Length=478

 Score =   427 bits (1099),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 248/305 (81%), Gaps = 1/305 (0%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E+ + +G IL TPNLKV++ AEL+ AT NFK D +LG GGFG V+KGWVDE TL PS+ G
Sbjct  121   EEESPDGRILETPNLKVFTFAELKTATKNFKGDTLLGEGGFGRVYKGWVDEKTLTPSKVG  180

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             SGMIVAIKKL   S+QGFEEW+SEV  LG   HPN++KLLGYCWE  +LLLVYE++Q GS
Sbjct  181   SGMIVAIKKLNHESMQGFEEWQSEVNFLGRLYHPNLVKLLGYCWEDKELLLVYEFLQKGS  240

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFR+N   + LSW+LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD NYNAK
Sbjct  241   LENHLFRRNPAIEPLSWELRLKIAIGAARGLAFLHTSEK-VIYRDFKASNILLDGNYNAK  299

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGP+G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE++TGLR
Sbjct  300   ISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELMTGLR  359

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD K  SGQ  LV W++P LS + K+K+IMDVR+EGQYSS+A + +A LTL+CLE  P+
Sbjct  360   ALDTKRLSGQQNLVDWLRPTLSLKKKVKTIMDVRIEGQYSSKAAILSADLTLKCLEHDPK  419

Query  1395  KRPSM  1409
              RPSM
Sbjct  420   NRPSM  424



>gb|KHN07820.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=407

 Score =   425 bits (1092),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 244/300 (81%), Gaps = 0/300 (0%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G IL  PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW+DE TL+P++ GSGM+V
Sbjct  72    DGQILERPNLKVFSFGDLKSATKSFKSDTLLGEGGFGRVYKGWLDEKTLSPAKAGSGMVV  131

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL   S QGF+EW+SEV  LG  SHPN++KLLGYCW+ ++LLLVYE++  GSLENHL
Sbjct  132   AIKKLNPESTQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDDDELLLVYEFLPKGSLENHL  191

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N   + LSW+ RL IAIG ARGLAFLH SE+QVI RD K+SNILLD N+NAKISDFG
Sbjct  192   FRRNPNIEPLSWNTRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDLNFNAKISDFG  251

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG+R+LD K
Sbjct  252   LAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRALDTK  311

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+GQ  LV W KP+LS + KLK+IMD ++ GQYS +A  QAAQLT++CLE  P++RPSM
Sbjct  312   RPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLEHDPKQRPSM  371



>ref|XP_004509434.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=407

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 256/334 (77%), Gaps = 0/334 (0%)
 Frame = +3

Query  408   LSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFK  587
              SA  S  G +    + + ++E  +       + NG IL  PNLKV+S  +L+ AT NF+
Sbjct  34    FSATTSSAGRSQFSEITSGSIEDTTEGSLSFHSPNGEILERPNLKVFSFVDLKSATRNFR  93

Query  588   RDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMF  767
              D +LG GGFG V+KGW+DE  L P++PGSG++VAIKKL   S QGF+EW+SEV  LG  
Sbjct  94    PDTLLGEGGFGRVYKGWLDEKNLTPAKPGSGIMVAIKKLNSESTQGFQEWQSEVNFLGRL  153

Query  768   SHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGL  947
             SHPN++KLLGYCW+  +LLLVYE+M  GSLENHLFR+N   + LSW+ R+ IAIG ARGL
Sbjct  154   SHPNLVKLLGYCWDDEELLLVYEFMAKGSLENHLFRRNPNIEPLSWNTRIKIAIGAARGL  213

Query  948   AFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAP  1127
             AFLH SE+QVI RD K+SNILLD ++NAKISDFGLAKLGPSGE SHVTTRV+GT GY AP
Sbjct  214   AFLHDSEKQVIYRDFKASNILLDGSFNAKISDFGLAKLGPSGEQSHVTTRVMGTYGYAAP  273

Query  1128  EYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIM  1307
             EY+ TG+LYVKSDVY FGV+LLEML+G+R+LD   P GQ  LV W KP+LS + KLK+IM
Sbjct  274   EYIATGHLYVKSDVYGFGVVLLEMLSGMRALDRTRPPGQQNLVEWGKPLLSNKKKLKNIM  333

Query  1308  DVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             D ++EGQYS +A +QAAQL+L+CLE+ P++RPSM
Sbjct  334   DGKIEGQYSQKAAIQAAQLSLKCLENDPKQRPSM  367



>ref|XP_009344675.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Pyrus x bretschneideri]
Length=411

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 243/307 (79%), Gaps = 0/307 (0%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E +    NG IL +PNL+V++ AE++ AT NFK D VLG GGFG VFKGWVDE TL PS+
Sbjct  54    ELQSQQPNGQILESPNLRVFTFAEMKAATRNFKSDAVLGEGGFGIVFKGWVDEKTLQPSK  113

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
              G+GM+VAIKKL   + QGF+EW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ 
Sbjct  114   AGTGMMVAIKKLNPENGQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMQK  173

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR++ G + LSWD RL IAIG ARGLAFLH SE+++I RD K+SNILLD ++N
Sbjct  174   GSLENHLFRRSAGIEPLSWDRRLKIAIGAARGLAFLHSSEKKIIYRDFKASNILLDGSFN  233

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AKISDFGLAKLGP G  SHV+TRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG
Sbjct  234   AKISDFGLAKLGPVGGESHVSTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTG  293

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
             LR+LD K P  Q  LV W KP+L  + KLK+I+DVRMEGQY+ +A +Q AQ+T +CL   
Sbjct  294   LRALDLKRPKEQQQLVEWAKPLLLNKRKLKTILDVRMEGQYAFKAAMQTAQITEKCLAPD  353

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  354   PKSRPSM  360



>ref|XP_006422428.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 gb|ESR35668.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
Length=400

 Score =   422 bits (1085),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 245/311 (79%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  ++S  NG ILPTPNL++++  EL  AT NFK D VLG GGFG VFKGW+DE   
Sbjct  32    FSASSGDESYPNGQILPTPNLRIFTFVELRAATRNFKSDTVLGEGGFGKVFKGWLDEK--  89

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP + GSG ++A+KKL   SLQGFEEW+SEV  LG  SHPN+++LLGYCWE  +LLLVYE
Sbjct  90    APGKSGSGTVIAVKKLNSESLQGFEEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYE  149

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L+W++RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  150   FMQKGSLENHLFGRGASVQPLAWNIRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  209

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  210   GSYTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  269

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH LV W+KP LS++ K + I+D R++GQY  +A  Q AQL+L+C
Sbjct  270   ILTGLRALDTNRPSGQHNLVDWIKPYLSEKRKFRHIIDARLQGQYPYKAAYQIAQLSLKC  329

Query  1377  LESQPEKRPSM  1409
             LE++P+ RPSM
Sbjct  330   LEAEPKHRPSM  340



>ref|XP_010266182.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nelumbo 
nucifera]
Length=425

 Score =   421 bits (1083),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 247/312 (79%), Gaps = 1/312 (0%)
 Frame = +3

Query  477   YSSAES-EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             YS+++  +++  +G ILPTP+LKV++ AEL+ AT NFK D VLG GGFG VFKGW+DE+T
Sbjct  43    YSTSKCLDEAYPDGQILPTPHLKVFTFAELKAATKNFKPDTVLGQGGFGRVFKGWIDEST  102

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
                S+ G+GM+VA+KKL   S+QG+EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVY
Sbjct  103   FLASKTGNGMVVAVKKLDSESMQGYEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVY  162

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLF +    + LSW+LRL I IG A+GLAFLH SE+Q+I RD K+SNILL
Sbjct  163   EFMQRGSLENHLFGRGAAIEPLSWNLRLKIVIGAAKGLAFLHTSEKQIIYRDFKASNILL  222

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D NYNAKISDFGLAK GPS  +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  223   DANYNAKISDFGLAKNGPSAGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLL  282

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EMLTG R+LD   PSGQ  LV W+KP L    K+K+IMD R+EGQYS +A  QAAQLTL+
Sbjct  283   EMLTGQRALDTSRPSGQTNLVDWLKPSLPDRRKVKNIMDPRLEGQYSMKAVQQAAQLTLK  342

Query  1374  CLESQPEKRPSM  1409
             CL S P+ RPSM
Sbjct  343   CLGSDPKSRPSM  354



>ref|XP_006379372.1| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
 gb|ERP57169.1| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
Length=410

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 252/338 (75%), Gaps = 5/338 (1%)
 Frame = +3

Query  405   QLSAAESEGGNANAKCLPTPNLEIYS--SAESEDSN-ANGTILPTPNLKVYSLAELEVAT  575
             Q ++  +  G +NA      N+  +S  SA S D    NG ILPTPNL+++S AEL+VAT
Sbjct  15    QTTSDTASSGVSNATSSRGSNISAHSRFSAGSGDEEFPNGQILPTPNLRIFSFAELKVAT  74

Query  576   SNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKL  755
              NFK D +LG GGFG V+KGW+DE   AP   GSG I+A+K+L   SLQGFEEW+SEV  
Sbjct  75    RNFKSDTLLGEGGFGQVYKGWLDEK--APGRIGSGTIIAVKRLNSESLQGFEEWQSEVNF  132

Query  756   LGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGV  935
             LG  SHP++++L+GYCWE  +LLLVYE+MQ GSLENHLF +    + L WD RL IAIG 
Sbjct  133   LGRLSHPHLVRLIGYCWEVKELLLVYEFMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGA  192

Query  936   ARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEG  1115
             ARGLAFLH S++QVI RD K+SNILLD  Y AK+SDFGLAKLGPS   SHVTTRV+GT G
Sbjct  193   ARGLAFLHTSDKQVIYRDFKASNILLDGAYTAKLSDFGLAKLGPSASQSHVTTRVMGTYG  252

Query  1116  YIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKL  1295
             Y APEY+ TG+LYVKSDVY FGV+L+E+LTGLR+LD   PSG+H LV W+KP LS + KL
Sbjct  253   YAAPEYVATGHLYVKSDVYGFGVVLVEILTGLRALDINRPSGRHSLVDWIKPYLSDKRKL  312

Query  1296  KSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             KSIMD  +EG+Y S+A LQ AQL L CLES+P+ RP M
Sbjct  313   KSIMDSHLEGRYPSKAALQIAQLALNCLESEPKHRPHM  350



>gb|AET03604.2| Serine/Threonine-kinase Cx32, related protein [Medicago truncatula]
Length=394

 Score =   420 bits (1080),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 253/334 (76%), Gaps = 0/334 (0%)
 Frame = +3

Query  408   LSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFK  587
              SA  S  G +    + + +++  +       + NG IL  PNLKV+S  EL+ AT +FK
Sbjct  20    FSATTSSAGRSQFSEVASGSIDDTTDGSLPFPSPNGQILERPNLKVFSFIELKAATKSFK  79

Query  588   RDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMF  767
              D +LG GGFG V+KGW+DE TL+P++ GSGM+VAIKKL   S QGF+EW+SEV  LG  
Sbjct  80    SDTLLGEGGFGKVYKGWLDEKTLSPTKAGSGMVVAIKKLNSESTQGFQEWQSEVNFLGRL  139

Query  768   SHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGL  947
             SHPN++KLLGYCW+ ++LLLVYE+M  GSLENHLFR+N   + LSW+ R+ IAIG ARGL
Sbjct  140   SHPNLVKLLGYCWDDDELLLVYEFMPKGSLENHLFRRNPNIEPLSWNTRIKIAIGAARGL  199

Query  948   AFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAP  1127
             AFLH S  QVI RD K+SNILLD +Y AKISDFGLAKLGPSG  SHVTTRV+GT GY AP
Sbjct  200   AFLHDSADQVIYRDFKASNILLDGSYIAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAP  259

Query  1128  EYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIM  1307
             EY+ TG+LYVKSDVY FGV+LLE+LT +R+LD K P+GQ  LV WVKP LS + KLK IM
Sbjct  260   EYIATGHLYVKSDVYGFGVVLLEILTAMRALDTKRPTGQQNLVEWVKPFLSNKKKLKGIM  319

Query  1308  DVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             D R+EGQYS +A +QAA L+L+CLE+ P++RPSM
Sbjct  320   DGRIEGQYSPKAAVQAAALSLKCLENDPKQRPSM  353



>ref|XP_006422427.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 ref|XP_006486596.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35667.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 gb|KDO68338.1| hypothetical protein CISIN_1g015094mg [Citrus sinensis]
Length=413

 Score =   421 bits (1081),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 245/311 (79%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  ++S  NG ILPTPNL++++  EL  AT NFK D VLG GGFG VFKGW+DE   
Sbjct  45    FSASSGDESYPNGQILPTPNLRIFTFVELRAATRNFKSDTVLGEGGFGKVFKGWLDEK--  102

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP + GSG ++A+KKL   SLQGFEEW+SEV  LG  SHPN+++LLGYCWE  +LLLVYE
Sbjct  103   APGKSGSGTVIAVKKLNSESLQGFEEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYE  162

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L+W++RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  163   FMQKGSLENHLFGRGASVQPLAWNIRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  222

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  223   GSYTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  282

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH LV W+KP LS++ K + I+D R++GQY  +A  Q AQL+L+C
Sbjct  283   ILTGLRALDTNRPSGQHNLVDWIKPYLSEKRKFRHIIDARLQGQYPYKAAYQIAQLSLKC  342

Query  1377  LESQPEKRPSM  1409
             LE++P+ RPSM
Sbjct  343   LEAEPKHRPSM  353



>ref|XP_011022164.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=438

 Score =   421 bits (1083),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 250/318 (79%), Gaps = 7/318 (2%)
 Frame = +3

Query  477   YSSAESED------SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGW  638
             +S A S D      ++A+G IL + NLK ++ A+L+ AT NFK D +LG GGFG V+KGW
Sbjct  52    FSEAASHDEGNEVINSADGQILESSNLKEFTFADLKRATKNFKSDTLLGEGGFGKVYKGW  111

Query  639   VDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
             +D+ T APS  GSGM+VAIKKL  GS+QGFEEW+SEV  LG  SHPN++KLLG+C +  +
Sbjct  112   IDQKTYAPSNSGSGMVVAIKKLNSGSMQGFEEWQSEVNFLGRLSHPNLVKLLGFCLDDKE  171

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+M  GSLENHLFR+N   + LSWD+RL IA G ARGLAFLH SE++VI RD K+
Sbjct  172   LLLVYEFMPKGSLENHLFRRNPNIEPLSWDIRLKIATGAARGLAFLHTSEKKVIYRDFKA  231

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD  YNAKISDFGLAK GPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY F
Sbjct  232   SNILLDGKYNAKISDFGLAKSGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGF  291

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLK-SIMDVRMEGQYSSEAELQA  1355
             GV+LLEML+G R+LD K P+GQ  LV W+KP+LS + KLK +IMD R+EGQYSS+A +QA
Sbjct  292   GVVLLEMLSGQRALDRKRPTGQQNLVEWLKPLLSHKKKLKTTIMDSRIEGQYSSKAMVQA  351

Query  1356  AQLTLRCLESQPEKRPSM  1409
             AQLTL+CL++ P  RPSM
Sbjct  352   AQLTLKCLKADPRNRPSM  369



>ref|XP_003629128.1| Serine/threonine protein kinase BIK1 [Medicago truncatula]
Length=408

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 253/334 (76%), Gaps = 0/334 (0%)
 Frame = +3

Query  408   LSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFK  587
              SA  S  G +    + + +++  +       + NG IL  PNLKV+S  EL+ AT +FK
Sbjct  34    FSATTSSAGRSQFSEVASGSIDDTTDGSLPFPSPNGQILERPNLKVFSFIELKAATKSFK  93

Query  588   RDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMF  767
              D +LG GGFG V+KGW+DE TL+P++ GSGM+VAIKKL   S QGF+EW+SEV  LG  
Sbjct  94    SDTLLGEGGFGKVYKGWLDEKTLSPTKAGSGMVVAIKKLNSESTQGFQEWQSEVNFLGRL  153

Query  768   SHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGL  947
             SHPN++KLLGYCW+ ++LLLVYE+M  GSLENHLFR+N   + LSW+ R+ IAIG ARGL
Sbjct  154   SHPNLVKLLGYCWDDDELLLVYEFMPKGSLENHLFRRNPNIEPLSWNTRIKIAIGAARGL  213

Query  948   AFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAP  1127
             AFLH S  QVI RD K+SNILLD +Y AKISDFGLAKLGPSG  SHVTTRV+GT GY AP
Sbjct  214   AFLHDSADQVIYRDFKASNILLDGSYIAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAP  273

Query  1128  EYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIM  1307
             EY+ TG+LYVKSDVY FGV+LLE+LT +R+LD K P+GQ  LV WVKP LS + KLK IM
Sbjct  274   EYIATGHLYVKSDVYGFGVVLLEILTAMRALDTKRPTGQQNLVEWVKPFLSNKKKLKGIM  333

Query  1308  DVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             D R+EGQYS +A +QAA L+L+CLE+ P++RPSM
Sbjct  334   DGRIEGQYSPKAAVQAAALSLKCLENDPKQRPSM  367



>ref|XP_002312803.2| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
 gb|EEE86758.2| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
Length=423

 Score =   420 bits (1080),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 214/375 (57%), Positives = 262/375 (70%), Gaps = 21/375 (6%)
 Frame = +3

Query  297   GNFVGSRTADSISGALP----SNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTP  464
             G+   S T  S +G L     S     TA S +S        +A  S G N +A      
Sbjct  6     GSSAHSPTTPSTTGHLSTAGISQTTSDTASSGVS--------NATSSRGSNISAHSR---  54

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
                 +S+   ++   NG ILPTPNL+++S AEL+VAT NFK D +LG GGFG V+KGW+D
Sbjct  55    ----FSAGSGDEEFPNGQILPTPNLRIFSFAELKVATRNFKSDTLLGEGGFGQVYKGWLD  110

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E   AP   GSG I+A+K+L   SLQGFEEW+SEV  LG  SHP++++L+GYCWE  +LL
Sbjct  111   EK--APGRIGSGTIIAVKRLNSESLQGFEEWQSEVNFLGRLSHPHLVRLIGYCWEVKELL  168

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+MQ GSLENHLF +    + L WD RL IAIG ARGLAFLH S++QVI RD K+SN
Sbjct  169   LVYEFMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASN  228

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  229   ILLDGAYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGV  288

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +L+E+LTGLR+LD   PSG+H LV W+KP LS + KLKSIMD  +EG+Y S+A LQ AQL
Sbjct  289   VLVEILTGLRALDINRPSGRHSLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQL  348

Query  1365  TLRCLESQPEKRPSM  1409
              L CLES+P+ RP M
Sbjct  349   ALNCLESEPKHRPHM  363



>ref|XP_007156235.1| hypothetical protein PHAVU_003G269700g [Phaseolus vulgaris]
 gb|ESW28229.1| hypothetical protein PHAVU_003G269700g [Phaseolus vulgaris]
Length=398

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 241/300 (80%), Gaps = 0/300 (0%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G IL  PNLK +S  +L+ A  +FK D +LG GGFG V+KGW+DE TLAP++PG GM+V
Sbjct  59    DGQILERPNLKEFSFVDLKSAAKSFKGDTLLGEGGFGRVYKGWLDEKTLAPAKPGFGMVV  118

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL   S QGF+EW+SEV  LG  SHPN++KLLGYCW+ ++LLLVYE+M  GSLENHL
Sbjct  119   AIKKLNPESTQGFQEWKSEVNFLGRLSHPNLVKLLGYCWDEDELLLVYEFMPKGSLENHL  178

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N   + LSW+ RL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAKISDFG
Sbjct  179   FRRNPNIEPLSWNTRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDGNYNAKISDFG  238

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG+R+ D +
Sbjct  239   LAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRAFDTR  298

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+GQ  LV W KP LS + KLK+IMD+R++GQYSS+A  QAA+L L+CLE  P++R SM
Sbjct  299   RPTGQQNLVEWTKPFLSSKKKLKTIMDIRIKGQYSSKAASQAAELILKCLEHDPKQRSSM  358



>ref|XP_010526844.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Tarenaya hassleriana]
Length=429

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 242/311 (78%), Gaps = 1/311 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S AE+E+S  +G IL TPNLK+Y+ +EL+ AT NFK + VLG GGFG V+KGWVDE TL+
Sbjct  62    SEAETENSFTDGQILETPNLKIYTFSELKTATMNFKPNTVLGQGGFGKVYKGWVDEITLS  121

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ GSGMIVA+K+L   S+QGF EW SE+  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  122   PSKVGSGMIVAVKRLNSESVQGFAEWRSEINFLGKLSHPNLVKLLGYCWEDKELLLVYEF  181

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+N   + LSWDLRL IAIG ARGL FLH S R+VI RD K+SNILLD 
Sbjct  182   MPKGSLENHLFRRNPAVEPLSWDLRLKIAIGAARGLTFLHSSNREVIYRDFKASNILLDS  241

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAKLGPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  242   DYNAKISDFGLAKLGPSNEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYTFGVVLLEM  301

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKP-MLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +TGLR+ D + P GQ  LV W++P ++    K+K IMD R++GQYSS A  + AQLT   
Sbjct  302   MTGLRAHDTRRPDGQQSLVDWLRPSLVGSRSKVKLIMDTRLKGQYSSAAVAELAQLTAST  361

Query  1377  LESQPEKRPSM  1409
             LE  P+KRP M
Sbjct  362   LEPDPKKRPHM  372



>ref|XP_010918257.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=428

 Score =   418 bits (1075),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 196/299 (66%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL+ AT NFK D VLG GGFG V+KGWVDE +L PS+  + M+VA
Sbjct  64    GRILEVPNLRIFAFAELKTATKNFKPDTVLGEGGFGRVYKGWVDEKSLNPSKSVAAMVVA  123

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG EEW+SEV  LG  SHPN+++LLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  124   VKKLNPESMQGLEEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEFMAKGSLENHLF  183

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             R+    + LSW LRL IAIG ARGLAFLH SE+Q+I RD K+SNILLD NYNAK+SDFGL
Sbjct  184   RRGAALQPLSWKLRLKIAIGAARGLAFLHTSEKQIIYRDFKASNILLDSNYNAKLSDFGL  243

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G  SHV+TRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML+G R+LD   
Sbjct  244   AKNGPTGGESHVSTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLSGQRALDTSR  303

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             PSG+H LV W KP+LS   KL  +MD R+EGQYSS+A L+AAQLTLRCL  +P+ RPSM
Sbjct  304   PSGKHNLVDWAKPLLSDRRKLARLMDPRLEGQYSSKAALKAAQLTLRCLAGEPKNRPSM  362



>ref|XP_010941423.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=426

 Score =   418 bits (1075),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 237/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SS    ++   G IL  PNL+ ++ AEL+ AT NFK + VLG GGFG V+KGWVDE TL 
Sbjct  53    SSVSVYEAFPEGRILEAPNLRTFTFAELKNATRNFKPETVLGEGGFGRVYKGWVDEKTLN  112

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             P+  G+GM+VA+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  113   PARSGAGMVVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLLGYCWEDTELLLVYEF  172

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + LSW LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  173   MAKGSLENHLFRRGAAFEPLSWSLRLKIAIGAARGLAFLHTSEKQVIYRDFKASNILLDS  232

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NYNAK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  233   NYNAKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  292

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+G R+LD   PSGQH LV W +P L+   KL  +MD R+EGQY S+  LQAAQLTLRCL
Sbjct  293   LSGQRALDTNRPSGQHNLVDWARPYLADRRKLSRLMDPRLEGQYPSKGALQAAQLTLRCL  352

Query  1380  ESQPEKRPSM  1409
                P+ RPSM
Sbjct  353   AGDPKSRPSM  362



>ref|XP_009395361.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   416 bits (1068),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 240/312 (77%), Gaps = 0/312 (0%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             I S A +++   +G IL  PNL+V++ +EL++AT NFK D VLG GGFG V+KGWV+E T
Sbjct  50    IVSGASTDEGFLDGQILEVPNLRVFTFSELKIATRNFKPDTVLGEGGFGRVYKGWVEEKT  109

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
             L P++ G GM+VA+KKL   S+QG E+W+SEV  LG  SHPN++KLLGYC E  +LLLVY
Sbjct  110   LNPAKSGIGMVVAVKKLNPESMQGLEQWQSEVNFLGRLSHPNLVKLLGYCLEDEELLLVY  169

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             EYM  GSLENHLFRK    + LSW LRL IAIG ARGLAFLH SE+QVI RD K+SNILL
Sbjct  170   EYMARGSLENHLFRKGSAFEPLSWSLRLKIAIGAARGLAFLHTSEKQVIYRDFKASNILL  229

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D NYNAK+SDFGLAK GPSG +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  230   DSNYNAKLSDFGLAKHGPSGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVMLL  289

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EML+G R+LD   PSGQH L+ + +PML+   KL  ++D R+EGQYSS+   Q AQLTL+
Sbjct  290   EMLSGQRALDTNRPSGQHNLIDFARPMLADRRKLARLIDNRLEGQYSSKGAYQVAQLTLK  349

Query  1374  CLESQPEKRPSM  1409
             CL   P  RPSM
Sbjct  350   CLAGDPRSRPSM  361



>gb|KHG09399.1| hypothetical protein F383_14054 [Gossypium arboreum]
 gb|KHG10456.1| hypothetical protein F383_08344 [Gossypium arboreum]
Length=416

 Score =   416 bits (1069),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 242/305 (79%), Gaps = 3/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E+   +G IL T NLKV++ AEL+ AT +F  + +LG GGFG V+KGW+DE TL PS+ G
Sbjct  62    EEEVPDGQILETSNLKVFTFAELKAATKSF--NTLLGEGGFGKVYKGWLDERTLTPSKVG  119

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
              GMIVAIKKL + S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ GS
Sbjct  120   FGMIVAIKKLKQESVQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMQKGS  179

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFR+N   + LSW+ RL I IG ARGLAFLH SE+ VI RD K+SNILLD +YNAK
Sbjct  180   LENHLFRRNPSVEPLSWETRLKIIIGAARGLAFLHFSEK-VIFRDFKASNILLDGHYNAK  238

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGPSG +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGVLLLE++TGLR
Sbjct  239   ISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVLLLEIMTGLR  298

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD K P GQ  LV W+KP LS + K K+ MD R+EGQYSS+A  Q A+LTL+CLE  P+
Sbjct  299   ALDTKRPDGQQNLVDWLKPTLSHKRKFKTFMDARIEGQYSSKAATQTAELTLKCLEHDPK  358

Query  1395  KRPSM  1409
              RPSM
Sbjct  359   NRPSM  363



>ref|XP_011000883.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Populus euphratica]
Length=422

 Score =   416 bits (1069),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 263/371 (71%), Gaps = 14/371 (4%)
 Frame = +3

Query  297   GNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEI  476
             G+   S T  S +G L +    +T+ +A S + +     A  S G N +A+         
Sbjct  6     GSSAHSPTTPSTTGHLSTGISQTTSDTASSGVSN-----ATSSRGSNISARSR-------  53

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+   ++   NG ILPTPNL+++S AEL+VAT NFK D +LG GGFG V+KGW+DE   
Sbjct  54    FSAGSGDEEFPNGQILPTPNLRIFSFAELKVATRNFKSDTLLGEGGFGQVYKGWLDEK--  111

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP   GSG ++A+K+L   SLQGFEEW+SEV  LG  SHP++++L+GYCWE  +LLLVYE
Sbjct  112   APGRNGSGTVIAVKRLNSESLQGFEEWQSEVNFLGRLSHPHLVRLIGYCWEVKELLLVYE  171

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L WD RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  172   FMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  231

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  232   GAYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  291

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+  LV W+KP LS + KLKSIMD  +EG+Y S+A LQ AQL L C
Sbjct  292   ILTGLRALDINRPSGRQTLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQLALNC  351

Query  1377  LESQPEKRPSM  1409
             LES+ + RP M
Sbjct  352   LESEHKHRPHM  362



>ref|XP_008367929.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=401

 Score =   415 bits (1067),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 240/307 (78%), Gaps = 0/307 (0%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E      NG IL +PNL+V++  EL+ AT NFK D VLG GGFG VFKGWVDE TL PS+
Sbjct  55    ELHSQQPNGQILESPNLRVFTFTELKAATRNFKSDQVLGEGGFGRVFKGWVDEKTLQPSK  114

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
              G+GM+VAIKKL   S+QG++EW+SEV  LG  SHPN++KLLGYC E  +LLLVYE+M+ 
Sbjct  115   SGTGMLVAIKKLNSESVQGYQEWQSEVNFLGRLSHPNLVKLLGYCLEDEELLLVYEFMKK  174

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR++ G + LSWD RL IAIG ARGLAFLH SE+Q+I RD K+SNILLD ++N
Sbjct  175   GSLENHLFRRSAGSELLSWDTRLKIAIGAARGLAFLHSSEKQIIYRDFKASNILLDWSFN  234

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             +KISDFGLAKLGP+G  SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG
Sbjct  235   SKISDFGLAKLGPAGAESHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTG  294

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
             LR+LD + P  Q  L  W KP+L  + KLK+I+DVRMEGQY+ +A +Q A +  +CLE  
Sbjct  295   LRALDMQRPREQQQLAEWAKPLLLHKRKLKNILDVRMEGQYAFKAAMQVALIAHKCLEPD  354

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  355   PKSRPSM  361



>ref|XP_009392329.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   416 bits (1068),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 240/310 (77%), Gaps = 1/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SSA  ++   +G IL  PNL+++S AEL  AT NFK +MVLG GGFG V+KG V+E TL 
Sbjct  55    SSASIDEVFPDGRILEAPNLRIFSFAELRTATRNFKPEMVLGEGGFGKVYKGCVEEKTLN  114

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             P++ G G++VA+KKL   S+QG EEW+SEV  LG  SHPN++KL+GYCWE  +LLLVYEY
Sbjct  115   PAKSGVGIVVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLMGYCWE-KELLLVYEY  173

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + LSW +RL IAIG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  174   MPKGSLENHLFRRGAAFEPLSWSIRLKIAIGAARGLAFLHSSEKQVIYRDFKASNILLDA  233

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NYNAK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE 
Sbjct  234   NYNAKLSDFGLAKHGPTGSDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLET  293

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+G R+LD   PSGQH LV W +PML+   KL  +MD R+EGQYSS+  LQAAQLTLRCL
Sbjct  294   LSGQRTLDPNRPSGQHNLVDWARPMLADRRKLARLMDPRLEGQYSSKGALQAAQLTLRCL  353

Query  1380  ESQPEKRPSM  1409
                P+ RPSM
Sbjct  354   AGDPKSRPSM  363



>ref|XP_006384848.1| kinase family protein [Populus trichocarpa]
 gb|ERP62645.1| kinase family protein [Populus trichocarpa]
Length=424

 Score =   415 bits (1067),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 210/376 (56%), Positives = 263/376 (70%), Gaps = 17/376 (5%)
 Frame = +3

Query  294   MGNFVG----SRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPT  461
             MGN  G    S T  S +G L S     T     S   S+   +A  S G N +A     
Sbjct  1     MGNCWGFSAHSPTTPSTTGQLSSAGISHTT----SNTTSFGVSNATSSRGSNISAHSR--  54

Query  462   PNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWV  641
                  +S+   ++   NG ILPTPNL+V+S AEL+VAT NFK D +LG GGFG V+KGW+
Sbjct  55    -----FSAGSGDEEFPNGQILPTPNLRVFSFAELKVATRNFKSDTLLGEGGFGQVYKGWL  109

Query  642   DENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKL  821
             DE   AP   GSG ++A+K+L   SLQGFEEW++EV  LG  SHP++++L+GYCWE  +L
Sbjct  110   DEK--APGRNGSGTVIAVKRLNSESLQGFEEWQAEVNFLGRLSHPHLVRLIGYCWEDKEL  167

Query  822   LLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSS  1001
             LLVYE+MQ GSLENHLF +    + L WD RL IAIG ARGL+FLH S++QVI RD K+S
Sbjct  168   LLVYEFMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGAARGLSFLHASDKQVIYRDFKAS  227

Query  1002  NILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFG  1181
             NIL+D +Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FG
Sbjct  228   NILIDGSYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFG  287

Query  1182  VLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQ  1361
             V+L+E+LTGLR+LD   PSG+H LV W+KP LS + KLKSIMD+R+EG+Y ++A L+ AQ
Sbjct  288   VVLVEILTGLRALDANRPSGRHTLVDWIKPFLSDKRKLKSIMDIRLEGRYPAKAALRIAQ  347

Query  1362  LTLRCLESQPEKRPSM  1409
             L L CLE +   RP M
Sbjct  348   LALNCLEQEHRHRPHM  363



>ref|XP_008393454.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=411

 Score =   415 bits (1066),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 196/307 (64%), Positives = 239/307 (78%), Gaps = 0/307 (0%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E +    NG IL  PNL+V++ AE++ AT NFK D VLG GGFG VFKGWVDE TL PS+
Sbjct  54    ELQSQQPNGRILEFPNLRVFTFAEMKAATRNFKSDAVLGEGGFGIVFKGWVDEKTLQPSK  113

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
              G+GM+VAIKKL   + QGF+EW+SEV  LG  SHP ++KLLGYCWE  +LLLVYE+MQ 
Sbjct  114   AGTGMMVAIKKLNPENGQGFQEWQSEVNFLGRLSHPXLVKLLGYCWEDKELLLVYEFMQK  173

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR++ G + LSWD RL IAIG ARGLAFLH SE+++I RD K+SNILLD ++N
Sbjct  174   GSLENHLFRRSAGIEPLSWDRRLKIAIGAARGLAFLHSSEKKIIYRDFKASNILLDGSFN  233

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AKISDFGLAKLGP G  SHV+TR++GT GY APEY+ TG+LYV SDVY FGV+LLE+LTG
Sbjct  234   AKISDFGLAKLGPVGGESHVSTRIMGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEILTG  293

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
             LR+LD K P  Q  LV W KP+L  + KLK+I+DVRME QY+ +A +Q AQ+T +CL   
Sbjct  294   LRALDLKRPKEQQQLVEWAKPLLLNKRKLKTILDVRMESQYAFKAAMQTAQITEKCLAPD  353

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  354   PKSRPSM  360



>ref|XP_010233714.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=431

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 238/310 (77%), Gaps = 2/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +SA  E     G IL  PNL+ ++  EL  AT NF+ D VLG GGFG V+KGWVDE T+ 
Sbjct  60    NSAFDEGGFLEGQILEAPNLRTFTFLELRTATKNFRPDSVLGEGGFGRVYKGWVDEKTMN  119

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             P++ G+GM+VA+KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  120   PAKSGTGMVVAVKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLVYEF  179

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  180   MAKGSLENHLFRR--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDA  237

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NYNAK+SDFGLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEM
Sbjct  238   NYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEM  297

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTG R+LD   P+GQ  LV W KP L+   KL  IMD R EGQY+S+  LQ+AQLT+ CL
Sbjct  298   LTGQRALDPNRPNGQLSLVDWAKPYLNDRRKLARIMDTRFEGQYNSKQALQSAQLTMICL  357

Query  1380  ESQPEKRPSM  1409
              ++P  RPSM
Sbjct  358   AAEPRSRPSM  367



>gb|AFW66750.1| putative protein kinase superfamily protein [Zea mays]
Length=430

 Score =   414 bits (1064),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 255/373 (68%), Gaps = 24/373 (6%)
 Frame = +3

Query  291   SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNL  470
             S G  + S+T+ SI+ +L +  K S+  S+     S R  S    EG             
Sbjct  21    SPGTTMTSKTSGSITTSLSTTGKLSSVGSSFMASASSRSTSGGFDEGAK-----------  69

Query  471   EIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDEN  650
               YS         +G IL  PNL+ ++  EL+ AT NF+ D VLG GGFG V+KGWVDE 
Sbjct  70    --YS---------DGQILEAPNLRTFTFVELKTATKNFRPDSVLGEGGFGRVYKGWVDEK  118

Query  651   TLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLV  830
             T+AP+   +GM+VA+KKL   S+QGFEEW+SE+  LG  SHPN++KLLGYCWE  +LLLV
Sbjct  119   TMAPTRNSTGMVVAVKKLNSESMQGFEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLV  178

Query  831   YEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNIL  1010
             YE+M  GSLENHLFR+  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNIL
Sbjct  179   YEFMAKGSLENHLFRR--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNIL  236

Query  1011  LDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLL  1190
             LD NYNAK+SDFGLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++
Sbjct  237   LDANYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVM  296

Query  1191  LEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             LEML+G R+LD   PSGQ  L  W KP L+   +L  +MD R EGQY+S    QAAQLTL
Sbjct  297   LEMLSGQRALDPNRPSGQLSLADWAKPYLADRRRLARLMDPRFEGQYNSRQAFQAAQLTL  356

Query  1371  RCLESQPEKRPSM  1409
              CL   P  RPSM
Sbjct  357   GCLAGDPRSRPSM  369



>ref|XP_002451394.1| hypothetical protein SORBIDRAFT_04g001360 [Sorghum bicolor]
 gb|EES04370.1| hypothetical protein SORBIDRAFT_04g001360 [Sorghum bicolor]
Length=436

 Score =   414 bits (1065),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 258/374 (69%), Gaps = 8/374 (2%)
 Frame = +3

Query  294   MGNFVG--SRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPN  467
             MGN  G   R A+    + P     S    +L+   S     ++ S G  A+A    T  
Sbjct  1     MGNICGGKDRVAEDFRPSSPGTTMTSKTSGSLTTSQSTTGKLSSVSSGFMASAGSRSTSG  60

Query  468   LEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDE  647
               +   A+  D    G IL  PNL+ ++  EL+ AT NF+ D VLG GGFG V+KGWVDE
Sbjct  61    GFVDEGAKYPD----GQILEAPNLRTFTFMELKTATKNFRPDSVLGEGGFGRVYKGWVDE  116

Query  648   NTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLL  827
              T+AP+  G+GM+VA+KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLL
Sbjct  117   KTMAPTRNGTGMVVAVKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLL  176

Query  828   VYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNI  1007
             VYE+M  GSLENHLFR+  G   LSW+LRL I+IG ARGLAFLH SE+QVI RD K+SNI
Sbjct  177   VYEFMAKGSLENHLFRR--GCAPLSWELRLKISIGAARGLAFLHASEKQVIYRDFKASNI  234

Query  1008  LLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVL  1187
             LLD NYNAK+SDFGLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+
Sbjct  235   LLDANYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVV  294

Query  1188  LLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLT  1367
             +LEML+G R+LD   PSGQ  L  W KP L+   KL  +MD R EGQY+S+   QAAQLT
Sbjct  295   MLEMLSGQRALDPNRPSGQLSLADWAKPYLADRRKLARLMDPRFEGQYNSKQAFQAAQLT  354

Query  1368  LRCLESQPEKRPSM  1409
             L CL  +P  RPSM
Sbjct  355   LNCLAGEPRSRPSM  368



>ref|XP_011000882.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Populus euphratica]
Length=423

 Score =   414 bits (1063),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 261/375 (70%), Gaps = 21/375 (6%)
 Frame = +3

Query  297   GNFVGSRTADSISGALP----SNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTP  464
             G+   S T  S +G L     S     TA S +S        +A  S G N +A+     
Sbjct  6     GSSAHSPTTPSTTGHLSTAGISQTTSDTASSGVS--------NATSSRGSNISARSR---  54

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
                 +S+   ++   NG ILPTPNL+++S AEL+VAT NFK D +LG GGFG V+KGW+D
Sbjct  55    ----FSAGSGDEEFPNGQILPTPNLRIFSFAELKVATRNFKSDTLLGEGGFGQVYKGWLD  110

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E   AP   GSG ++A+K+L   SLQGFEEW+SEV  LG  SHP++++L+GYCWE  +LL
Sbjct  111   EK--APGRNGSGTVIAVKRLNSESLQGFEEWQSEVNFLGRLSHPHLVRLIGYCWEVKELL  168

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+MQ GSLENHLF +    + L WD RL IAIG ARGLAFLH S++QVI RD K+SN
Sbjct  169   LVYEFMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASN  228

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  229   ILLDGAYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGV  288

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +L+E+LTGLR+LD   PSG+  LV W+KP LS + KLKSIMD  +EG+Y S+A LQ AQL
Sbjct  289   VLVEILTGLRALDINRPSGRQTLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQL  348

Query  1365  TLRCLESQPEKRPSM  1409
              L CLES+ + RP M
Sbjct  349   ALNCLESEHKHRPHM  363



>ref|XP_011040800.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=424

 Score =   414 bits (1063),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 264/376 (70%), Gaps = 17/376 (5%)
 Frame = +3

Query  294   MGNFVGS----RTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPT  461
             MGN  GS     T  S +G L S    +    A S   S+   +A  S G N +A     
Sbjct  1     MGNCWGSCAHGPTTPSTTGQLSS----AGISHATSNTTSFGVSNATSSRGSNISAHSR--  54

Query  462   PNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWV  641
                  +S+   ++   NG ILPTPNL+V+S AEL+VAT NFK D +LG GGFG V+KGW+
Sbjct  55    -----FSAGSGDEEFPNGQILPTPNLRVFSFAELKVATRNFKSDTLLGEGGFGQVYKGWL  109

Query  642   DENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKL  821
             DE   AP   GSG ++A+K+L   SLQGFEEW++EV  LG  SHP++++L+GYCWE  +L
Sbjct  110   DEK--APGRNGSGTVIAVKRLNSESLQGFEEWQAEVNFLGRLSHPHLVRLIGYCWEDKEL  167

Query  822   LLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSS  1001
             LLVYE+MQ GSLENHLF +    + L WD RL IAIG ARGL+FLH S++QVI RD K+S
Sbjct  168   LLVYEFMQKGSLENHLFGRGSAVQPLPWDTRLKIAIGAARGLSFLHASDKQVIYRDFKAS  227

Query  1002  NILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFG  1181
             NIL+D +Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FG
Sbjct  228   NILIDGSYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFG  287

Query  1182  VLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQ  1361
             V+L+E+LTGLR+LD   PSG+H LV W+KP LS + KLKSIMD R+EG+Y ++A L+ AQ
Sbjct  288   VVLVEILTGLRALDTNRPSGRHTLVDWIKPYLSDKRKLKSIMDSRLEGRYPAKAALRIAQ  347

Query  1362  LTLRCLESQPEKRPSM  1409
             L L CLES+   RP M
Sbjct  348   LALNCLESEHRHRPHM  363



>ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Vitis vinifera]
Length=415

 Score =   413 bits (1061),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 241/310 (78%), Gaps = 3/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S  S+++  NG ILP PNL++++ +EL+ AT NF+ D VLG GGFG VFKGW+DE    
Sbjct  49    ASGGSDEAFPNGQILPHPNLRIFTFSELKAATKNFRPDTVLGEGGFGKVFKGWLDEKV--  106

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S+ GSG ++A+KKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  107   -SKSGSGTVIAVKKLNSESMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEF  165

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLF +    + L WD+RL I+IG ARGL FLH SE+QVI RD K+SNILLD 
Sbjct  166   MQKGSLENHLFGRGATVQPLPWDIRLKISIGAARGLTFLHTSEKQVIYRDFKASNILLDG  225

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +Y AKISDFGLAKLGP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EM
Sbjct  226   SYTAKISDFGLAKLGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEM  285

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD   PSGQH LV W+KP LS   KLK+IMD R+EG+Y S+A  Q AQL+LRC+
Sbjct  286   LTGLRALDTTRPSGQHNLVDWIKPHLSDRRKLKTIMDARLEGRYPSKAANQIAQLSLRCI  345

Query  1380  ESQPEKRPSM  1409
              S+ + RPSM
Sbjct  346   GSEHKSRPSM  355



>ref|XP_007043058.1| Serine/threonine-protein kinase cx32 isoform 2 [Theobroma cacao]
 gb|EOX98889.1| Serine/threonine-protein kinase cx32 isoform 2 [Theobroma cacao]
Length=434

 Score =   413 bits (1062),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 241/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+   +++  NG ILPTPNL+++S AEL  AT NF+ DMVLG GGFG VFKGW+DE   
Sbjct  66    FSALSGDEAFPNGQILPTPNLRIFSFAELRAATKNFRPDMVLGEGGFGKVFKGWLDEK--  123

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP + GSG +VA+KKL   SLQGFEEW+SEV  LG   HP++++LLGYCWE  +LLLVYE
Sbjct  124   APGKNGSGNLVAVKKLNSESLQGFEEWQSEVNFLGRLYHPHLVRLLGYCWEDKELLLVYE  183

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    K+L WD+RL IAIG A+GL+FLH S++QVI RD K+SNILLD
Sbjct  184   FMQKGSLENHLFGRGATVKSLEWDIRLKIAIGAAKGLSFLHTSDKQVIYRDFKASNILLD  243

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  244   GSYTAKISDFGLAKFGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  303

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV WVKP LS   KLKS+MD R+EG+Y S+A  + A L L+C
Sbjct  304   ILTGLRALDPNRPSGRHNLVDWVKPYLSDRRKLKSLMDHRLEGKYPSKAAFRIAHLALKC  363

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  364   LAPEPKHRPSM  374



>ref|XP_010935290.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=428

 Score =   413 bits (1061),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 239/312 (77%), Gaps = 0/312 (0%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             I SS    +++  G IL  PNL++++ AEL+ AT NFK D VLG GGFG V+KGWVDE T
Sbjct  51    IGSSVSLGEASPEGRILEVPNLRIFTFAELKGATRNFKPDTVLGEGGFGRVYKGWVDEKT  110

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
             L P++ G GM+VA+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVY
Sbjct  111   LNPAKSGMGMVVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVY  170

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E++  GSLENHLFR+    + LSW LRL IAIG ARGLAFLH S+++VI RD K+SNILL
Sbjct  171   EFLIKGSLENHLFRRGAAYEPLSWSLRLKIAIGAARGLAFLHTSDKKVIYRDFKASNILL  230

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D NYN K+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  231   DSNYNPKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLL  290

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EML+G R+LD   PSGQH LV W KP L+   KL  +MD R+EGQY S+   QAAQLTL+
Sbjct  291   EMLSGQRALDTNRPSGQHNLVDWAKPYLADRRKLARLMDPRLEGQYPSKGAFQAAQLTLK  350

Query  1374  CLESQPEKRPSM  1409
             CL  +P+ RPSM
Sbjct  351   CLGGEPKSRPSM  362



>dbj|BAD28317.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD28151.1| putative protein kinase [Oryza sativa Japonica Group]
Length=454

 Score =   413 bits (1062),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 235/307 (77%), Gaps = 3/307 (1%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D++A G IL  PNL++++ AEL  AT NFK D VLG GGFG V KGWVDE T++P+  GS
Sbjct  82    DASAEGRILEAPNLRIFTFAELRAATRNFKADTVLGEGGFGRVHKGWVDERTMSPARSGS  141

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             GM VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GSL
Sbjct  142   GMAVAVKKLDPESLQGVQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAQGSL  201

Query  858   ENHLFRKN---VGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             ENHLFRK      ++ LSW LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD  ++
Sbjct  202   ENHLFRKGGSASPQQPLSWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLDTQFH  261

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTG
Sbjct  262   AKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELLTG  321

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
             LR+LD   PSGQH LV W KP LS   KL  +MD R+EGQYSS    +AAQLTLRCL + 
Sbjct  322   LRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEGQYSSRGAQRAAQLTLRCLAAD  381

Query  1389  PEKRPSM  1409
              + RPSM
Sbjct  382   HKNRPSM  388



>ref|XP_008663506.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X4 [Zea mays]
Length=547

 Score =   416 bits (1070),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NF+ D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  193   GRILEAPNLRIFTFAELRAATRNFRPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  252

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYEYM  GSLENHLF
Sbjct  253   VKKLNQESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEYMPKGSLENHLF  312

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + +SW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAK+SDFGL
Sbjct  313   RKGGSFEPISWNLRLRIAIGAARGLAFLHSSEKQVIYRDFKASNILLDTNYNAKLSDFGL  372

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   
Sbjct  373   AKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTAR  432

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S+A LQAAQLTLRCLE  P  RPSM
Sbjct  433   PAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRCLEGDPRSRPSM  491



>ref|XP_002527153.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF35235.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=430

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 246/336 (73%), Gaps = 9/336 (3%)
 Frame = +3

Query  402   RQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSN  581
             R  + A S+G N +           +S    +++  NG ILPTPNLKV++  EL+ AT N
Sbjct  44    RSTNTASSQGSNISGNSR-------FSGGSGDEAFPNGQILPTPNLKVFTFQELKAATKN  96

Query  582   FKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLG  761
             F+ D VLG GGFG VFKGW+DE      +PGSG ++A+KKL   SLQGFEEW+SEV  LG
Sbjct  97    FRSDTVLGEGGFGKVFKGWLDEK--GSGKPGSGTVIAVKKLNSESLQGFEEWQSEVHFLG  154

Query  762   MFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVAR  941
               SHPN+++LLGYCWE  +LLLVYE+MQ GSLENHLF +    + L WD+R+ IAIG AR
Sbjct  155   RLSHPNLVRLLGYCWEDKELLLVYEFMQKGSLENHLFGRGSTVQPLPWDIRIKIAIGAAR  214

Query  942   GLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYI  1121
             GLAFLH S++QVI RD K+SNILLD +Y AKISDFGLAKLGPS   SHVTTRV+GT GY 
Sbjct  215   GLAFLHTSDKQVIYRDFKASNILLDGSYTAKISDFGLAKLGPSASQSHVTTRVMGTYGYA  274

Query  1122  APEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKS  1301
             APEY+ TG+LYVKSDVY FGV+L E+LTGL +LD   PSG+H LV W+KP L  + KLK+
Sbjct  275   APEYVATGHLYVKSDVYGFGVVLAEILTGLHALDTNRPSGRHNLVEWIKPYLYDKRKLKT  334

Query  1302  IMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             IMD R+EG+Y S+   + AQL L C+ES+P+ RPSM
Sbjct  335   IMDSRLEGRYPSKPAFRIAQLALNCIESEPKHRPSM  370



>ref|NP_001147123.1| serine/threonine-protein kinase Cx32 [Zea mays]
 gb|ACG25550.1| serine/threonine-protein kinase Cx32 [Zea mays]
Length=428

 Score =   412 bits (1059),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 254/373 (68%), Gaps = 24/373 (6%)
 Frame = +3

Query  291   SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNL  470
             S G  + S+T+ SI+ +L +  K S+  S+       R  S    EG             
Sbjct  21    SPGTTMTSKTSGSITTSLSTTGKLSSVGSSFMASAGSRSTSGGFDEGAK-----------  69

Query  471   EIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDEN  650
               YS         +G IL  PNL+ ++  EL+ AT NF+ D VLG GGFG V+KGWVDE 
Sbjct  70    --YS---------DGQILEAPNLRTFTFVELKTATKNFRPDSVLGEGGFGRVYKGWVDEK  118

Query  651   TLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLV  830
             T+AP+   +GM+VA+KKL   S+QGFEEW+SE+  LG  SHPN++KLLGYCWE  +LLLV
Sbjct  119   TMAPTRNSTGMVVAVKKLNSESMQGFEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLV  178

Query  831   YEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNIL  1010
             YE+M  GSLENHLFR+  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNIL
Sbjct  179   YEFMAKGSLENHLFRR--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNIL  236

Query  1011  LDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLL  1190
             LD NYNAK+SDFGLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++
Sbjct  237   LDANYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVM  296

Query  1191  LEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             LEML+G R+LD   PSGQ  L  W KP L+   +L  +MD R EGQY+S    QAAQLTL
Sbjct  297   LEMLSGQRALDPNRPSGQLSLADWAKPYLADRRRLARLMDPRFEGQYNSRQAFQAAQLTL  356

Query  1371  RCLESQPEKRPSM  1409
              CL   P  RPSM
Sbjct  357   GCLAGDPRSRPSM  369



>ref|XP_007043057.1| Serine/threonine-protein kinase cx32 isoform 1 [Theobroma cacao]
 gb|EOX98888.1| Serine/threonine-protein kinase cx32 isoform 1 [Theobroma cacao]
Length=488

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 241/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+   +++  NG ILPTPNL+++S AEL  AT NF+ DMVLG GGFG VFKGW+DE   
Sbjct  120   FSALSGDEAFPNGQILPTPNLRIFSFAELRAATKNFRPDMVLGEGGFGKVFKGWLDEK--  177

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP + GSG +VA+KKL   SLQGFEEW+SEV  LG   HP++++LLGYCWE  +LLLVYE
Sbjct  178   APGKNGSGNLVAVKKLNSESLQGFEEWQSEVNFLGRLYHPHLVRLLGYCWEDKELLLVYE  237

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    K+L WD+RL IAIG A+GL+FLH S++QVI RD K+SNILLD
Sbjct  238   FMQKGSLENHLFGRGATVKSLEWDIRLKIAIGAAKGLSFLHTSDKQVIYRDFKASNILLD  297

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  298   GSYTAKISDFGLAKFGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  357

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV WVKP LS   KLKS+MD R+EG+Y S+A  + A L L+C
Sbjct  358   ILTGLRALDPNRPSGRHNLVDWVKPYLSDRRKLKSLMDHRLEGKYPSKAAFRIAHLALKC  417

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  418   LAPEPKHRPSM  428



>emb|CBI37741.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   412 bits (1058),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 241/310 (78%), Gaps = 3/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S  S+++  NG ILP PNL++++ +EL+ AT NF+ D VLG GGFG VFKGW+DE    
Sbjct  49    ASGGSDEAFPNGQILPHPNLRIFTFSELKAATKNFRPDTVLGEGGFGKVFKGWLDEKV--  106

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S+ GSG ++A+KKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  107   -SKSGSGTVIAVKKLNSESMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEF  165

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLF +    + L WD+RL I+IG ARGL FLH SE+QVI RD K+SNILLD 
Sbjct  166   MQKGSLENHLFGRGATVQPLPWDIRLKISIGAARGLTFLHTSEKQVIYRDFKASNILLDG  225

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +Y AKISDFGLAKLGP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EM
Sbjct  226   SYTAKISDFGLAKLGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEM  285

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD   PSGQH LV W+KP LS   KLK+IMD R+EG+Y S+A  Q AQL+LRC+
Sbjct  286   LTGLRALDTTRPSGQHNLVDWIKPHLSDRRKLKTIMDARLEGRYPSKAANQIAQLSLRCI  345

Query  1380  ESQPEKRPSM  1409
              S+ + RPSM
Sbjct  346   GSEHKSRPSM  355



>ref|XP_009397897.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397904.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=426

 Score =   410 bits (1055),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 235/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S    +D    G IL  PNL++++ AEL  AT  FK + VLG GGFG V+KGWV+E TL 
Sbjct  51    SGVSVDDVFPEGRILEAPNLRIFTFAELRSATRGFKPETVLGEGGFGRVYKGWVEEKTLN  110

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             P++ G G++VA+KKL   S+QG EEW+SEV  LG  SHPN++KL+GYCWE  +LLLVYEY
Sbjct  111   PAKSGLGIVVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLMGYCWEDKELLLVYEY  170

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + LSW +RL IAIG ARGLAFLH S++QVI RD K+SNILLD 
Sbjct  171   MSKGSLENHLFRRGAAFEPLSWSIRLKIAIGAARGLAFLHSSDKQVIYRDFKASNILLDA  230

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NY AK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  231   NYIAKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  290

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+G R+LD   PSGQH LV W +PML+   KL  +MD R+EGQYSS+  LQAAQLTL CL
Sbjct  291   LSGQRALDANRPSGQHNLVDWARPMLADRRKLARLMDPRLEGQYSSKGALQAAQLTLSCL  350

Query  1380  ESQPEKRPSM  1409
                P+ RPSM
Sbjct  351   AGDPKSRPSM  360



>ref|XP_009382066.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=445

 Score =   411 bits (1056),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 235/312 (75%), Gaps = 0/312 (0%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             I SS    D+   G IL  PNL +++ AEL  AT NFK D VLG GGFG V+KGWVDE T
Sbjct  104   IGSSVTIGDAYPEGRILEAPNLVIFTFAELRSATRNFKPDCVLGEGGFGRVYKGWVDEKT  163

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
             L P++ G GMIVA+KKL   SLQG EEW+SEV  LG  SHPN+++LLGYCWE  +LLLVY
Sbjct  164   LNPTKSGIGMIVAVKKLNPESLQGLEEWQSEVNFLGRLSHPNLVRLLGYCWEEKELLLVY  223

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             EYM  GSLENHLFRK    + LSWD+R+ IAIG ARGLAFLH SE+QVI RD K+SNILL
Sbjct  224   EYMAKGSLENHLFRKGKAYEPLSWDIRMKIAIGAARGLAFLHLSEKQVIYRDFKASNILL  283

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D N+  K+SDFGLAK GP+G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  284   DANFVPKLSDFGLAKNGPTGGQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLL  343

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EML+GLR+LD   PSG H LV + KP LS   KL  +MD R+EG+Y S+A  QAAQLT+R
Sbjct  344   EMLSGLRALDTTRPSGHHNLVDFAKPFLSDRRKLARLMDPRLEGRYPSKAAQQAAQLTVR  403

Query  1374  CLESQPEKRPSM  1409
             CL   P+ RPSM
Sbjct  404   CLAGDPKSRPSM  415



>gb|EMT24247.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Aegilops tauschii]
Length=412

 Score =   410 bits (1053),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 234/301 (78%), Gaps = 2/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A G IL  PNL+ ++  EL+ AT NF+ D VLG GGFG V+KGWVDE T+ P++ G+GM+
Sbjct  48    AAGQILEAPNLRTFTFLELKTATKNFRPDSVLGEGGFGRVYKGWVDEKTMNPTKSGTGMV  107

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSLENH
Sbjct  108   VAVKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLVYEFMAKGSLENH  167

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD +YNAK+SDF
Sbjct  168   LFRK--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDASYNAKLSDF  225

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEML+G R+LD 
Sbjct  226   GLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMLSGKRALDP  285

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+GQ  LV W KP L+   KL  +MD + EGQY+S+   QAAQLTL CL  +P  RPS
Sbjct  286   NRPNGQQSLVDWAKPYLADRRKLARLMDPQFEGQYNSKQSHQAAQLTLNCLAGEPRSRPS  345

Query  1407  M  1409
             M
Sbjct  346   M  346



>ref|XP_009345926.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=418

 Score =   410 bits (1053),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 252/349 (72%), Gaps = 13/349 (4%)
 Frame = +3

Query  363   STAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLK  542
             ST  S +S+  S    S A +   N+            +S+A  ++++A+G ILPTPNL+
Sbjct  21    STVISNISQTTSNNTSSGASTVSRNSQ-----------FSAASGDEASAHGQILPTPNLR  69

Query  543   VYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQ  722
             ++S  EL+ AT NF+ D VLG GGFG VFKGW+D+   AP++ G   ++A+KKL   SLQ
Sbjct  70    IFSYLELKAATRNFRSDTVLGEGGFGMVFKGWLDDK--APAKSGKSTVIAVKKLSSESLQ  127

Query  723   GFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALS  902
             GFEEW+SEV  LG  SHPN++KL GYCWE  +LLLVYE+M  GSLENHLF +    + L 
Sbjct  128   GFEEWQSEVNFLGRLSHPNLVKLFGYCWEDKELLLVYEFMPKGSLENHLFGRGSAVQPLP  187

Query  903   WDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENS  1082
             WD+RL +AIG ARGL FLH SE+QVI RD K+SNILLD +Y AKISDFGLAK+GPS   S
Sbjct  188   WDIRLKVAIGAARGLEFLHTSEKQVIYRDFKASNILLDASYTAKISDFGLAKMGPSASQS  247

Query  1083  HVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGW  1262
             HVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E+LTGLR+LD   P+G+H LV W
Sbjct  248   HVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEILTGLRALDTTRPNGKHNLVDW  307

Query  1263  VKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +KP LS + KLKSIMD R+EG+Y S+A  + + L L C+ES+   RPSM
Sbjct  308   IKPFLSDKRKLKSIMDPRLEGRYPSKAAFRISHLALNCIESEHRNRPSM  356



>ref|XP_008653727.1| PREDICTED: probable serine/threonine-protein kinase NAK [Zea 
mays]
Length=443

 Score =   410 bits (1055),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 253/373 (68%), Gaps = 24/373 (6%)
 Frame = +3

Query  291   SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNL  470
             S G  + S+T+ SI+  L +  K S+  S+       R  S    EG             
Sbjct  36    SPGTTMTSKTSGSITTILSTTGKLSSVGSSFMASAGSRSTSGGFDEGAK-----------  84

Query  471   EIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDEN  650
               YS         +G IL  PNL+ ++  EL+ A  NF+ D VLG GGFG V+KGWVDE 
Sbjct  85    --YS---------DGQILEAPNLRTFTFIELKTAPKNFRPDSVLGEGGFGRVYKGWVDEK  133

Query  651   TLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLV  830
             T+AP+  G+GM+VA+KKL   S+QGFEEW+SE+  LG  SHPN++KLLGYCWE  +LLLV
Sbjct  134   TMAPTRNGTGMVVAVKKLNSESMQGFEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLV  193

Query  831   YEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNIL  1010
             YE+M  GSLENHLFR+  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNIL
Sbjct  194   YEFMAKGSLENHLFRR--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNIL  251

Query  1011  LDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLL  1190
             LD NYNAK+SDFGLAKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++
Sbjct  252   LDANYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVM  311

Query  1191  LEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             LEML+G R+LD   PSGQ  L  W KP L+   +L  +MD R EGQY+S    QAAQLTL
Sbjct  312   LEMLSGQRALDPNRPSGQLSLADWAKPYLADRRRLARLMDPRFEGQYNSRQAFQAAQLTL  371

Query  1371  RCLESQPEKRPSM  1409
              CL   P  RPSM
Sbjct  372   GCLAGDPRSRPSM  384



>ref|XP_008235964.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=416

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 243/311 (78%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++++ +G ILPTPNL+++S  EL+ AT NF+ D VLG GGFG VFKGW+DE   
Sbjct  48    FSAASGDEASPHGQILPTPNLRIFSYLELKAATRNFRSDTVLGEGGFGMVFKGWLDEK--  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP++ G   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  106   APTKSGKTTVIAVKKLSSESLQGFEEWQSEVNFLGRLSHPNLVKLLGYCLEDTELLLVYE  165

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L WD+RL IAIG ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  166   FMQKGSLENHLFGRGSAVQPLPWDIRLKIAIGAARGLAFLHTSEKQVIYRDFKASNILLD  225

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  226   GSYIAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  285

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV W+KP LS + KLK IMD R+EG+Y ++A  + +QL L+C
Sbjct  286   ILTGLRALDQNRPSGKHNLVDWIKPFLSDKRKLKGIMDPRLEGKYPAKAAFRISQLALKC  345

Query  1377  LESQPEKRPSM  1409
             +ES+ + RPSM
Sbjct  346   IESEQKNRPSM  356



>gb|EAY87019.1| hypothetical protein OsI_08416 [Oryza sativa Indica Group]
Length=460

 Score =   411 bits (1056),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 235/311 (76%), Gaps = 7/311 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D++A G IL  PNL++++ AEL  AT NFK D VLG GGFG V KGWVDE T++P+  GS
Sbjct  82    DASAEGRILEAPNLRIFTFAELRAATRNFKADTVLGEGGFGRVHKGWVDERTMSPARSGS  141

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             GM VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GSL
Sbjct  142   GMAVAVKKLDPESLQGVQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAQGSL  201

Query  858   ENHLFRKNVGR-------KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             ENHLFR    +       + LSW LRL+IAIG ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  202   ENHLFRSEPRKGGSASPQQPLSWSLRLHIAIGAARGLAFLHSSEKHVIYRDFKASNILLD  261

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               ++AK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  262   TQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  321

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH LV W KP LS   KL  +MD R+EGQYSS    +AAQLTLRC
Sbjct  322   LLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEGQYSSRGAQRAAQLTLRC  381

Query  1377  LESQPEKRPSM  1409
             L +  + RPSM
Sbjct  382   LAADHKNRPSM  392



>ref|XP_007199945.1| hypothetical protein PRUPE_ppa006347mg [Prunus persica]
 gb|EMJ01144.1| hypothetical protein PRUPE_ppa006347mg [Prunus persica]
Length=416

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 243/311 (78%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++++ +G ILPTPNL+++S  EL+ AT NF+ D VLG GGFG VFKGW+DE   
Sbjct  48    FSAASGDEASPHGQILPTPNLRIFSYLELKAATRNFRSDTVLGEGGFGMVFKGWLDEK--  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP++ G   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  106   APTKSGKTTVIAVKKLSSESLQGFEEWQSEVNFLGRLSHPNLVKLLGYCLEDTELLLVYE  165

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L WD+RL IAIG ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  166   FMQKGSLENHLFGRGSAVQPLPWDIRLKIAIGAARGLAFLHTSEKQVIYRDFKASNILLD  225

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  226   GSYIAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  285

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV W+KP LS + KLK IMD R+EG+Y ++A  + +QL L+C
Sbjct  286   ILTGLRALDTNRPSGKHNLVDWIKPFLSDKRKLKGIMDPRLEGKYPAKAAFRISQLALKC  345

Query  1377  LESQPEKRPSM  1409
             +ES+ + RPSM
Sbjct  346   IESEQKNRPSM  356



>ref|XP_008382436.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=418

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 251/349 (72%), Gaps = 13/349 (4%)
 Frame = +3

Query  363   STAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLK  542
             ST  S +S+  S    S A +   N+            +S+A  ++++A+G ILPTPNL+
Sbjct  21    STVISNISQTTSNNTSSGASTVSRNSQ-----------FSAASGDEASAHGQILPTPNLR  69

Query  543   VYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQ  722
             ++S  EL+ AT NF+ D VLG GGFG VFKGW+D+   AP++ G   ++A+KKL   SLQ
Sbjct  70    IFSYLELKAATRNFRSDTVLGEGGFGVVFKGWLDDK--APTKSGKSTVIAVKKLSSESLQ  127

Query  723   GFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALS  902
             GFEEW+SEV  LG  SHPN++KL GYCWE  +LLLVYEYM  GSLENHLF +    + L 
Sbjct  128   GFEEWQSEVNFLGRLSHPNLVKLFGYCWEDKELLLVYEYMPKGSLENHLFGRGSAVQPLP  187

Query  903   WDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENS  1082
             WD+RL +AIG ARGL FLH SE+QVI RD K+SNILLD +Y AKISDFGLAK+GPS   S
Sbjct  188   WDIRLKVAIGAARGLEFLHTSEKQVIYRDFKASNILLDASYTAKISDFGLAKMGPSASQS  247

Query  1083  HVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGW  1262
             HVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E+LTGLR+LD   P G+H LV W
Sbjct  248   HVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEILTGLRALDTTRPXGKHNLVDW  307

Query  1263  VKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +KP LS + KLKSIMD  ++G+Y S+A  + +QL L C+ES+   RPSM
Sbjct  308   IKPFLSDKRKLKSIMDPHLQGRYPSKAAFRISQLALNCIESEHRNRPSM  356



>ref|XP_003538908.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Glycine max]
Length=366

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 257/355 (72%), Gaps = 20/355 (6%)
 Frame = +3

Query  345   PSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTIL  524
             PSNN  S  +S     GS R++   ES   N  +  + + N+ ++ S E           
Sbjct  14    PSNN--SPHYS-----GSAREMGITESTSVNGGSSSINSNNM-VFPSVE-----------  54

Query  525   PTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
              T NLK ++ A+L+ AT +FK D +LG GGFG V+KGW+ E TL P++ GSGM+VA+KKL
Sbjct  55    -TRNLKQFNFADLKAATKSFKSDALLGEGGFGKVYKGWLHEKTLTPTKAGSGMVVAVKKL  113

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                SLQGF EW+SE+  LG  SHPN++KLLGYC +  + LLVYE+M  GSLENHLFR+N 
Sbjct  114   NSESLQGFREWQSEINFLGRISHPNLVKLLGYCCDDIEFLLVYEFMPKGSLENHLFRRNT  173

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
               + LSWD R+ IAIG ARGLAFLH SE+Q+I RD K+SNILLDE+YNAKISDFGLAKLG
Sbjct  174   NSEPLSWDTRIKIAIGAARGLAFLHTSEKQIIYRDFKASNILLDEDYNAKISDFGLAKLG  233

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             PSGE+SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   P  Q
Sbjct  234   PSGEDSHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLRALDKNRPIEQ  293

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
               L+ W KP LS + KLKSIMD R+EGQYS++A L++A L L+CL+   +KRP M
Sbjct  294   QNLIEWAKPSLSDKRKLKSIMDERIEGQYSTKAALKSAHLILKCLQCDRKKRPHM  348



>ref|XP_008809115.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=400

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL+ AT NF+ D +LG GGFG+V+KGW+DE  L PS+  +GM+VA
Sbjct  47    GRILEVPNLRIFTFAELKTATRNFRPDTILGEGGFGSVYKGWLDEKALNPSKSMAGMVVA  106

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             IKKL   S+QG E+W+SEV  LG  SHPN+++LLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  107   IKKLNPESMQGLEQWQSEVNFLGRLSHPNLVRLLGYCWEDTELLLVYEFMAKGSLENHLF  166

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK  G + LSW LRL IAIG ARGLAFLH SE++VI RD K+SNILLD NYNAK+SDFGL
Sbjct  167   RKGAGLQPLSWRLRLKIAIGAARGLAFLHTSEKKVIYRDFKASNILLDSNYNAKLSDFGL  226

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G  SHV+TRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML+G R+LD   
Sbjct  227   AKNGPTGGESHVSTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLLEMLSGQRALDTNR  286

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             PSG+H LV W KP L    KL  +MD +++GQYSS+A  QAA+LTLRCL  +P+ RPSM
Sbjct  287   PSGKHSLVDWAKPFLLDRRKLAMLMDSQLDGQYSSKAAHQAAKLTLRCLAGEPKNRPSM  345



>ref|NP_001047694.1| Os02g0670100 [Oryza sativa Japonica Group]
 dbj|BAF09608.1| Os02g0670100 [Oryza sativa Japonica Group]
Length=458

 Score =   410 bits (1054),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 234/311 (75%), Gaps = 7/311 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D++A G IL  PNL++++ AEL  AT NFK D VLG GGFG V KGWVDE T++P+  GS
Sbjct  82    DASAEGRILEAPNLRIFTFAELRAATRNFKADTVLGEGGFGRVHKGWVDERTMSPARSGS  141

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             GM VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GSL
Sbjct  142   GMAVAVKKLDPESLQGVQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAQGSL  201

Query  858   ENHLFRKNVGR-------KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             ENHLFR    +       + LSW LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  202   ENHLFRSEPRKGGSASPQQPLSWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLD  261

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               ++AK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  262   TQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  321

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH LV W KP LS   KL  +MD R+EGQYSS    +AAQLTLRC
Sbjct  322   LLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEGQYSSRGAQRAAQLTLRC  381

Query  1377  LESQPEKRPSM  1409
             L +  + RPSM
Sbjct  382   LAADHKNRPSM  392



>gb|KHN41825.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=339

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 238/305 (78%), Gaps = 3/305 (1%)
 Frame = +3

Query  504   NANGTILP---TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             N+N  + P   T NLK ++ A+L+ AT +FK D +LG GGFG V+KGW+ E TL P++ G
Sbjct  17    NSNNMVFPSVETRNLKQFNFADLKAATKSFKSDALLGEGGFGKVYKGWLHEKTLTPTKAG  76

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             SGM+VA+KKL   SLQGF EW+SE+  LG  SHPN++KLLGYC +  + LLVYE+M  GS
Sbjct  77    SGMVVAVKKLNSESLQGFREWQSEINFLGRISHPNLVKLLGYCCDDIEFLLVYEFMPKGS  136

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFR+N   + LSWD R+ IAIG ARGLAFLH SE+Q+I RD K+SNILLDE+YNAK
Sbjct  137   LENHLFRRNTNSEPLSWDTRIKIAIGAARGLAFLHTSEKQIIYRDFKASNILLDEDYNAK  196

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGPSGE+SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR
Sbjct  197   ISDFGLAKLGPSGEDSHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLR  256

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD   P  Q  L+ W KP LS + KLKSIMD R+EGQYS++A L++A L L+CL+   +
Sbjct  257   ALDKNRPIEQQNLIEWAKPSLSDKRKLKSIMDERIEGQYSTKAALKSAHLILKCLQCDRK  316

Query  1395  KRPSM  1409
             KRP M
Sbjct  317   KRPHM  321



>ref|XP_008812270.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=424

 Score =   408 bits (1049),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL+ AT NFK + VLG GGFG V+KGWVDE TL P++ G GM+VA
Sbjct  62    GRILEAPNLRIFTFAELKNATRNFKPETVLGEGGFGRVYKGWVDEKTLNPAKSGFGMVVA  121

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  122   VKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLLGYCWEDRELLLVYEFMAKGSLENHLF  181

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             R+    + LSW LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NY  K+SDFGL
Sbjct  182   RRGAAFEPLSWSLRLKIAIGAARGLAFLHTSEKQVIYRDFKASNILLDSNYTPKLSDFGL  241

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML+G R+LD   
Sbjct  242   AKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLSGQRALDNNR  301

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+GQH LV W KP L+   KL  ++D R+EGQY S+  LQAAQLTL+CL   P+ RPSM
Sbjct  302   PTGQHNLVDWGKPYLADRRKLSRLIDPRLEGQYHSKGALQAAQLTLKCLAGDPKSRPSM  360



>ref|XP_004976505.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Setaria italica]
Length=433

 Score =   408 bits (1049),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL+V++ AEL  AT NFK D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  79    GRILEAPNLRVFTFAELRSATRNFKPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  138

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYE+M  G+LENHLF
Sbjct  139   VKKLNPESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEFMPKGNLENHLF  198

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + + W+LRL IAIG ARGLAFLH SERQ+I RD K+SNILLD NYNAK+SDFGL
Sbjct  199   RKGGAFEPIPWNLRLRIAIGAARGLAFLHSSERQIIYRDFKASNILLDTNYNAKLSDFGL  258

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDV+ FGV+LLEMLTGLR+LD   
Sbjct  259   AKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVWAFGVVLLEMLTGLRALDTGR  318

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S+A LQAAQL+LRCLE  P  RPSM
Sbjct  319   PAQQHNLVDWAKPHLADRRKLARLVDPRLEGQYPSKAALQAAQLSLRCLEGDPRSRPSM  377



>ref|XP_008781319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=424

 Score =   407 bits (1047),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 235/304 (77%), Gaps = 0/304 (0%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             +++  G IL  PNL++++ AEL+ AT NFK + VLG GGFG V+KGWVDE TL P++ G 
Sbjct  57    EASPEGRILEAPNLRIFTFAELKSATRNFKPETVLGEGGFGRVYKGWVDEKTLNPAKSGM  116

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             GM+VA+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSL
Sbjct  117   GMMVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMARGSL  176

Query  858   ENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKI  1037
             ENHLFR+    + LSW LRL IAIG ARGLAFLH SER+VI RD K+SNILLD NYN K+
Sbjct  177   ENHLFRRGAAFEPLSWSLRLKIAIGAARGLAFLHTSERKVIYRDFKASNILLDSNYNPKL  236

Query  1038  SDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRS  1217
             SDFGLAKLGP+G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML+G R+
Sbjct  237   SDFGLAKLGPTGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLSGQRA  296

Query  1218  LDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEK  1397
             LD   PS QH L+ W KP L+   KL  +MD R+EG+Y S+   +AAQLTL+CL  +P+ 
Sbjct  297   LDTNRPSEQHNLIDWGKPYLADRRKLARLMDPRLEGRYPSKGAFRAAQLTLKCLAGEPKN  356

Query  1398  RPSM  1409
             RPSM
Sbjct  357   RPSM  360



>gb|KHG23247.1| hypothetical protein F383_30094 [Gossypium arboreum]
Length=410

 Score =   407 bits (1046),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 242/311 (78%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  +++  NG ILP PNL+++S AEL+ A  NF+ DMVLG GGFG VFKGW+DE  L
Sbjct  49    FSASSGDEAFPNGQILPAPNLRIFSFAELKTAAKNFRPDMVLGEGGFGKVFKGWIDEKAL  108

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
               S  GS  +VA+KKL   SLQGFEEW+SEV  LG  SHP++++LLGYCWE  +LLLVYE
Sbjct  109   GKS--GSATLVAVKKLNSESLQGFEEWQSEVNFLGRLSHPHLVRLLGYCWEDKELLLVYE  166

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    ++L W++R+ IAIG A+GL+FLH S+++VI RD K+SNILLD
Sbjct  167   FMQKGSLENHLFGRGSSVQSLEWNIRIKIAIGAAKGLSFLHSSDKKVIYRDFKASNILLD  226

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  227   GSYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  286

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH L  W+KP LS   KLKSIMD R+EG+Y S+A ++ AQL L+C
Sbjct  287   ILTGLRALDPNRPSGQHNLSEWIKPYLSDRRKLKSIMDNRLEGKYPSKAAVRIAQLALKC  346

Query  1377  LESQPEKRPSM  1409
             LE  P+ RPSM
Sbjct  347   LEPGPKYRPSM  357



>ref|NP_001147720.1| serine/threonine-protein kinase Cx32 [Zea mays]
 gb|ACG28486.1| serine/threonine-protein kinase Cx32 [Zea mays]
 gb|AFW69825.1| putative protein kinase superfamily protein [Zea mays]
Length=438

 Score =   408 bits (1048),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 231/299 (77%), Gaps = 2/299 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL+ ++  EL+ AT NF+ D VLG GGFGTV+KGWVDE T+ P+  G+GM+VA
Sbjct  75    GQILEAPNLRTFTFMELKTATKNFRLDSVLGEGGFGTVYKGWVDEKTMTPTRNGTGMVVA  134

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  135   VKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDRELLLVYEFMAKGSLENHLF  194

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             R+  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAK+SDFGL
Sbjct  195   RR--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDANYNAKLSDFGL  252

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AKLGP+G  SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEML+G R+LD   
Sbjct  253   AKLGPTGSKSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMLSGQRALDPNR  312

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+GQ  L  W KP L+   +L  +MD R EGQY+S+   QAAQLTL CL  +P  RPSM
Sbjct  313   PNGQLSLADWAKPFLADRRRLARLMDPRFEGQYNSKQAFQAAQLTLNCLAGEPRSRPSM  371



>gb|AFW59201.1| putative protein kinase superfamily protein [Zea mays]
Length=564

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NF+ D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  101   GRILEAPNLRIFTFAELRAATRNFRPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  160

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYEYM  GSLENHLF
Sbjct  161   VKKLNQESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEYMPKGSLENHLF  220

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + +SW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAK+SDFGL
Sbjct  221   RKGGSFEPISWNLRLRIAIGAARGLAFLHSSEKQVIYRDFKASNILLDTNYNAKLSDFGL  280

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   
Sbjct  281   AKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTAR  340

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S+A LQAAQLTLRCLE  P  RPSM
Sbjct  341   PAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRCLEGDPRSRPSM  399



>dbj|BAJ91759.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=403

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 232/299 (78%), Gaps = 2/299 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL+ ++  EL+ AT NF+ D VLG GGFG V+KGWVDE T+ P++ G+GM+VA
Sbjct  41    GQILEAPNLRTFTFLELKTATKNFRPDSVLGEGGFGRVYKGWVDEKTMNPTKSGTGMVVA  100

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  101   VKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLVYEFMAKGSLENHLF  160

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD +YNAK+SDFGL
Sbjct  161   RK--GCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDASYNAKLSDFGL  218

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEML+G R+LD   
Sbjct  219   AKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMLSGKRALDPNR  278

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+GQ  L  W KP L+   KL  +MD + EGQY+S+   QAAQLTL CL  +P  RPSM
Sbjct  279   PNGQQSLADWAKPYLADRRKLARLMDPQFEGQYNSKQSYQAAQLTLNCLAGEPRSRPSM  337



>gb|KDP42038.1| hypothetical protein JCGZ_03101 [Jatropha curcas]
Length=431

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 240/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S    +++  NG ILP PNL+++S AEL+ AT NF+ D VLG GGFG VFKGW+DE + 
Sbjct  63    FSVVSGDEALPNGQILPIPNLRIFSFAELKAATRNFRPDTVLGEGGFGKVFKGWLDERST  122

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
               S  GSG ++A+KKL   S QGFEEW+SEV  LG  SHPN+++L+GYCWE  +LLLVYE
Sbjct  123   GKS--GSGNVIAVKKLNSESFQGFEEWQSEVNFLGRLSHPNLVRLIGYCWEDKELLLVYE  180

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L W++RL IAIG ARGL+FLH S++QVI RD K+SNILLD
Sbjct  181   FMQKGSLENHLFGRGSTVQPLPWEIRLKIAIGAARGLSFLHTSDKQVIYRDFKASNILLD  240

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  241   GSYTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  300

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV W+KP L  + KLK+IMD R+EG+Y S+A  + AQL + C
Sbjct  301   ILTGLRALDTNRPSGRHNLVDWIKPFLYDKRKLKNIMDSRLEGKYPSKAAFRIAQLAINC  360

Query  1377  LESQPEKRPSM  1409
             +ES+P+ RPSM
Sbjct  361   IESEPKNRPSM  371



>ref|XP_010064951.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=396

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 234/294 (80%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TP+L++Y+LAEL+ AT NFK D +LG GGFG VFKGWVDE TLAPS+ G+G+ VA+KK  
Sbjct  38    TPSLRMYTLAELKSATRNFKPDTMLGEGGFGRVFKGWVDERTLAPSKVGNGIPVAVKKSN  97

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG  EW+SEVK LG FSHPN+++LLGYCWE N+ LLVYEYMQ GSLENHLFR+  G
Sbjct  98    PDSDQGLREWQSEVKFLGKFSHPNLVRLLGYCWEDNQYLLVYEYMQRGSLENHLFRR--G  155

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              + L WD+RL IAIG ARG+ FLH SE+ VI RD KSSNILLD ++NAK+SDFGLAKLGP
Sbjct  156   AEPLPWDVRLKIAIGAARGVDFLHTSEKNVIYRDFKSSNILLDADFNAKLSDFGLAKLGP  215

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
             +G NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++LD   PSGQ 
Sbjct  216   AGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLQALDNTRPSGQQ  275

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W +P L  + KL+ IMD R+EG+Y  +A  QAA+L L+CLE  P+ RPSM
Sbjct  276   NLVEWARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCLEGDPKARPSM  329



>emb|CAH66747.1| H0409D10.5 [Oryza sativa Indica Group]
 gb|EAY95176.1| hypothetical protein OsI_16994 [Oryza sativa Indica Group]
Length=476

 Score =   408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 230/299 (77%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NFK D VLG GGFG V+KGWVDE T++P+  G+GM++A
Sbjct  113   GRILEVPNLRIFTFAELRAATRNFKPDSVLGEGGFGRVYKGWVDERTMSPARSGTGMVIA  172

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG +EW+SE+  LG  SHPN+++L+GYC E  +LLLVYE+M  GSLENHLF
Sbjct  173   VKKLNPESVQGLQEWQSEINFLGRLSHPNLVRLIGYCVEDRELLLVYEFMAKGSLENHLF  232

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + +SW+LRL IAIG ARGLAFLH SERQ+I RD K+SNILLD +YNAK+SDFGL
Sbjct  233   RKGSAYQPISWNLRLRIAIGAARGLAFLHSSERQIIYRDFKASNILLDTHYNAKLSDFGL  292

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R+LD   
Sbjct  293   AKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRALDTGR  352

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S A  QAAQLTLRCL   P  RPSM
Sbjct  353   PAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCLSGDPRSRPSM  411



>ref|XP_009392862.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=421

 Score =   405 bits (1042),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/361 (56%), Positives = 257/361 (71%), Gaps = 10/361 (3%)
 Frame = +3

Query  342   LPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANG--  515
              P+ ++ +   +  S  G +R  +++     +AN + L T +   +  + S  ++A+G  
Sbjct  7     FPARSQSTPPDTRPSSPGHWRSKASS-----SANTEKLSTFDSSHFGRSNSSFASADGEL  61

Query  516   ---TILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
                 IL  PNL+V++ AEL+ AT NFK D VLG GGFG V+KGWVDE TL P++ G GM+
Sbjct  62    REGRILEVPNLRVFTFAELKTATGNFKHDKVLGEGGFGIVYKGWVDEKTLNPAKSGLGMV  121

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KKL   S+QG E+W+SEV  LG  SHPN++KLLGYCWE  +LLLVYEYM  GSLENH
Sbjct  122   VAVKKLNHESVQGLEQWQSEVDFLGRLSHPNLVKLLGYCWEDVELLLVYEYMAKGSLENH  181

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFR+    + LSW LRL IAI  A GLAFLH SE++VI RD K+SNILLD NYNAK+SDF
Sbjct  182   LFRRGATFEPLSWSLRLKIAIDAAHGLAFLHASEKKVIYRDFKASNILLDSNYNAKLSDF  241

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK GP+  +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML G R+LD 
Sbjct  242   GLAKHGPTDGDSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLLEMLAGQRALDS  301

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               PS QH LV + KP+L+   KL  +MD R+EG+Y ++  LQAAQLTL+CL + P  RPS
Sbjct  302   NRPSNQHNLVAYAKPLLADRRKLGRLMDPRLEGRYPAKGALQAAQLTLKCLANDPRSRPS  361

Query  1407  M  1409
             M
Sbjct  362   M  362



>ref|XP_010530999.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=430

 Score =   405 bits (1041),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 235/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SS     ++ +G IL TPNL++YS ++L  AT NF  +MVLG GGFG V+KGWVDE TL+
Sbjct  57    SSVSGVGTSDSGQILETPNLRIYSFSDLRTATRNFGPEMVLGQGGFGKVYKGWVDEITLS  116

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ GSGM VA+K+L   SLQG  EW SE+  LG  SHPN++KLLGYCWE  +LLLVYE 
Sbjct  117   PSKVGSGMAVAVKRLNSQSLQGLAEWRSEINFLGKLSHPNLVKLLGYCWEDKELLLVYEL  176

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSL+NHLFR+N G + LSWD RL IA+G ARGLAFLH S RQVI RD K+SNILLD 
Sbjct  177   MPKGSLDNHLFRRNAGVEPLSWDTRLKIAVGAARGLAFLHGSNRQVIYRDFKASNILLDS  236

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAK GPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FG +LLEM
Sbjct  237   DYNAKISDFGLAKRGPSPEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGAVLLEM  296

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             +TGLR+ D +   G+  LV W++P LS   KL  +MD R++GQYSS++  + A++TL CL
Sbjct  297   MTGLRAHDTRRGDGKQSLVEWLRPSLSSRSKLLRVMDTRIKGQYSSDSATELARITLSCL  356

Query  1380  ESQPEKRPSM  1409
             E  P+KRP M
Sbjct  357   ELDPKKRPHM  366



>ref|XP_010530998.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=431

 Score =   405 bits (1041),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 235/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SS     ++ +G IL TPNL++YS ++L  AT NF  +MVLG GGFG V+KGWVDE TL+
Sbjct  58    SSVSGVGTSDSGQILETPNLRIYSFSDLRTATRNFGPEMVLGQGGFGKVYKGWVDEITLS  117

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ GSGM VA+K+L   SLQG  EW SE+  LG  SHPN++KLLGYCWE  +LLLVYE 
Sbjct  118   PSKVGSGMAVAVKRLNSQSLQGLAEWRSEINFLGKLSHPNLVKLLGYCWEDKELLLVYEL  177

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSL+NHLFR+N G + LSWD RL IA+G ARGLAFLH S RQVI RD K+SNILLD 
Sbjct  178   MPKGSLDNHLFRRNAGVEPLSWDTRLKIAVGAARGLAFLHGSNRQVIYRDFKASNILLDS  237

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAK GPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FG +LLEM
Sbjct  238   DYNAKISDFGLAKRGPSPEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGAVLLEM  297

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             +TGLR+ D +   G+  LV W++P LS   KL  +MD R++GQYSS++  + A++TL CL
Sbjct  298   MTGLRAHDTRRGDGKQSLVEWLRPSLSSRSKLLRVMDTRIKGQYSSDSATELARITLSCL  357

Query  1380  ESQPEKRPSM  1409
             E  P+KRP M
Sbjct  358   ELDPKKRPHM  367



>ref|XP_004512261.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cicer arietinum]
Length=406

 Score =   404 bits (1038),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 237/301 (79%), Gaps = 1/301 (0%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G  + TPNLKV+S  +L+ AT +FK D +LG GGFG V+KGW++  TLAP + GSGM+V
Sbjct  62    SGKFMQTPNLKVFSYGDLKAATKSFKSDALLGEGGFGKVYKGWLNAETLAPVKAGSGMMV  121

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL   S+QG EEW+SE+  LG  SHPN++KLLGYC + NK LLVYE+M  G+LE HL
Sbjct  122   AIKKLKPDSVQGVEEWQSEINFLGRISHPNLVKLLGYCKDNNKFLLVYEFMPRGNLETHL  181

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N   + LSW+ RL IAI  ARGLAFLH SE+QVI RD K+SNILLD NYNAKISDFG
Sbjct  182   FRRNTDIEPLSWNTRLKIAIDAARGLAFLHSSEKQVIYRDFKASNILLDGNYNAKISDFG  241

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPS  +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL +LD K
Sbjct  242   LAKLGPSEGDSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLHALDTK  301

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKS-IMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
              P+GQ  LV W+KP LS + KLKS I+D R+EGQYS +A  + A+L L+CLES P+KRPS
Sbjct  302   RPTGQQNLVEWIKPSLSDKRKLKSNIVDYRLEGQYSPKAAFETAKLILKCLESDPKKRPS  361

Query  1407  M  1409
             M
Sbjct  362   M  362



>ref|XP_009337112.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=412

 Score =   404 bits (1039),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/330 (60%), Positives = 246/330 (75%), Gaps = 6/330 (2%)
 Frame = +3

Query  423   SEGGNAN-AKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMV  599
             S GG +  ++   +P +E     E      NG IL +PNL+V++  EL+ AT NFK D V
Sbjct  37    SSGGRSQFSEATSSPRIE-----ELHSQQPNGQILESPNLRVFTFTELKAATKNFKSDQV  91

Query  600   LGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPN  779
             LG GGFG VFKGWVD  TL PS+ G+GM+VAIKKL   S+QG++EW+SEV  LG  SHPN
Sbjct  92    LGEGGFGRVFKGWVDGETLQPSKYGTGMLVAIKKLNPESVQGYQEWQSEVNFLGRLSHPN  151

Query  780   VIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLH  959
             ++KLLGYC E  +LLLVYE+MQ GSLENHLFR++ G   LSW  RL IAIG ARGLAFLH
Sbjct  152   LVKLLGYCLEDEELLLVYEFMQKGSLENHLFRRSAGSDLLSWGTRLKIAIGAARGLAFLH  211

Query  960   CSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLE  1139
              SE+Q+I RD KSSNILLD ++N+KISDFGLAKLGP+G  SHV+TR++GT GY APEY+ 
Sbjct  212   SSEKQIIYRDFKSSNILLDGSFNSKISDFGLAKLGPAGGESHVSTRIMGTYGYAAPEYIA  271

Query  1140  TGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRM  1319
             TG+LYV SDVY FGV+LLE+LTG R+LD + P  +  LV W KP+L  + +LK+I+DVRM
Sbjct  272   TGHLYVNSDVYGFGVVLLEILTGHRALDRQRPREEQQLVEWAKPLLLHKRRLKNILDVRM  331

Query  1320  EGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             EGQY+ +A +QAA +  +CLE  P  RPSM
Sbjct  332   EGQYAFKAVMQAALIAHKCLEPDPRSRPSM  361



>ref|XP_009392863.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   404 bits (1038),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/330 (60%), Positives = 244/330 (74%), Gaps = 5/330 (2%)
 Frame = +3

Query  435   NANAKCLPTPNLEIYSSAESEDSNANG-----TILPTPNLKVYSLAELEVATSNFKRDMV  599
             +AN + L T +   +  + S  ++A+G      IL  PNL+V++ AEL+ AT NFK D V
Sbjct  19    SANTEKLSTFDSSHFGRSNSSFASADGELREGRILEVPNLRVFTFAELKTATGNFKHDKV  78

Query  600   LGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPN  779
             LG GGFG V+KGWVDE TL P++ G GM+VA+KKL   S+QG E+W+SEV  LG  SHPN
Sbjct  79    LGEGGFGIVYKGWVDEKTLNPAKSGLGMVVAVKKLNHESVQGLEQWQSEVDFLGRLSHPN  138

Query  780   VIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLH  959
             ++KLLGYCWE  +LLLVYEYM  GSLENHLFR+    + LSW LRL IAI  A GLAFLH
Sbjct  139   LVKLLGYCWEDVELLLVYEYMAKGSLENHLFRRGATFEPLSWSLRLKIAIDAAHGLAFLH  198

Query  960   CSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLE  1139
              SE++VI RD K+SNILLD NYNAK+SDFGLAK GP+  +SHVTTRV+GT GY APEY+ 
Sbjct  199   ASEKKVIYRDFKASNILLDSNYNAKLSDFGLAKHGPTDGDSHVTTRVMGTFGYAAPEYVA  258

Query  1140  TGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRM  1319
             TG+LYVKSDVY FGV+LLEML G R+LD   PS QH LV + KP+L+   KL  +MD R+
Sbjct  259   TGHLYVKSDVYGFGVVLLEMLAGQRALDSNRPSNQHNLVAYAKPLLADRRKLGRLMDPRL  318

Query  1320  EGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             EG+Y ++  LQAAQLTL+CL + P  RPSM
Sbjct  319   EGRYPAKGALQAAQLTLKCLANDPRSRPSM  348



>ref|XP_007018056.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY15281.1| Kinase superfamily protein [Theobroma cacao]
Length=433

 Score =   405 bits (1041),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 237/309 (77%), Gaps = 2/309 (1%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             S E E   A+G I+ T  LK+++LAEL+ AT NF+ D VLG GGFG VFKGWVDE T AP
Sbjct  56    SKEQETMPASGKIVST-TLKIFTLAELKAATRNFRPDTVLGEGGFGRVFKGWVDEKTYAP  114

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+ G GM VA+KK    S QG +EW++EVK LG F HPN++KLLGYCWE N+ LLVYEYM
Sbjct  115   SKVGVGMAVAVKKSNPDSSQGLQEWQAEVKFLGKFCHPNLVKLLGYCWEENQFLLVYEYM  174

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
             Q GSLENHLFR   G + L+W+ RL IAIG A+GLAFLH SE+ VI RD K+SNILLD  
Sbjct  175   QKGSLENHLFRMG-GAEPLTWETRLKIAIGAAQGLAFLHTSEKSVIYRDFKASNILLDGA  233

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YNAK+SDFGLAKLGP   NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML
Sbjct  234   YNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TGLR+LD   PSG+H LV W K  L+Q+ KLK IMD R+E +Y  +A LQA +L LRCLE
Sbjct  294   TGLRALDTNRPSGEHNLVEWAKYSLTQKKKLKKIMDPRLEERYPLKAALQAGELILRCLE  353

Query  1383  SQPEKRPSM  1409
             S P+ RPSM
Sbjct  354   SDPKNRPSM  362



>ref|XP_006656517.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Oryza brachyantha]
Length=413

 Score =   404 bits (1038),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 238/310 (77%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S   ++D+  +G IL +PNL++++ AEL+ AT NF+ D VLG GGFG V+KGWVDE T+ 
Sbjct  58    SGVSTDDAYPDGQILESPNLRIFTFAELKNATKNFRTDTVLGEGGFGKVYKGWVDEKTMN  117

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+  +G++VA+KKL   S+QG E+WESEV  LG  SHPN++KLLGYC + ++LLLVYE+
Sbjct  118   PSKSSTGIVVAVKKLNPESVQGTEQWESEVNFLGRISHPNLVKLLGYCKDNDELLLVYEF  177

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + L W LRL I IG ARGLAFLH SERQ+I RD K+SNILLD 
Sbjct  178   MAKGSLENHLFRRGAVYEPLPWSLRLKILIGAARGLAFLHSSERQIIYRDFKASNILLDS  237

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             N+NAK+SDFGLAK GP G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  238   NFNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  297

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+GLR+LD   PSG+  LV W KP+L+   KL  +MD R+EGQY S   LQAAQLTL+CL
Sbjct  298   LSGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHSRGALQAAQLTLKCL  357

Query  1380  ESQPEKRPSM  1409
               +P+ RPSM
Sbjct  358   SGEPKNRPSM  367



>emb|CDP14494.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 239/306 (78%), Gaps = 2/306 (1%)
 Frame = +3

Query  492   SEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEP  671
             SE++  NG ILP PNL+++S +EL+ AT NF+ D VLG GGFG V+KGW+DE + + +  
Sbjct  56    SEEAYPNGQILPHPNLRIFSFSELKAATRNFRGDTVLGEGGFGKVYKGWLDEKSTSKNS-  114

Query  672   GSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNG  851
              S  ++A+KKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ G
Sbjct  115   -SSTVIAVKKLNSESMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEEKELLLVYEFMQKG  173

Query  852   SLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNA  1031
             SLENHLF +    ++L WD+RL I+IG ARGLAFLH S+RQVI RD K+SNILLD +YNA
Sbjct  174   SLENHLFGRGSAVQSLPWDIRLKISIGAARGLAFLHASDRQVIYRDFKASNILLDGSYNA  233

Query  1032  KISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGL  1211
             KISDFGLAK+GP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EMLTGL
Sbjct  234   KISDFGLAKMGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGL  293

Query  1212  RSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQP  1391
             R+LD   P+GQH L  W+KP LS   KLK +MDVR+EG+Y S+A +Q AQL L CL  +P
Sbjct  294   RALDTNRPNGQHNLTDWIKPHLSDRRKLKIMMDVRLEGKYPSKAAVQIAQLALTCLGPEP  353

Query  1392  EKRPSM  1409
             + RPSM
Sbjct  354   KTRPSM  359



>gb|AAM61685.1| putative protein kinase [Arabidopsis thaliana]
Length=414

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 239/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  ED+  +G ILP PNL+++SLAEL  +T NF+ + VLG GGFG VFKGW+++ T 
Sbjct  52    FSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKT-  110

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  111   -PGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  170   YMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  230   GSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS++ KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  290   ILTGLHALDPTRPTGQHNLTEWIKPHLSEKRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  349

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  350   LGPEPKNRPSM  360



>ref|XP_008813320.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Phoenix 
dactylifera]
Length=392

 Score =   402 bits (1034),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 235/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SS   ++ +  G IL  PNL++++ AEL+ AT NFK D +LG GGFG V+KGW ++ TL 
Sbjct  54    SSVSIDEVHQEGRILEVPNLRIFTFAELKSATRNFKPDTILGEGGFGRVYKGWANDKTLN  113

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S+  + M+VA+KKL   S+QG E+W+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  114   RSKSVAAMVVAVKKLNPESMQGLEQWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEF  173

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLE+HLFR+    + LSW LRL IAIG ARGLAFLH SE ++I RD KSSNILLD 
Sbjct  174   MAKGSLEHHLFRRAAACQPLSWSLRLKIAIGAARGLAFLHASETKIIYRDFKSSNILLDS  233

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             NYNAK+SDFGLAK GPS  +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  234   NYNAKLSDFGLAKNGPSDGDSHVTTRVMGTRGYAAPEYIATGHLYVKSDVYGFGVVLLEM  293

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+G R+LD   PSG+  LV W KP L+   KL S+MD R+EG+Y S+  LQAAQLTLRCL
Sbjct  294   LSGQRALDPNRPSGKQNLVDWAKPFLADRRKLASLMDPRLEGRYRSKGALQAAQLTLRCL  353

Query  1380  ESQPEKRPSM  1409
                P++RPSM
Sbjct  354   AGDPKRRPSM  363



>ref|NP_565408.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
 gb|AAK43904.1|AF370585_1 putative protein kinase [Arabidopsis thaliana]
 gb|AAK83605.1| At2g17220/T23A1.8 [Arabidopsis thaliana]
 gb|AAD25140.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAN31120.1| At2g17220/T23A1.8 [Arabidopsis thaliana]
 gb|AEC06599.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
Length=414

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 238/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  ED+  +G ILP PNL+++SLAEL  +T NF+ + VLG GGFG VFKGW+++ T 
Sbjct  52    FSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKT-  110

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  111   -PGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  170   YMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  230   GSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  290   ILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  349

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  350   LGPEPKNRPSM  360



>gb|EAZ24138.1| hypothetical protein OsJ_07878 [Oryza sativa Japonica Group]
Length=460

 Score =   405 bits (1040),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 232/311 (75%), Gaps = 7/311 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D++A G IL  PNL++++ AEL  AT NFK D VLG GGFG V KGWVDE T++P+  GS
Sbjct  82    DASAEGRILEAPNLRIFTFAELRAATRNFKADTVLGEGGFGRVHKGWVDERTMSPARSGS  141

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             GM VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GSL
Sbjct  142   GMAVAVKKLDPESLQGVQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAQGSL  201

Query  858   ENHLFRKNVGR-------KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             ENHLFR    +       + LSW LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  202   ENHLFRSEPRKGGSASPQQPLSWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLD  261

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               ++AK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  262   TQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  321

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   P  QH LV W KP LS   KL  +MD R+EGQYSS    +AAQLTLRC
Sbjct  322   LLTGLRALDAGRPQRQHHLVDWAKPFLSDRRKLARLMDPRLEGQYSSRGAQRAAQLTLRC  381

Query  1377  LESQPEKRPSM  1409
             L +  + RPSM
Sbjct  382   LAADHKNRPSM  392



>ref|XP_008448468.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Cucumis melo]
Length=407

 Score =   402 bits (1034),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 242/309 (78%), Gaps = 0/309 (0%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             S +  +S  +G IL  PNLK +S  EL++ T NF+ + ++G GGFG V+KGWVD+ TLAP
Sbjct  53    SVDVSESYPSGKILDQPNLKEFSFTELKLITKNFRPESLIGQGGFGKVYKGWVDDKTLAP  112

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+  SGM+VAIKKL   S+QGF+EW++EV  LG  SHPN++KLLG+CWE  +LLLVYE+M
Sbjct  113   SKSNSGMVVAIKKLNAESVQGFQEWQAEVNFLGRLSHPNLVKLLGFCWEDEELLLVYEFM  172

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
               GSLENHLF +    + LSW+ RL IAIG ARGLAFLH SE++VI RD K+SNILLD N
Sbjct  173   PRGSLENHLFGRRSSIEPLSWERRLKIAIGAARGLAFLHSSEKEVIYRDFKASNILLDLN  232

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YN+KISDFGLA+LGP+GE+SHVTTR++GT GY+APEY+ TG+LYVKSDVY FGV+LLE++
Sbjct  233   YNSKISDFGLARLGPAGEDSHVTTRIMGTYGYVAPEYVSTGHLYVKSDVYGFGVVLLEIM  292

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TGLR+ D    + Q  LV W KP L ++ ++K++MD ++EGQYSS+A ++   LTL+CLE
Sbjct  293   TGLRAHDMNRTTEQRNLVDWAKPFLVKKKRIKNLMDAKIEGQYSSKAAMRVGDLTLKCLE  352

Query  1383  SQPEKRPSM  1409
             + P KRPSM
Sbjct  353   TDPRKRPSM  361



>ref|NP_001045693.1| Os02g0118200 [Oryza sativa Japonica Group]
 dbj|BAD07615.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF07607.1| Os02g0118200 [Oryza sativa Japonica Group]
 gb|EAY84215.1| hypothetical protein OsI_05597 [Oryza sativa Indica Group]
 gb|EAZ21510.1| hypothetical protein OsJ_05134 [Oryza sativa Japonica Group]
Length=427

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 232/299 (78%), Gaps = 2/299 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL+ ++  EL  AT NF+ D VLG GGFG V+KGWVDE T+ P + G+GM+VA
Sbjct  71    GQILEAPNLRTFTFIELRTATKNFRPDSVLGEGGFGRVYKGWVDEKTMNPVKGGTGMVVA  130

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYC+E  +LLLVYE+M  GSLENHLF
Sbjct  131   VKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCFEDKELLLVYEFMAKGSLENHLF  190

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             +K  G   LSW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAK+SDFGL
Sbjct  191   KK--GCPPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDANYNAKLSDFGL  248

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AKLGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEM++G R+LD   
Sbjct  249   AKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMMSGQRALDPNR  308

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+GQ  LV W KP L+   KL  +MD R EGQY+S+  +QAAQLTL CL  +P  RPSM
Sbjct  309   PNGQLSLVDWAKPYLADRRKLARLMDPRFEGQYNSKQAVQAAQLTLNCLAGEPRSRPSM  367



>ref|NP_973478.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
 gb|AEC06600.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
Length=413

 Score =   402 bits (1034),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 238/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  ED+  +G ILP PNL+++SLAEL  +T NF+ + VLG GGFG VFKGW+++ T 
Sbjct  51    FSVASGEDAYPDGQILPIPNLRIFSLAELRASTRNFRSENVLGEGGFGKVFKGWLEDKT-  109

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  110   -PGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  168

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  169   YMQKGSLENHLFRKGSAVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  228

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  229   GSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAE  288

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  289   ILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  348

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  349   LGPEPKNRPSM  359



>ref|XP_011088714.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Sesamum indicum]
 ref|XP_011088715.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X3 [Sesamum indicum]
Length=437

 Score =   403 bits (1036),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G +LP PNL+++S +EL+ AT NF+ D VLG GGFG V+KGW+D+ + A +      ++A
Sbjct  77    GHMLPHPNLRIFSFSELKAATRNFRSDTVLGEGGFGKVYKGWLDDKSSARAAGNGSSVIA  136

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ GSLENHLF
Sbjct  137   VKKLNSESMQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMQKGSLENHLF  196

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
              +    + L WD+RL I IG ARGLAFLH S+R+VI RD K+SNILLD +Y+AKISDFGL
Sbjct  197   GRGSAAQPLPWDIRLKILIGAARGLAFLHASDRKVIYRDFKASNILLDGSYHAKISDFGL  256

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK+GP+   SHVTT+V+GT GY APEY+ TG+LYVKSDVY FGV+L+EMLTGLR+LD   
Sbjct  257   AKMGPTASRSHVTTQVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLRALDTNR  316

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             PSGQH LV W+KP LS   KLK+IMD+R+EG+Y S++ LQ AQL L CLE++P+ RPSM
Sbjct  317   PSGQHNLVDWIKPHLSDRRKLKNIMDLRLEGRYPSKSALQIAQLALNCLENEPKNRPSM  375



>ref|XP_009788445.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=416

 Score =   402 bits (1034),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S   ++   NG ILP  +L+++S  EL+ AT NF+ D VLG GGFG V+KGW+DE   A
Sbjct  49    ASGSVDEVYPNGQILPHSSLRMFSFTELKAATRNFRNDTVLGEGGFGKVYKGWLDERASA  108

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S  GSG ++A+KKL   SLQG EEW+SEV  LG FSHPN++KLLGYCWE  +LLLVYE+
Sbjct  109   KS--GSGTVIAVKKLNSESLQGLEEWQSEVNFLGRFSHPNLVKLLGYCWEDKELLLVYEF  166

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLF +    + L W++RL I IG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  167   MQKGSLENHLFGRGSAAQPLPWNVRLKIVIGAARGLAFLHASEKQVIYRDFKASNILLDG  226

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EM
Sbjct  227   SYNAKISDFGLAKLGPSASQSHVTTRVVGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEM  286

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD   PS QH LV W+KP LS   KLK  MD R+EG+Y S A +Q AQL L CL
Sbjct  287   LTGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCL  346

Query  1380  ESQPEKRPSM  1409
               +P+ RPSM
Sbjct  347   GPEPKTRPSM  356



>ref|XP_011088711.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Sesamum indicum]
 ref|XP_011088712.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Sesamum indicum]
Length=438

 Score =   403 bits (1036),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G +LP PNL+++S +EL+ AT NF+ D VLG GGFG V+KGW+D+ + A +      ++A
Sbjct  78    GHMLPHPNLRIFSFSELKAATRNFRSDTVLGEGGFGKVYKGWLDDKSSARAAGNGSSVIA  137

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ GSLENHLF
Sbjct  138   VKKLNSESMQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMQKGSLENHLF  197

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
              +    + L WD+RL I IG ARGLAFLH S+R+VI RD K+SNILLD +Y+AKISDFGL
Sbjct  198   GRGSAAQPLPWDIRLKILIGAARGLAFLHASDRKVIYRDFKASNILLDGSYHAKISDFGL  257

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK+GP+   SHVTT+V+GT GY APEY+ TG+LYVKSDVY FGV+L+EMLTGLR+LD   
Sbjct  258   AKMGPTASRSHVTTQVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLRALDTNR  317

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             PSGQH LV W+KP LS   KLK+IMD+R+EG+Y S++ LQ AQL L CLE++P+ RPSM
Sbjct  318   PSGQHNLVDWIKPHLSDRRKLKNIMDLRLEGRYPSKSALQIAQLALNCLENEPKNRPSM  376



>ref|XP_008448469.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Cucumis melo]
Length=404

 Score =   402 bits (1032),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 242/309 (78%), Gaps = 0/309 (0%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             S +  +S  +G IL  PNLK +S  EL++ T NF+ + ++G GGFG V+KGWVD+ TLAP
Sbjct  50    SVDVSESYPSGKILDQPNLKEFSFTELKLITKNFRPESLIGQGGFGKVYKGWVDDKTLAP  109

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+  SGM+VAIKKL   S+QGF+EW++EV  LG  SHPN++KLLG+CWE  +LLLVYE+M
Sbjct  110   SKSNSGMVVAIKKLNAESVQGFQEWQAEVNFLGRLSHPNLVKLLGFCWEDEELLLVYEFM  169

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
               GSLENHLF +    + LSW+ RL IAIG ARGLAFLH SE++VI RD K+SNILLD N
Sbjct  170   PRGSLENHLFGRRSSIEPLSWERRLKIAIGAARGLAFLHSSEKEVIYRDFKASNILLDLN  229

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YN+KISDFGLA+LGP+GE+SHVTTR++GT GY+APEY+ TG+LYVKSDVY FGV+LLE++
Sbjct  230   YNSKISDFGLARLGPAGEDSHVTTRIMGTYGYVAPEYVSTGHLYVKSDVYGFGVVLLEIM  289

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TGLR+ D    + Q  LV W KP L ++ ++K++MD ++EGQYSS+A ++   LTL+CLE
Sbjct  290   TGLRAHDMNRTTEQRNLVDWAKPFLVKKKRIKNLMDAKIEGQYSSKAAMRVGDLTLKCLE  349

Query  1383  SQPEKRPSM  1409
             + P KRPSM
Sbjct  350   TDPRKRPSM  358



>ref|XP_008364420.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=374

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 241/314 (77%), Gaps = 2/314 (1%)
 Frame = +3

Query  468   LEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDE  647
             ++ +S+A  ++++A+G ILPTPNL+++S  EL+VAT NF+ D VLG GGFG VFKGW+++
Sbjct  1     MDSFSAASGDEASAHGQILPTPNLRIFSFLELKVATRNFRPDTVLGEGGFGMVFKGWLED  60

Query  648   NTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLL  827
                AP++ G   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KL GYCWE  +LLL
Sbjct  61    K--APAKSGKSTVIAVKKLSSESLQGFEEWQSEVNFLGRLSHPNLVKLFGYCWEDKELLL  118

Query  828   VYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNI  1007
             VYE+M  GSLENHLF +    + L WD R+ +AIG ARGL FLH SE+QVI RD K+SNI
Sbjct  119   VYEFMSKGSLENHLFGRGSAVQPLPWDXRIKVAIGAARGLEFLHTSEKQVIYRDFKASNI  178

Query  1008  LLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVL  1187
             LLD +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+
Sbjct  179   LLDGSYTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVV  238

Query  1188  LLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLT  1367
             L+E+LTGLR+LD   PSG+  LV W+KP LS + KLK IMD +++G+Y S+A  + + L 
Sbjct  239   LIEILTGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKGIMDPQLQGRYPSKAAFRISLLA  298

Query  1368  LRCLESQPEKRPSM  1409
             L+C+ES+   RPSM
Sbjct  299   LKCIESEHRNRPSM  312



>ref|XP_009788446.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=415

 Score =   402 bits (1033),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S   ++   NG ILP  +L+++S  EL+ AT NF+ D VLG GGFG V+KGW+DE   A
Sbjct  48    ASGSVDEVYPNGQILPHSSLRMFSFTELKAATRNFRNDTVLGEGGFGKVYKGWLDERASA  107

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S  GSG ++A+KKL   SLQG EEW+SEV  LG FSHPN++KLLGYCWE  +LLLVYE+
Sbjct  108   KS--GSGTVIAVKKLNSESLQGLEEWQSEVNFLGRFSHPNLVKLLGYCWEDKELLLVYEF  165

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLF +    + L W++RL I IG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  166   MQKGSLENHLFGRGSAAQPLPWNVRLKIVIGAARGLAFLHASEKQVIYRDFKASNILLDG  225

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EM
Sbjct  226   SYNAKISDFGLAKLGPSASQSHVTTRVVGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEM  285

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD   PS QH LV W+KP LS   KLK  MD R+EG+Y S A +Q AQL L CL
Sbjct  286   LTGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCL  345

Query  1380  ESQPEKRPSM  1409
               +P+ RPSM
Sbjct  346   GPEPKTRPSM  355



>ref|XP_006646791.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Oryza brachyantha]
Length=428

 Score =   402 bits (1034),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 231/299 (77%), Gaps = 3/299 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNLK ++  EL  AT NF+ D VLG GGFG V+KGWVDE  + P + G+GM+VA
Sbjct  73    GQILEAPNLKTFTFIELRTATKNFRPDSVLGEGGFGRVYKGWVDEK-MNPVKSGTGMVVA  131

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG+EEW+SE+  LG  SHPN++KLLGYCWE  +LLLVYE+M  GSLENHLF
Sbjct  132   VKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDRELLLVYEFMAKGSLENHLF  191

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             +K  G   L+W+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD NYNAK+SDFGL
Sbjct  192   KK--GCPPLTWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDANYNAKLSDFGL  249

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             A+LGP+G NSH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV++LEML+G R+LD   
Sbjct  250   ARLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMLSGQRALDPNR  309

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+GQ  LV W KP L+   KL  +MD R EGQY+S+  LQAAQLTL CL  +P  RPSM
Sbjct  310   PNGQLSLVDWAKPYLADRRKLARLMDARFEGQYNSKQALQAAQLTLNCLAGEPRSRPSM  368



>ref|XP_006342141.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=417

 Score =   402 bits (1033),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/322 (61%), Positives = 244/322 (76%), Gaps = 7/322 (2%)
 Frame = +3

Query  459   TPNLEIYSSAESEDSN-----ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGT  623
             T N+   SS +  DS      A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGT
Sbjct  39    TRNVVAKSSGDGGDSRKVEVPASGKII-TPNLKMFTLAELKSATRNFRPDTVLGEGGFGT  97

Query  624   VFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYC  803
             VFKGWVD+ T APS+ G GM VA+KK    S QG +EW++EVK LG FSHPN++KL+GYC
Sbjct  98    VFKGWVDDKTFAPSKVGVGMPVAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYC  157

Query  804   WEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVIC  983
             WE    LLVYE+MQ GSLE+HLFRK  G +ALSWD RL IAIG ARGL FLH +E+QVI 
Sbjct  158   WEEKTFLLVYEHMQKGSLESHLFRKE-GAEALSWDTRLKIAIGAARGLEFLHTTEKQVIY  216

Query  984   RDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKS  1163
             RD K++NILLD +YNAK+SDFGLAK+GP   +SHVTT+++GT GY APEY+ TG+LYVKS
Sbjct  217   RDFKAANILLDTDYNAKLSDFGLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHLYVKS  276

Query  1164  DVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEA  1343
             DVY FGV+LLE+L+G R LD   P+G+H LV W KPML  + KL+ +MD R+E QY S+A
Sbjct  277   DVYGFGVVLLEILSGRRVLDLNRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKA  336

Query  1344  ELQAAQLTLRCLESQPEKRPSM  1409
               Q A++ L+CLE  P+ RPSM
Sbjct  337   AFQIAEIILKCLEPDPKNRPSM  358



>ref|XP_006409336.1| hypothetical protein EUTSA_v10022708mg [Eutrema salsugineum]
 gb|ESQ50789.1| hypothetical protein EUTSA_v10022708mg [Eutrema salsugineum]
Length=408

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 237/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+   ED+   G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++E   
Sbjct  46    FSAGSGEDAYPEGQILPIPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLEEK--  103

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P    +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E + LLLVYE
Sbjct  104   GPGNHVTGTVIAVKKLNSESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGDDLLLVYE  163

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  164   YMQKGSLENHLFRKGSVVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  223

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAK+SDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSD + FGV+L E
Sbjct  224   GSYNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNFGFGVVLAE  283

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   P+GQH L  WVKP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  284   ILTGLRALDPTRPTGQHNLTEWVKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  343

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  344   LEPEPKNRPSM  354



>emb|CAE03087.2| OSJNBa0017B10.2 [Oryza sativa Japonica Group]
Length=475

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/299 (63%), Positives = 229/299 (77%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NFK D VLG GGFG V+KGWVDE T++P+  G+GM++A
Sbjct  112   GRILEVPNLRIFTFAELRAATRNFKPDSVLGEGGFGRVYKGWVDERTMSPARSGTGMVIA  171

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG +EW+SE+  LG  SHPN+++L+GYC E  +LLLVYE+M  GSLENHLF
Sbjct  172   VKKLNPESVQGLQEWQSEINFLGRLSHPNLVRLIGYCVEDRELLLVYEFMAKGSLENHLF  231

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + +SW+L L IAIG ARGLAFLH SERQ+I RD K+SNILLD +YNAK+SDFGL
Sbjct  232   RKGSAYQPISWNLCLRIAIGAARGLAFLHSSERQIIYRDFKASNILLDTHYNAKLSDFGL  291

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R+LD   
Sbjct  292   AKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRALDTGR  351

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S A  QAAQLTLRCL   P  RPSM
Sbjct  352   PAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCLSGDPRSRPSM  410



>ref|XP_009373402.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
 ref|XP_009373403.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=429

 Score =   401 bits (1031),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 241/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++++A+G ILPTPNL+++S  EL+VAT NF+ D VLG GGFG VFKGW+++   
Sbjct  59    FSAASGDEASAHGQILPTPNLRIFSYLELKVATRNFRPDTVLGEGGFGMVFKGWLEDK--  116

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP++ G   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KL GYCWE  +LLLVYE
Sbjct  117   APAKSGKSTVIAVKKLSSESLQGFEEWQSEVNFLGRLSHPNLVKLFGYCWEDKELLLVYE  176

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLF +    + L WD R+ +AIG ARGL FLH SE+QVI RD K+SNILLD
Sbjct  177   FMSKGSLENHLFGRGSAVQPLPWDTRIKVAIGAARGLEFLHTSEKQVIYRDFKASNILLD  236

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  237   GSYTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIE  296

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+  LV W+KP LS + KLKSIMD +++G+Y S+A  + + L+L+C
Sbjct  297   ILTGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKSIMDPQLQGRYPSKAAFRISLLSLKC  356

Query  1377  LESQPEKRPSM  1409
             +ES+   RPSM
Sbjct  357   IESEHRNRPSM  367



>ref|XP_004146212.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
Length=405

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/380 (53%), Positives = 261/380 (69%), Gaps = 28/380 (7%)
 Frame = +3

Query  270   HSSTAV*SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAK  449
             H S AV     F    T+ + SG + S+   STA  +        Q SAA          
Sbjct  10    HHSNAVPCQAVFSTPGTSGNFSGIVESSGTNSTAGGS--------QFSAA----------  51

Query  450   CLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVF  629
                        S +  +S  +G IL  PNLK +S  EL++ T NF+ + ++G GGFG V+
Sbjct  52    ----------GSVDVSESCPSGKILDQPNLKEFSFTELKLITKNFRPESLIGQGGFGKVY  101

Query  630   KGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWE  809
             KGWVD+ TLAPS+  SGM+VAIKKL   S+QGF++W++EV  LG  +HPNV+KLLG+CWE
Sbjct  102   KGWVDDKTLAPSKSNSGMVVAIKKLNAESVQGFQDWQAEVNFLGRLNHPNVVKLLGFCWE  161

Query  810   YNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRD  989
              ++LLLVYE+M  GSLENHLF +    + LSW+ RL IAIG ARGLAFLH SE++VI RD
Sbjct  162   DDELLLVYEFMPRGSLENHLFGRRSSIEPLSWERRLKIAIGAARGLAFLHSSEKEVIYRD  221

Query  990   LKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDV  1169
              K+SNILLD NYN+KISDFGLA+LGP+GE SHVTTR++GT GY+APEY+ TG+LYVKSDV
Sbjct  222   FKASNILLDLNYNSKISDFGLARLGPTGEESHVTTRIMGTYGYVAPEYVSTGHLYVKSDV  281

Query  1170  YCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAEL  1349
             Y FGV+LLE++TGLR+ D    S Q  LV W KP L ++ ++K++MD R+EGQYSS+A  
Sbjct  282   YGFGVVLLEIMTGLRAHDMNRTSDQRNLVDWAKPFLMKKKRIKNLMDARIEGQYSSKAVT  341

Query  1350  QAAQLTLRCLESQPEKRPSM  1409
                 LTL+CLE+ P KRPSM
Sbjct  342   LVGDLTLKCLETDPRKRPSM  361



>ref|NP_001058637.1| Os06g0727400 [Oryza sativa Japonica Group]
 dbj|BAD61815.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF20551.1| Os06g0727400 [Oryza sativa Japonica Group]
 dbj|BAG91489.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66388.1| hypothetical protein OsJ_22723 [Oryza sativa Japonica Group]
Length=414

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/324 (60%), Positives = 242/324 (75%), Gaps = 4/324 (1%)
 Frame = +3

Query  438   ANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGF  617
             +N+  +P+      S   ++D+  +G IL + NL++++ AEL+ AT NF+ D VLG GGF
Sbjct  49    SNSTFIPS----TISGVSTDDAYPDGQILESRNLRIFTFAELKNATKNFRTDTVLGEGGF  104

Query  618   GTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLG  797
             G V+KGWVDE T+ PS+  +G++VA+KKL   S+QG E+WESEV  LG  SHPN++KLLG
Sbjct  105   GKVYKGWVDERTMNPSKSSTGVVVAVKKLNPESVQGTEQWESEVNFLGRISHPNLVKLLG  164

Query  798   YCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQV  977
             YC + ++LLLVYE+M  GSLENHLFR+    + L W LRL I IG ARGLAFLH SERQ+
Sbjct  165   YCKDNDELLLVYEFMAKGSLENHLFRRGAVYEPLPWSLRLKILIGAARGLAFLHSSERQI  224

Query  978   ICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYV  1157
             I RD K+SNILLD N+NAK+SDFGLAK GP G  SHVTTRV+GT GY APEY+ TG+LYV
Sbjct  225   IYRDFKASNILLDSNFNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYV  284

Query  1158  KSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSS  1337
             KSDVY FGV+LLEML+GLR+LD   PSG+  LV W KP+L+   KL  +MD R+EGQY S
Sbjct  285   KSDVYGFGVVLLEMLSGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHS  344

Query  1338  EAELQAAQLTLRCLESQPEKRPSM  1409
                LQAAQLTL+CL   P+ RPSM
Sbjct  345   RGALQAAQLTLKCLSGDPKSRPSM  368



>gb|KCW70322.1| hypothetical protein EUGRSUZ_F03566 [Eucalyptus grandis]
Length=354

 Score =   398 bits (1023),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 229/289 (79%), Gaps = 2/289 (1%)
 Frame = +3

Query  543   VYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQ  722
             +Y+LAEL+ AT NFK D +LG GGFG VFKGWVDE TLAPS+ G+G+ VA+KK    S Q
Sbjct  1     MYTLAELKSATRNFKPDTMLGEGGFGRVFKGWVDERTLAPSKVGNGIPVAVKKSNPDSDQ  60

Query  723   GFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALS  902
             G  EW+SEVK LG FSHPN+++LLGYCWE N+ LLVYEYMQ GSLENHLFR+  G + L 
Sbjct  61    GLREWQSEVKFLGKFSHPNLVRLLGYCWEDNQYLLVYEYMQRGSLENHLFRR--GAEPLP  118

Query  903   WDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENS  1082
             WD+RL IAIG ARG+ FLH SE+ VI RD KSSNILLD ++NAK+SDFGLAKLGP+G NS
Sbjct  119   WDVRLKIAIGAARGVDFLHTSEKNVIYRDFKSSNILLDADFNAKLSDFGLAKLGPAGGNS  178

Query  1083  HVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGW  1262
             HVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++LD   PSGQ  LV W
Sbjct  179   HVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLQALDNTRPSGQQNLVEW  238

Query  1263  VKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              +P L  + KL+ IMD R+EG+Y  +A  QAA+L L+CLE  P+ RPSM
Sbjct  239   ARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCLEGDPKARPSM  287



>ref|XP_009593137.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=416

 Score =   400 bits (1029),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 232/310 (75%), Gaps = 2/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S   ++   NG ILP  +L+++S  EL+ AT NF+ D VLG GGFG V+KGW+DE   A
Sbjct  49    ASGSVDEVYPNGQILPHSSLRMFSFTELKAATRNFRNDTVLGEGGFGKVYKGWLDERASA  108

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S  GSG ++A+KKL   SLQG EEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+
Sbjct  109   KS--GSGTVIAVKKLNSESLQGLEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEF  166

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLF +    + L W++RL I IG ARGLAFLH SE+QVI RD K+SNILLD 
Sbjct  167   MQKGSLENHLFGRGSAAQPLPWNVRLKIVIGAARGLAFLHASEKQVIYRDFKASNILLDG  226

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+EM
Sbjct  227   SYNAKISDFGLAKLGPSASQSHVTTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEM  286

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGLR+LD   PS QH LV W+KP LS   KLK  MD R+EG+Y S A +Q AQL L CL
Sbjct  287   LTGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCL  346

Query  1380  ESQPEKRPSM  1409
               +P+ RPSM
Sbjct  347   GPEPKTRPSM  356



>ref|XP_002886105.1| hypothetical protein ARALYDRAFT_480605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62364.1| hypothetical protein ARALYDRAFT_480605 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   400 bits (1028),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 236/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  ED+  +G ILP PNL+++SL EL  AT NF+ + VLG GGFG VFKGW+++ T 
Sbjct  52    FSVASGEDAYPDGQILPIPNLRIFSLTELRAATRNFRSENVLGEGGFGKVFKGWLEDKTA  111

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  112   G--KHSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  170   YMQKGSLENHLFRKGSSVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  230   GSYNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  290   ILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  349

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  350   LGPEPKNRPSM  360



>ref|XP_010111698.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
 gb|EXC31537.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
Length=436

 Score =   401 bits (1030),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 243/330 (74%), Gaps = 21/330 (6%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  +++  NG ILPTPNL+++S AEL+ AT NF+ D VLG GGFG V+KGW+D+   
Sbjct  45    FSVASCDENYPNGQILPTPNLRIFSFAELKTATKNFRADTVLGEGGFGKVYKGWLDDK--  102

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P + G+ M++A+KKL   SLQGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE
Sbjct  103   GPGKSGNSMVIAVKKLNSESLQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYE  162

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + LSWDLRL I+IG ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  163   FMQKGSLENHLFGRGSVVQPLSWDLRLKISIGAARGLAFLHTSEKQVIYRDFKASNILLD  222

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLE-------------------  1139
              +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+                    
Sbjct  223   GSYTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATDQLGQAQGPNIGLMCAVW  282

Query  1140  TGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRM  1319
             TG+LYVKSDVY FGV+L+E+LTGLR+LD   PSG+H LV W+KP LS + KLK+IMD R+
Sbjct  283   TGHLYVKSDVYGFGVVLVEILTGLRALDTNRPSGKHNLVDWIKPYLSDKRKLKNIMDSRL  342

Query  1320  EGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             EG+Y S+A    A L L+C+ES+ + RPSM
Sbjct  343   EGKYPSKAASHIAHLALKCIESEHKHRPSM  372



>gb|AES95298.2| Serine/Threonine-kinase Cx32, related protein [Medicago truncatula]
Length=387

 Score =   399 bits (1025),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 235/302 (78%), Gaps = 2/302 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G  L  PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW++  TLAP++ GSGMIV
Sbjct  53    SGKFLEMPNLKVFSYGDLKAATKSFKSDALLGEGGFGKVYKGWLNAVTLAPAKAGSGMIV  112

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL R S+QG +EW+SE+  LG  SHPN++KLLGYC + ++ LLVYE+M  GSLENHL
Sbjct  113   AIKKLKRDSVQGLQEWQSEINFLGRISHPNLVKLLGYCRDNDEFLLVYEFMPRGSLENHL  172

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N   + LSW+ RL IA   ARGLAFLH S++QVI RD K+SNILLD NYNAKISDFG
Sbjct  173   FRRNTNIEPLSWNTRLKIATDAARGLAFLHSSDKQVIYRDFKASNILLDGNYNAKISDFG  232

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAK GPSG +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++ D  
Sbjct  233   LAKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEMLTGLQAFDSN  292

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKS--IMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRP  1403
              P GQ  L+ W+KP LS + KLKS  I+D R+EGQY+S+A  + A L L+CL+  P+KRP
Sbjct  293   RPEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILKCLQPDPKKRP  352

Query  1404  SM  1409
             SM
Sbjct  353   SM  354



>ref|NP_001235086.1| protein kinase [Glycine max]
 gb|ACM89536.1| protein kinase [Glycine max]
 gb|KHN46866.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=412

 Score =   400 bits (1027),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/300 (64%), Positives = 234/300 (78%), Gaps = 3/300 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             NG ILPT NL++++ AEL+ AT NF+ D VLG GGFG V+KGW++E   A S+ GSG ++
Sbjct  69    NGQILPTSNLRIFTFAELKAATRNFRADTVLGEGGFGKVYKGWLEEK--ATSKTGSGTVI  126

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             A+KKL   SLQG EEW+SEV  LG  SHPN++KLLGYC E ++LLLVYE+MQ GSLENHL
Sbjct  127   AVKKLNSESLQGLEEWQSEVNFLGRLSHPNLVKLLGYCLEESELLLVYEFMQKGSLENHL  186

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             F +    + L WD+RL IAIG ARGLAFLH SE+ VI RD K+SNILLD +YNAKISDFG
Sbjct  187   FGRGSAVQPLPWDIRLKIAIGAARGLAFLHTSEK-VIYRDFKASNILLDGSYNAKISDFG  245

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E+LTGLR+LD  
Sbjct  246   LAKLGPSASQSHVTTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEILTGLRALDSN  305

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              PSGQH L  WVKP L    KLK IMD R+EG++ S+A  + AQL+++CL S+P+ RPSM
Sbjct  306   RPSGQHKLTEWVKPYLHDRRKLKGIMDSRLEGKFPSKAAFRIAQLSMKCLASEPKHRPSM  365



>gb|KCW70323.1| hypothetical protein EUGRSUZ_F03566 [Eucalyptus grandis]
Length=360

 Score =   398 bits (1022),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 229/293 (78%), Gaps = 4/293 (1%)
 Frame = +3

Query  543   VYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQ  722
             +Y+LAEL+ AT NFK D +LG GGFG VFKGWVDE TLAPS+ G+G+ VA+KK    S Q
Sbjct  1     MYTLAELKSATRNFKPDTMLGEGGFGRVFKGWVDERTLAPSKVGNGIPVAVKKSNPDSDQ  60

Query  723   GFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGR----  890
             G  EW+SEVK LG FSHPN+++LLGYCWE N+ LLVYEYMQ GSLENHLFR+  G     
Sbjct  61    GLREWQSEVKFLGKFSHPNLVRLLGYCWEDNQYLLVYEYMQRGSLENHLFRRTFGNAGGA  120

Query  891   KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPS  1070
             + L WD+RL IAIG ARG+ FLH SE+ VI RD KSSNILLD ++NAK+SDFGLAKLGP+
Sbjct  121   EPLPWDVRLKIAIGAARGVDFLHTSEKNVIYRDFKSSNILLDADFNAKLSDFGLAKLGPA  180

Query  1071  GENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHW  1250
             G NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++LD   PSGQ  
Sbjct  181   GGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGLQALDNTRPSGQQN  240

Query  1251  LVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             LV W +P L  + KL+ IMD R+EG+Y  +A  QAA+L L+CLE  P+ RPSM
Sbjct  241   LVEWARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCLEGDPKARPSM  293



>ref|XP_003581530.2| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Brachypodium distachyon]
Length=558

 Score =   405 bits (1040),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 233/300 (78%), Gaps = 0/300 (0%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
              GTIL TPNL++++ AEL+ AT NFK D +LG GGFG V+KGWVDE T+ P   G+GM++
Sbjct  191   QGTILETPNLRIFTYAELKAATRNFKPDSMLGEGGFGRVYKGWVDEKTMNPVRSGTGMVI  250

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             A+KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYE+M  GSLENHL
Sbjct  251   AVKKLSQESVQGLQEWQSEVNFLGRISHPNLVRLLGYCLEDKELLLVYEFMAKGSLENHL  310

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FRK    + +SW LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD +YNAK+SDFG
Sbjct  311   FRKGGSVQPISWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLDTHYNAKLSDFG  370

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAK GP+G +SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD  
Sbjct  371   LAKDGPTGGDSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTA  430

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+ Q  LV W KP L+   KL  ++D R+EGQY S+A L+AAQLTL CL  +P  RPSM
Sbjct  431   RPAPQLNLVDWAKPYLADRRKLARLVDPRLEGQYPSKAALRAAQLTLSCLAGEPRNRPSM  490



>ref|XP_010240264.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Brachypodium distachyon]
Length=557

 Score =   405 bits (1040),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 233/300 (78%), Gaps = 0/300 (0%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
              GTIL TPNL++++ AEL+ AT NFK D +LG GGFG V+KGWVDE T+ P   G+GM++
Sbjct  190   QGTILETPNLRIFTYAELKAATRNFKPDSMLGEGGFGRVYKGWVDEKTMNPVRSGTGMVI  249

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             A+KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYE+M  GSLENHL
Sbjct  250   AVKKLSQESVQGLQEWQSEVNFLGRISHPNLVRLLGYCLEDKELLLVYEFMAKGSLENHL  309

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FRK    + +SW LRL IAIG ARGLAFLH SE+ VI RD K+SNILLD +YNAK+SDFG
Sbjct  310   FRKGGSVQPISWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLDTHYNAKLSDFG  369

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAK GP+G +SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD  
Sbjct  370   LAKDGPTGGDSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTA  429

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P+ Q  LV W KP L+   KL  ++D R+EGQY S+A L+AAQLTL CL  +P  RPSM
Sbjct  430   RPAPQLNLVDWAKPYLADRRKLARLVDPRLEGQYPSKAALRAAQLTLSCLAGEPRNRPSM  489



>ref|XP_004159758.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase Cx32, chloroplastic-like [Cucumis sativus]
Length=405

 Score =   399 bits (1026),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 259/380 (68%), Gaps = 28/380 (7%)
 Frame = +3

Query  270   HSSTAV*SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAK  449
             H S AV     F    T+ + SG + S+   STA  +        Q SAA          
Sbjct  10    HHSNAVPCQAVFSTPGTSGNFSGIVESSGTNSTAGGS--------QFSAA----------  51

Query  450   CLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVF  629
                        S +  +   +G IL  PNLK +S  EL++ T NF+ + ++G GGFG V+
Sbjct  52    ----------GSVDVSEPYPSGKILDQPNLKEFSFTELKLITKNFRPESLIGQGGFGKVY  101

Query  630   KGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWE  809
             KGWVD+ TLAPS+  SGM+VAIKKL   S+QGF+EW++EV  LG  +HPN++KLLG+CWE
Sbjct  102   KGWVDDKTLAPSKSNSGMVVAIKKLNAESVQGFQEWQAEVNFLGRLNHPNLVKLLGFCWE  161

Query  810   YNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRD  989
              ++ LLVYE+M  GSLENHLF +    + LSW+ RL IAIG ARGLAFLH SE++VI RD
Sbjct  162   DDEFLLVYEFMPRGSLENHLFGRRSSIEPLSWERRLKIAIGAARGLAFLHSSEKEVIYRD  221

Query  990   LKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDV  1169
              K+SNILLD NYN+KISDFGLA+LGP+GE SHVTTR++GT GY+APEY+ TG+LYVKSDV
Sbjct  222   FKASNILLDLNYNSKISDFGLARLGPTGEESHVTTRIMGTYGYVAPEYVSTGHLYVKSDV  281

Query  1170  YCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAEL  1349
             Y FGV+LLE++TGLR+ D    S Q  LV W KP L +E ++K++MD R+EGQYSS+A  
Sbjct  282   YGFGVVLLEIMTGLRAHDMNRTSDQRNLVDWAKPXLDEEKRIKNLMDARIEGQYSSKAVT  341

Query  1350  QAAQLTLRCLESQPEKRPSM  1409
                 LTL+CLE+ P KRPSM
Sbjct  342   LVGDLTLKCLETDPRKRPSM  361



>ref|XP_007157997.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
 gb|ESW29991.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
Length=361

 Score =   397 bits (1021),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 235/303 (78%), Gaps = 3/303 (1%)
 Frame = +3

Query  510   NGTILP---TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSG  680
             N  + P   T NLK ++ A+L+ AT +F+ D++LG GGFG V+KGW+DE TL P++ GSG
Sbjct  41    NNAVFPRVETRNLKQFNFADLKAATKSFRSDVLLGEGGFGKVYKGWLDEKTLTPTKSGSG  100

Query  681   MIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLE  860
             M+VA+KKL   S+QGF EW+SE+  LG  SHPN++KLLGYC +  + LLVYE M  GSLE
Sbjct  101   MVVAVKKLNSESVQGFREWQSEINFLGRISHPNLVKLLGYCCDDVEFLLVYELMPKGSLE  160

Query  861   NHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKIS  1040
             NHLFR+N   + LSW+ R+ IAIG ARGLAFLH SE+Q+I RD K+SNILLDE+YNAKIS
Sbjct  161   NHLFRRNTSTETLSWNTRIKIAIGAARGLAFLHTSEKQIIYRDFKASNILLDEDYNAKIS  220

Query  1041  DFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSL  1220
             DFGLAKLGPSG  SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+L
Sbjct  221   DFGLAKLGPSGGYSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEILTGLRAL  280

Query  1221  DYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKR  1400
             D   P  Q  L+ W KP LS + KLKSIMD R+EGQYS++A ++AA LTL+CL+    KR
Sbjct  281   DRNRPLEQQNLIEWAKPSLSDKKKLKSIMDERIEGQYSTKAAMRAAHLTLKCLQRDHRKR  340

Query  1401  PSM  1409
             P M
Sbjct  341   PPM  343



>ref|XP_008372852.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase NAK [Malus domestica]
Length=429

 Score =   400 bits (1027),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 239/311 (77%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++++A+G ILPTPNL+++S  EL+VAT NF+ D VLG GGFG VFKGW+++   
Sbjct  59    FSAASGDEASAHGQILPTPNLRIFSFLELKVATRNFRPDTVLGEGGFGMVFKGWLEDK--  116

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP++ G   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KL GYCWE  +LLLVYE
Sbjct  117   APAKSGKSTVIAVKKLSSESLQGFEEWQSEVNFLGRLSHPNLVKLFGYCWEDKELLLVYE  176

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M  GSLENHLF +    + L WD R+ +AIG ARGL FLH SE+QVI RD K+SNILLD
Sbjct  177   FMSKGSLENHLFGRGSAVQPLPWDXRIKVAIGAARGLEFLHTSEKQVIYRDFKASNILLD  236

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AKISDFGLAK+GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  237   GSYTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIE  296

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+  LV W+KP LS + KLK IMD +++G+Y S+A  + + L L+C
Sbjct  297   ILTGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKGIMDPQLQGRYPSKAAFRISLLALKC  356

Query  1377  LESQPEKRPSM  1409
             +ES+   RPSM
Sbjct  357   IESEHRNRPSM  367



>gb|ACJ84370.1| unknown [Medicago truncatula]
 gb|AFK33998.1| unknown [Medicago truncatula]
Length=401

 Score =   399 bits (1025),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 235/302 (78%), Gaps = 2/302 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G  L  PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW++  TLAP++ GSGMIV
Sbjct  67    SGKFLEMPNLKVFSYGDLKAATKSFKSDALLGEGGFGKVYKGWLNAVTLAPAKAGSGMIV  126

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIKKL R S+QG +EW+SE+  LG  SHPN++KLLGYC + ++ LLVYE+M  GSLENHL
Sbjct  127   AIKKLKRDSVQGLQEWQSEINFLGRISHPNLVKLLGYCRDNDEFLLVYEFMPRGSLENHL  186

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N   + LSW+ RL IA   ARGLAFLH S++QVI RD K+SNILLD NYNAKISDFG
Sbjct  187   FRRNTNIEPLSWNTRLKIATDAARGLAFLHSSDKQVIYRDFKASNILLDGNYNAKISDFG  246

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAK GPSG +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++ D  
Sbjct  247   LAKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEMLTGLQAFDSN  306

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKS--IMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRP  1403
              P GQ  L+ W+KP LS + KLKS  I+D R+EGQY+S+A  + A L L+CL+  P+KRP
Sbjct  307   RPEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILKCLQPDPKKRP  366

Query  1404  SM  1409
             SM
Sbjct  367   SM  368



>ref|XP_003572799.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=448

 Score =   400 bits (1029),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/304 (63%), Positives = 233/304 (77%), Gaps = 5/304 (2%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL TPNL++++ AEL+ AT NFK D +LG GGFG VFKGWVDE T++P+  GSGM VA
Sbjct  79    GRILETPNLRIFTFAELKAATRNFKADTLLGEGGFGRVFKGWVDEKTMSPARSGSGMAVA  138

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   SLQG +EW++EV  LG   HPN+++LLGYCWE  +LLLVYEYM  G+LE+HLF
Sbjct  139   VKKLNPESLQGLQEWQTEVNFLGRLVHPNLVRLLGYCWEDKELLLVYEYMAKGNLEDHLF  198

Query  873   RKNVGR-----KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKI  1037
             R    +     + LSW LRL +AIG ARGLAFLH SE+ VI RD K+SNILLD +++AK+
Sbjct  199   RSEPRKGGGAFQPLSWSLRLRVAIGAARGLAFLHSSEKHVIYRDFKASNILLDTHFHAKL  258

Query  1038  SDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRS  1217
             SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+
Sbjct  259   SDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEVLTGLRA  318

Query  1218  LDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEK  1397
             LD   PSGQH LV W KP L+   KL  +MD R+EGQYSS    +AAQLTLRCL ++   
Sbjct  319   LDTDRPSGQHNLVDWAKPHLADRRKLARLMDPRLEGQYSSRGAQRAAQLTLRCLAAEHTN  378

Query  1398  RPSM  1409
             RPSM
Sbjct  379   RPSM  382



>ref|XP_010690221.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010690222.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/305 (62%), Positives = 234/305 (77%), Gaps = 2/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             +D   NG ILPTPNL+ +S  E++ AT NFK D +LG GGFG V+KGW++     P + G
Sbjct  50    DDVYPNGHILPTPNLREFSFQEMKTATRNFKGDTLLGEGGFGRVYKGWLESK--HPHKSG  107

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             SG++VAIKKL   S+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+M  GS
Sbjct  108   SGVVVAIKKLNSESVQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEFMSKGS  167

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLF +    + L WDLRL I IG ARG+AF+H S+ +VI RD+K+SNILLD +YNAK
Sbjct  168   LENHLFGRGSAVQPLPWDLRLKIIIGAARGIAFIHSSDDRVIYRDIKASNILLDSSYNAK  227

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+++E+LTGLR
Sbjct  228   ISDFGLAKLGPSESQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVIVELLTGLR  287

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD   PSG+H LV W+KP LS + KLK IMD+R+EG+Y  +A +  A+L L C+E +P 
Sbjct  288   ALDTTRPSGKHTLVDWIKPFLSDKRKLKGIMDIRLEGKYPLKAAVATAELALTCIEQEPR  347

Query  1395  KRPSM  1409
              RPSM
Sbjct  348   ARPSM  352



>gb|KGN55604.1| hypothetical protein Csa_3G001760 [Cucumis sativus]
Length=405

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 261/380 (69%), Gaps = 28/380 (7%)
 Frame = +3

Query  270   HSSTAV*SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAK  449
             H S AV     F    T+ + SG + S+   STA  +        Q SAA          
Sbjct  10    HHSNAVPCQAVFSTPGTSGNFSGIVESSGTNSTAGGS--------QFSAA----------  51

Query  450   CLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVF  629
                        S +  +S  +G IL  PNLK +S  EL++ T NF+ + ++G GGFG V+
Sbjct  52    ----------GSVDVSESCPSGKILDQPNLKEFSFTELKLITKNFRPESLIGQGGFGKVY  101

Query  630   KGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWE  809
             KGWVD+ TLAPS+  SGM+VAIKKL   S+QGF+EW++EV  LG  +HPN++KLLG+CWE
Sbjct  102   KGWVDDKTLAPSKSNSGMVVAIKKLNAESVQGFQEWQAEVNFLGRLNHPNLVKLLGFCWE  161

Query  810   YNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRD  989
              ++LLLVYE+M  GSLENHLF +    + LSW+ RL I+IG ARGLAFLH SE++VI RD
Sbjct  162   DDELLLVYEFMPRGSLENHLFGRRSSIEPLSWERRLKISIGAARGLAFLHSSEKEVIYRD  221

Query  990   LKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDV  1169
              K+SNILLD NYN+KISDFGLA+LGP+GE SHVTTR++GT GY+APEY+ TG+LYVKSDV
Sbjct  222   FKASNILLDLNYNSKISDFGLARLGPTGEESHVTTRIMGTYGYVAPEYVSTGHLYVKSDV  281

Query  1170  YCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAEL  1349
             Y FGV+LLE++TGLR+ D    S Q  LV W KP L ++ ++K++MD R+EGQYSS+A  
Sbjct  282   YGFGVVLLEIMTGLRAHDMNRTSDQRNLVDWAKPFLMKKKRIKNLMDARIEGQYSSKAVT  341

Query  1350  QAAQLTLRCLESQPEKRPSM  1409
                 LTL+CLE+ P KRPSM
Sbjct  342   LVGDLTLKCLETDPRKRPSM  361



>gb|KHG23246.1| hypothetical protein F383_30094 [Gossypium arboreum]
Length=419

 Score =   399 bits (1025),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 242/320 (76%), Gaps = 11/320 (3%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  +++  NG ILP PNL+++S AEL+ A  NF+ DMVLG GGFG VFKGW+DE  L
Sbjct  49    FSASSGDEAFPNGQILPAPNLRIFSFAELKTAAKNFRPDMVLGEGGFGKVFKGWIDEKAL  108

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWE---------SEVKLLGMFSHPNVIKLLGYCWE  809
               S  GS  +VA+KKL   SLQGFEEW+         SEV  LG  SHP++++LLGYCWE
Sbjct  109   GKS--GSATLVAVKKLNSESLQGFEEWQLLFHLLLVQSEVNFLGRLSHPHLVRLLGYCWE  166

Query  810   YNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRD  989
               +LLLVYE+MQ GSLENHLF +    ++L W++R+ IAIG A+GL+FLH S+++VI RD
Sbjct  167   DKELLLVYEFMQKGSLENHLFGRGSSVQSLEWNIRIKIAIGAAKGLSFLHSSDKKVIYRD  226

Query  990   LKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDV  1169
              K+SNILLD +Y AK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDV
Sbjct  227   FKASNILLDGSYTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDV  286

Query  1170  YCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAEL  1349
             Y FGV+L+E+LTGLR+LD   PSGQH L  W+KP LS   KLKSIMD R+EG+Y S+A +
Sbjct  287   YGFGVVLVEILTGLRALDPNRPSGQHNLSEWIKPYLSDRRKLKSIMDNRLEGKYPSKAAV  346

Query  1350  QAAQLTLRCLESQPEKRPSM  1409
             + AQL L+CLE  P+ RPSM
Sbjct  347   RIAQLALKCLEPGPKYRPSM  366



>emb|CDY31372.1| BnaA07g03070D [Brassica napus]
Length=410

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+    D+   G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW++E   
Sbjct  48    FSAGSGGDACPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEEK--  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P    +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E ++LLLVYE
Sbjct  106   GPGSHSTGTVIAVKKLNSESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGDELLLVYE  165

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  166   YMQKGSLENHLFRKGSVVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  225

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSD Y FGV+L E
Sbjct  226   SSYNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAE  285

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL+L+C
Sbjct  286   ILTGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKC  345

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  346   LEPEPKNRPSM  356



>ref|XP_009121148.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=410

 Score =   399 bits (1024),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+    D+   G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW++E   
Sbjct  48    FSAGSGGDACPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEEK--  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P    +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E ++LLLVYE
Sbjct  106   GPGSHSTGTVIAVKKLNSESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGDELLLVYE  165

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  166   YMQKGSLENHLFRKGSVVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  225

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSD Y FGV+L E
Sbjct  226   SSYNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAE  285

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL+L+C
Sbjct  286   ILTGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKC  345

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  346   LEPEPKNRPSM  356



>ref|XP_006590748.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X3 [Glycine max]
 gb|KHN41824.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=382

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 231/292 (79%), Gaps = 0/292 (0%)
 Frame = +3

Query  534   NLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRG  713
             NLK +S A L+ AT +FK D +LG GGFG V+KGW+DE TLAP++ GSG++VAIKKL   
Sbjct  57    NLKEFSFANLKAATKSFKSDALLGEGGFGKVYKGWLDEKTLAPTKAGSGIMVAIKKLNPE  116

Query  714   SLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRK  893
             S+QG  EW+SE+  LGM SHPN++KLLGYC +  + LLVYE+M  GSLENHLF +N   +
Sbjct  117   SMQGLREWQSEIDFLGMISHPNLVKLLGYCCDDVEFLLVYEFMPKGSLENHLFWRNTNTE  176

Query  894   ALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSG  1073
              LSWD R+ IAIG ARGLA+LH SE+Q+I RD K+SNILLDE+YNAKISDFGLAKLGPSG
Sbjct  177   PLSWDTRIKIAIGAARGLAYLHTSEKQIIYRDFKASNILLDEDYNAKISDFGLAKLGPSG  236

Query  1074  ENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWL  1253
              +SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R++D   P  Q  L
Sbjct  237   GDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRAIDRNRPIEQQNL  296

Query  1254  VGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             V W KP LS + K KSIMD R+EGQYS++A L+A QLTL+CLE   +KRP M
Sbjct  297   VEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKCLERDLKKRPHM  348



>dbj|BAK06515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 246/352 (70%), Gaps = 6/352 (2%)
 Frame = +3

Query  369   AFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVY  548
             A +A+S  G  R+  +A +     N    P         +E+  S   G IL  PNL+++
Sbjct  42    AAAAMSSPGQPRKSPSAPTTSITGNGSTRPVAGGSTNGGSEASPSR-EGRILEAPNLRIF  100

Query  549   SLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGF  728
             + AEL+ AT NFK D +LG GGFG V KGWVDE T++P+  G+GM VA+KKL   SLQG 
Sbjct  101   TFAELKAATRNFKSDTLLGEGGFGRVHKGWVDEKTMSPARSGAGMPVAVKKLNPESLQGV  160

Query  729   EEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKA----  896
             +EW+SEV  LG   HPN+++LLGYCWE  +LLLVYEYM  G+LE+HLFR    + A    
Sbjct  161   QEWQSEVNFLGRLIHPNLVRLLGYCWEDKELLLVYEYMAKGNLEDHLFRNEPRKGAGAFQ  220

Query  897   -LSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSG  1073
              LSW LRL +AI  ARGLAFLH SE+ VI RD K+SNILLD  ++AK+SDFGLAK GP+G
Sbjct  221   PLSWSLRLRVAIDAARGLAFLHSSEKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAG  280

Query  1074  ENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWL  1253
              +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+LTGLR+LD   PSGQH L
Sbjct  281   GSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEVLTGLRALDTDRPSGQHNL  340

Query  1254  VGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             V W KP L+   KL  +MD R+EGQYSS    +AAQLTLRCL ++   RPSM
Sbjct  341   VDWAKPHLADRRKLARLMDPRLEGQYSSRGAQRAAQLTLRCLAAEHTNRPSM  392



>ref|XP_010515435.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=415

 Score =   399 bits (1024),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S    ED+   G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW+++   
Sbjct  52    FSVTSGEDAYPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEDK--  109

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP +   G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  110   APGKQSVGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLFR+    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  170   FMQKGSLENHLFRRGSSVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  230   GSYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LT L +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  290   ILTSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  349

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  350   LGPEPKDRPSM  360



>ref|XP_010489347.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=416

 Score =   398 bits (1023),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S    ED    G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW+++ T 
Sbjct  52    FSVTSGEDVYPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEDKT-  110

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  111   -PGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  169

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLFR+    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  170   FMQKGSLENHLFRRGSSVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  229

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  230   GSYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAE  289

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LT L +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  290   ILTSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGRYPFKSAFRVAQLALKC  349

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  350   LGPEPKDRPSM  360



>ref|XP_006590747.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Glycine max]
Length=392

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 231/292 (79%), Gaps = 0/292 (0%)
 Frame = +3

Query  534   NLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRG  713
             NLK +S A L+ AT +FK D +LG GGFG V+KGW+DE TLAP++ GSG++VAIKKL   
Sbjct  67    NLKEFSFANLKAATKSFKSDALLGEGGFGKVYKGWLDEKTLAPTKAGSGIMVAIKKLNPE  126

Query  714   SLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRK  893
             S+QG  EW+SE+  LGM SHPN++KLLGYC +  + LLVYE+M  GSLENHLF +N   +
Sbjct  127   SMQGLREWQSEIDFLGMISHPNLVKLLGYCCDDVEFLLVYEFMPKGSLENHLFWRNTNTE  186

Query  894   ALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSG  1073
              LSWD R+ IAIG ARGLA+LH SE+Q+I RD K+SNILLDE+YNAKISDFGLAKLGPSG
Sbjct  187   PLSWDTRIKIAIGAARGLAYLHTSEKQIIYRDFKASNILLDEDYNAKISDFGLAKLGPSG  246

Query  1074  ENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWL  1253
              +SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R++D   P  Q  L
Sbjct  247   GDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRAIDRNRPIEQQNL  306

Query  1254  VGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             V W KP LS + K KSIMD R+EGQYS++A L+A QLTL+CLE   +KRP M
Sbjct  307   VEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKCLERDLKKRPHM  358



>ref|XP_010515408.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010515419.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010515427.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=416

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S    ED+   G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW+++   
Sbjct  53    FSVTSGEDAYPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEDK--  110

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             AP +   G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  111   APGKQSVGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  170

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLFR+    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  171   FMQKGSLENHLFRRGSSVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  230

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  231   GSYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAE  290

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LT L +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  291   ILTSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKC  350

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  351   LGPEPKDRPSM  361



>ref|XP_003538909.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X1 [Glycine max]
Length=391

 Score =   397 bits (1020),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 231/292 (79%), Gaps = 0/292 (0%)
 Frame = +3

Query  534   NLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRG  713
             NLK +S A L+ AT +FK D +LG GGFG V+KGW+DE TLAP++ GSG++VAIKKL   
Sbjct  66    NLKEFSFANLKAATKSFKSDALLGEGGFGKVYKGWLDEKTLAPTKAGSGIMVAIKKLNPE  125

Query  714   SLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRK  893
             S+QG  EW+SE+  LGM SHPN++KLLGYC +  + LLVYE+M  GSLENHLF +N   +
Sbjct  126   SMQGLREWQSEIDFLGMISHPNLVKLLGYCCDDVEFLLVYEFMPKGSLENHLFWRNTNTE  185

Query  894   ALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSG  1073
              LSWD R+ IAIG ARGLA+LH SE+Q+I RD K+SNILLDE+YNAKISDFGLAKLGPSG
Sbjct  186   PLSWDTRIKIAIGAARGLAYLHTSEKQIIYRDFKASNILLDEDYNAKISDFGLAKLGPSG  245

Query  1074  ENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWL  1253
              +SHV+TR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R++D   P  Q  L
Sbjct  246   GDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRAIDRNRPIEQQNL  305

Query  1254  VGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             V W KP LS + K KSIMD R+EGQYS++A L+A QLTL+CLE   +KRP M
Sbjct  306   VEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKCLERDLKKRPHM  357



>ref|XP_004231098.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=410

 Score =   397 bits (1021),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 228/309 (74%), Gaps = 0/309 (0%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             SA S      G ILP PNL+ +S  EL+ AT NF+ D VLG GGFG V+KGW+D+   + 
Sbjct  42    SAASGVDEVYGQILPHPNLRTFSFTELKTATRNFRSDTVLGEGGFGKVYKGWLDDRASSR  101

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             +   +G ++A+KKL   SLQG EEW+ EV  LG  SHPN++KLLGYCWE  +LLLVYE+M
Sbjct  102   TASATGTVIAVKKLNSESLQGLEEWQCEVNFLGTLSHPNLVKLLGYCWEDKELLLVYEFM  161

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
             Q GSLENHLF +    + L W++RL I IG ARGLAFLH SE+QVI RD K+SNILLD +
Sbjct  162   QKGSLENHLFGRGSAVQPLPWNIRLQIVIGAARGLAFLHASEKQVIYRDFKASNILLDGS  221

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY++TG+LYVKSDVY FGV+L+EML
Sbjct  222   YNAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVQTGHLYVKSDVYGFGVVLVEML  281

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TGLR+LD   PS QH LV W+KP LS   KLK  MD R+EG+Y S A +Q AQL L CL 
Sbjct  282   TGLRALDTNRPSNQHNLVEWIKPHLSDRRKLKDKMDSRLEGRYPSRAAVQIAQLALSCLG  341

Query  1383  SQPEKRPSM  1409
              +P+ RP M
Sbjct  342   PEPKTRPGM  350



>ref|XP_004287732.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   397 bits (1021),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/335 (58%), Positives = 239/335 (71%), Gaps = 9/335 (3%)
 Frame = +3

Query  405   QLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNF  584
             +LS   S  G +             S    +  + +G IL T NL+V+S A+++ AT NF
Sbjct  30    RLSQTSSSTGRSQFSHFSEATTSTLSPRYDDQESTDGEILETSNLRVFSFADMKSATKNF  89

Query  585   KRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGM  764
             K D +LG GGFG VFKGWVDE TL P + G+GM++A+KKL   S+QGF+EW+SEV  LG 
Sbjct  90    KSDQILGEGGFGRVFKGWVDEKTLQPCKAGTGMMIAVKKLNPESVQGFQEWQSEVNFLGR  149

Query  765   FSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARG  944
              SHPN++KLLGYCWE  +LLLVYE+M  G         N   + LSWD+R+ IAIG ARG
Sbjct  150   LSHPNLVKLLGYCWEDKELLLVYEFMPKG---------NPNIEPLSWDIRIRIAIGAARG  200

Query  945   LAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIA  1124
             LAFLH SE+ +I RD K+SNILLD NYNAKISDFGLAKLGP+G +SHV+TR++GT GY A
Sbjct  201   LAFLHSSEKHIIYRDFKASNILLDGNYNAKISDFGLAKLGPTGGDSHVSTRIMGTYGYAA  260

Query  1125  PEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSI  1304
             PEY+ TG+LYVKSDVY FGV+LLE+LTGLR+LD K P  Q  LV W KP+L  + KLK+I
Sbjct  261   PEYIATGHLYVKSDVYGFGVVLLEILTGLRALDTKRPKEQLNLVDWAKPLLPHKRKLKTI  320

Query  1305  MDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             MD RMEGQYS +A LQ A +TL+CL   P+ RPSM
Sbjct  321   MDARMEGQYSFKAALQTANITLKCLAPDPKSRPSM  355



>emb|CDX71350.1| BnaC07g06290D [Brassica napus]
Length=410

 Score =   397 bits (1021),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 234/311 (75%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+    D+   G ILP PNL+++SLAEL   T NFK + VLG GGFG VFKGW++E   
Sbjct  48    FSAGSGGDACPEGQILPIPNLRIFSLAELRATTRNFKSENVLGEGGFGKVFKGWLEEK--  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P    +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E ++LLLVYE
Sbjct  106   GPGSHSTGTVIAVKKLNSESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGDELLLVYE  165

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  166   YMQKGSLENHLFRKGSVVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  225

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSD Y FGV+L E
Sbjct  226   SSYNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAE  285

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGL +LD   P+GQH L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL+L+C
Sbjct  286   ILTGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKC  345

Query  1377  LESQPEKRPSM  1409
             LE +P+ RPSM
Sbjct  346   LEPEPKNRPSM  356



>ref|XP_009396689.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=396

 Score =   397 bits (1019),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 247/355 (70%), Gaps = 11/355 (3%)
 Frame = +3

Query  345   PSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTIL  524
             PSN    + F A S   +  +LS      G +             S A  ++    G IL
Sbjct  14    PSNTGHQSTFKASSSDATTEKLSTHSCSFGRSTV-----------SGASGDEEFPEGRIL  62

Query  525   PTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
               PNL+ ++ AE+++AT NF+ D +LG GGFG V+KGWV+E TL P++ G GMIVA+KKL
Sbjct  63    EVPNLRTFTFAEMKIATRNFRPDTILGEGGFGRVYKGWVEEKTLNPAKTGLGMIVAVKKL  122

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                S+QG E+W+SEVK LG  SHPN++KLLGYC E N+LLLVYEYM  GSLE+HLFRK  
Sbjct  123   SPDSMQGLEQWQSEVKFLGRLSHPNLVKLLGYCLEDNELLLVYEYMARGSLESHLFRKGE  182

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
               + LSW LRL IAIG ARGLAFLH SE++VI RD K++NILLD NYNAK+SDFGLAK G
Sbjct  183   SYEPLSWSLRLKIAIGAARGLAFLHTSEKEVIYRDFKAANILLDSNYNAKLSDFGLAKNG  242

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             P+  ++HVTTR++GT GY APEY+ TG+LYVKSDVY FGV++LEMLTG+R++D   P   
Sbjct  243   PTDGDTHVTTRIMGTMGYAAPEYMATGHLYVKSDVYGFGVVVLEMLTGMRAVDTNRPVTL  302

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
               LV + +P LS   KL  +MD R+EGQY  +  LQ AQLTL CL S P+KRP+M
Sbjct  303   RNLVTYARPSLSDRRKLARLMDRRLEGQYPPKGALQVAQLTLECLASDPKKRPNM  357



>ref|XP_010489344.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010489345.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=417

 Score =   397 bits (1021),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S    ED    G ILP PNL+++SLAEL  AT NFK + VLG GGFG VFKGW+++ T 
Sbjct  53    FSVTSGEDVYPEGQILPIPNLRIFSLAELRAATRNFKSENVLGEGGFGKVFKGWLEDKT-  111

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P +  +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  112   -PGKQSNGTVIAVKKLNAESFQGFEEWQCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYE  170

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLFR+    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD
Sbjct  171   FMQKGSLENHLFRRGSSVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASNILLD  230

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L E
Sbjct  231   GSYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAE  290

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LT L +LD   P+GQH L  W+KP LS+  KL+SIMD R+EG+Y  ++  + AQL L+C
Sbjct  291   ILTSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGRYPFKSAFRVAQLALKC  350

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  351   LGPEPKDRPSM  361



>ref|XP_003612340.1| Serine/threonine protein kinase [Medicago truncatula]
Length=461

 Score =   399 bits (1024),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 234/301 (78%), Gaps = 2/301 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G  L  PNLKV+S  +L+ AT +FK D +LG GGFG V+KGW++  TLAP++ GSGMIVA
Sbjct  128   GKFLEMPNLKVFSYGDLKAATKSFKSDALLGEGGFGKVYKGWLNAVTLAPAKAGSGMIVA  187

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             IKKL R S+QG +EW+SE+  LG  SHPN++KLLGYC + ++ LLVYE+M  GSLENHLF
Sbjct  188   IKKLKRDSVQGLQEWQSEINFLGRISHPNLVKLLGYCRDNDEFLLVYEFMPRGSLENHLF  247

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             R+N   + LSW+ RL IA   ARGLAFLH S++QVI RD K+SNILLD NYNAKISDFGL
Sbjct  248   RRNTNIEPLSWNTRLKIATDAARGLAFLHSSDKQVIYRDFKASNILLDGNYNAKISDFGL  307

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GPSG +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGL++ D   
Sbjct  308   AKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEMLTGLQAFDSNR  367

Query  1233  PSGQHWLVGWVKPMLSQEGKLKS--IMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
             P GQ  L+ W+KP LS + KLKS  I+D R+EGQY+S+A  + A L L+CL+  P+KRPS
Sbjct  368   PEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILKCLQPDPKKRPS  427

Query  1407  M  1409
             M
Sbjct  428   M  428



>ref|XP_009765256.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana sylvestris]
Length=428

 Score =   397 bits (1021),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 261/364 (72%), Gaps = 24/364 (7%)
 Frame = +3

Query  342   LPSNNKGSTAFSALSR------IGSYRQLSAAES-EGGNANAKC-LPTPNLEIYSSAESE  497
             LPS+NK S+  S + +        + R + A  S +GG+ + K  LP P           
Sbjct  12    LPSSNKFSSPPSVIKKHTATPASNTKRAVVAQPSGDGGDQSEKEELPLP-----------  60

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
                A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGW+D+ T APS+ G 
Sbjct  61    ---ASGKII-TPNLKMFTLAELKSATKNFRPDTVLGEGGFGTVFKGWIDDKTFAPSKVGV  116

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             G+ VA+KK    S QG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYE+M  GSL
Sbjct  117   GIPVAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKEFLLVYEHMLKGSL  176

Query  858   ENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKI  1037
             E+HLFRK    +ALSWD RL IAIG A+GLAFLH +E+QVI RD K+SNILLD +YNAK+
Sbjct  177   ESHLFRKECA-EALSWDTRLKIAIGAAKGLAFLHTTEKQVIYRDFKASNILLDSDYNAKL  235

Query  1038  SDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRS  1217
             SDFGLAK+GP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTG R 
Sbjct  236   SDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEILTGRRV  295

Query  1218  LDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEK  1397
             LD   P+G+  LV W KPML  + KL+ IMD R+EGQY S+A  Q A++ L+CLE  P+ 
Sbjct  296   LDLNRPNGETNLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYQIAEIILQCLEPDPKT  355

Query  1398  RPSM  1409
             RPSM
Sbjct  356   RPSM  359



>ref|XP_006364355.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=418

 Score =   397 bits (1020),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G ILP PNL+ +S  EL+ AT NF+ D VLG GGFG V+KGW+D+   + +  G+G ++A
Sbjct  60    GQILPHPNLRTFSFTELKTATRNFRSDTVLGEGGFGKVYKGWLDDRASSRTASGTGTVIA  119

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   SLQG EEW+ EV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ GSLENHLF
Sbjct  120   VKKLNSESLQGLEEWQCEVNFLGTLSHPNLVKLLGYCWEDKELLLVYEFMQKGSLENHLF  179

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
              +    + L W++RL I IG ARGLAFLH SE+QVI RD K+SNILLD +YNAKISDFGL
Sbjct  180   GRGSAVQPLPWNIRLQIVIGAARGLAFLHASEKQVIYRDFKASNILLDGSYNAKISDFGL  239

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AKLGPS   SHVTTRV+GT GY APEY++TG+LYVKSDVY FGV+L+EMLT LR+LD   
Sbjct  240   AKLGPSASQSHVTTRVMGTYGYAAPEYVQTGHLYVKSDVYGFGVVLVEMLTALRALDTNR  299

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             PS QH LV W+KP LS   KLK  MD R+EG+Y S A +Q AQL L CL  +P+ RP M
Sbjct  300   PSNQHNLVEWIKPHLSDRRKLKDKMDSRLEGRYPSRAAVQIAQLALSCLGPEPKTRPGM  358



>ref|XP_009792375.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Nicotiana sylvestris]
Length=423

 Score =   397 bits (1020),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 236/305 (77%), Gaps = 2/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E+   +G I+ TPNLK+YS  EL+ AT NF+ D +LG GGFG VFKGWVD+ TLAPS+ G
Sbjct  60    EEVAISGKII-TPNLKMYSFVELKSATRNFRPDTILGEGGFGRVFKGWVDDKTLAPSKVG  118

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
              G+ VA+KK    SLQG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYEYMQ GS
Sbjct  119   IGIAVAVKKSNADSLQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKQFLLVYEYMQKGS  178

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFRK  G + LSWD RL I IG ARGLAFLH +E+QVI RD K++NILLD +YNAK
Sbjct  179   LENHLFRKE-GAETLSWDTRLKIVIGAARGLAFLHTTEKQVIYRDFKAANILLDGDYNAK  237

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             +SDFGLAKLGP+  NSHVTT V+GT GY APEY+ +G+LYVKSDVY FGV+LLE+LTGLR
Sbjct  238   LSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEILTGLR  297

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
              LD   P+G+  LV W KP+L  + KL+ +MD R+EG+Y ++A  + AQL L+CL   P+
Sbjct  298   VLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCLMPDPK  357

Query  1395  KRPSM  1409
              RPS+
Sbjct  358   TRPSI  362



>ref|XP_009792373.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana sylvestris]
Length=432

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 236/305 (77%), Gaps = 2/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E+   +G I+ TPNLK+YS  EL+ AT NF+ D +LG GGFG VFKGWVD+ TLAPS+ G
Sbjct  69    EEVAISGKII-TPNLKMYSFVELKSATRNFRPDTILGEGGFGRVFKGWVDDKTLAPSKVG  127

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
              G+ VA+KK    SLQG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYEYMQ GS
Sbjct  128   IGIAVAVKKSNADSLQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKQFLLVYEYMQKGS  187

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFRK  G + LSWD RL I IG ARGLAFLH +E+QVI RD K++NILLD +YNAK
Sbjct  188   LENHLFRKE-GAETLSWDTRLKIVIGAARGLAFLHTTEKQVIYRDFKAANILLDGDYNAK  246

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             +SDFGLAKLGP+  NSHVTT V+GT GY APEY+ +G+LYVKSDVY FGV+LLE+LTGLR
Sbjct  247   LSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEILTGLR  306

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
              LD   P+G+  LV W KP+L  + KL+ +MD R+EG+Y ++A  + AQL L+CL   P+
Sbjct  307   VLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCLMPDPK  366

Query  1395  KRPSM  1409
              RPS+
Sbjct  367   TRPSI  371



>ref|XP_009792374.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana sylvestris]
Length=431

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 236/305 (77%), Gaps = 3/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E+   +G I+ TPNLK+YS  EL+ AT NF+ D +LG GGFG VFKGWVD+ TLAPS+ G
Sbjct  69    EEVAISGKII-TPNLKMYSFVELKSATRNFRPDTILGEGGFGRVFKGWVDDKTLAPSKVG  127

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
              G+ VA+KK    SLQG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYEYMQ GS
Sbjct  128   IGIAVAVKKSNADSLQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKQFLLVYEYMQKGS  187

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFRK  G + LSWD RL I IG ARGLAFLH +E+QVI RD K++NILLD +YNAK
Sbjct  188   LENHLFRK--GAETLSWDTRLKIVIGAARGLAFLHTTEKQVIYRDFKAANILLDGDYNAK  245

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             +SDFGLAKLGP+  NSHVTT V+GT GY APEY+ +G+LYVKSDVY FGV+LLE+LTGLR
Sbjct  246   LSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEILTGLR  305

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
              LD   P+G+  LV W KP+L  + KL+ +MD R+EG+Y ++A  + AQL L+CL   P+
Sbjct  306   VLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCLMPDPK  365

Query  1395  KRPSM  1409
              RPS+
Sbjct  366   TRPSI  370



>ref|XP_010663976.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Vitis vinifera]
Length=425

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 235/307 (77%), Gaps = 3/307 (1%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E  ++   G I+ TPNLK+++ AEL+ AT NF+ D +LG GGFG VFKGWVDE T AP++
Sbjct  51    EKTETAETGKII-TPNLKMFTFAELKSATRNFRPDTMLGEGGFGRVFKGWVDEKTYAPTK  109

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
                G+ VA+KK    S QG +EW+SEVK LG F+HPN++KLLGYCWE  + LLVYEYMQ 
Sbjct  110   VSVGIPVAVKKSNPESEQGLKEWQSEVKFLGKFTHPNLVKLLGYCWEDKQFLLVYEYMQK  169

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR  VG + L+W++RL IAIG ARGLAFLH SE+ VI RD KSSN+LLD +YN
Sbjct  170   GSLENHLFR--VGAEPLTWEIRLKIAIGAARGLAFLHTSEKTVIYRDFKSSNVLLDGDYN  227

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AK+SDFGLAKLGPS  +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG
Sbjct  228   AKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTG  287

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
              ++LD   P GQ  LV W KP L+ + KLK IMD R+  QY  +A  QAA+L L+CLES 
Sbjct  288   NQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCLESD  347

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  348   PKNRPSM  354



>ref|XP_010663975.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Vitis vinifera]
Length=426

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 235/307 (77%), Gaps = 3/307 (1%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E  ++   G I+ TPNLK+++ AEL+ AT NF+ D +LG GGFG VFKGWVDE T AP++
Sbjct  52    EKTETAETGKII-TPNLKMFTFAELKSATRNFRPDTMLGEGGFGRVFKGWVDEKTYAPTK  110

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
                G+ VA+KK    S QG +EW+SEVK LG F+HPN++KLLGYCWE  + LLVYEYMQ 
Sbjct  111   VSVGIPVAVKKSNPESEQGLKEWQSEVKFLGKFTHPNLVKLLGYCWEDKQFLLVYEYMQK  170

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR  VG + L+W++RL IAIG ARGLAFLH SE+ VI RD KSSN+LLD +YN
Sbjct  171   GSLENHLFR--VGAEPLTWEIRLKIAIGAARGLAFLHTSEKTVIYRDFKSSNVLLDGDYN  228

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AK+SDFGLAKLGPS  +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG
Sbjct  229   AKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTG  288

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
              ++LD   P GQ  LV W KP L+ + KLK IMD R+  QY  +A  QAA+L L+CLES 
Sbjct  289   NQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCLESD  348

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  349   PKNRPSM  355



>ref|XP_009765257.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana sylvestris]
Length=427

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 261/364 (72%), Gaps = 25/364 (7%)
 Frame = +3

Query  342   LPSNNKGSTAFSALSR------IGSYRQLSAAES-EGGNANAKC-LPTPNLEIYSSAESE  497
             LPS+NK S+  S + +        + R + A  S +GG+ + K  LP P           
Sbjct  12    LPSSNKFSSPPSVIKKHTATPASNTKRAVVAQPSGDGGDQSEKEELPLP-----------  60

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
                A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGW+D+ T APS+ G 
Sbjct  61    ---ASGKII-TPNLKMFTLAELKSATKNFRPDTVLGEGGFGTVFKGWIDDKTFAPSKVGV  116

Query  678   GMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSL  857
             G+ VA+KK    S QG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYE+M  GSL
Sbjct  117   GIPVAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKEFLLVYEHMLKGSL  176

Query  858   ENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKI  1037
             E+HLFRK    +ALSWD RL IAIG A+GLAFLH +E+QVI RD K+SNILLD +YNAK+
Sbjct  177   ESHLFRKCA--EALSWDTRLKIAIGAAKGLAFLHTTEKQVIYRDFKASNILLDSDYNAKL  234

Query  1038  SDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRS  1217
             SDFGLAK+GP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTG R 
Sbjct  235   SDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEILTGRRV  294

Query  1218  LDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEK  1397
             LD   P+G+  LV W KPML  + KL+ IMD R+EGQY S+A  Q A++ L+CLE  P+ 
Sbjct  295   LDLNRPNGETNLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYQIAEIILQCLEPDPKT  354

Query  1398  RPSM  1409
             RPSM
Sbjct  355   RPSM  358



>gb|EMT33274.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=396

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/305 (62%), Positives = 230/305 (75%), Gaps = 0/305 (0%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             E +   G IL  PNL++++ AEL  AT NFK D +LG GGFG V+KGWVDE T+ P+  G
Sbjct  81    EGAEPEGRILEAPNLRIFTFAELRAATRNFKPDTLLGEGGFGQVYKGWVDEKTMNPARSG  140

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             +GM++A+KKL + SLQG EEW+ EV  LG  SHPN+++LLGYC E  +LLLVYE+M  GS
Sbjct  141   TGMVIAVKKLNQESLQGLEEWQCEVNFLGRISHPNLVRLLGYCLEDRELLLVYEFMAKGS  200

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFRK    + + W LRL IAI  ARGLAFLH SE+ VI RD K+SNILLD NYNAK
Sbjct  201   LENHLFRKGGSVQPIPWGLRLRIAIDAARGLAFLHSSEKHVIYRDFKASNILLDTNYNAK  260

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             +SDFGLA+ GP+G +SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR
Sbjct  261   LSDFGLARNGPTGGDSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLR  320

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD   P+ Q  LV W KP L+   KL  ++D R+EGQY S+A L+AAQLTL CL  +P 
Sbjct  321   ALDTARPAQQLNLVDWAKPYLADRRKLPRLVDPRLEGQYPSKAALRAAQLTLSCLAGEPR  380

Query  1395  KRPSM  1409
              RPSM
Sbjct  381   NRPSM  385



>ref|XP_002510681.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF52868.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=435

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 236/310 (76%), Gaps = 3/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +++  E +   G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFG VFKG++DE T A
Sbjct  57    NNSSRETTPPTGKIV-TPNLKMFTLAELKSATRNFRPDTVLGEGGFGRVFKGYIDEKTYA  115

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS  G GM VA+KK    S QG EEW+SEVK LG FSHPN++KLLGYCWE  + LLVYEY
Sbjct  116   PSRVGVGMAVAVKKSSPDSPQGLEEWQSEVKFLGKFSHPNLVKLLGYCWEDRQFLLVYEY  175

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLENHLFRK  G + L W +RL +AIG A+GLAFLH SE+ VI RD K+SNILLD 
Sbjct  176   MQKGSLENHLFRK--GAEPLPWHVRLKVAIGAAQGLAFLHTSEKSVIYRDFKTSNILLDG  233

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             +YNAK+SDFGLAKLGP   NSHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLEM
Sbjct  234   DYNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVRSDVYGFGVVLLEM  293

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTG R+LD   P+ +  L+ W  P LS++ KL  IMD R+EGQY  +  +QAA+L L+CL
Sbjct  294   LTGRRALDNNRPNSEQNLIEWATPSLSEKRKLTKIMDPRLEGQYPIKGAMQAAELILQCL  353

Query  1380  ESQPEKRPSM  1409
             ES P+ RPSM
Sbjct  354   ESDPKSRPSM  363



>ref|XP_009112418.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=412

 Score =   395 bits (1015),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 236/315 (75%), Gaps = 1/315 (0%)
 Frame = +3

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             N   +S+A  ED+   G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++
Sbjct  45    NFSGFSAASGEDAYPEGQILPNPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLE  104

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E     S   +G ++A+KKL  GS  GFEEW+ EV  LG  SHPN++KLLGYC E + LL
Sbjct  105   EKGPG-SHSSTGPVIAVKKLLSGSFHGFEEWQCEVNFLGRISHPNLVKLLGYCLEGDDLL  163

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYEYMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SN
Sbjct  164   LVYEYMQKGSLENHLFRKGSVVQPLSWEIRLTIAIGAAKGLAFLHASEKQVIYRDFKASN  223

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD +YNAK+SDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSD Y FGV
Sbjct  224   ILLDASYNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGV  283

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +L E+LTGLR++D   P+GQ  L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL
Sbjct  284   VLAEILTGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQL  343

Query  1365  TLRCLESQPEKRPSM  1409
              L+CLE + + RPSM
Sbjct  344   ALKCLEPEQKNRPSM  358



>ref|XP_009622682.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=436

 Score =   396 bits (1017),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 237/301 (79%), Gaps = 2/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGWVD+ T APS+ G G+ 
Sbjct  69    ASGKIV-TPNLKMFTLAELKSATKNFRPDTVLGEGGFGTVFKGWVDDKTFAPSKVGVGIP  127

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYE+MQ GSLE+H
Sbjct  128   VAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKEFLLVYEHMQKGSLESH  187

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G +A+SWD RL IAIG A+GL FLH +E+QVI RD K+SNILLD +YNAK+SDF
Sbjct  188   LFRKE-GAEAMSWDTRLKIAIGAAKGLTFLHTTEKQVIYRDFKASNILLDADYNAKLSDF  246

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK+GP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTG R LD 
Sbjct  247   GLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEILTGRRVLDL  306

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+G+  LV W KPML  + KL+ IMD R+EGQY S+A  + A++ ++CLE  P+ RPS
Sbjct  307   NRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCLEPDPKTRPS  366

Query  1407  M  1409
             M
Sbjct  367   M  367



>ref|XP_009622683.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=435

 Score =   395 bits (1016),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 237/301 (79%), Gaps = 2/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGWVD+ T APS+ G G+ 
Sbjct  68    ASGKIV-TPNLKMFTLAELKSATKNFRPDTVLGEGGFGTVFKGWVDDKTFAPSKVGVGIP  126

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYE+MQ GSLE+H
Sbjct  127   VAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKEFLLVYEHMQKGSLESH  186

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G +A+SWD RL IAIG A+GL FLH +E+QVI RD K+SNILLD +YNAK+SDF
Sbjct  187   LFRKE-GAEAMSWDTRLKIAIGAAKGLTFLHTTEKQVIYRDFKASNILLDADYNAKLSDF  245

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK+GP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTG R LD 
Sbjct  246   GLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEILTGRRVLDL  305

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+G+  LV W KPML  + KL+ IMD R+EGQY S+A  + A++ ++CLE  P+ RPS
Sbjct  306   NRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCLEPDPKTRPS  365

Query  1407  M  1409
             M
Sbjct  366   M  366



>ref|XP_009622684.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Nicotiana tomentosiformis]
Length=435

 Score =   395 bits (1016),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 237/301 (79%), Gaps = 3/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGWVD+ T APS+ G G+ 
Sbjct  69    ASGKIV-TPNLKMFTLAELKSATKNFRPDTVLGEGGFGTVFKGWVDDKTFAPSKVGVGIP  127

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG +EW++EVK LG FSHPN++KL+GYCWE  + LLVYE+MQ GSLE+H
Sbjct  128   VAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCWEEKEFLLVYEHMQKGSLESH  187

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G +A+SWD RL IAIG A+GL FLH +E+QVI RD K+SNILLD +YNAK+SDF
Sbjct  188   LFRK--GAEAMSWDTRLKIAIGAAKGLTFLHTTEKQVIYRDFKASNILLDADYNAKLSDF  245

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK+GP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTG R LD 
Sbjct  246   GLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEILTGRRVLDL  305

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+G+  LV W KPML  + KL+ IMD R+EGQY S+A  + A++ ++CLE  P+ RPS
Sbjct  306   NRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCLEPDPKTRPS  365

Query  1407  M  1409
             M
Sbjct  366   M  366



>emb|CDY47489.1| BnaA09g08980D [Brassica napus]
Length=412

 Score =   394 bits (1013),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 236/315 (75%), Gaps = 1/315 (0%)
 Frame = +3

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             N   +S+A  ED+   G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++
Sbjct  45    NFSGFSAASGEDAYPEGQILPNPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLE  104

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E     S   +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E + LL
Sbjct  105   EKGPG-SHSSTGTVIAVKKLNSESFQGFEEWQCEVNFLGRISHPNLVKLLGYCLEGDDLL  163

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYEYMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SN
Sbjct  164   LVYEYMQKGSLENHLFRKGSVVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASN  223

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD +YNAK+SDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSD Y FGV
Sbjct  224   ILLDASYNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGV  283

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +L E+LTGLR++D   P+GQ  L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL
Sbjct  284   VLAEILTGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQL  343

Query  1365  TLRCLESQPEKRPSM  1409
              L+CLE + + RPSM
Sbjct  344   ALKCLEPEQKNRPSM  358



>ref|XP_008663505.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
Length=581

 Score =   400 bits (1028),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 235/335 (70%), Gaps = 36/335 (11%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NF+ D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  191   GRILEAPNLRIFTFAELRAATRNFRPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  250

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYEYM  GSLENHLF
Sbjct  251   VKKLNQESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEYMPKGSLENHLF  310

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD------------  1016
             RK    + +SW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD            
Sbjct  311   RKGGSFEPISWNLRLRIAIGAARGLAFLHSSEKQVIYRDFKASNILLDTVHVRLMHIRLL  370

Query  1017  ------------------------ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIA  1124
                                     +NYNAK+SDFGLAK GP+G +SHVTTRV+GT GY A
Sbjct  371   TSHQYNGQPGTRTKTHAFFPCHPPQNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAA  430

Query  1125  PEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSI  1304
             PEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   P+ QH LV W KP L+   KL  +
Sbjct  431   PEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRL  490

Query  1305  MDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +D R+EGQY S+A LQAAQLTLRCLE  P  RPSM
Sbjct  491   VDPRLEGQYPSKAALQAAQLTLRCLEGDPRSRPSM  525



>gb|KFK40107.1| hypothetical protein AALP_AA3G331300 [Arabis alpina]
Length=411

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 235/312 (75%), Gaps = 2/312 (1%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             ++S+   +D    G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++E  
Sbjct  48    VFSAGSGDDVYPEGQILPIPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLEEKV  107

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
               P +  +G ++A+KKL   S QG+EEW+ EV  LG  SHPN++KLLGYC E + LLLVY
Sbjct  108   --PGKQSNGTVIAVKKLNSESFQGYEEWQCEVNFLGRISHPNLVKLLGYCLEGDDLLLVY  165

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILL
Sbjct  166   EFMQKGSLENHLFRKGSSVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILL  225

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L 
Sbjct  226   DASYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLA  285

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             E+LTGL +LD   PSGQH L  W+KP L +  KL+SI+D R+EG+Y  ++  + A L L+
Sbjct  286   EILTGLHALDPNRPSGQHNLTEWIKPHLFERRKLRSIIDPRLEGKYPFKSVFRVAHLALK  345

Query  1374  CLESQPEKRPSM  1409
             CL  +P+ RPSM
Sbjct  346   CLGPEPKDRPSM  357



>ref|NP_001174044.1| Os04g0563900 [Oryza sativa Japonica Group]
 dbj|BAH92772.1| Os04g0563900 [Oryza sativa Japonica Group]
Length=555

 Score =   399 bits (1025),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/299 (63%), Positives = 229/299 (77%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NFK D VLG GGFG V+KGWVDE T++P+  G+GM++A
Sbjct  112   GRILEVPNLRIFTFAELRAATRNFKPDSVLGEGGFGRVYKGWVDERTMSPARSGTGMVIA  171

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL   S+QG +EW+SE+  LG  SHPN+++L+GYC E  +LLLVYE+M  GSLENHLF
Sbjct  172   VKKLNPESVQGLQEWQSEINFLGRLSHPNLVRLIGYCVEDRELLLVYEFMAKGSLENHLF  231

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + +SW+L L IAIG ARGLAFLH SERQ+I RD K+SNILLD +YNAK+SDFGL
Sbjct  232   RKGSAYQPISWNLCLRIAIGAARGLAFLHSSERQIIYRDFKASNILLDTHYNAKLSDFGL  291

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AK GP+   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG+R+LD   
Sbjct  292   AKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGMRALDTGR  351

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ QH LV W KP L+   KL  ++D R+EGQY S A  QAAQLTLRCL   P  RPSM
Sbjct  352   PAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCLSGDPRSRPSM  410



>gb|KFK40106.1| hypothetical protein AALP_AA3G331300 [Arabis alpina]
Length=412

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 235/312 (75%), Gaps = 2/312 (1%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             ++S+   +D    G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++E  
Sbjct  49    VFSAGSGDDVYPEGQILPIPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLEEKV  108

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
               P +  +G ++A+KKL   S QG+EEW+ EV  LG  SHPN++KLLGYC E + LLLVY
Sbjct  109   --PGKQSNGTVIAVKKLNSESFQGYEEWQCEVNFLGRISHPNLVKLLGYCLEGDDLLLVY  166

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SNILL
Sbjct  167   EFMQKGSLENHLFRKGSSVQPLSWEIRLRIAIGAAKGLAFLHASEKQVIYRDFKASNILL  226

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D +YNAKISDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSDVY FGV+L 
Sbjct  227   DASYNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLA  286

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             E+LTGL +LD   PSGQH L  W+KP L +  KL+SI+D R+EG+Y  ++  + A L L+
Sbjct  287   EILTGLHALDPNRPSGQHNLTEWIKPHLFERRKLRSIIDPRLEGKYPFKSVFRVAHLALK  346

Query  1374  CLESQPEKRPSM  1409
             CL  +P+ RPSM
Sbjct  347   CLGPEPKDRPSM  358



>emb|CDY26797.1| BnaC09g09240D [Brassica napus]
Length=416

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 236/315 (75%), Gaps = 1/315 (0%)
 Frame = +3

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             N   +S+A  ED+   G ILP PNL+++SLAEL  +T NFK + VLG GGFG VFKGW++
Sbjct  49    NFSGFSAASGEDAYPEGQILPNPNLRIFSLAELRASTRNFKSENVLGEGGFGKVFKGWLE  108

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E     S   +G ++A+KKL   S QGFEEW+ EV  LG  SHPN++KLLGYC E + LL
Sbjct  109   EKGPG-SHSSTGTVIAVKKLNSESFQGFEEWQCEVNFLGRISHPNLVKLLGYCLEGDDLL  167

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYEYMQ GSLENHLFRK    + LSW++RL IAIG A+GLAFLH SE+QVI RD K+SN
Sbjct  168   LVYEYMQKGSLENHLFRKGSVVQPLSWEIRLKIAIGAAKGLAFLHASEKQVIYRDFKASN  227

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD +YNAK+SDFGLAKLGPS   SH+TTRV+GT+GY APEY+ TG+LYVKSD Y FGV
Sbjct  228   ILLDASYNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGV  287

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +L E+LTGLR++D   P+GQ  L  W+KP LS+  KL+ IMD R+EG+Y  ++  + AQL
Sbjct  288   VLAEILTGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQL  347

Query  1365  TLRCLESQPEKRPSM  1409
              L+CLE + + RPSM
Sbjct  348   ALKCLEPEQKNRPSM  362



>gb|KFK30195.1| hypothetical protein AALP_AA7G230500 [Arabis alpina]
Length=416

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 240/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A S+ S      +G +L TP+LKVYS  EL+ AT NFK D +LG GGFG V++GWVD
Sbjct  49    FSEAASDTSGGTMSHSGLLLETPHLKVYSFMELKTATKNFKPDSMLGQGGFGKVYRGWVD  108

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVA+K+L   S QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  109   TKTLAPSKVGSGMIVAVKRLNSDSFQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  168

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLE HLFR+N   ++  WDLR+ I IG ARGLA+LH S+R+VI RD K+SN
Sbjct  169   LVYEFMPKGSLETHLFRRN---ESFPWDLRIKILIGAARGLAYLHGSQREVIYRDFKASN  225

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGPS E SHVTTRV+GT+GY APEY+ TG+LYVKSDVY FGV
Sbjct  226   ILLDSKYDAKISDFGLAKLGPSQEKSHVTTRVMGTQGYAAPEYMATGHLYVKSDVYAFGV  285

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGLR+ D + P+GQ  LV W++P LS + K+K IMD  ++GQY+S+   + A++
Sbjct  286   VLLEVMTGLRAHDPRRPNGQESLVDWLRPELSCKYKVKRIMDQGIKGQYTSKVANEMARI  345

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E +P+ RP M
Sbjct  346   TLSCIEPEPKNRPHM  360



>gb|KDP36787.1| hypothetical protein JCGZ_08078 [Jatropha curcas]
Length=424

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 236/318 (74%), Gaps = 7/318 (2%)
 Frame = +3

Query  471   EIYSSAESEDSNANGTILPT-----PNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKG  635
             E  SS +   SN    +  T     P LK+Y+L EL+ AT NF+ D +LG GGFG VFKG
Sbjct  50    EYISSPDENGSNMTRRVPSTGKIIMPILKIYTLHELKSATRNFRPDTMLGEGGFGRVFKG  109

Query  636   WVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYN  815
             W+DE T APS+ G GM VA+KK    S QG +EW+ EVK LG FSHPN++KLLGYCWE  
Sbjct  110   WIDEKTFAPSKVGVGMAVAVKKSNPDSEQGLQEWQCEVKFLGKFSHPNLVKLLGYCWEDR  169

Query  816   KLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLK  995
             + LLVYEYM  GSLENHLFR++   + LSW++RL IAI  A+GLAFLH SE+ VI RD K
Sbjct  170   QFLLVYEYMPKGSLENHLFRRSA--EPLSWEIRLKIAIEAAQGLAFLHTSEKTVIYRDFK  227

Query  996   SSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYC  1175
             +SNILLD NYNAK+SDFGLAKLGP   NSHVTTRV+GT GY APEY+ TG+LYVKSDVY 
Sbjct  228   TSNILLDGNYNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYG  287

Query  1176  FGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQA  1355
             FGV+LLEMLTGL++LD   P+G+H LV W KP LS + KLK IMD R+E QY  +  + A
Sbjct  288   FGVVLLEMLTGLKALDTNRPNGKHNLVDWAKPSLSDKRKLKRIMDPRLEQQYPLKGAIHA  347

Query  1356  AQLTLRCLESQPEKRPSM  1409
             A+L ++CLES+P+ RPSM
Sbjct  348   AELIIKCLESEPKTRPSM  365



>ref|XP_008663503.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Zea mays]
Length=583

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 235/335 (70%), Gaps = 36/335 (11%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NF+ D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  193   GRILEAPNLRIFTFAELRAATRNFRPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  252

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYEYM  GSLENHLF
Sbjct  253   VKKLNQESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEYMPKGSLENHLF  312

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD------------  1016
             RK    + +SW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD            
Sbjct  313   RKGGSFEPISWNLRLRIAIGAARGLAFLHSSEKQVIYRDFKASNILLDTVHVRLMHIRLL  372

Query  1017  ------------------------ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIA  1124
                                     +NYNAK+SDFGLAK GP+G +SHVTTRV+GT GY A
Sbjct  373   TSHQYNGQPGTRTKTHAFFPCHPPQNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAA  432

Query  1125  PEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSI  1304
             PEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   P+ QH LV W KP L+   KL  +
Sbjct  433   PEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRL  492

Query  1305  MDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +D R+EGQY S+A LQAAQLTLRCLE  P  RPSM
Sbjct  493   VDPRLEGQYPSKAALQAAQLTLRCLEGDPRSRPSM  527



>ref|XP_008663504.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Zea mays]
Length=582

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 235/335 (70%), Gaps = 36/335 (11%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NF+ D VLG GGFG V+KGWVDE T+ P+  G GM+VA
Sbjct  192   GRILEAPNLRIFTFAELRAATRNFRPDTVLGEGGFGRVYKGWVDERTMNPTRSGIGMVVA  251

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + S+QG +EW+SEV  LG  SHPN+++LLGYC E  +LLLVYEYM  GSLENHLF
Sbjct  252   VKKLNQESVQGLQEWQSEVNFLGRLSHPNLVRLLGYCVEDRELLLVYEYMPKGSLENHLF  311

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD------------  1016
             RK    + +SW+LRL IAIG ARGLAFLH SE+QVI RD K+SNILLD            
Sbjct  312   RKGGSFEPISWNLRLRIAIGAARGLAFLHSSEKQVIYRDFKASNILLDTVHVRLMHIRLL  371

Query  1017  ------------------------ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIA  1124
                                     +NYNAK+SDFGLAK GP+G +SHVTTRV+GT GY A
Sbjct  372   TSHQYNGQPGTRTKTHAFFPCHPPQNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAA  431

Query  1125  PEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSI  1304
             PEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   P+ QH LV W KP L+   KL  +
Sbjct  432   PEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRL  491

Query  1305  MDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             +D R+EGQY S+A LQAAQLTLRCLE  P  RPSM
Sbjct  492   VDPRLEGQYPSKAALQAAQLTLRCLEGDPRSRPSM  526



>ref|XP_003519694.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN29881.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=412

 Score =   392 bits (1008),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 236/311 (76%), Gaps = 3/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S +  +    NG ILPT NL++++ AEL+ AT NFK D VLG GGFG VFKGW++E   
Sbjct  58    FSVSSGDQPYPNGQILPTSNLRIFTFAELKAATRNFKADTVLGEGGFGKVFKGWLEEK--  115

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             A S+ GSG ++A+KKL   SLQG EEW+SEV  LG  SH N++KLLGYC E ++LLLVYE
Sbjct  116   ATSKGGSGTVIAVKKLNSESLQGLEEWQSEVNFLGRLSHTNLVKLLGYCLEESELLLVYE  175

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L WD+RL IAIG ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  176   FMQKGSLENHLFGRGSAVQPLPWDIRLKIAIGAARGLAFLHTSEK-VIYRDFKASNILLD  234

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  235   GSYNAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  294

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTG R+LD   PSG H L  WVKP L    KLK IMD R+EG++ S+A  + AQL+L+C
Sbjct  295   ILTGQRALDTNRPSGLHSLTEWVKPYLHDRRKLKGIMDPRLEGKFPSKAAFRIAQLSLKC  354

Query  1377  LESQPEKRPSM  1409
             L S+P++RPSM
Sbjct  355   LASEPKQRPSM  365



>gb|KHN09350.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=415

 Score =   392 bits (1008),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/322 (60%), Positives = 240/322 (75%), Gaps = 22/322 (7%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G IL  PNLKV+   EL+ AT+NF+ D +LG GGFG V+KGW+DE+TLAP++ G GM+V
Sbjct  79    DGQILKWPNLKVFDFEELKSATNNFRSDTLLGEGGFGRVYKGWLDEDTLAPTKAGCGMVV  138

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK L   S QGF++W++E+ ++  FSHPN++ LLGYCW+ ++ LLVYE+M  GSL+NHL
Sbjct  139   AIKWLNPESTQGFDQWQTELNIMRRFSHPNLVNLLGYCWDDDEHLLVYEFMPKGSLDNHL  198

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK-----  1034
             F++N   + LSW+ RL IAIGVARGLAFLH SE  VI RD KSSNILLD NYN K     
Sbjct  199   FKRNRNLELLSWNTRLKIAIGVARGLAFLHASENNVIHRDFKSSNILLDGNYNPKISDFG  258

Query  1035  -----------------ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKS  1163
                              ISDFGLAKLGPSG  SHVTTRV+GT GY APEY+ TG+LYVKS
Sbjct  259   LATLGSSEGQSHNYNPEISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKS  318

Query  1164  DVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEA  1343
             DVY FGV+LLE+LTG+R+LD   P+GQ  LV W KP+LS + KLK+IMD ++ GQYS +A
Sbjct  319   DVYGFGVVLLEILTGMRALDTNRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSLQA  378

Query  1344  ELQAAQLTLRCLESQPEKRPSM  1409
               QAAQLT++CL+S PE+RPSM
Sbjct  379   AWQAAQLTMKCLQSIPEERPSM  400



>gb|EYU38037.1| hypothetical protein MIMGU_mgv1a007214mg [Erythranthe guttata]
Length=415

 Score =   392 bits (1007),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 234/311 (75%), Gaps = 5/311 (2%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A   D   +G ++P PNL+V+S +EL+ AT NF+ D VLG GGFG V+KGW+D    
Sbjct  50    FSAASGTDFAGSGQMIPHPNLRVFSFSELKTATRNFRSDTVLGEGGFGKVYKGWLD----  105

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              P    SG ++A+KKL   S+QGF+EW+SEV  LG  SH N++KLLGYCWE  +LLLVYE
Sbjct  106   -PKSSTSGSVIAVKKLNSESMQGFDEWQSEVNFLGRLSHQNLVKLLGYCWEDKELLLVYE  164

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L W++RL I IG A GLAFLH S+  VI RD K+SNILLD
Sbjct  165   FMQKGSLENHLFGRGSAVQPLPWNIRLKILIGAAHGLAFLHASDGNVIYRDFKASNILLD  224

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y+AKISDFGLAK+GP+   SHVTT+V+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  225   GSYHAKISDFGLAKMGPTASRSHVTTQVIGTYGYAAPEYVATGHLYVKSDVYGFGVVLVE  284

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             MLTGLR+LD   PSGQH LV W+KP L +  KLK+IMD R+EG+Y S++ L  AQL L C
Sbjct  285   MLTGLRALDTNRPSGQHSLVDWIKPHLCERRKLKNIMDSRLEGRYPSKSALHIAQLALTC  344

Query  1377  LESQPEKRPSM  1409
             LES+P+ RPSM
Sbjct  345   LESEPKNRPSM  355



>ref|XP_004955142.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=462

 Score =   394 bits (1011),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 189/310 (61%), Positives = 233/310 (75%), Gaps = 6/310 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             +++ NG IL  PNL+V++ AEL   T NFK D VLG GGFG V+KGWVDE T++P+  G+
Sbjct  86    EASLNGRILEVPNLRVFTFAELRAVTRNFKADTVLGEGGFGRVYKGWVDERTMSPARNGA  145

Query  678   G-MIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             G M VA+KKL   SLQG +EW++EV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GS
Sbjct  146   GSMPVAVKKLNPESLQGVQEWQTEVNFLGRLSHPNLVRLLGYCWEEKELLLVYEYMAKGS  205

Query  855   LENHLFRKNVGR-----KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             LENHLFR    +     + L W +RL IAIG ARGLAFLH SE+ VI RD K+SNILLD 
Sbjct  206   LENHLFRSEPRKGGAAVQPLPWSVRLRIAIGAARGLAFLHSSEKHVIYRDFKASNILLDT  265

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             ++NAK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+
Sbjct  266   HFNAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  325

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTG+R+LD   P+ QH LV W KP L+   KL  ++D R+EGQYSS    +AAQLTLRCL
Sbjct  326   LTGMRALDTDRPAAQHNLVDWAKPFLADRKKLARLVDPRLEGQYSSRGAQRAAQLTLRCL  385

Query  1380  ESQPEKRPSM  1409
              +  + RPSM
Sbjct  386   AADHKNRPSM  395



>ref|XP_010320466.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=413

 Score =   392 bits (1006),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 232/301 (77%), Gaps = 3/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGWVD+ T APS  G GM 
Sbjct  57    ASGKII-TPNLKMFTLAELKSATRNFRPDTVLGEGGFGTVFKGWVDDKTFAPSRVGVGMP  115

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG +EW++EVK LG  SHPN++KL+GYCWE    LLVYE+MQ GSLE+H
Sbjct  116   VAVKKSNADSEQGLKEWQAEVKFLGKLSHPNLVKLIGYCWEDKTFLLVYEHMQKGSLESH  175

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G +ALSW  RL IAIG A+GL FLH  E+QVI RD K++NILLD +YNAK+SDF
Sbjct  176   LFRK--GAEALSWGTRLKIAIGAAKGLDFLHTIEKQVIYRDFKTANILLDSDYNAKLSDF  233

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK+GP   +SHVTT+++GT GY APEY+ TG++YVKSDVY FGV+LLE+L+G R LD 
Sbjct  234   GLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHVYVKSDVYGFGVVLLEILSGRRVLDL  293

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+G+H LV W KPML  + KL+ +MD R+E QY S+A  Q A++ LRCLE  P+ RPS
Sbjct  294   NRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKAAFQIAEIILRCLEPDPKNRPS  353

Query  1407  M  1409
             M
Sbjct  354   M  354



>ref|XP_002452769.1| hypothetical protein SORBIDRAFT_04g032190 [Sorghum bicolor]
 gb|EES05745.1| hypothetical protein SORBIDRAFT_04g032190 [Sorghum bicolor]
Length=473

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 230/313 (73%), Gaps = 7/313 (2%)
 Frame = +3

Query  492   SEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEP  671
             S     +G IL  PNL+V++ AEL  AT NFK D V+G GGFG V KGWVDE T++P+  
Sbjct  91    SRHQPVDGRILEVPNLRVFTFAELRAATRNFKADTVVGEGGFGRVHKGWVDERTMSPARN  150

Query  672   GSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNG  851
             G+G+ VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  G
Sbjct  151   GAGVPVAVKKLNPESLQGVQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAKG  210

Query  852   SLENHLFRKN-------VGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNIL  1010
             SLENHLFR         V +  L W LRL IAIG ARGLAFLH SE+ VI RD K+SNIL
Sbjct  211   SLENHLFRSEPRKGGAAVHQPLLPWSLRLRIAIGAARGLAFLHSSEKHVIYRDFKASNIL  270

Query  1011  LDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLL  1190
             LD ++NAK+SDFGLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L
Sbjct  271   LDTHFNAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVL  330

Query  1191  LEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             LE+LTGLR+LD   P+ QH LV W KP L+   KL  ++D R+EGQY S    +AAQLTL
Sbjct  331   LEILTGLRALDTDRPAAQHNLVDWAKPYLADRRKLARLVDPRLEGQYPSRGAQRAAQLTL  390

Query  1371  RCLESQPEKRPSM  1409
             RCL +  + RPSM
Sbjct  391   RCLAADHKNRPSM  403



>ref|XP_004966517.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Setaria italica]
Length=415

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 234/313 (75%), Gaps = 6/313 (2%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S    +D   +G IL +P+LK+Y+ AEL+ AT +F+ + VLG GGFG V+KGWVDE TL 
Sbjct  55    SGVSVDDDYPDGQILESPDLKIYTFAELKSATRSFRPETVLGEGGFGKVYKGWVDEKTLN  114

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS    GM+VA+KKL   S+QG E+W+SEV  LG  SHPN++KLLGYC + N+LLLVYE+
Sbjct  115   PSRSSIGMVVAVKKLNPESVQGMEQWQSEVNFLGRISHPNLVKLLGYCMDDNELLLVYEF  174

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + L W LRL I IG ARGLAFLH SERQ+I RD K+SNILLD 
Sbjct  175   MAKGSLENHLFRRGAVYEPLPWSLRLKILIGAARGLAFLHSSERQIIYRDFKASNILLDS  234

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             ++NAK+SDFGLAK GP GE SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  235   HFNAKLSDFGLAKHGPDGEESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEM  294

Query  1200  LTGLRSLDYK*PSGQHW---LVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTL  1370
             ++GLR+LD   PS Q+    LV W KP+L+   KL  +MD  +EGQYSS+  L AAQLTL
Sbjct  295   ISGLRALD---PSRQNEKVNLVNWAKPLLADRRKLSQVMDSGLEGQYSSKGALLAAQLTL  351

Query  1371  RCLESQPEKRPSM  1409
             +CL   P+ RPSM
Sbjct  352   KCLNGDPKSRPSM  364



>emb|CBI40720.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 235/307 (77%), Gaps = 3/307 (1%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E  ++   G I+ TPNLK+++ AEL+ AT NF+ D +LG GGFG VFKGWVDE T AP++
Sbjct  51    EKTETAETGKII-TPNLKMFTFAELKSATRNFRPDTMLGEGGFGRVFKGWVDEKTYAPTK  109

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
                G+ VA+KK    S QG +EW+SEVK LG F+HPN++KLLGYCWE  + LLVYEYMQ 
Sbjct  110   VSVGIPVAVKKSNPESEQGLKEWQSEVKFLGKFTHPNLVKLLGYCWEDKQFLLVYEYMQK  169

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLFR  VG + L+W++RL IAIG ARGLAFLH SE+ VI RD KSSN+LLD +YN
Sbjct  170   GSLENHLFR--VGAEPLTWEIRLKIAIGAARGLAFLHTSEKTVIYRDFKSSNVLLDGDYN  227

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AK+SDFGLAKLGPS  +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG
Sbjct  228   AKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTG  287

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
              ++LD   P GQ  LV W KP L+ + KLK IMD R+  QY  +A  QAA+L L+CLES 
Sbjct  288   NQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCLESD  347

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  348   PKNRPSM  354



>ref|XP_004144887.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004154222.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
Length=413

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++   +G ILP+ NL+ YSLAEL+ AT NF+ + +LG GGFG V+KGW++E  L
Sbjct  45    FSAASGDEVFPHGQILPSSNLREYSLAELKAATKNFRAEALLGEGGFGKVYKGWLEEKGL  104

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                  G+ M++A+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE ++LLL YE
Sbjct  105   G--RKGNSMVIAVKKLKSDSVQGLEEWQSEVGFLGRLSHPNLVKLLGYCWEDHELLLTYE  162

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +      L WD RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  163   FMQKGSLENHLFGRGSAVTPLGWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  222

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  223   GSYTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIE  282

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             MLTGLR+LD   P+GQ  L  W+KP LS+  KLK++MD R+EG+Y S +  Q AQL L+C
Sbjct  283   MLTGLRALDENRPTGQEHLTEWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQC  342

Query  1377  LESQPEKRPSM  1409
             +E + + RPSM
Sbjct  343   IEQEQKNRPSM  353



>ref|XP_008447840.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447841.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447842.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447843.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
Length=414

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 236/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++   +G ILP+ NL+ YSLAEL+ AT NF+ + +LG GGFG V+KGW++E  L
Sbjct  45    FSAASGDEVFPHGQILPSSNLREYSLAELKAATKNFRAEALLGEGGFGKVYKGWLEEKGL  104

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                  G+ M++A+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE ++LLL YE
Sbjct  105   G--RKGNSMVIAVKKLKSDSVQGIEEWQSEVGFLGRLSHPNLVKLLGYCWEDHELLLTYE  162

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +      L WD RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  163   FMQKGSLENHLFGRGSAVTPLGWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  222

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  223   GSYTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIE  282

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             MLTGLR+LD   P+GQ  L+ W+KP LS+  KLK++MD R+EG+Y S +  Q AQL L+C
Sbjct  283   MLTGLRALDENRPTGQENLMDWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQC  342

Query  1377  LESQPEKRPSM  1409
             +E + + RPSM
Sbjct  343   IEQEQKNRPSM  353



>ref|XP_010446903.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Camelina sativa]
 ref|XP_010446904.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Camelina sativa]
Length=423

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 238/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S   SE SN     +G IL +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD
Sbjct  46    FSEVASECSNGIISDSGLILESPNLKVYTFLDLKTATKNFKPDSMLGQGGFGKVYRGWVD  105

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  106   AKTLAPSKAGSGMIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  165

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR+N   +   W+LR+ IAIG ARGLAFLH  +R+VI RD K+SN
Sbjct  166   LVYEFMPRGSLENHLFRRN---EPFPWELRIKIAIGAARGLAFLHGLQREVIYRDFKASN  222

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  223   ILLDSTYDAKISDFGLAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGV  282

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGL++ + K P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++
Sbjct  283   VLLEVMTGLKAHNTKRPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTKVATEMARI  342

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  343   TLSCIEPDPKNRPHM  357



>dbj|BAK05598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 229/299 (77%), Gaps = 0/299 (0%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             G IL  PNL++++ AEL  AT NFK D +LG GGFG V+KGWVDE T+ P+  G+GM++A
Sbjct  90    GRILEAPNLRIFTFAELRAATRNFKPDTLLGEGGFGQVYKGWVDEKTMNPARSGTGMVIA  149

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KKL + SLQG EEW+ EV  LG  SHPN+++LLGYC E  +LLLVYE+M  GSLENHLF
Sbjct  150   VKKLNQESLQGLEEWQCEVNFLGRISHPNLVRLLGYCLEDRELLLVYEFMAKGSLENHLF  209

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             RK    + + W LR+ IA+  ARGLAFLH SE+ VI RD K+SNILLD NYNAK+SDFGL
Sbjct  210   RKGGSVQPIPWGLRIRIAMDAARGLAFLHSSEKHVIYRDFKASNILLDTNYNAKLSDFGL  269

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             A+ GP+G +SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   
Sbjct  270   ARNGPTGGDSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTAR  329

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P+ Q  LV W KP L+   KL  ++D R+EGQY S+A L+AAQLTL CL  +P+ RPSM
Sbjct  330   PAQQLNLVDWAKPYLADRRKLPRLVDPRLEGQYPSKAVLRAAQLTLSCLAGEPKNRPSM  388



>ref|XP_010437452.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X4 [Camelina sativa]
Length=396

 Score =   390 bits (1001),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 239/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE SN     +G IL +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD
Sbjct  19    FSEAASECSNGIISDSGLILESPNLKVYTFLDLKTATKNFKPDSMLGQGGFGKVYRGWVD  78

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TL+PS+ GSG+IVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  79    AKTLSPSKAGSGVIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  138

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR+N   +   W+LR+ IAIG ARGLAFLH  +R+VI RD K+SN
Sbjct  139   LVYEFMPRGSLENHLFRRN---EPFPWELRIKIAIGAARGLAFLHGLQREVIYRDFKASN  195

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGP+ E SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  196   ILLDSTYDAKISDFGLAKLGPADEKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYAFGV  255

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGL++ + K P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++
Sbjct  256   VLLEVMTGLKAHNIKRPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTKVATEMARI  315

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  316   TLSCIEPDPKNRPHM  330



>ref|XP_010437451.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X3 [Camelina sativa]
Length=418

 Score =   390 bits (1002),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 239/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE SN     +G IL +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD
Sbjct  41    FSEAASECSNGIISDSGLILESPNLKVYTFLDLKTATKNFKPDSMLGQGGFGKVYRGWVD  100

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TL+PS+ GSG+IVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  101   AKTLSPSKAGSGVIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  160

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR+N   +   W+LR+ IAIG ARGLAFLH  +R+VI RD K+SN
Sbjct  161   LVYEFMPRGSLENHLFRRN---EPFPWELRIKIAIGAARGLAFLHGLQREVIYRDFKASN  217

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGP+ E SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  218   ILLDSTYDAKISDFGLAKLGPADEKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYAFGV  277

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGL++ + K P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++
Sbjct  278   VLLEVMTGLKAHNIKRPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTKVATEMARI  337

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  338   TLSCIEPDPKNRPHM  352



>gb|KDP43762.1| hypothetical protein JCGZ_22389 [Jatropha curcas]
Length=398

 Score =   389 bits (1000),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 259/383 (68%), Gaps = 45/383 (12%)
 Frame = +3

Query  294   MGNFVGSRTADSISGAL-----------PSNNKGSTAFSALSRIGSYRQLSAAESEGGNA  440
             MGN  GS + D    ++            SNN  +  FSA S      Q SAA SE    
Sbjct  1     MGNCFGSSSHDVNPSSIITSTTNPPTPGSSNNNTTMEFSATSSSAGKSQFSAAVSE----  56

Query  441   NAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFG  620
                              +ED N+NG IL  PNLK ++ A+L  AT NF+ D VLG GGFG
Sbjct  57    ----------------VNEDGNSNGQILEAPNLKEFTFADLRGATRNFRSDSVLGEGGFG  100

Query  621   TVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGY  800
              VFKG + E T APS+ G+G+ VAIK              SEV  LG  SHPN++KLLGY
Sbjct  101   KVFKGGLAEKTYAPSKTGTGLTVAIK--------------SEVNFLGRLSHPNLVKLLGY  146

Query  801   CWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVI  980
             CWE  +LLLVYE+MQ GSLENHLFR+N   + LSWDLRL IAIG ARGLAFLH SE+ VI
Sbjct  147   CWEDKELLLVYEFMQKGSLENHLFRRNPNIEPLSWDLRLKIAIGTARGLAFLHTSEKPVI  206

Query  981   CRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVK  1160
              RD K+SNILLD NYNAKISDFGLAKLGPSG +SHVTTRV+G+ GY APEY+ TG+LYVK
Sbjct  207   YRDFKASNILLDGNYNAKISDFGLAKLGPSGGDSHVTTRVMGSYGYAAPEYIATGHLYVK  266

Query  1161  SDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSE  1340
             SDVY FGV+LLE+LTGLR+LD + P+GQ  LV W+KP+L  + KLK+ MDVR+EGQ SS+
Sbjct  267   SDVYGFGVVLLELLTGLRALDRRRPNGQQNLVDWLKPILPYKKKLKATMDVRIEGQNSSK  326

Query  1341  AELQAAQLTLRCLESQPEKRPSM  1409
             A LQAAQLTL+CLE  P+ RPSM
Sbjct  327   AMLQAAQLTLQCLEPDPQSRPSM  349



>emb|CDP07284.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   391 bits (1004),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 228/301 (76%), Gaps = 2/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A G I+  PNLK+++ +EL  AT NF+ D VLG GGFG VF+GWVDE T APS+ G G+ 
Sbjct  81    ATGHIMAAPNLKMFTYSELRSATRNFRPDTVLGEGGFGRVFRGWVDEKTYAPSKVGVGIP  140

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG  EW++EVK LG F HPN++KLLGYCWE  + LLVYEYMQ GSLE+H
Sbjct  141   VAVKKSNPDSEQGLSEWQAEVKFLGKFCHPNLVKLLGYCWEDREFLLVYEYMQRGSLESH  200

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFRK  G + L+W+ RL IAIG ARGLAFLH +E+QVI RD K+SN+LLD ++NAK+SDF
Sbjct  201   LFRK--GAETLAWETRLKIAIGAARGLAFLHTTEKQVIYRDFKASNVLLDSDFNAKLSDF  258

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAKLGP    SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE+++G R LD 
Sbjct  259   GLAKLGPVNGYSHVTTRVVGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIISGRRVLDL  318

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               PSG+H LV W KP+L  + KL+ +MD ++EG+Y S    Q AQL L+CLE  P+KRP 
Sbjct  319   NRPSGEHNLVDWSKPLLPDKRKLRKVMDPQLEGRYPSRGAFQIAQLILKCLEPDPKKRPP  378

Query  1407  M  1409
             M
Sbjct  379   M  379



>ref|XP_004238436.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Solanum lycopersicum]
Length=414

 Score =   390 bits (1001),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 231/301 (77%), Gaps = 2/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TPNLK+++LAEL+ AT NF+ D VLG GGFGTVFKGWVD+ T APS  G GM 
Sbjct  57    ASGKII-TPNLKMFTLAELKSATRNFRPDTVLGEGGFGTVFKGWVDDKTFAPSRVGVGMP  115

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG +EW++EVK LG  SHPN++KL+GYCWE    LLVYE+MQ GSLE+H
Sbjct  116   VAVKKSNADSEQGLKEWQAEVKFLGKLSHPNLVKLIGYCWEDKTFLLVYEHMQKGSLESH  175

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LFR   G +ALSW  RL IAIG A+GL FLH  E+QVI RD K++NILLD +YNAK+SDF
Sbjct  176   LFRTE-GAEALSWGTRLKIAIGAAKGLDFLHTIEKQVIYRDFKTANILLDSDYNAKLSDF  234

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAK+GP   +SHVTT+++GT GY APEY+ TG++YVKSDVY FGV+LLE+L+G R LD 
Sbjct  235   GLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHVYVKSDVYGFGVVLLEILSGRRVLDL  294

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               P+G+H LV W KPML  + KL+ +MD R+E QY S+A  Q A++ LRCLE  P+ RPS
Sbjct  295   NRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKAAFQIAEIILRCLEPDPKNRPS  354

Query  1407  M  1409
             M
Sbjct  355   M  355



>ref|XP_004290061.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=430

 Score =   390 bits (1002),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 237/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+   +++  +G ILP  NL+++S  EL+ AT NF+ D VLG GGFG V+KGW++E   
Sbjct  59    FSARSGDETCPDGQILPDANLRIFSYLELKSATRNFRSDTVLGEGGFGKVYKGWLEERPA  118

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                +PG   ++A+KKL   SLQGFEEW+SEV  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  119   M--KPGRTTVIAVKKLNSESLQGFEEWQSEVNFLGRLSHPNLVKLLGYCLEEKELLLVYE  176

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L WD+RL +AIG ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  177   FMQKGSLENHLFGRGSVVQPLPWDIRLKVAIGAARGLAFLHTSEKQVIYRDFKASNILLD  236

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              ++NAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  237   GSFNAKISDFGLAKLGPSESQSHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLVE  296

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSG+H LV W+KP LS + KLK IMD R+E +Y ++A  + +QL L+C
Sbjct  297   ILTGLRALDTNRPSGRHNLVEWIKPFLSDKRKLKGIMDPRLEAKYPAKAAFRISQLALKC  356

Query  1377  LESQPEKRPSM  1409
             +ES+ + RPSM
Sbjct  357   IESEHKNRPSM  367



>ref|XP_010437450.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Camelina sativa]
Length=428

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 239/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE SN     +G IL +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD
Sbjct  51    FSEAASECSNGIISDSGLILESPNLKVYTFLDLKTATKNFKPDSMLGQGGFGKVYRGWVD  110

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TL+PS+ GSG+IVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  111   AKTLSPSKAGSGVIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  170

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR+N   +   W+LR+ IAIG ARGLAFLH  +R+VI RD K+SN
Sbjct  171   LVYEFMPRGSLENHLFRRN---EPFPWELRIKIAIGAARGLAFLHGLQREVIYRDFKASN  227

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGP+ E SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  228   ILLDSTYDAKISDFGLAKLGPADEKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYAFGV  287

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGL++ + K P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++
Sbjct  288   VLLEVMTGLKAHNIKRPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTKVATEMARI  347

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  348   TLSCIEPDPKNRPHM  362



>ref|XP_006412084.1| hypothetical protein EUTSA_v10025265mg [Eutrema salsugineum]
 gb|ESQ53537.1| hypothetical protein EUTSA_v10025265mg [Eutrema salsugineum]
Length=429

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/315 (59%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE +      +G ILP+P+L VYS  +L  AT NFK D +LG GGFG V++GW+D
Sbjct  52    FSEAASESAGGIMSYSGQILPSPSLHVYSFLDLTTATKNFKPDSMLGQGGFGKVYRGWID  111

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVA+K+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  112   AKTLAPSKAGSGMIVAVKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  171

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR++   +   WDLR+ I IG ARGLAFLH  +R+VI RD K+SN
Sbjct  172   LVYEFMPKGSLENHLFRRS---EPFPWDLRIKIVIGAARGLAFLHGLQREVIYRDFKASN  228

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD NY+A++SDFGLAKLGPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  229   ILLDSNYDARLSDFGLAKLGPSHEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGV  288

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGLR+ + K P+GQ  LV W++P LS + K+K IMD  ++GQYSS+   +  ++
Sbjct  289   VLLEIMTGLRAHNPKRPNGQESLVDWLRPELSSKHKVKHIMDEGIKGQYSSKVAAEMGRI  348

Query  1365  TLRCLESQPEKRPSM  1409
             T  C++  P+ RP M
Sbjct  349   TFSCIQPDPKNRPHM  363



>ref|XP_010530963.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Tarenaya hassleriana]
Length=409

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 231/305 (76%), Gaps = 2/305 (1%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             +++  NG IL TPNL++++LAEL  AT NFK + VLG GGFG VFKGW++E   A S  G
Sbjct  55    DEAYPNGQILSTPNLRIFTLAELRAATKNFKSENVLGEGGFGKVFKGWLEEK--ASSRHG  112

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             SG +VA+KKL   S QGFEEW+SE+  LG   H N++KLLGYC E   LLLVYE+MQ GS
Sbjct  113   SGTVVAVKKLNSESFQGFEEWQSEIHFLGRLYHRNLVKLLGYCLEGQDLLLVYEFMQKGS  172

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFRK    + L W++RL IAIG A+GLAFLH SE+QVI RD K+SNILLD +Y+AK
Sbjct  173   LENHLFRKGSSVQPLPWEIRLKIAIGAAKGLAFLHTSEKQVIYRDFKASNILLDGSYSAK  232

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             ISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDV+ FGV+L E+LTGL 
Sbjct  233   ISDFGLAKLGPSDSQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVFGFGVVLAEILTGLH  292

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD   PSGQH L  W+KP L+   KL+SIMD R+EG+Y  +A  + AQL L+C+  +P+
Sbjct  293   ALDTNRPSGQHNLSDWIKPYLADRRKLRSIMDPRLEGKYPLKAAFRVAQLALKCIGPEPK  352

Query  1395  KRPSM  1409
             +RP M
Sbjct  353   QRPPM  357



>ref|XP_010437449.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Camelina sativa]
Length=433

 Score =   389 bits (1000),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 239/315 (76%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE SN     +G IL +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD
Sbjct  56    FSEAASECSNGIISDSGLILESPNLKVYTFLDLKTATKNFKPDSMLGQGGFGKVYRGWVD  115

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TL+PS+ GSG+IVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  116   AKTLSPSKAGSGVIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  175

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR+N   +   W+LR+ IAIG ARGLAFLH  +R+VI RD K+SN
Sbjct  176   LVYEFMPRGSLENHLFRRN---EPFPWELRIKIAIGAARGLAFLHGLQREVIYRDFKASN  232

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  Y+AKISDFGLAKLGP+ E SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  233   ILLDSTYDAKISDFGLAKLGPADEKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYAFGV  292

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGL++ + K P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++
Sbjct  293   VLLEVMTGLKAHNIKRPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTKVATEMARI  352

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  353   TLSCIEPDPKNRPHM  367



>gb|KGN43339.1| hypothetical protein Csa_7G024130 [Cucumis sativus]
Length=487

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 235/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S+A  ++   +G ILP+ NL+ YSLAEL+ AT NF+ + +LG GGFG V+KGW++E  L
Sbjct  119   FSAASGDEVFPHGQILPSSNLREYSLAELKAATKNFRAEALLGEGGFGKVYKGWLEEKGL  178

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                  G+ M++A+KKL   S+QG EEW+SEV  LG  SHPN++KLLGYCWE ++LLL YE
Sbjct  179   G--RKGNSMVIAVKKLKSDSVQGLEEWQSEVGFLGRLSHPNLVKLLGYCWEDHELLLTYE  236

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +      L WD RL IAIG ARGLAFLH S++QVI RD K+SNILLD
Sbjct  237   FMQKGSLENHLFGRGSAVTPLGWDTRLKIAIGAARGLAFLHTSDKQVIYRDFKASNILLD  296

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +Y AK+SDFGLAKLGPS   SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  297   GSYTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIE  356

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             MLTGLR+LD   P+GQ  L  W+KP LS+  KLK++MD R+EG+Y S +  Q AQL L+C
Sbjct  357   MLTGLRALDENRPTGQEHLTEWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQC  416

Query  1377  LESQPEKRPSM  1409
             +E + + RPSM
Sbjct  417   IEQEQKNRPSM  427



>ref|XP_006855749.1| hypothetical protein AMTR_s00044p00168360 [Amborella trichopoda]
 gb|ERN17216.1| hypothetical protein AMTR_s00044p00168360 [Amborella trichopoda]
Length=879

 Score =   403 bits (1035),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 235/314 (75%), Gaps = 1/314 (0%)
 Frame = +3

Query  471   EIYSSAESEDSN-ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDE  647
             E+ S  +SED    NG IL  PNLK Y+ AEL+ AT NFK D +LG GGFG VFKGWVDE
Sbjct  70    ELLSCEKSEDDAFPNGRILDNPNLKTYTYAELKTATKNFKPDTILGEGGFGRVFKGWVDE  129

Query  648   NTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLL  827
              TLAP++ G GMIVA+KKL   S+QG +EW+ EV  LG  SHPN++KLLGYCWE  +LLL
Sbjct  130   KTLAPAKSGLGMIVAVKKLNSESMQGLKEWQCEVNHLGRLSHPNLVKLLGYCWEEKELLL  189

Query  828   VYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNI  1007
             VYE+M  GSLENHLFR+    + L+W LRL IAIG A+GL FLH  E+ +I RD K++NI
Sbjct  190   VYEFMPKGSLENHLFRRGSSNEPLTWSLRLKIAIGAAKGLTFLHNLEKHIIYRDFKAANI  249

Query  1008  LLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVL  1187
             LLD NYNAKISDFGLAK GP G++SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+
Sbjct  250   LLDSNYNAKISDFGLAKFGPLGDDSHVTTRVMGTHGYAAPEYVATGHLYVKSDVYTFGVV  309

Query  1188  LLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLT  1367
             LLE+LTGLR+LD   P+ Q  LV W KP+L    KL+ +MD+R++ QY  +  L+  +L+
Sbjct  310   LLEILTGLRALDLNRPTSQINLVDWAKPLLGDRRKLEVLMDIRLDNQYPIKGALETCKLS  369

Query  1368  LRCLESQPEKRPSM  1409
             L+CL  +P KRP M
Sbjct  370   LKCLTPEPRKRPHM  383



>emb|CDX69153.1| BnaC01g03000D [Brassica napus]
Length=430

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE S      +G IL +PNLKVYS A+L  AT NFK + +LG GGFG V++GW+D
Sbjct  53    FSEAVSESSGGVMSYSGQILASPNLKVYSFADLVTATKNFKPESMLGQGGFGKVYRGWID  112

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVA+K+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  113   AKTLAPSKVGSGMIVAVKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  172

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR++   +   WDLR+ I IG ARGLAFLH  +R+VI RD K+SN
Sbjct  173   LVYEFMPKGSLENHLFRRS---EPFPWDLRIKIVIGAARGLAFLHGLQREVIYRDFKASN  229

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD +Y+AKISDFGLAKLGPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  230   ILLDSHYDAKISDFGLAKLGPSQEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGV  289

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGLR+ D K P+GQ  LV W++P L+   ++K IMD  + GQYSS+   +  ++
Sbjct  290   VLLEVMTGLRAHDPKRPNGQESLVDWLRPELTNRHRVKHIMDKGIIGQYSSKVAAEMGRI  349

Query  1365  TLRCLESQPEKRPSM  1409
             TL C++  P+ RP M
Sbjct  350   TLSCIKPDPKNRPHM  364



>emb|CDX75515.1| BnaA01g01870D [Brassica napus]
Length=427

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE S      +G IL +PNLKVYS A+L  AT NFK + +LG GGFG V++GW+D
Sbjct  51    FSEAVSESSGGVMSYSGQILASPNLKVYSFADLVTATKNFKPESMLGQGGFGKVYRGWID  110

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVA+K+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  111   AKTLAPSKVGSGMIVAVKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  170

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR++   +   WDLR+ I IG ARGLAFLH  +R+VI RD K+SN
Sbjct  171   LVYEFMPKGSLENHLFRRS---EPFPWDLRIKIVIGAARGLAFLHGLQREVIYRDFKASN  227

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD NY+AKISDFGLAKLGPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  228   ILLDSNYDAKISDFGLAKLGPSQEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGV  287

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGLR+ + K P+GQ  LV W++P L  + ++K IMD  + GQYSS+   +  ++
Sbjct  288   VLLEIMTGLRAHNPKRPNGQESLVDWLRPELVNKHRVKHIMDKGIVGQYSSKIAAEMGRI  347

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  348   TLSCIEPDPKNRPHM  362



>ref|XP_008781318.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=384

 Score =   386 bits (992),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 230/312 (74%), Gaps = 2/312 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             SS    +++  G IL  PNL++++ AEL+ AT NFK + V+G GGFG V+KGWVD+ TL 
Sbjct  51    SSVSDGEASPEGRILEAPNLRIFTFAELKRATRNFKPETVIGEGGFGRVYKGWVDDKTLN  110

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSH--PNVIKLLGYCWEYNKLLLVY  833
             P++ G GM+VA+KK+   SLQG E+W+SEV  LG  SH  PN++KLLGYCWE  +LLLVY
Sbjct  111   PAKSGMGMVVAVKKMIPESLQGLEQWQSEVNFLGRLSHQHPNLVKLLGYCWEDKELLLVY  170

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E++  G L NHLFR+    + LSW LRL IAIG ARGLAFLH SER++I RD K+SNILL
Sbjct  171   EFVARGILANHLFRRGAAFEPLSWSLRLKIAIGAARGLAFLHTSERKLIHRDFKASNILL  230

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D NYN KI+DFGLAK GPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  231   DSNYNPKIADFGLAKHGPSCGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLL  290

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EML+G R+ D   PS QH LV W  P L+   +L  +MD R+EG+Y S+   QAAQLTL+
Sbjct  291   EMLSGQRAYDRSRPSKQHNLVDWGTPYLADRRRLARLMDPRLEGRYPSKGAFQAAQLTLK  350

Query  1374  CLESQPEKRPSM  1409
             CL   P+ RPSM
Sbjct  351   CLAGDPKSRPSM  362



>ref|XP_009151452.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Brassica rapa]
Length=427

 Score =   387 bits (995),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 236/315 (75%), Gaps = 7/315 (2%)
 Frame = +3

Query  477   YSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE S      +G IL +PNLKVYS A+L  AT NFK + +LG GGFG V++GW+D
Sbjct  51    FSEAVSESSGGVMSYSGQILASPNLKVYSFADLVTATKNFKPESMLGQGGFGKVYRGWID  110

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
               TLAPS+ GSGMIVA+K+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +LL
Sbjct  111   AKTLAPSKVGSGMIVAVKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKELL  170

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYE+M  GSLENHLFR++   +   WDLR+ I IG ARGLAFLH  +R+VI RD K+SN
Sbjct  171   LVYEFMPKGSLENHLFRRS---EPFPWDLRIKIVIGAARGLAFLHGLQREVIYRDFKASN  227

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD NY+AKISDFGLAKLGPS E SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  228   ILLDSNYDAKISDFGLAKLGPSQEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAFGV  287

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLE++TGLR+ + K P+GQ  LV W++P L  + ++K IMD  + GQYSS+   +  ++
Sbjct  288   VLLEVMTGLRAHNPKRPNGQESLVDWLRPELVNKHRVKHIMDKGIVGQYSSKVAAEMGRI  347

Query  1365  TLRCLESQPEKRPSM  1409
             TL C+E  P+ RP M
Sbjct  348   TLFCIEPDPKNRPHM  362



>ref|XP_006283798.1| hypothetical protein CARUB_v10004888mg [Capsella rubella]
 gb|EOA16696.1| hypothetical protein CARUB_v10004888mg [Capsella rubella]
Length=424

 Score =   387 bits (994),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 239/317 (75%), Gaps = 9/317 (3%)
 Frame = +3

Query  477   YSSAESEDS----NANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             +S A SE S    + +G +L +PNLKVY+  +L+ AT NFK + +LG GGFG V++GWVD
Sbjct  49    FSGAASECSAGKISDSGLLLESPNLKVYTFLDLKTATKNFKPESMLGQGGFGKVYRGWVD  108

Query  645   ENTLAPSEP--GSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNK  818
               TLAPS P  GSGMIVAIK+L   S+QGF EW SEV  LGM SHPN++KLLGYC E  +
Sbjct  109   AKTLAPSNPKSGSGMIVAIKRLNSESVQGFAEWRSEVNFLGMLSHPNLVKLLGYCREDKE  168

Query  819   LLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKS  998
             LLLVYE+M  GSLENHLFR+N   +   WDLR+ IAIG ARGLAFLH  +R+VI RD K+
Sbjct  169   LLLVYEFMPRGSLENHLFRRN---EPFPWDLRIKIAIGAARGLAFLHGLQREVIYRDFKA  225

Query  999   SNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCF  1178
             SNILLD NY+AKISDFGLAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDVY F
Sbjct  226   SNILLDSNYDAKISDFGLAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYAF  285

Query  1179  GVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAA  1358
             GV+LLE++TG ++ + K P GQ  LV W+ P LS + ++K IMD  ++GQY+++A  + A
Sbjct  286   GVVLLEVMTGQKAHNTKRPRGQESLVDWLGPELSSKHRVKQIMDKGIKGQYTTKAATEMA  345

Query  1359  QLTLRCLESQPEKRPSM  1409
             ++TL C+E  P+ RP M
Sbjct  346   RITLACIEPDPKNRPHM  362



>ref|XP_003563244.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=414

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 228/310 (74%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S   ++D    G IL +PNL++++ AEL+ AT NF+ + VLG GGFG V+KGWVDE  + 
Sbjct  56    SGVSTDDGYPEGEILESPNLRIFTFAELKSATKNFRPETVLGEGGFGKVYKGWVDEKAMN  115

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+  +G ++A+KKL   S+QG E+W+SEV  LG  SHPN++KLLGYC E N+LLLVYEY
Sbjct  116   PSKMSTGGVIAVKKLNSESVQGMEQWQSEVNFLGRISHPNLVKLLGYCMEDNELLLVYEY  175

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + L W LRL I +G ARGLAFLH SERQVI RD K+SNILLD 
Sbjct  176   MAKGSLENHLFRRGAVYEPLPWSLRLKILMGAARGLAFLHSSERQVIYRDFKASNILLDS  235

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             ++NAK+SDFGLAK GP    SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  236   HFNAKLSDFGLAKHGPDDGESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEM  295

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L GLR+LD   P+ +  LV W KP+L+   +L  +MD R+EGQY +     AAQLTL+CL
Sbjct  296   LCGLRALDPSRPTEKLNLVNWAKPLLADRRRLSQLMDSRLEGQYHARGAFHAAQLTLKCL  355

Query  1380  ESQPEKRPSM  1409
                P+ RPSM
Sbjct  356   SGDPKSRPSM  365



>ref|XP_002307794.2| hypothetical protein POPTR_0005s27330g [Populus trichocarpa]
 gb|EEE94790.2| hypothetical protein POPTR_0005s27330g [Populus trichocarpa]
Length=447

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 253/379 (67%), Gaps = 18/379 (5%)
 Frame = +3

Query  294   MGNFVGSRTA---DSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTP  464
             MGN  GS      +S S   PS  K S   S  + +G        E E    N       
Sbjct  1     MGNCWGSTPVTNHNSPSATKPSTPKTSANHSKENGLGGRSSSDRKEKESVKING------  54

Query  465   NLEIYSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFK  632
                +Y   + +D  A     G ++     K+++LAEL+ AT NF+ D VLG GGFG VFK
Sbjct  55    ---MYVKNKDKDRTAIIPPRGQVMAILGPKLFTLAELKSATRNFRPDTVLGEGGFGRVFK  111

Query  633   GWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEY  812
             GWVDE T AP++ G GM VA+KK    S QG +EW+SEVKLLG FSHPN+++LLGYCWE 
Sbjct  112   GWVDEKTYAPAKVGCGMAVAVKKSNPDSSQGLQEWQSEVKLLGKFSHPNLVRLLGYCWEE  171

Query  813   NKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDL  992
             N+ LLVYEYMQ GSLE HLFRK  G + L W++R+ IAIG A GLAFLH SE+ VI RD 
Sbjct  172   NQFLLVYEYMQKGSLEKHLFRK--GAEPLPWNVRIKIAIGAAEGLAFLHTSEKSVIYRDF  229

Query  993   KSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVY  1172
             K+SNILLD  +NAK+SDFGLAK GP   NSHVTTRV+GT GY APEY+ TG+LYVKSDVY
Sbjct  230   KTSNILLDGAFNAKLSDFGLAKFGPLNGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVY  289

Query  1173  CFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQ  1352
              FGV+LLE+LTGL++LD   P  Q  LV + +P LS + KLK IMD R+E QY  +A +Q
Sbjct  290   GFGVVLLELLTGLKALDTNRPIWQQNLVEFARPSLSDKRKLKKIMDPRLEEQYPIKAAVQ  349

Query  1353  AAQLTLRCLESQPEKRPSM  1409
             AA+L L+CLES P+ RPSM
Sbjct  350   AAELILQCLESDPKSRPSM  368



>ref|XP_010066335.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW64210.1| hypothetical protein EUGRSUZ_G01860 [Eucalyptus grandis]
Length=414

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 233/312 (75%), Gaps = 2/312 (1%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             ++S +  ++   NG IL  PNL++Y+ +EL+ AT NFK DMVLG GGFG V+KGW++E  
Sbjct  45    LFSVSSGDEVFPNGQILQHPNLRIYTFSELKAATKNFKSDMVLGEGGFGKVYKGWLEEKP  104

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
                S  GSG ++A+KKL   SLQG EEW+SE+  LG  SHPN++KLLGYC+E  +LLLVY
Sbjct  105   STRS--GSGSVIAVKKLNSESLQGVEEWQSEINFLGRLSHPNLVKLLGYCYEDTELLLVY  162

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             E+MQ GSLENHLF +    + L  ++R+ IA+G ARGL FLH S++ VI RD K+SNILL
Sbjct  163   EFMQKGSLENHLFGRGSAVQPLPMEIRIKIALGAARGLTFLHTSDKHVIYRDFKASNILL  222

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D +YNAK+SDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L 
Sbjct  223   DGSYNAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLA  282

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             EMLTG R+LD   PSG+H LV WVKP L+   KLK++MD  +EG+Y S+   Q AQL LR
Sbjct  283   EMLTGQRALDLNRPSGKHNLVDWVKPYLADRRKLKTLMDSNLEGKYPSKTVFQVAQLALR  342

Query  1374  CLESQPEKRPSM  1409
             CL  +P+ RPSM
Sbjct  343   CLAPEPKCRPSM  354



>ref|XP_002439066.1| hypothetical protein SORBIDRAFT_10g030880 [Sorghum bicolor]
 gb|EER90433.1| hypothetical protein SORBIDRAFT_10g030880 [Sorghum bicolor]
Length=419

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/305 (61%), Positives = 229/305 (75%), Gaps = 0/305 (0%)
 Frame = +3

Query  495   EDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPG  674
             +D    G IL +PNLK+Y+ AEL+ AT NF+ + VLG GGFG V+KGWVDE TL PS+  
Sbjct  65    DDDYPEGQILESPNLKIYTFAELKSATKNFRPETVLGEGGFGKVYKGWVDEKTLNPSKAS  124

Query  675   SGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             +G++VA+KKL   S+QG E+W+SEV  LG  SHPN++KLLGY  + N+LLLVYE+M  GS
Sbjct  125   TGIMVAVKKLNPESVQGMEQWQSEVNFLGRISHPNLVKLLGYSMDDNELLLVYEFMSKGS  184

Query  855   LENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAK  1034
             LENHLFR+    + L W LRL I IG ARGLAFLH SERQ+I RD K+SNILLD ++NAK
Sbjct  185   LENHLFRRGAVSEPLPWSLRLKILIGAARGLAFLHSSERQIIYRDFKASNILLDSHFNAK  244

Query  1035  ISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLR  1214
             +SDFGLAK GP G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM++GLR
Sbjct  245   LSDFGLAKHGPDGGESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEMISGLR  304

Query  1215  SLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPE  1394
             +LD    S +  LV W +P+LS   KL  +MD  +EGQY+ +  L AAQLTL+CL   P+
Sbjct  305   ALDPSRQSEKVNLVNWARPLLSDRRKLSQLMDSGLEGQYNPKGALLAAQLTLKCLNGDPK  364

Query  1395  KRPSM  1409
              RPSM
Sbjct  365   SRPSM  369



>ref|XP_010548159.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=411

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 249/355 (70%), Gaps = 6/355 (2%)
 Frame = +3

Query  345   PSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTPNLEIYSSAESEDSNANGTIL  524
             PS++  +   + +S+  S    S A S G N ++      N    +S+  ++   +G IL
Sbjct  8     PSDSPATPGSTVISKSISNTTASTATSGGSNISS------NGGFSASSGGDEPYPDGQIL  61

Query  525   PTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
               PNL+V++L EL+ AT NFK + VLG GGFG VFKGW+++   +    G+  +VA+K+L
Sbjct  62    SAPNLRVFTLTELKAATKNFKSENVLGEGGFGKVFKGWLEDKASSTGRHGTATVVAVKRL  121

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                S QGFEEW+SEV  LG  SHPN+++L GYC E   LLLVYE+MQ GSLENHLFR+  
Sbjct  122   NSESFQGFEEWQSEVHFLGRLSHPNLVRLSGYCLEGRDLLLVYEFMQKGSLENHLFRRGS  181

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
               + L W+ RL IAIG A+GLAFLH SE++VI RD K+SNILLD +Y AKISDFGLAKLG
Sbjct  182   AIQPLPWETRLRIAIGAAKGLAFLHASEKKVIYRDFKASNILLDGSYTAKISDFGLAKLG  241

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             PS   SHVTTRV+GT GY APEY+ TG+LYVKSDV+ FGV+L E+LTGLR++D   PSGQ
Sbjct  242   PSESQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVFGFGVVLAEILTGLRAVDTSRPSGQ  301

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             H L  W+KP L+   KL+S+MD R+EG+YS +A  + A+L L+C+  +P+KRP M
Sbjct  302   HNLSEWIKPYLADRRKLRSVMDPRLEGKYSIKAAFRVAELALKCIGPEPKKRPPM  356



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 244/329 (74%), Gaps = 0/329 (0%)
 Frame = +3

Query  423   SEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVL  602
             S+  N+    L + N ++ + +  +   + G IL + N+K Y+LAEL+ AT NF+ D VL
Sbjct  21    SKNSNSAGNDLSSTNSKVSTGSVPQTPRSEGEILKSTNVKSYTLAELKSATRNFRPDSVL  80

Query  603   GTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNV  782
             G GGFG+VFKGW+DEN+LAP++PG+G+++A+K+L + S QG  EW +EV  LG FSHP++
Sbjct  81    GEGGFGSVFKGWIDENSLAPAKPGTGIVIAVKRLNQESFQGHREWLAEVNYLGQFSHPHL  140

Query  783   IKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHC  962
             ++L+GYC E    LLVYE+M  GSLENHLFR+    + LSW LRL +A+  A+GLAFLH 
Sbjct  141   VRLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWSLRLKVALDAAKGLAFLHS  200

Query  963   SERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLET  1142
             SE +VI RD K+SNILLD +YNAK+SDFGLAK GP+G+ SHV+TRV+GT GY APEYL T
Sbjct  201   SETKVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPTGDKSHVSTRVMGTYGYAAPEYLAT  260

Query  1143  GYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRME  1322
             G+L  KSDVY +GV+LLEML+G R++D   PSGQH LV W KP L+ + K+ S++D R+E
Sbjct  261   GHLTTKSDVYSYGVVLLEMLSGKRAVDKNRPSGQHSLVEWAKPYLANKRKVFSVLDSRLE  320

Query  1323  GQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             GQYSS+   + A L LRCL ++ + RP+M
Sbjct  321   GQYSSDESYRVATLALRCLSTESKYRPNM  349



>ref|XP_010536475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
 ref|XP_010536476.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=462

 Score =   387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 229/301 (76%), Gaps = 3/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
             A+G I+ TP+LK+++LAEL  AT NF+ D ++G GGFG VFKGWVD+ TL+PS+ G G+ 
Sbjct  122   ASGKIV-TPDLKMFTLAELRTATRNFRPDSMIGEGGFGRVFKGWVDDKTLSPSKVGVGIP  180

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEYM  GSLENH
Sbjct  181   VAVKKSNPDSSQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEDNQFLLVYEYMPKGSLENH  240

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LF K  G + L+W  RL IAIG A GLAFLH SE+ VI RD K+SNILLD N++AK+SDF
Sbjct  241   LFAK--GAEPLTWSTRLKIAIGAAEGLAFLHNSEKSVIYRDFKASNILLDSNFHAKLSDF  298

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAKLGP   +SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD 
Sbjct  299   GLAKLGPINGHSHVTTRVMGTYGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDP  358

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               PS QH LV W KP L+ + KLK IMD R++ +Y   A +Q A L LRC+E+ P+ RPS
Sbjct  359   TRPSAQHNLVEWAKPCLTDKKKLKKIMDPRLDRKYPVSAVVQTAALILRCIEADPKNRPS  418

Query  1407  M  1409
             M
Sbjct  419   M  419



>ref|XP_011074087.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Sesamum indicum]
Length=423

 Score =   385 bits (988),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 224/294 (76%), Gaps = 1/294 (0%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TPNLK+++L +L+ AT NF+ D VLG GGFG VFKG++DE T APS  G GM VA+KK  
Sbjct  60    TPNLKMFTLEDLKSATRNFRPDTVLGEGGFGRVFKGYIDEKTYAPSRVGVGMPVAVKKSN  119

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG +EW++EVK LG FSHPN++KLLGYCWE  + LLVYEYMQ GSLENHLFRK+  
Sbjct  120   PDSEQGLKEWQAEVKFLGKFSHPNLVKLLGYCWEERQFLLVYEYMQKGSLENHLFRKDAA  179

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              + + WD+R+NIAIG ARGLAFLH +E+QVI RD K+SNILLD  YNAK+SDFGLAKLGP
Sbjct  180   -EPIPWDVRINIAIGAARGLAFLHNTEKQVIYRDFKASNILLDAEYNAKLSDFGLAKLGP  238

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                NSHVTT+V+GT GY APEY+ TG+LYVKSDVY FGV+LLE++TGLR LD   P GQ 
Sbjct  239   VDGNSHVTTKVVGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIITGLRVLDLNRPGGQT  298

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP L  + KL+ ++D R++G Y  +A   AA+L L CLE  P+ RP M
Sbjct  299   NLVEWAKPSLPDKKKLRKLIDPRLQGNYPPKAAYGAAELILSCLEPDPKCRPGM  352



>ref|NP_001148215.1| protein kinase APK1B [Zea mays]
 gb|ACG30206.1| protein kinase APK1B [Zea mays]
Length=466

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 229/311 (74%), Gaps = 7/311 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D  A+G IL  PNL+V++ AEL+ AT +FK D VLG GGFG V+KGWVDE T+ P+   S
Sbjct  88    DRQADGRILEAPNLRVFTFAELKAATRSFKPDTVLGEGGFGRVYKGWVDERTMGPARNDS  147

Query  678   G-MIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             G + VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GS
Sbjct  148   GGLPVAVKKLNPESLQGAQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAKGS  207

Query  855   LENHLF----RKNVGR--KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             LENHLF    RK  G   + L W LRL I  G ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  208   LENHLFGSEPRKGGGGAVQPLPWSLRLRIVTGAARGLAFLHSSEKHVIYRDFKASNILLD  267

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              ++NAK+SD GLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  268   THFNAKLSDLGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  327

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   P+ QH LV W KP L+   KL  +MD R+EGQY S    +AAQLTLRC
Sbjct  328   VLTGLRALDTDRPTAQHSLVDWAKPYLADRRKLARLMDPRLEGQYPSRGAQRAAQLTLRC  387

Query  1377  LESQPEKRPSM  1409
             L +  + RPSM
Sbjct  388   LAADHKNRPSM  398



>ref|XP_009764652.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana sylvestris]
Length=391

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/308 (61%), Positives = 232/308 (75%), Gaps = 5/308 (2%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E E +  +G I+ TPNLKV+SLAEL+ AT NF+ D +LG GGFG VFKGW+DE TLAPS 
Sbjct  53    ELEATTTSGKIV-TPNLKVFSLAELKSATRNFRPDTMLGEGGFGRVFKGWIDEKTLAPSR  111

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCW-EYNKLLLVYEYMQ  845
              G GM VA+KK    S QG +EW++EVK LG FSHPN++KL+GYC  E  + LLVYE+MQ
Sbjct  112   VGVGMAVAVKKSNPDSEQGLKEWQAEVKFLGKFSHPNLVKLIGYCCCEEKEFLLVYEHMQ  171

Query  846   NGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENY  1025
              GSLE HLFR N   + LSWD RL I IG ARGL FLH +E+QVI RD K+SNILLDE+Y
Sbjct  172   KGSLERHLFRSN---ETLSWDTRLKIVIGAARGLTFLHTTEKQVIYRDFKASNILLDEDY  228

Query  1026  NAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLT  1205
             NAK+SDFGLAKLGP   NSHV+TRV+GT GY APEY+ +G+LYV SDVY FGV+LLE++T
Sbjct  229   NAKLSDFGLAKLGPINGNSHVSTRVVGTYGYAAPEYVASGHLYVNSDVYGFGVVLLEIIT  288

Query  1206  GLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLES  1385
             GLR LD   P+GQ  LV W KP+L  + K + +MD +++G+Y   A  Q AQL L+CL+S
Sbjct  289   GLRVLDLTRPTGQLDLVDWAKPLLPDKRKPRKMMDSKIQGRYPINAAFQIAQLILQCLDS  348

Query  1386  QPEKRPSM  1409
              P+ RPSM
Sbjct  349   DPKNRPSM  356



>ref|XP_010094560.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
 gb|EXB56314.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
Length=441

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 205/383 (54%), Positives = 259/383 (68%), Gaps = 9/383 (2%)
 Frame = +3

Query  264   IYHSSTAV*SMGNFVGSRTADSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNAN  443
             I HS+ A  +  +F+ +++ DS    L     G+T  S     G   ++ A +       
Sbjct  10    INHSTPA--TTKSFISNKSKDS----LKKYGLGATKRSEKQNGGGEEEIRAVDHGKATMT  63

Query  444   AKCL-PTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFG  620
             A       N E  + +E+     N   + TPNLK ++L+EL+ AT +F+ D VLG GGFG
Sbjct  64    AASENDNNNRETTTRSEALPLPPNSGKIITPNLKSFTLSELKKATRDFRPDTVLGEGGFG  123

Query  621   TVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGY  800
              VFKGW+DE T APS  G GM VA+KK    S QG  EW++EVK LG F HPN++KLLGY
Sbjct  124   RVFKGWIDEKTYAPSRVGVGMAVAVKKSNSDSSQGLSEWQAEVKFLGKFCHPNLVKLLGY  183

Query  801   CWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVI  980
             CWE N+ LLVYEYMQ GSLENHLFRK  G + LSW  RL IAIG ARGLAFLH SE+ VI
Sbjct  184   CWEENQFLLVYEYMQKGSLENHLFRK--GAEPLSWSTRLKIAIGAARGLAFLHNSEKSVI  241

Query  981   CRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVK  1160
              RD K+SNILLD NY+AK+SDFGLAKLGP   NSHVTTRV+GT GY APEY+ TG+LYVK
Sbjct  242   YRDFKTSNILLDGNYSAKLSDFGLAKLGPVNGNSHVTTRVMGTYGYAAPEYVATGHLYVK  301

Query  1161  SDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSE  1340
             SDV+ FGV+LLE+LTG+R+LD   PSGQ+ L+ W +P L+++ KLK IMD  +   Y  +
Sbjct  302   SDVFGFGVVLLELLTGIRALDTNRPSGQYVLIDWARPSLTEKKKLKKIMDKGLGEGYPIK  361

Query  1341  AELQAAQLTLRCLESQPEKRPSM  1409
               +Q A L ++CLES+P+ RPSM
Sbjct  362   GAMQVAALIIKCLESEPKSRPSM  384



>ref|XP_007142571.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
 gb|ESW14565.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
Length=416

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 230/311 (74%), Gaps = 5/311 (2%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S A  +     G ILP  NL+++S A+L+ AT NF+ D+VLG GGFG VFKGW++E   
Sbjct  60    FSVASGDQPYPTGQILPASNLRIFSFADLKAATRNFRPDLVLGEGGFGKVFKGWLEEK--  117

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
                   SG ++A+KKL   S QG EEW SE+  LG  SHPN++KLLGYC E  +LLLVYE
Sbjct  118   --GNSKSGTVIAVKKLNSESSQGMEEWRSEINFLGRLSHPNLVKLLGYCLEETELLLVYE  175

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +M+ GSLENHLF +    + L WD+RL IAIG ARGLAFLH S++ VI RD K+SNILLD
Sbjct  176   FMRKGSLENHLFGRGSAVQPLPWDIRLKIAIGAARGLAFLHTSQK-VIYRDFKASNILLD  234

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              +YNAKISDFGLAKLGPS   SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+L+E
Sbjct  235   GSYNAKISDFGLAKLGPSASQSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLVE  294

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   PSGQH L  WVKP L    KLK +MD R+EG++ S+A  + AQL L+C
Sbjct  295   ILTGLRALDPNRPSGQHNLTDWVKPYLHDRRKLKGVMDSRLEGKFPSKAAFRIAQLALKC  354

Query  1377  LESQPEKRPSM  1409
             L ++P++RPSM
Sbjct  355   LATEPKQRPSM  365



>emb|CAB80276.1| protein kinase-like protein [Arabidopsis thaliana]
Length=415

 Score =   383 bits (983),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G +L +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD  TLAPS  GSGMIV
Sbjct  58    SGKLLESPNLKVYNFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIV  117

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK+L   S+QGF EW SEV  LGM SH N++KLLGYC E  +LLLVYE+M  GSLE+HL
Sbjct  118   AIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHL  177

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N       WDLR+ I IG ARGLAFLH  +R+VI RD K+SNILLD NY+AK+SDFG
Sbjct  178   FRRN---DPFPWDLRIKIVIGAARGLAFLHSLQREVIYRDFKASNILLDSNYDAKLSDFG  234

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDV+ FGV+LLE++TGL + + K
Sbjct  235   LAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTK  294

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++TL C+E  P+ RP M
Sbjct  295   RPRGQESLVDWLRPELSNKHRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHM  354



>gb|EEC81341.1| hypothetical protein OsI_24527 [Oryza sativa Indica Group]
Length=943

 Score =   399 bits (1024),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/310 (62%), Positives = 236/310 (76%), Gaps = 0/310 (0%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             S   ++D+  +G IL +PNL++++ AEL+ AT NF+ D VLG GGFG V+KGWVDE T+ 
Sbjct  59    SGVSTDDAYPDGQILESPNLRIFTFAELKNATKNFRTDTVLGEGGFGKVYKGWVDERTMN  118

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
              S+  +G++VA+KKL   S+QG E+WESEV  LG  SHPN++KLLGYC + ++LLLVYE+
Sbjct  119   SSKSSTGVVVAVKKLNPESVQGTEQWESEVNFLGRISHPNLVKLLGYCKDNDELLLVYEF  178

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             M  GSLENHLFR+    + L W LRL I IG ARGLAFLH SERQ+I RD K+SNILLD 
Sbjct  179   MAKGSLENHLFRRGAVYEPLPWSLRLKILIGAARGLAFLHSSERQIIYRDFKASNILLDS  238

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             N+NAK+SDFGLAK GP G  SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  239   NFNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  298

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             L+GLR+LD   PSG+  LV W KP+L+   KL  +MD R+EGQY S   LQAAQLTL+CL
Sbjct  299   LSGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHSRGALQAAQLTLKCL  358

Query  1380  ESQPEKRPSM  1409
                P+ RPSM
Sbjct  359   SGDPKSRPSM  368



>ref|XP_010663977.1| PREDICTED: protein kinase APK1B, chloroplastic [Vitis vinifera]
Length=418

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 230/299 (77%), Gaps = 3/299 (1%)
 Frame = +3

Query  513   GTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVA  692
             GTI+ TPNLK+++ AEL+ AT NF+   +LG GGFG VFKGWVDE T AP++   G+ VA
Sbjct  60    GTII-TPNLKMFTFAELKSATRNFRPHTMLGEGGFGRVFKGWVDEKTYAPTKVSVGIPVA  118

Query  693   IKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLF  872
             +KK    S QG +EW+SEVK LG F+HPN++KLLGYC E  + LLVYEYM  GSLENHLF
Sbjct  119   VKKSNPESEQGLKEWQSEVKFLGKFTHPNLVKLLGYCCEDQQFLLVYEYMHKGSLENHLF  178

Query  873   RKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGL  1052
             ++  G ++L+W++RL IAIG ARGLAFLH SE+ VI RD KSSNILLD +YNAK+SDFGL
Sbjct  179   KR--GAESLTWEIRLKIAIGAARGLAFLHTSEKTVIYRDFKSSNILLDGDYNAKLSDFGL  236

Query  1053  AKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*  1232
             AKLGPS  +SHVTT+++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG ++LD   
Sbjct  237   AKLGPSDGDSHVTTQIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTGKQTLDINR  296

Query  1233  PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             P GQ  LV W KP+L  + KLK IMD R+  QY  +A  Q A+L L+CLES P+ RPSM
Sbjct  297   PPGQLNLVEWTKPLLPNKRKLKKIMDPRLRDQYPLKAATQVAELILKCLESDPKNRPSM  355



>ref|XP_002300641.2| hypothetical protein POPTR_0002s01040g [Populus trichocarpa]
 gb|EEE79914.2| hypothetical protein POPTR_0002s01040g [Populus trichocarpa]
Length=465

 Score =   384 bits (987),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/398 (53%), Positives = 259/398 (65%), Gaps = 29/398 (7%)
 Frame = +3

Query  261   SIYHSSTAV*SMGNFVGSRTADSIS-------GALPSNNKGSTAFSALSRIGSYRQLSAA  419
             SIYHSS             T   IS       G  P  N  S   +  S   + R  S  
Sbjct  22    SIYHSSNP----------ETISKISIRMGNCWGTTPVTNHNSPTPTKPSTPETTRNHSKE  71

Query  420   ESEGGNANAKCLPTPNLEIYSSAESEDSN--------ANGTILPTPNLKVYSLAELEVAT  575
                G  ++++C    + +     E +  +        A+G I+  P  K+++LAEL+ AT
Sbjct  72    NGLGSRSSSQCKAKEDDKFGMGMEKKGKDEIAMISAAASGQIILAP--KLFTLAELKSAT  129

Query  576   SNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKL  755
              NFK + VLG GGFG VFKGWVDE T AP++ G+GM VA+KK    S QG EEW+SEV+ 
Sbjct  130   RNFKPNTVLGEGGFGRVFKGWVDEKTYAPAKVGTGMAVAVKKSSPESSQGLEEWQSEVEF  189

Query  756   LGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGV  935
             LG  SHPN++KLLGYCWE    LLVYEYMQ GSLE HLFRK  G + L+WD+RL IAIG 
Sbjct  190   LGKLSHPNLVKLLGYCWEDEHFLLVYEYMQKGSLEKHLFRK--GAEPLAWDIRLKIAIGA  247

Query  936   ARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEG  1115
             A+GLAFLH S++ VI RD K+SNILLD  YNAK+SDFGLAKLGP   +SHVTTR++GT G
Sbjct  248   AQGLAFLHTSDKSVIYRDFKTSNILLDGAYNAKLSDFGLAKLGPLNGDSHVTTRIMGTYG  307

Query  1116  YIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKL  1295
             Y APEYL TG+LYVKSDVY FGV+LLE+LTGL++LD   PSGQH LV + +P L +  KL
Sbjct  308   YAAPEYLATGHLYVKSDVYGFGVVLLELLTGLKALDTNRPSGQHNLVEYARPFLLERRKL  367

Query  1296  KSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             K IMD  +E +Y  +A +QAA+L LRCLES    RPSM
Sbjct  368   KKIMDPGLEERYPLKAAMQAAELILRCLESDLRIRPSM  405



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   382 bits (981),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 240/329 (73%), Gaps = 0/329 (0%)
 Frame = +3

Query  423   SEGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVL  602
             S+  N+    L + N ++ +++      + G IL + NLK Y+LAEL+ AT NF+ D VL
Sbjct  21    SKNSNSAGNDLSSTNSKVSAASVPPTPRSEGEILQSSNLKSYTLAELKSATRNFRPDSVL  80

Query  603   GTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNV  782
             G GGFG+VFKGW+DENTL  ++PG+G+++A+K+L + S QG  EW +EV  LG FSHP++
Sbjct  81    GEGGFGSVFKGWIDENTLVAAKPGTGIVIAVKRLNQESFQGHREWLAEVNYLGQFSHPHL  140

Query  783   IKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHC  962
             ++L+GYC E    LLVYE+M  GSLENHLFR+    + LSW LRL +A+  A+GLAFLH 
Sbjct  141   VRLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWSLRLKVALDAAKGLAFLHS  200

Query  963   SERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLET  1142
              E +VI RD K+SNILLD +YNAK+SDFGLAK GP+G+ SHV+TRV+GT GY APEYL T
Sbjct  201   DENKVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPTGDKSHVSTRVMGTYGYAAPEYLAT  260

Query  1143  GYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRME  1322
             G+L  KSDVY FGV+LLEML+G R++D   PSGQH LV W KP L+ + K+ S++D R+E
Sbjct  261   GHLTTKSDVYSFGVVLLEMLSGKRAVDKNRPSGQHSLVEWAKPYLANKRKVFSVLDSRLE  320

Query  1323  GQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             GQYSS+   + A L LRCL ++   RP+M
Sbjct  321   GQYSSDESYRVATLALRCLSTESRYRPNM  349



>ref|XP_004500869.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=383

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 235/311 (76%), Gaps = 4/311 (1%)
 Frame = +3

Query  480   SSAESED-SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             SSA ++D +  +G I+ + NLK+++L EL+ AT NF+ D ++G GGFG VFKGW+D N+ 
Sbjct  25    SSAGADDGAKVDGKIV-SQNLKMFTLEELKSATRNFRPDTMVGEGGFGRVFKGWIDPNSC  83

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
              PS+ G G+ VA+KK    SLQG +EW+SEVK LG FSHPN++KLLGYCWE ++ LLVYE
Sbjct  84    RPSKVGVGIPVAVKKSNPDSLQGLQEWQSEVKFLGKFSHPNLVKLLGYCWEEDQFLLVYE  143

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             YMQ GSLE+HLFRK  G +ALSWD+RL IAIG ARGLAFLH S+  VI RD KSSNILLD
Sbjct  144   YMQKGSLESHLFRK--GPEALSWDIRLKIAIGAARGLAFLHTSQNSVIYRDFKSSNILLD  201

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              ++NAK+SDFGLAK GP    SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  202   GDFNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  261

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             MLTGL +LD   P+ +  LV +    LS   KLK+IMD RM  QYS  A LQ + L L+C
Sbjct  262   MLTGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKC  321

Query  1377  LESQPEKRPSM  1409
             LES P+ RPSM
Sbjct  322   LESDPKNRPSM  332



>ref|XP_003523529.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
 gb|KHN33798.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=370

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 220/294 (75%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
              P L  Y+L EL  AT NF+ D VLG GGFG VFKGW+D+NT  PS  G G+ VA+KK  
Sbjct  53    VPKLIKYTLDELRSATRNFRPDTVLGEGGFGRVFKGWIDKNTFKPSRVGVGIPVAVKKSN  112

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               SLQG EEW+SEV+LLG FSHPN++KL+GYCWE ++ LLVYEYMQ GSLE+HLFR+  G
Sbjct  113   PDSLQGLEEWQSEVQLLGKFSHPNLVKLIGYCWEESQFLLVYEYMQKGSLESHLFRR--G  170

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              K LSWD+RL IAIG ARGLAFLH SE+ VI RD KSSNILLD ++NAK+SDFGLAK GP
Sbjct  171   PKPLSWDIRLKIAIGAARGLAFLHTSEKSVIYRDFKSSNILLDGDFNAKLSDFGLAKFGP  230

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                 SHVTTR++GT GY APEY+ TG+LY+KSDVY FGV+LLEMLTG  +LD   P+G  
Sbjct  231   VNGKSHVTTRIMGTYGYAAPEYMATGHLYIKSDVYGFGVVLLEMLTGRAALDTNQPTGMQ  290

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV      L  + +LK +MD  ME QYS  A  Q AQL L+CLES+P+KRPSM
Sbjct  291   NLVECTMSSLHAKKRLKEVMDPNMEEQYSLRAAFQIAQLILKCLESKPKKRPSM  344



>ref|XP_004500870.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=381

 Score =   380 bits (977),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 189/310 (61%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = +3

Query  480   SSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLA  659
             +S+  + +  +G I+ + NLK+++L EL+ AT NF+ D ++G GGFG VFKGW+D N+  
Sbjct  24    NSSADDGAKVDGKIV-SQNLKMFTLEELKSATRNFRPDTMVGEGGFGRVFKGWIDPNSCR  82

Query  660   PSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEY  839
             PS+ G G+ VA+KK    SLQG +EW+SEVK LG FSHPN++KLLGYCWE ++ LLVYEY
Sbjct  83    PSKVGVGIPVAVKKSNPDSLQGLQEWQSEVKFLGKFSHPNLVKLLGYCWEEDQFLLVYEY  142

Query  840   MQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
             MQ GSLE+HLFRK  G +ALSWD+RL IAIG ARGLAFLH S+  VI RD KSSNILLD 
Sbjct  143   MQKGSLESHLFRK--GPEALSWDIRLKIAIGAARGLAFLHTSQNSVIYRDFKSSNILLDG  200

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             ++NAK+SDFGLAK GP    SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  201   DFNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  260

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGL +LD   P+ +  LV +    LS   KLK+IMD RM  QYS  A LQ + L L+CL
Sbjct  261   LTGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKCL  320

Query  1380  ESQPEKRPSM  1409
             ES P+ RPSM
Sbjct  321   ESDPKNRPSM  330



>ref|NP_001190928.1| putative serine/threonine-protein kinase Cx32 [Arabidopsis thaliana]
 gb|AEE86539.1| putative serine/threonine-protein kinase Cx32 [Arabidopsis thaliana]
Length=420

 Score =   382 bits (981),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G +L +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD  TLAPS  GSGMIV
Sbjct  63    SGKLLESPNLKVYNFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIV  122

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK+L   S+QGF EW SEV  LGM SH N++KLLGYC E  +LLLVYE+M  GSLE+HL
Sbjct  123   AIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHL  182

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N       WDLR+ I IG ARGLAFLH  +R+VI RD K+SNILLD NY+AK+SDFG
Sbjct  183   FRRN---DPFPWDLRIKIVIGAARGLAFLHSLQREVIYRDFKASNILLDSNYDAKLSDFG  239

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDV+ FGV+LLE++TGL + + K
Sbjct  240   LAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTK  299

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++TL C+E  P+ RP M
Sbjct  300   RPRGQESLVDWLRPELSNKHRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHM  359



>gb|KCW55673.1| hypothetical protein EUGRSUZ_I01524 [Eucalyptus grandis]
Length=405

 Score =   381 bits (979),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 237/311 (76%), Gaps = 3/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  ++++ +G ILP PNL++++ AEL+VAT NFK D +LG GGFG VFKGW++E   
Sbjct  18    FSASSGDETSPHGQILPHPNLRIFTFAELKVATKNFKSDSLLGEGGFGKVFKGWLEEKPS  77

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             A +  GSG+++A+K+L   S QGF EW++E+  LG  SHPN++KL+GYC E  +LLLVYE
Sbjct  78    AKN--GSGLVIAVKRLKSESAQGFREWQAEIDFLGRLSHPNLVKLIGYCLEETELLLVYE  135

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L W LRL IA+G ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  136   FMQKGSLENHLFGRGAVVQPLQWSLRLKIAVGAARGLAFLHTSEKQVIYRDFKASNILLD  195

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               YNAKISDFGLAK+GPS   SHV+TRV+GT+GY APEY+ TG+LYVKSDV+ FGV+L+E
Sbjct  196   GFYNAKISDFGLAKIGPSPSQSHVSTRVMGTQGYAAPEYIATGHLYVKSDVFGFGVVLVE  255

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR++D    +G+  LV WVKP LS   KLK+IMD  ++G+Y S+   + AQL L C
Sbjct  256   ILTGLRAVDTG-RTGKENLVEWVKPYLSDRRKLKTIMDAGLQGKYPSKVVYEIAQLALTC  314

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  315   LAGEPKARPSM  325



>ref|XP_004500872.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=362

 Score =   380 bits (975),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 234/309 (76%), Gaps = 4/309 (1%)
 Frame = +3

Query  486   AESED-SNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             A+S+D +  +G I+ + NLK+++L EL+ AT NF+ D ++G GGFG VFKGW+D N+  P
Sbjct  6     AKSDDGAKVDGKIV-SQNLKMFTLEELKSATRNFRPDTMVGEGGFGRVFKGWIDPNSCRP  64

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+ G G+ VA+KK    SLQG +EW+SEVK LG FSHPN++KLLGYCWE ++ LLVYEYM
Sbjct  65    SKVGVGIPVAVKKSNPDSLQGLQEWQSEVKFLGKFSHPNLVKLLGYCWEEDQFLLVYEYM  124

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
             Q GSLE+HLFRK  G +ALSWD+RL IAIG ARGLAFLH S+  VI RD KSSNILLD +
Sbjct  125   QKGSLESHLFRK--GPEALSWDIRLKIAIGAARGLAFLHTSQNSVIYRDFKSSNILLDGD  182

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             +NAK+SDFGLAK GP    SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEML
Sbjct  183   FNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEML  242

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TGL +LD   P+ +  LV +    LS   KLK+IMD RM  QYS  A LQ + L L+CLE
Sbjct  243   TGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKCLE  302

Query  1383  SQPEKRPSM  1409
             S P+ RPSM
Sbjct  303   SDPKNRPSM  311



>ref|NP_195285.3| putative serine/threonine-protein kinase Cx32 [Arabidopsis thaliana]
 sp|P27450.2|CX32_ARATH RecName: Full=Probable serine/threonine-protein kinase Cx32, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL38844.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM20151.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE86538.1| putative serine/threonine-protein kinase Cx32 [Arabidopsis thaliana]
Length=419

 Score =   382 bits (980),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 228/300 (76%), Gaps = 3/300 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G +L +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD  TLAPS  GSGMIV
Sbjct  62    SGKLLESPNLKVYNFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIV  121

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK+L   S+QGF EW SEV  LGM SH N++KLLGYC E  +LLLVYE+M  GSLE+HL
Sbjct  122   AIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHL  181

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N       WDLR+ I IG ARGLAFLH  +R+VI RD K+SNILLD NY+AK+SDFG
Sbjct  182   FRRN---DPFPWDLRIKIVIGAARGLAFLHSLQREVIYRDFKASNILLDSNYDAKLSDFG  238

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDV+ FGV+LLE++TGL + + K
Sbjct  239   LAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTK  298

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++TL C+E  P+ RP M
Sbjct  299   RPRGQESLVDWLRPELSNKHRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHM  358



>gb|AFK43900.1| unknown [Lotus japonicus]
Length=394

 Score =   381 bits (978),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 229/312 (73%), Gaps = 2/312 (1%)
 Frame = +3

Query  474   IYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENT  653
             I+ +  + ++   G I+  PNLK++ L +L+ AT NFK D +LG GGFG VFKGW+D  T
Sbjct  39    IHDATAALEAPCTGKIV-KPNLKMFPLDDLKTATRNFKPDTILGEGGFGRVFKGWIDPKT  97

Query  654   LAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVY  833
               PS  G G+ VA+KK    SLQG EEW+SEVK LG FSHPN++KLLGYCWE +  LLVY
Sbjct  98    FKPSRVGVGIPVAVKKSSSDSLQGLEEWQSEVKFLGKFSHPNLVKLLGYCWEESCFLLVY  157

Query  834   EYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILL  1013
             EYMQ GSLE+HLFRK  G + LSWD+RL IAIG ARGLAFLH  E+ VI RD KSSNIL 
Sbjct  158   EYMQKGSLESHLFRKE-GPEPLSWDIRLKIAIGAARGLAFLHNLEKSVIYRDFKSSNILP  216

Query  1014  DENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLL  1193
             D ++NAK+SDFGLAKLGP    SH+TTRV+GT GY APEY+ TG+LYVKSDVY FGV+LL
Sbjct  217   DRDFNAKLSDFGLAKLGPINGRSHITTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLL  276

Query  1194  EMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLR  1373
             E+LTGL +LD   P+    LVG+  P LS +  LK IMD +M+ QYS +A L  AQL L 
Sbjct  277   EILTGLIALDKNRPTYGQNLVGYAMPSLSDKKSLKKIMDPKMDQQYSIKAALLIAQLILT  336

Query  1374  CLESQPEKRPSM  1409
             CLES P+ RPSM
Sbjct  337   CLESDPKNRPSM  348



>ref|XP_011041221.1| PREDICTED: probable serine/threonine-protein kinase NAK [Populus 
euphratica]
Length=426

 Score =   382 bits (980),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 253/379 (67%), Gaps = 19/379 (5%)
 Frame = +3

Query  294   MGNFVGSRTA---DSISGALPSNNKGSTAFSALSRIGSYRQLSAAESEGGNANAKCLPTP  464
             MGN  GS      +S S   P   K S   S  + +G        E E          + 
Sbjct  1     MGNCWGSTPVTNHNSPSATKPPTPKTSANHSKENGLGGRSSCDRKEKE----------SV  50

Query  465   NLEIYSSAESEDSNA----NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFK  632
              + +Y   + +D  A    +G ++     ++++LAEL+ AT NF+ D VLG GGFG VFK
Sbjct  51    KIGMYVKNKDKDETAIIPLSGQVMAILGPRLFTLAELKSATRNFRPDTVLGEGGFGRVFK  110

Query  633   GWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEY  812
             GWVDE T AP++ G GM VA+KK    S QG +EW+SEVKLLG FSHPN+++LLGYCWE 
Sbjct  111   GWVDEKTYAPAKVGCGMAVAVKKSNPDSSQGLQEWQSEVKLLGKFSHPNLVRLLGYCWEE  170

Query  813   NKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDL  992
              + LLVYEYMQ GSLE HLFRK  G + L W++R+ IAIG A GLAFLH SE+ VI RD 
Sbjct  171   KQFLLVYEYMQKGSLEKHLFRK--GAEPLPWNVRIKIAIGAAEGLAFLHTSEKSVIYRDF  228

Query  993   KSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVY  1172
             K+SNILLD  +NAK+SDFGLAK GP   NSHVTTRV+GT GY APEY+ TG+LYVKSDVY
Sbjct  229   KTSNILLDGAFNAKLSDFGLAKFGPLNGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVY  288

Query  1173  CFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQ  1352
              FGV+LLE+LTGL++LD   PS Q  LV + +P LS + KLK IMD R+E QY  +A +Q
Sbjct  289   GFGVVLLELLTGLKALDTNRPSWQQNLVEFARPSLSDKRKLKKIMDPRLEEQYPIKAAVQ  348

Query  1353  AAQLTLRCLESQPEKRPSM  1409
             AA+L L+CLE  P+ RPSM
Sbjct  349   AAELILQCLECDPKSRPSM  367



>gb|AFW63337.1| putative protein kinase superfamily protein [Zea mays]
Length=462

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 228/311 (73%), Gaps = 7/311 (2%)
 Frame = +3

Query  498   DSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGS  677
             D   +G IL  PNL+V++ AEL+ AT +FK D VLG GGFG V+KGWVDE T+ P+   S
Sbjct  90    DRQPDGRILEAPNLRVFTFAELKAATRSFKPDTVLGEGGFGRVYKGWVDERTMGPARNDS  149

Query  678   G-MIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGS  854
             G + VA+KKL   SLQG +EW+SEV  LG  SHPN+++LLGYCWE  +LLLVYEYM  GS
Sbjct  150   GGLPVAVKKLNPESLQGAQEWQSEVNFLGRLSHPNLVRLLGYCWEDKELLLVYEYMAKGS  209

Query  855   LENHLF----RKNVGR--KALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             LENHLF    RK  G   + L W LRL I  G ARGLAFLH SE+ VI RD K+SNILLD
Sbjct  210   LENHLFGSEPRKGGGGAVQPLPWSLRLRIVTGAARGLAFLHSSEKHVIYRDFKASNILLD  269

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
              ++NAK+SD GLAK GP+G +SHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLE
Sbjct  270   THFNAKLSDLGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  329

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR+LD   P+ QH LV W KP L+   KL  +MD R+EGQY S    +AAQLTLRC
Sbjct  330   VLTGLRALDTDRPTAQHSLVDWAKPYLADRRKLARLMDPRLEGQYPSRGAQRAAQLTLRC  389

Query  1377  LESQPEKRPSM  1409
             L +  + RPSM
Sbjct  390   LAADHKNRPSM  400



>ref|XP_007157998.1| hypothetical protein PHAVU_002G115900g [Phaseolus vulgaris]
 gb|ESW29992.1| hypothetical protein PHAVU_002G115900g [Phaseolus vulgaris]
Length=393

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 234/307 (76%), Gaps = 5/307 (2%)
 Frame = +3

Query  501   SNANGTILPTP---NLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEP  671
             SN +G + P+     LK +S AEL+ AT +FK D +LG GGFG V+KGW+ E TL P++ 
Sbjct  54    SNGSGIVFPSEEMRRLKEFSFAELKAATKSFKSDALLGEGGFGKVYKGWLHEKTLTPTKA  113

Query  672   GSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNG  851
             GSG++VAIKKL   S+QG +EW+SE+  LG  SHPN++KLLGYC +  + LLVYE+M  G
Sbjct  114   GSGIMVAIKKLNPESMQGLQEWQSEINFLGRVSHPNLVKLLGYCCDDVEFLLVYEFMPKG  173

Query  852   SLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNA  1031
             SLE HLF        LSWD RL IAIG ARGLA+LH SE+Q+I RD K+SNILLDE +NA
Sbjct  174   SLETHLFWSG-NTVPLSWDTRLKIAIGAARGLAYLHTSEKQIIYRDFKASNILLDEEFNA  232

Query  1032  KISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGL  1211
             KISDFGLAKLGPS  +SHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLE+L G+
Sbjct  233   KISDFGLAKLGPSVGDSHVTTRIIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELLKGM  292

Query  1212  RSLDYK*PSGQHWLVGWVKPMLSQEGKLKS-IMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
             R+LD   PSGQ  LV W+KP LS + KLKS IMD ++EGQYS++A L+AAQLTL CL++ 
Sbjct  293   RALDVNRPSGQENLVEWMKPYLSDKTKLKSDIMDEKIEGQYSTKAALKAAQLTLECLQND  352

Query  1389  PEKRPSM  1409
               KRPSM
Sbjct  353   RNKRPSM  359



>emb|CAA20030.1| protein kinase - like protein [Arabidopsis thaliana]
Length=356

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 226/297 (76%), Gaps = 3/297 (1%)
 Frame = +3

Query  519   ILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIK  698
             +L +PNLKVY+  +L+ AT NFK D +LG GGFG V++GWVD  TLAPS  GSGMIVAIK
Sbjct  2     LLESPNLKVYNFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIK  61

Query  699   KLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRK  878
             +L   S+QGF EW SEV  LGM SH N++KLLGYC E  +LLLVYE+M  GSLE+HLFR+
Sbjct  62    RLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLFRR  121

Query  879   NVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAK  1058
             N       WDLR+ I IG ARGLAFLH  +R+VI RD K+SNILLD NY+AK+SDFGLAK
Sbjct  122   N---DPFPWDLRIKIVIGAARGLAFLHSLQREVIYRDFKASNILLDSNYDAKLSDFGLAK  178

Query  1059  LGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PS  1238
             LGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDV+ FGV+LLE++TGL + + K P 
Sbjct  179   LGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPR  238

Query  1239  GQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++TL C+E  P+ RP M
Sbjct  239   GQESLVDWLRPELSNKHRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHM  295



>emb|CBI40719.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 231/307 (75%), Gaps = 2/307 (1%)
 Frame = +3

Query  489   ESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSE  668
             E  +    GTI+ TPNLK+++ AEL+ AT NF+   +LG GGFG VFKGWVDE T AP++
Sbjct  51    EKTEIAETGTII-TPNLKMFTFAELKSATRNFRPHTMLGEGGFGRVFKGWVDEKTYAPTK  109

Query  669   PGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQN  848
                G+ VA+KK    S QG +EW+SEVK LG F+HPN++KLLGYC E  + LLVYEYM  
Sbjct  110   VSVGIPVAVKKSNPESEQGLKEWQSEVKFLGKFTHPNLVKLLGYCCEDQQFLLVYEYMHK  169

Query  849   GSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYN  1028
             GSLENHLF+   G ++L+W++RL IAIG ARGLAFLH SE+ VI RD KSSNILLD +YN
Sbjct  170   GSLENHLFKLG-GAESLTWEIRLKIAIGAARGLAFLHTSEKTVIYRDFKSSNILLDGDYN  228

Query  1029  AKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTG  1208
             AK+SDFGLAKLGPS  +SHVTT+++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTG
Sbjct  229   AKLSDFGLAKLGPSDGDSHVTTQIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEMLTG  288

Query  1209  LRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQ  1388
              ++LD   P GQ  LV W KP+L  + KLK IMD R+  QY  +A  Q A+L L+CLES 
Sbjct  289   KQTLDINRPPGQLNLVEWTKPLLPNKRKLKKIMDPRLRDQYPLKAATQVAELILKCLESD  348

Query  1389  PEKRPSM  1409
             P+ RPSM
Sbjct  349   PKNRPSM  355



>ref|XP_003548810.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Glycine max]
Length=417

 Score =   380 bits (975),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 234/322 (73%), Gaps = 22/322 (7%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G IL  PNLKV+   EL+ AT+NF  D +LG GGFG V+KGW+D +TLAP++ GSGM+V
Sbjct  81    DGQILKWPNLKVFDFEELKSATNNFSSDTLLGEGGFGRVYKGWLDGDTLAPTKAGSGMVV  140

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK L   S QGF++W++E+ ++  FSHPN++ LLGYCW+ ++ LLVYE+M   SL+NHL
Sbjct  141   AIKWLNPQSTQGFDQWQTELNIMRRFSHPNLVNLLGYCWDDDEHLLVYEFMPKRSLDNHL  200

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             F++N     LSW+ RL IAIG ARGLAFLH SE  +I RD KSSNILLD NYN KISDFG
Sbjct  201   FKRNRNLGFLSWNTRLKIAIGAARGLAFLHASENNIIHRDFKSSNILLDGNYNPKISDFG  260

Query  1050  LAKL----------------------GPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKS  1163
             LA L                      GPS   SHVTTRV+GT GY APEY+ TG+LYVKS
Sbjct  261   LATLVSYEGQSHNYSPEISDFDLAKWGPSEGESHVTTRVMGTVGYAAPEYVATGHLYVKS  320

Query  1164  DVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEA  1343
             DVY FGV+LLE+LTG+R+LD   P+GQ  LV W KP+LS + KLK+IMD ++ GQYS +A
Sbjct  321   DVYGFGVVLLEILTGMRALDTNRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSLQA  380

Query  1344  ELQAAQLTLRCLESQPEKRPSM  1409
               QAAQLT++CL+S PE+RPSM
Sbjct  381   AWQAAQLTMKCLQSIPEERPSM  402



>ref|XP_010028844.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=437

 Score =   380 bits (976),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 237/311 (76%), Gaps = 3/311 (1%)
 Frame = +3

Query  477   YSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTL  656
             +S++  ++++ +G ILP PNL++++ AEL+VAT NFK D +LG GGFG VFKGW++E   
Sbjct  50    FSASSGDETSPHGQILPHPNLRIFTFAELKVATKNFKSDSLLGEGGFGKVFKGWLEEKPS  109

Query  657   APSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYE  836
             A +  GSG+++A+K+L   S QGF EW++E+  LG  SHPN++KL+GYC E  +LLLVYE
Sbjct  110   AKN--GSGLVIAVKRLKSESAQGFREWQAEIDFLGRLSHPNLVKLIGYCLEETELLLVYE  167

Query  837   YMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLD  1016
             +MQ GSLENHLF +    + L W LRL IA+G ARGLAFLH SE+QVI RD K+SNILLD
Sbjct  168   FMQKGSLENHLFGRGAVVQPLQWSLRLKIAVGAARGLAFLHTSEKQVIYRDFKASNILLD  227

Query  1017  ENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLE  1196
               YNAKISDFGLAK+GPS   SHV+TRV+GT+GY APEY+ TG+LYVKSDV+ FGV+L+E
Sbjct  228   GFYNAKISDFGLAKIGPSPSQSHVSTRVMGTQGYAAPEYIATGHLYVKSDVFGFGVVLVE  287

Query  1197  MLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRC  1376
             +LTGLR++D    +G+  LV WVKP LS   KLK+IMD  ++G+Y S+   + AQL L C
Sbjct  288   ILTGLRAVDTG-RTGKENLVEWVKPYLSDRRKLKTIMDAGLQGKYPSKVVYEIAQLALTC  346

Query  1377  LESQPEKRPSM  1409
             L  +P+ RPSM
Sbjct  347   LAGEPKARPSM  357



>ref|XP_006435368.1| hypothetical protein CICLE_v10001177mg [Citrus clementina]
 gb|ESR48608.1| hypothetical protein CICLE_v10001177mg [Citrus clementina]
Length=441

 Score =   380 bits (977),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 225/295 (76%), Gaps = 2/295 (1%)
 Frame = +3

Query  528   TPN-LKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
             TPN LK+++L +L  AT NF+ D +LG GGFG VFKGWVD  TLAP++ G G  VA+KK 
Sbjct  82    TPNYLKMFTLQDLRAATKNFRPDTMLGEGGFGRVFKGWVDHKTLAPTKVGVGKAVAVKKS  141

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                S+QG  EW++EVK LG FSHPN++KL+GYCWE  + LLVYEYMQ GSLENHLFRK  
Sbjct  142   NPDSIQGLREWQAEVKFLGKFSHPNLVKLIGYCWEDRQFLLVYEYMQKGSLENHLFRKGS  201

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
               + L W+ RL IAI  A+GL FLH SE+ VI RD K+SNILLD +YNAK+SDFGLAKLG
Sbjct  202   A-EPLPWNTRLKIAIDAAKGLTFLHSSEKSVIYRDFKASNILLDGSYNAKLSDFGLAKLG  260

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             P   NSHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   PSG+
Sbjct  261   PIDGNSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTNRPSGE  320

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             H LV + +P L+ + +LK IMD R+E QY  +  L A Q+ ++CLE++P+ RPSM
Sbjct  321   HVLVDFARPSLTDKRRLKKIMDPRLEEQYPIKGALLAGQIIIKCLEAEPKNRPSM  375



>ref|XP_010428693.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=464

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 222/294 (76%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TPNLK+++L EL+ AT NF+ + V+G GGFG VFKGWVDE TLAPS  G G  VA+KK  
Sbjct  126   TPNLKMFTLVELKTATKNFRPESVIGEGGFGQVFKGWVDEKTLAPSRAGVGRPVAVKKSN  185

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEY+  GSLENHLF K  G
Sbjct  186   PDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEENQFLLVYEYLPKGSLENHLFAK--G  243

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              +AL WD RL IAI  A+GL FLH SE+ VI RD K+SNILLD N++AK+SDFGLAKLGP
Sbjct  244   AEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKLGP  303

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                 SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD   PS Q 
Sbjct  304   INGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQ  363

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+L+Q+ KL+ +MD R+E +Y   A L+ A+L LRCLE+ P+ RP M
Sbjct  364   NLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVLKTAELILRCLEADPKNRPPM  417



>ref|XP_010679959.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=403

 Score =   379 bits (972),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 229/306 (75%), Gaps = 3/306 (1%)
 Frame = +3

Query  492   SEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEP  671
             S D   +G +L  PNL+V+S  EL+ AT NFK + +LG GGFG V+KGW+D+     S+ 
Sbjct  57    SGDVFPSGELLEKPNLRVFSFGELKNATKNFKPETLLGEGGFGRVYKGWIDD---VSSKS  113

Query  672   GSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNG  851
             G  + VAIKKL  GS+QGFEEW+SEV  LG  SHPN++KLLGYCWE  +LLLVYEY+  G
Sbjct  114   GLKIAVAIKKLNSGSMQGFEEWQSEVNFLGRLSHPNLVKLLGYCWEDKELLLVYEYLPKG  173

Query  852   SLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNA  1031
             SLE+HLFR+N   + LSW+ R++I +GVARGLAFLH S+ QVI RD K+SNILLD NY+A
Sbjct  174   SLEHHLFRRNSCVEPLSWNKRMSIVLGVARGLAFLHSSDNQVIYRDFKASNILLDVNYDA  233

Query  1032  KISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGL  1211
             KISDFGLAKLGPSG NSHVTTR++GT GY APEY+ TG+LY+ SDVY FGV+LLEMLTG 
Sbjct  234   KISDFGLAKLGPSGGNSHVTTRIMGTFGYAAPEYVATGHLYMNSDVYGFGVVLLEMLTGS  293

Query  1212  RSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQP  1391
             R++D   P GQ  LV W  P LS + KL+ I+D R+ GQYS +A  + AQ+TL+CL   P
Sbjct  294   RAVDLNRPKGQQNLVEWTSPYLSNKKKLRGIIDPRLVGQYSLKAAFELAQVTLKCLRPDP  353

Query  1392  EKRPSM  1409
               RP M
Sbjct  354   RTRPGM  359



>ref|XP_010416552.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Camelina sativa]
Length=500

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 226/301 (75%), Gaps = 3/301 (1%)
 Frame = +3

Query  507   ANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMI  686
              +G I+ TPNLK+++L EL+ AT NF+ + V+G GGFG VFKGWVDE TLAPS  G G  
Sbjct  155   PSGKIV-TPNLKMFTLVELKTATKNFRPESVIGEGGFGQVFKGWVDEKTLAPSRAGVGKP  213

Query  687   VAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENH  866
             VA+KK    S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEY+  GSLENH
Sbjct  214   VAVKKSNPDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEENQFLLVYEYLPKGSLENH  273

Query  867   LFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDF  1046
             LF K  G +AL WD RL IAI  A+GL FLH SE+ VI RD K+SNILLD N++AK+SDF
Sbjct  274   LFAK--GAEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDF  331

Query  1047  GLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDY  1226
             GLAKLGP    SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD 
Sbjct  332   GLAKLGPINGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDP  391

Query  1227  K*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPS  1406
               PS Q  LV W KP+L+Q+ KL+ +MD R+E +Y   A ++ A+L LRCLE+ P+ RP 
Sbjct  392   NRPSAQQNLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLEADPKNRPP  451

Query  1407  M  1409
             M
Sbjct  452   M  452



>ref|XP_008237981.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=429

 Score =   379 bits (973),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 232/315 (74%), Gaps = 3/315 (1%)
 Frame = +3

Query  465   NLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVD  644
             N+E  S+A    +         P LK +SLAEL+  T +F+ D +LG GGFG VFKGWV+
Sbjct  64    NIEEKSAAPDAAAPRESVETEVPKLKEFSLAELKKCTRDFRPDTILGEGGFGRVFKGWVN  123

Query  645   ENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLL  824
             E+T APS  G GM VA+KK    S QG +EW++EV  LG + HPN+++LLGYC E N+ L
Sbjct  124   EDTYAPSRVGIGMAVAVKKSNPDSYQGLQEWQAEVNFLGKYRHPNLVRLLGYCCEENQFL  183

Query  825   LVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSN  1004
             LVYEYMQ GSLENHLFRK  G++ L W+LRL IAIG ARGLAFLH SE+ VI RD K+SN
Sbjct  184   LVYEYMQKGSLENHLFRK--GQEPLGWELRLKIAIGAARGLAFLHTSEK-VIYRDFKASN  240

Query  1005  ILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGV  1184
             ILLD  YNAK+SDFGLAK+GP   NSHVTTR++GT GY APEY+ TG+LYVKSDVY FGV
Sbjct  241   ILLDPAYNAKLSDFGLAKVGPINGNSHVTTRIIGTYGYAAPEYVATGHLYVKSDVYGFGV  300

Query  1185  LLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQL  1364
             +LLEMLTGLR+LD   PS +H LV W++P L ++ +LK IMD  +  QY  +A  QAA+L
Sbjct  301   VLLEMLTGLRALDNNRPSREHSLVDWLRPSLHKKKELKKIMDPGLGDQYPLKAACQAAEL  360

Query  1365  TLRCLESQPEKRPSM  1409
              L+CLES P+ RPSM
Sbjct  361   ILKCLESDPKNRPSM  375



>ref|XP_011092993.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=414

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 231/302 (76%), Gaps = 1/302 (0%)
 Frame = +3

Query  504   NANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGM  683
             + +G +L  PNL+V+S +EL+ AT NF+ D VLG GGFG V+KG + +      E G+G 
Sbjct  59    SGSGQMLAHPNLRVFSFSELKSATRNFRSDTVLGEGGFGKVYKGRLLDFKNGAGE-GAGS  117

Query  684   IVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLEN  863
              +A+KKL   S+QGF+EW+SEV  LG  SHPN++KLLGYCWE  +LLLVYE+MQ GSLEN
Sbjct  118   PIAVKKLNSESMQGFQEWQSEVNFLGRLSHPNLVKLLGYCWEDTELLLVYEFMQKGSLEN  177

Query  864   HLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISD  1043
             HLF +    + L W++R+ I IG ARGLAFLH S+++VI RD K+SNILLD +Y+AKISD
Sbjct  178   HLFGRGSAGQPLPWNVRVKILIGAARGLAFLHASDKKVIYRDFKASNILLDGSYHAKISD  237

Query  1044  FGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLD  1223
             FGLAK+GP+   SHVTT+V+GT GY APEY+ TG+LYVKSDVY FGV+L+EMLTGLR+LD
Sbjct  238   FGLAKMGPTASKSHVTTQVMGTNGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLRALD  297

Query  1224  YK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRP  1403
                PSG+H LV W+KP L    KLK++MD R+EG+Y S + LQ AQL L CLE++P+ RP
Sbjct  298   PNRPSGKHNLVEWIKPHLPDRRKLKNVMDSRLEGKYPSRSALQIAQLALNCLENEPKNRP  357

Query  1404  SM  1409
             SM
Sbjct  358   SM  359



>ref|XP_010416550.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010416551.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=465

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/294 (62%), Positives = 222/294 (76%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TPNLK+++L EL+ AT NF+ + V+G GGFG VFKGWVDE TLAPS  G G  VA+KK  
Sbjct  126   TPNLKMFTLVELKTATKNFRPESVIGEGGFGQVFKGWVDEKTLAPSRAGVGKPVAVKKSN  185

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEY+  GSLENHLF K  G
Sbjct  186   PDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEENQFLLVYEYLPKGSLENHLFAK--G  243

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              +AL WD RL IAI  A+GL FLH SE+ VI RD K+SNILLD N++AK+SDFGLAKLGP
Sbjct  244   AEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKLGP  303

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                 SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD   PS Q 
Sbjct  304   INGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQ  363

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+L+Q+ KL+ +MD R+E +Y   A ++ A+L LRCLE+ P+ RP M
Sbjct  364   NLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLEADPKNRPPM  417



>ref|XP_002869077.1| connexin 32 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45336.1| connexin 32 [Arabidopsis lyrata subsp. lyrata]
Length=421

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 225/300 (75%), Gaps = 3/300 (1%)
 Frame = +3

Query  510   NGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIV  689
             +G +L +PNLKVYS  +L+ AT NFK D +LG GGFG V++GWVD  TLAPS  GSGMIV
Sbjct  65    SGKLLESPNLKVYSFLDLKTATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIV  124

Query  690   AIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHL  869
             AIK+L   S+QGF EW SEV  LGM SH N++KLLGYC E  +LLLVYE+M  GSLE+HL
Sbjct  125   AIKRLNSESVQGFAEWRSEVNFLGMLSHQNLVKLLGYCREDKELLLVYEFMPKGSLESHL  184

Query  870   FRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFG  1049
             FR+N       WDLR+ I IG ARGLAFLH  +R+VI RD K+SNILLD NY AK+SDFG
Sbjct  185   FRRN---DPFPWDLRIKIVIGAARGLAFLHSLQREVIYRDFKASNILLDSNYEAKLSDFG  241

Query  1050  LAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK  1229
             LAKLGP+ E SHVTTR++GT GY APEY+ TG+LYVKSDV+ FGV+LLE++TG  + + K
Sbjct  242   LAKLGPADEKSHVTTRIMGTYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGQTAHNTK  301

Query  1230  *PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              P GQ  LV W++P LS + ++K IMD  ++GQY+++   + A++T  C+E  P+ RP M
Sbjct  302   RPRGQESLVDWLRPELSSKHRVKQIMDKGIKGQYTTQVATELARITFSCIEPDPKNRPHM  361



>ref|XP_010471786.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=465

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 223/294 (76%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TPNLK+++L EL+ AT NF+ + V+G GGFG VFKGWVD+ TLAPS  G G+ VA+KK  
Sbjct  126   TPNLKMFTLVELKTATKNFRPESVIGEGGFGQVFKGWVDDKTLAPSRAGVGIPVAVKKSN  185

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEY+  GSLENHLF K  G
Sbjct  186   PDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEENQFLLVYEYLPKGSLENHLFAK--G  243

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              +AL WD RL IAI  A+GL FLH SE+ VI RD K+SNILLD N++AK+SDFGLAKLGP
Sbjct  244   AEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKLGP  303

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                 SHVTTRV+GT GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD   PS Q 
Sbjct  304   INGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQ  363

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+L+Q+ KL+ +MD R+E +Y   A ++ A+L LRCLE+ P+ RP M
Sbjct  364   NLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLEADPKNRPPM  417



>ref|XP_004146213.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase Cx32, chloroplastic-like [Cucumis sativus]
Length=365

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 233/309 (75%), Gaps = 1/309 (0%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             S +  +S  +G IL  PNLK +S  EL++ T  F+   V+G GGF  V+KGWV++ TLAP
Sbjct  36    SVDVSESCPSGKILDQPNLKEFSFTELKLITRXFRPASVVGQGGFRKVYKGWVNDKTLAP  95

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+  SGM VAIKKL   S+QGF++W++EV  LG  +HPNV+KLLG+CWE  +LLLVYE+M
Sbjct  96    SKSNSGMAVAIKKLNAESVQGFQDWQAEVNFLGRLNHPNVVKLLGFCWEDEELLLVYEFM  155

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
               GSLE+HLFR +   + LSW+ RL IAIG ARGLAFLH +E++VI RD K+SNILLD N
Sbjct  156   SKGSLESHLFRSSF-TQPLSWERRLKIAIGAARGLAFLHSTEKEVIYRDFKTSNILLDLN  214

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YN+KIS+FGLA+LGP+GE SHVTTR++GT GY+APEY+  G+LYVKSDVY FGV+LLE++
Sbjct  215   YNSKISNFGLARLGPAGEVSHVTTRIIGTYGYVAPEYVTAGHLYVKSDVYGFGVVLLEIM  274

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TG R+ D   P  Q  LV W KP L ++ K+K+++D ++EGQYS +A      LTL+CLE
Sbjct  275   TGWRAHDVNRPHEQRNLVDWAKPFLVKKKKIKNLIDAKLEGQYSLKAATLVGDLTLKCLE  334

Query  1383  SQPEKRPSM  1409
             + P KRPSM
Sbjct  335   THPRKRPSM  343



>ref|XP_006473798.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85106.1| hypothetical protein CISIN_1g013519mg [Citrus sinensis]
Length=441

 Score =   378 bits (971),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 224/295 (76%), Gaps = 2/295 (1%)
 Frame = +3

Query  528   TPN-LKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKL  704
             TPN LK+++L +L  AT NF+ D +LG GGFG VFKGWVD  TLAP++ G G  VA+KK 
Sbjct  82    TPNYLKMFTLQDLRAATKNFRPDTMLGEGGFGRVFKGWVDHKTLAPTKVGVGKAVAVKKS  141

Query  705   YRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNV  884
                S+QG  EW++EVK LG FSHPN++KL+GYCWE  + LLVYEYMQ GSLENHLFRK  
Sbjct  142   NPDSIQGLREWQAEVKFLGKFSHPNLVKLIGYCWEDRQFLLVYEYMQKGSLENHLFRKGS  201

Query  885   GRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLG  1064
               + L W+ RL IAI  A+ L FLH SE+ VI RD K+SNILLD +YNAK+SDFGLAKLG
Sbjct  202   A-EPLPWNTRLKIAIDAAKDLTFLHSSEKSVIYRDFKASNILLDGSYNAKLSDFGLAKLG  260

Query  1065  PSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQ  1244
             P   NSHVTTR++GT GY APEY+ TG+LYVKSDVY FGV+LLEMLTGLR+LD   PSG+
Sbjct  261   PIDGNSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTGLRALDTNRPSGE  320

Query  1245  HWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             H LV + +P L+ + +LK IMD R+E QY  +  L A Q+ ++CLE++P+ RPSM
Sbjct  321   HVLVDFARPSLTDKRRLKKIMDPRLEEQYPIKGALLAGQIIIKCLEAEPKNRPSM  375



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   377 bits (967),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 235/328 (72%), Gaps = 11/328 (3%)
 Frame = +3

Query  426   EGGNANAKCLPTPNLEIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLG  605
             +GG++N+         + S+  SE     G IL +PNLK +S ++L+ AT NF+ D VLG
Sbjct  27    DGGDSNSSS------RVPSTTRSE-----GEILQSPNLKSFSFSDLKTATRNFRPDSVLG  75

Query  606   TGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVI  785
              GGFG+VFKGW+DENT A ++PG+G+I+A+K+L +   QG  EW +EV  LG FSHP+++
Sbjct  76    EGGFGSVFKGWIDENTFAATKPGTGVIIAVKRLNQEGFQGHREWLAEVNYLGQFSHPHLV  135

Query  786   KLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCS  965
             KL+GYC E    LLVYE++  GSLENHLFR+    + LSW LRL +A+G A+GLAFLH +
Sbjct  136   KLIGYCLEDEHRLLVYEFVPRGSLENHLFRRGSYFQPLSWKLRLKVALGAAKGLAFLHSA  195

Query  966   ERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETG  1145
             E +VI RD K+SNILLD NY AK+SDFGLAK GP+G+ SHV+TRV+GT GY APEY+ TG
Sbjct  196   ETKVIYRDFKTSNILLDSNYTAKLSDFGLAKDGPTGDKSHVSTRVMGTYGYAAPEYMATG  255

Query  1146  YLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEG  1325
             +L  KSDVY FGV+LLEML+G R++D   PSG+H LV W KP L  + K+  ++D R+EG
Sbjct  256   HLTSKSDVYSFGVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEG  315

Query  1326  QYSSEAELQAAQLTLRCLESQPEKRPSM  1409
             QYS E   + A L LRCL   P  RPSM
Sbjct  316   QYSMEVASKVANLALRCLSKDPRFRPSM  343



>ref|XP_004159759.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
Length=365

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 234/309 (76%), Gaps = 1/309 (0%)
 Frame = +3

Query  483   SAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAP  662
             S +  +S  +G IL  PNLK +S  EL++ T NF+   V+G GGFG V+KGWV++ TLAP
Sbjct  36    SVDVSESCPSGKILDQPNLKEFSFTELKLITRNFRPASVVGQGGFGKVYKGWVNDKTLAP  95

Query  663   SEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYM  842
             S+  SGM VAIKKL   S+QGF++W++EV  LG  +HPN++KLLG+CWE  +LLLVYE+M
Sbjct  96    SKSNSGMAVAIKKLNAESVQGFQDWQAEVNFLGRLNHPNLVKLLGFCWEDEELLLVYEFM  155

Query  843   QNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDEN  1022
               GSLE+HLFR +   + LSW+ RL IAIG ARGLAFLH +E++VI RD K+SNILLD N
Sbjct  156   SKGSLESHLFRSSF-TQPLSWERRLKIAIGAARGLAFLHSTEKEVIYRDFKTSNILLDMN  214

Query  1023  YNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEML  1202
             YN+KIS+FGLA+LGP+GE SHVTTR++GT  Y+APEY+  G+LYVKS+VY FGV+LLE++
Sbjct  215   YNSKISNFGLARLGPAGEVSHVTTRIIGTYSYVAPEYVTAGHLYVKSEVYGFGVVLLEIM  274

Query  1203  TGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLE  1382
             TG R+ D   P  Q  LV W KP L ++ ++K+++D ++EGQYS +A      LTL+CLE
Sbjct  275   TGWRAHDVNRPHEQRNLVDWAKPFLVKKKRIKNLLDAKLEGQYSLKAATLVGDLTLKCLE  334

Query  1383  SQPEKRPSM  1409
             + P KRPSM
Sbjct  335   AHPRKRPSM  343



>ref|XP_004301978.1| PREDICTED: protein kinase 2A, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=444

 Score =   378 bits (970),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 252/389 (65%), Gaps = 21/389 (5%)
 Frame = +3

Query  294   MGNFVGSRTADSISGALPSNNKGSTAFSALS-------RIGSYRQLSAAESEGG-----N  437
             MGN  G+R     S  +   +  +     +         +G  R + + +   G     +
Sbjct  1     MGNCFGARVKHYNSQPVSKQSSPAETMRDIKGIKLDGLEVGRKRMMDSKKESSGIVMPTS  60

Query  438   ANAKCLPTPNL-----EIYSSAESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVL  602
                  LP PN      E +      +    G I+  PNLK ++ A L+ AT NFK D +L
Sbjct  61    TRDHMLPCPNQKPSEPETHHKLPCPNPRTMGRIV-KPNLKEFTFAALKKATRNFKTDTIL  119

Query  603   GTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNV  782
             G GGFG VFKGWVD+NT APS  G GM VA+KK    S QG ++WE+EV  LG + HPN+
Sbjct  120   GEGGFGRVFKGWVDKNTYAPSRAGIGMAVAVKKSKADSYQGRKKWEAEVNFLGKYLHPNL  179

Query  783   IKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVGRKALSWDLRLNIAIGVARGLAFLHC  962
             +KLLGYC E ++ LLVYEYMQ GSLENHLFRK  G+K LSW +RL IAIG ARGLAFLH 
Sbjct  180   VKLLGYCCEEDQFLLVYEYMQKGSLENHLFRK--GQKPLSWRIRLKIAIGAARGLAFLHT  237

Query  963   SERQVICRDLKSSNILLDENYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLET  1142
             SE+ VI RD K+SNILLD++YNAK+SDFGLAKLGPS ENSHVTT ++GT GY APEY+ T
Sbjct  238   SEK-VIYRDFKASNILLDQDYNAKLSDFGLAKLGPSNENSHVTTSIIGTYGYAAPEYVAT  296

Query  1143  GYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRME  1322
             G+LYVKSDVY F V+LLEMLTG R+LD   P+ +H LV W +P L +   +K +MD ++ 
Sbjct  297   GHLYVKSDVYGFSVVLLEMLTGRRALDTNRPADEHNLVDWARPSLLKNKDVKQMMDPKLG  356

Query  1323  GQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              QY+ +   QAA+L  +CLES P+ RPSM
Sbjct  357   DQYNIKGAYQAAELIHQCLESDPKDRPSM  385



>ref|XP_010040704.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=452

 Score =   378 bits (970),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 232/310 (75%), Gaps = 9/310 (3%)
 Frame = +3

Query  486   AESEDSNANGTILPTPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPS  665
             A+   + A    + TP LK+Y+LAEL+  T NF+ D+V G GGFG +++GWVDE TLAPS
Sbjct  112   ADEPPATAKAREVITPYLKMYTLAELKSVTRNFRPDVVYGEGGFGRLYRGWVDERTLAPS  171

Query  666   EPGSGMIVAIKKLYRGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQ  845
             + GSG+ VA+KK    + +G  EW+SEVK LG  SHPN+++LLGYCWE N+ LLVYEYMQ
Sbjct  172   KVGSGIRVAVKKY---NPEGLGEWQSEVKFLGKVSHPNLMRLLGYCWEDNQYLLVYEYMQ  228

Query  846   NGSLENHLFRKNVGRKA--LSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDE  1019
              GSL N LF    GR+A  L WD+RL IAIG ARG+ FLH SE+ VI RD KSS ILLD 
Sbjct  229   GGSLGNRLF----GRRAESLPWDVRLKIAIGAARGVDFLHSSEKSVIYRDFKSSKILLDA  284

Query  1020  NYNAKISDFGLAKLGPSGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEM  1199
             ++NAK+SDFGLAKLGP+G NSHVTTRV+GT GY APEY+ TG+LYVKSDVY FGV+LLEM
Sbjct  285   DFNAKLSDFGLAKLGPAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  344

Query  1200  LTGLRSLDYK*PSGQHWLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCL  1379
             LTGL++ D   PSGQ  LVG  +P L  + KL+ IMD R+EG+Y  +A  QAA+L L+CL
Sbjct  345   LTGLQAFDNTRPSGQQNLVGLARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCL  404

Query  1380  ESQPEKRPSM  1409
             E  P+ RPSM
Sbjct  405   EGDPKARPSM  414



>ref|XP_006302239.1| hypothetical protein CARUB_v10020265mg [Capsella rubella]
 gb|EOA35137.1| hypothetical protein CARUB_v10020265mg [Capsella rubella]
Length=459

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 224/294 (76%), Gaps = 2/294 (1%)
 Frame = +3

Query  528   TPNLKVYSLAELEVATSNFKRDMVLGTGGFGTVFKGWVDENTLAPSEPGSGMIVAIKKLY  707
             TP+LK+++L EL+ AT NF+ + V+G GGFG VFKGWVDE TLAPS  G G+ VA+KK  
Sbjct  119   TPDLKMFTLVELKTATKNFRPESVIGEGGFGQVFKGWVDEKTLAPSRAGVGIPVAVKKSN  178

Query  708   RGSLQGFEEWESEVKLLGMFSHPNVIKLLGYCWEYNKLLLVYEYMQNGSLENHLFRKNVG  887
               S QG  EW+ EV+ LG F HPN++KLLGYCWE N+ LLVYEY+  GSLENHLF +  G
Sbjct  179   PDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEENQFLLVYEYLPKGSLENHLFAR--G  236

Query  888   RKALSWDLRLNIAIGVARGLAFLHCSERQVICRDLKSSNILLDENYNAKISDFGLAKLGP  1067
              +AL WD RL IAI  A+GL FLH SE+ VI RD K+SNILLD N++AK+SDFGLAKLGP
Sbjct  237   AEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKLGP  296

Query  1068  SGENSHVTTRVLGTEGYIAPEYLETGYLYVKSDVYCFGVLLLEMLTGLRSLDYK*PSGQH  1247
                 SHVTTRV+GT+GY APEY+ TG+LYV+SDVY FGV+LLE+LTGLR+LD   PS Q 
Sbjct  297   INGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQ  356

Query  1248  WLVGWVKPMLSQEGKLKSIMDVRMEGQYSSEAELQAAQLTLRCLESQPEKRPSM  1409
              LV W KP+L+Q+ K++ +MD R+E +Y   A ++ A+L LRCLE+ P+ RP M
Sbjct  357   NLVEWAKPVLTQKKKIQKMMDPRLEHKYPLLAVVKTAELILRCLEADPKNRPPM  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378