BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24868_g1_i2 len=923 path=[3165:0-75 1599:76-144 3826:145-197
1721:198-228 3391:229-256 1780:257-315 3032:316-370 1894:371-462
3586:463-473 1997:474-598 4369:599-612 2872:613-633 2157:634-922]

Length=923
                                                                      Score     E

ref|XP_009772021.1|  PREDICTED: protein SRG1-like                       375   2e-125   
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                       368   7e-123   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                       368   8e-123   
gb|KDP32875.1|  hypothetical protein JCGZ_12167                         367   2e-122   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                       366   7e-122   
ref|XP_009772022.1|  PREDICTED: protein SRG1-like                       361   8e-120   
ref|XP_002268288.1|  PREDICTED: protein SRG1                            360   1e-119   Vitis vinifera
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                       360   1e-119   
gb|KDP21186.1|  hypothetical protein JCGZ_21657                         358   7e-119   
ref|XP_006355623.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    358   8e-119   
ref|XP_004488976.1|  PREDICTED: protein SRG1-like                       355   6e-118   
ref|XP_006477808.1|  PREDICTED: protein SRG1-like                       354   3e-117   
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like              354   4e-117   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    354   4e-117   
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2            354   4e-117   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                       353   5e-117   
ref|XP_002271080.1|  PREDICTED: protein SRG1                            353   5e-117   Vitis vinifera
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                       353   7e-117   
ref|XP_009610877.1|  PREDICTED: protein SRG1-like                       353   8e-117   
ref|XP_010272749.1|  PREDICTED: protein SRG1-like                       353   1e-116   
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                       353   1e-116   
ref|XP_006428590.1|  hypothetical protein CICLE_v10012028mg             353   1e-116   
ref|XP_011045559.1|  PREDICTED: protein SRG1                            352   1e-116   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                       352   2e-116   
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    352   2e-116   
ref|XP_007025217.1|  Senescence-related gene 1                          352   2e-116   
gb|KDO54061.1|  hypothetical protein CISIN_1g018035mg                   352   3e-116   
ref|XP_009610881.1|  PREDICTED: protein SRG1-like                       351   3e-116   
ref|XP_010057204.1|  PREDICTED: protein SRG1-like                       352   4e-116   
ref|XP_002300453.1|  SENESCENCE-RELATED GENE 1 family protein           351   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1            350   7e-116   
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                     350   8e-116   
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                       350   9e-116   
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg             349   2e-115   
ref|XP_006477804.1|  PREDICTED: protein SRG1-like                       349   2e-115   
ref|XP_006355575.1|  PREDICTED: protein SRG1-like                       349   3e-115   
ref|XP_004233003.1|  PREDICTED: protein SRG1-like                       349   3e-115   
ref|XP_006489681.1|  PREDICTED: protein SRG1-like                       349   3e-115   
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg             348   3e-115   
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                       348   1e-114   
ref|XP_002269087.1|  PREDICTED: protein SRG1                            348   1e-114   Vitis vinifera
ref|XP_002519766.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    347   1e-114   Ricinus communis
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1            347   1e-114   
ref|XP_006442335.1|  hypothetical protein CICLE_v10020844mg             347   2e-114   
ref|XP_006477806.1|  PREDICTED: protein SRG1-like                       347   2e-114   
ref|XP_006442325.1|  hypothetical protein CICLE_v10020838mg             346   3e-114   
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                       347   3e-114   
ref|XP_011085301.1|  PREDICTED: protein SRG1-like                       345   6e-114   
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                       345   7e-114   
ref|XP_011085300.1|  PREDICTED: protein SRG1-like                       345   8e-114   
ref|XP_011085299.1|  PREDICTED: protein SRG1-like                       345   8e-114   
gb|KDO52127.1|  hypothetical protein CISIN_1g045260mg                   345   1e-113   
ref|XP_002300451.1|  SENESCENCE-RELATED GENE 1 family protein           345   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007022032.1|  Senescence-related gene 1                          345   2e-113   
ref|XP_010273386.1|  PREDICTED: protein SRG1-like                       343   8e-113   
gb|KEH38517.1|  2OG-Fe(II) oxygenase family oxidoreductase              342   1e-112   
emb|CBI16708.3|  unnamed protein product                                341   1e-112   
ref|XP_011045561.1|  PREDICTED: protein SRG1-like                       342   1e-112   
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                       342   2e-112   
gb|KHN25971.1|  Protein SRG1                                            346   2e-112   
ref|XP_006489639.1|  PREDICTED: protein SRG1-like                       341   3e-112   
ref|NP_001240998.1|  uncharacterized protein LOC100786574               341   4e-112   
ref|XP_003638405.1|  Protein SRG1                                       341   5e-112   
ref|XP_007025218.1|  Senescence-related gene 1, putative                340   5e-112   
gb|KEH19983.1|  flavonol synthase/flavanone 3-hydroxylase               340   6e-112   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2            340   1e-111   
gb|KEH19984.1|  flavonol synthase/flavanone 3-hydroxylase               340   1e-111   
ref|XP_006355571.1|  PREDICTED: protein SRG1-like                       340   1e-111   
gb|AFK37891.1|  unknown                                                 338   1e-111   
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                       340   1e-111   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988    351   2e-111   
emb|CDP20503.1|  unnamed protein product                                339   2e-111   
gb|KHN19470.1|  Protein SRG1                                            339   2e-111   
ref|XP_006442327.1|  hypothetical protein CICLE_v10020829mg             339   2e-111   
ref|XP_007214442.1|  hypothetical protein PRUPE_ppa024861mg             339   3e-111   
ref|XP_006477891.1|  PREDICTED: protein SRG1-like                       338   3e-111   
ref|XP_002519761.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    338   4e-111   Ricinus communis
ref|XP_006420337.1|  hypothetical protein CICLE_v10005281mg             338   4e-111   
ref|XP_007149498.1|  hypothetical protein PHAVU_005G075400g             338   4e-111   
ref|XP_003543178.1|  PREDICTED: protein SRG1                            338   4e-111   
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg             338   5e-111   
ref|XP_006355625.1|  PREDICTED: protein SRG1-like                       338   5e-111   
emb|CAN72414.1|  hypothetical protein VITISV_032872                     339   6e-111   Vitis vinifera
emb|CBI16709.3|  unnamed protein product                                338   6e-111   
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...    337   8e-111   
ref|XP_003517890.1|  PREDICTED: protein SRG1-like isoform X1            337   9e-111   
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2            337   1e-110   
ref|XP_006467558.1|  PREDICTED: protein SRG1-like isoform X1            337   1e-110   
ref|XP_009376707.1|  PREDICTED: protein SRG1-like                       338   1e-110   
gb|KDO52129.1|  hypothetical protein CISIN_1g018426mg                   337   1e-110   
ref|XP_004294174.1|  PREDICTED: protein SRG1-like                       338   1e-110   
ref|XP_010057208.1|  PREDICTED: protein SRG1-like                       337   2e-110   
ref|XP_003546739.1|  PREDICTED: protein SRG1                            336   2e-110   
ref|XP_009799622.1|  PREDICTED: protein SRG1-like                       337   2e-110   
ref|XP_002528475.1|  Leucoanthocyanidin dioxygenase, putative           337   2e-110   Ricinus communis
ref|XP_007211480.1|  hypothetical protein PRUPE_ppa007597mg             336   3e-110   
ref|XP_006428589.1|  hypothetical protein CICLE_v10012028mg             333   3e-110   
ref|XP_006442328.1|  hypothetical protein CICLE_v10020825mg             336   3e-110   
ref|NP_001242069.1|  uncharacterized protein LOC100777264               336   3e-110   
ref|XP_011005822.1|  PREDICTED: protein SRG1-like                       336   3e-110   
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                       336   3e-110   Vitis vinifera
ref|XP_007211481.1|  hypothetical protein PRUPE_ppa007600mg             336   4e-110   
ref|XP_002269432.1|  PREDICTED: protein SRG1                            335   4e-110   Vitis vinifera
ref|XP_007022024.1|  Senescence-related gene 1                          335   6e-110   
ref|XP_007013636.1|  Senescence-related gene 1                          335   6e-110   
ref|XP_004233861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    355   6e-110   
ref|XP_010057216.1|  PREDICTED: protein SRG1-like isoform X1            335   6e-110   
gb|KDO52128.1|  hypothetical protein CISIN_1g035879mg                   335   8e-110   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2            335   1e-109   
gb|KHN29927.1|  Protein SRG1-like protein                               333   1e-109   
gb|AFK39688.1|  unknown                                                 334   1e-109   
ref|XP_003540518.1|  PREDICTED: protein SRG1-like                       334   2e-109   
gb|KEH38519.1|  2OG-Fe(II) oxygenase family oxidoreductase              334   2e-109   
ref|XP_010057213.1|  PREDICTED: protein SRG1-like isoform X1            334   2e-109   
emb|CDP14579.1|  unnamed protein product                                334   3e-109   
gb|AFK41350.1|  unknown                                                 333   3e-109   
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    334   3e-109   
gb|KCW74247.1|  hypothetical protein EUGRSUZ_E02887                     332   3e-109   
ref|XP_004488689.1|  PREDICTED: protein SRG1-like                       333   3e-109   
gb|KDP25011.1|  hypothetical protein JCGZ_23994                         333   4e-109   
gb|KHN36942.1|  Protein SRG1                                            333   6e-109   
ref|XP_006477805.1|  PREDICTED: protein SRG1-like                       335   1e-108   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                       332   1e-108   
ref|XP_003518803.1|  PREDICTED: protein SRG1-like                       332   1e-108   
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1            332   1e-108   
gb|AGL52587.1|  2-oxoglutarate/Fe2+-dependent dioxygenase               332   2e-108   
ref|XP_004490337.1|  PREDICTED: protein SRG1-like                       331   2e-108   
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2            332   2e-108   
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1            332   2e-108   
ref|XP_006355570.1|  PREDICTED: protein SRG1-like                       331   2e-108   
gb|KCW74257.1|  hypothetical protein EUGRSUZ_E02903                     330   2e-108   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    334   2e-108   
ref|XP_006355624.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    330   4e-108   
ref|XP_007022030.1|  Senescence-related gene 1                          331   5e-108   
ref|XP_006432901.1|  hypothetical protein CICLE_v10001620mg             330   5e-108   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2            330   5e-108   
gb|KHG25230.1|  Protein SRG1 -like protein                              330   6e-108   
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                       330   6e-108   
emb|CBI30795.3|  unnamed protein product                                335   7e-108   
ref|XP_007022033.1|  Senescence-related gene 1                          339   9e-108   
ref|XP_009757227.1|  PREDICTED: protein SRG1-like isoform X2            330   9e-108   
ref|XP_009799618.1|  PREDICTED: protein SRG1-like isoform X1            330   1e-107   
ref|XP_009376717.1|  PREDICTED: protein SRG1-like                       330   1e-107   
ref|XP_004134919.1|  PREDICTED: protein SRG1-like                       329   1e-107   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg             329   2e-107   
ref|XP_009757223.1|  PREDICTED: protein SRG1-like isoform X1            330   2e-107   
gb|KEH27885.1|  flavonol synthase/flavanone 3-hydroxylase               329   2e-107   
gb|KHN29925.1|  Protein SRG1-like protein                               328   3e-107   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                       328   4e-107   
ref|XP_010095129.1|  Protein SRG1                                       328   5e-107   
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                       327   8e-107   
ref|XP_008226353.1|  PREDICTED: protein SRG1-like                       327   1e-106   
gb|KDP47183.1|  hypothetical protein JCGZ_25692                         326   1e-106   
ref|XP_006452693.1|  hypothetical protein CICLE_v10008745mg             327   1e-106   
gb|AGL52586.1|  2-oxoglutarate/Fe2+-dependent dioxygenase               327   1e-106   
ref|XP_008345138.1|  PREDICTED: protein SRG1-like                       327   2e-106   
gb|KEH27901.1|  flavonol synthase/flavanone 3-hydroxylase               326   2e-106   
ref|XP_004233001.1|  PREDICTED: protein SRG1-like                       326   2e-106   
ref|XP_009610870.1|  PREDICTED: protein SRG1-like                       326   2e-106   
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                       326   3e-106   
ref|XP_002519769.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    326   4e-106   Ricinus communis
ref|XP_010057196.1|  PREDICTED: protein SRG1-like isoform X2            322   5e-106   
ref|XP_003518805.1|  PREDICTED: protein SRG1                            325   5e-106   
ref|XP_011085296.1|  PREDICTED: protein SRG1-like                       325   6e-106   
gb|KDP21180.1|  hypothetical protein JCGZ_21651                         325   1e-105   
gb|KDP21184.1|  hypothetical protein JCGZ_21655                         325   1e-105   
gb|KHF98196.1|  Protein SRG1 -like protein                              323   3e-105   
ref|XP_004490334.1|  PREDICTED: protein SRG1-like isoform X1            323   3e-105   
ref|XP_003516325.1|  PREDICTED: protein SRG1                            323   4e-105   
ref|XP_006477892.1|  PREDICTED: protein SRG1-like                       320   4e-105   
ref|XP_003614575.1|  SRG1-like protein                                  323   5e-105   
ref|XP_010476835.1|  PREDICTED: protein SRG1                            322   9e-105   
ref|XP_010089186.1|  Protein SRG1                                       320   1e-104   
ref|XP_006355573.1|  PREDICTED: protein SRG1-like                       322   1e-104   
ref|XP_007158816.1|  hypothetical protein PHAVU_002G184400g             322   1e-104   
ref|XP_006355629.1|  PREDICTED: protein SRG1-like                       322   2e-104   
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                       321   2e-104   
ref|NP_173145.1|  Fe(II)/ascorbate oxidase family protein SRG1          321   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KEH16106.1|  flavonol synthase/flavanone 3-hydroxylase               320   3e-104   
gb|KDO54069.1|  hypothetical protein CISIN_1g023533mg                   318   3e-104   
emb|CDX81796.1|  BnaC08g38050D                                          320   3e-104   
ref|XP_002314207.1|  hypothetical protein POPTR_0009s03100g             320   7e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010041379.1|  PREDICTED: protein SRG1-like                       318   8e-104   
ref|XP_002890198.1|  hypothetical protein ARALYDRAFT_889094             320   8e-104   
ref|XP_004232992.1|  PREDICTED: protein SRG1                            318   3e-103   
ref|XP_006305827.1|  hypothetical protein CARUB_v10010858mg             318   3e-103   
ref|XP_010665637.1|  PREDICTED: protein SRG1-like                       318   4e-103   
gb|KEH27888.1|  2OG-Fe(II) oxygenase family oxidoreductase              317   5e-103   
gb|KHG06473.1|  Protein SRG1 -like protein                              318   6e-103   
ref|XP_008463796.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    317   7e-103   
ref|XP_006432916.1|  hypothetical protein CICLE_v10001622mg             317   1e-102   
ref|XP_009117729.1|  PREDICTED: protein SRG1                            317   1e-102   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                         317   1e-102   
gb|KDO39329.1|  hypothetical protein CISIN_1g018221mg                   317   1e-102   
gb|AFK43235.1|  unknown                                                 317   1e-102   
ref|XP_006432911.1|  hypothetical protein CICLE_v10001626mg             317   1e-102   
gb|KEH17543.1|  2OG-Fe(II) oxygenase family oxidoreductase              315   3e-102   
ref|XP_003614583.1|  Protein SRG1                                       315   3e-102   
ref|XP_010476836.1|  PREDICTED: protein SRG1-like                       315   5e-102   
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                       315   5e-102   
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg             315   6e-102   
ref|XP_003614574.1|  Protein SRG1                                       314   9e-102   
gb|KEH27895.1|  2OG-Fe(II) oxygenase family oxidoreductase              314   1e-101   
emb|CDY24858.1|  BnaA08g14520D                                          314   1e-101   
ref|XP_010540138.1|  PREDICTED: protein SRG1-like                       315   1e-101   
ref|XP_010459259.1|  PREDICTED: protein SRG1-like                       314   1e-101   
ref|XP_002270474.1|  PREDICTED: protein SRG1                            313   2e-101   Vitis vinifera
ref|XP_002869680.1|  oxidoreductase                                     313   2e-101   
ref|XP_010498039.1|  PREDICTED: protein SRG1-like                       313   2e-101   
ref|XP_009610868.1|  PREDICTED: protein SRG1-like isoform X1            313   2e-101   
emb|CDY08970.1|  BnaC08g12000D                                          313   3e-101   
ref|XP_006416751.1|  hypothetical protein EUTSA_v10008010mg             312   5e-101   
ref|XP_010459260.1|  PREDICTED: protein SRG1-like                       312   5e-101   
ref|XP_010525534.1|  PREDICTED: protein SRG1-like                       312   6e-101   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                         312   8e-101   
ref|XP_006432907.1|  hypothetical protein CICLE_v10001648mg             309   9e-101   
emb|CAN62525.1|  hypothetical protein VITISV_002347                     311   1e-100   Vitis vinifera
ref|XP_006302461.1|  hypothetical protein CARUB_v10020553mg             311   1e-100   
ref|XP_009109218.1|  PREDICTED: protein SRG1-like                       311   1e-100   
ref|XP_003614589.1|  SRG1-like protein                                  311   1e-100   
ref|XP_009139101.1|  PREDICTED: protein SRG1-like isoform X1            311   2e-100   
ref|XP_010433658.1|  PREDICTED: protein SRG1-like                       311   2e-100   
gb|AFK45966.1|  unknown                                                 311   2e-100   
ref|XP_003638414.1|  SRG1-like protein                                  312   2e-100   
ref|XP_002270078.1|  PREDICTED: protein SRG1                            311   3e-100   Vitis vinifera
emb|CBI30782.3|  unnamed protein product                                311   3e-100   
ref|XP_009149139.1|  PREDICTED: protein SRG1-like                       310   3e-100   
ref|XP_010448451.1|  PREDICTED: protein SRG1-like                       310   4e-100   
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like         310   4e-100   
ref|XP_003632981.1|  PREDICTED: protein SRG1-like                       310   5e-100   
ref|XP_008238358.1|  PREDICTED: S-norcoclaurine synthase 1-like         310   8e-100   
ref|XP_010498040.1|  PREDICTED: protein SRG1-like                       309   8e-100   
ref|XP_002279610.1|  PREDICTED: S-norcoclaurine synthase 1-like         309   9e-100   Vitis vinifera
gb|KEH38520.1|  2OG-Fe(II) oxygenase family oxidoreductase              306   1e-99    
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...    309   1e-99    Papaver somniferum
ref|XP_004490336.1|  PREDICTED: protein SRG1-like                       308   2e-99    
ref|XP_006389976.1|  hypothetical protein EUTSA_v10018772mg             308   2e-99    
ref|XP_006494099.1|  PREDICTED: protein SRG1-like                       308   2e-99    
emb|CDY21769.1|  BnaA09g45200D                                          308   2e-99    
gb|KDO43333.1|  hypothetical protein CISIN_1g022160mg                   306   3e-99    
ref|XP_009139110.1|  PREDICTED: protein SRG1-like isoform X2            308   3e-99    
ref|XP_006420284.1|  hypothetical protein CICLE_v10005497mg             306   3e-99    
ref|XP_003632980.1|  PREDICTED: protein SRG1-like                       308   4e-99    
gb|KEH17519.1|  flavonol synthase/flavanone 3-hydroxylase               307   4e-99    
gb|KEH17521.1|  flavonol synthase/flavanone 3-hydroxylase               308   4e-99    
gb|KEH27886.1|  2OG-Fe(II) oxygenase family oxidoreductase              307   5e-99    
ref|XP_006355628.1|  PREDICTED: protein SRG1-like                       307   6e-99    
ref|XP_002279625.1|  PREDICTED: S-norcoclaurine synthase 1              307   6e-99    Vitis vinifera
ref|XP_008439690.1|  PREDICTED: protein SRG1-like                       308   7e-99    
ref|XP_010537691.1|  PREDICTED: protein SRG1-like isoform X1            306   1e-98    
sp|D4N500.1|DIOX1_PAPSO  RecName: Full=Thebaine 6-O-demethylase         306   1e-98    Papaver somniferum
gb|AFN53719.1|  putative Fe(II) oxygenase superfamily protein           323   2e-98    
ref|XP_010057197.1|  PREDICTED: protein SRG1-like isoform X1            306   2e-98    
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1            306   2e-98    
gb|KDP23860.1|  hypothetical protein JCGZ_27165                         306   3e-98    
ref|XP_002270036.1|  PREDICTED: protein SRG1                            305   4e-98    Vitis vinifera
ref|XP_004146011.1|  PREDICTED: protein SRG1-like                       305   5e-98    
ref|NP_173144.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    305   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                       305   5e-98    
ref|XP_009137512.1|  PREDICTED: protein SRG1-like                       305   5e-98    
ref|XP_002270514.1|  PREDICTED: protein SRG1-like                       305   5e-98    Vitis vinifera
emb|CDY52434.1|  BnaA07g39110D                                          304   7e-98    
ref|XP_009799621.1|  PREDICTED: protein SRG1-like isoform X2            301   7e-98    
sp|D4N502.1|DIOX3_PAPSO  RecName: Full=Codeine O-demethylase            304   9e-98    Papaver somniferum
ref|XP_006573183.1|  PREDICTED: protein SRG1-like isoform X2            303   9e-98    
emb|CBI30781.3|  unnamed protein product                                305   1e-97    
ref|XP_002270288.1|  PREDICTED: protein SRG1                            304   1e-97    Vitis vinifera
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like         303   2e-97    
ref|XP_009117731.1|  PREDICTED: protein SRG1-like                       303   2e-97    
ref|XP_002271009.1|  PREDICTED: protein SRG1                            303   3e-97    Vitis vinifera
ref|XP_006494095.1|  PREDICTED: codeine O-demethylase-like isofor...    300   3e-97    
ref|XP_004134607.1|  PREDICTED: protein SRG1-like                       303   3e-97    
gb|KEH27900.1|  flavonol synthase/flavanone 3-hydroxylase               300   4e-97    
gb|AGL52588.1|  2-oxoglutarate/Fe2+-dependent dioxygenase               302   4e-97    
dbj|BAC42769.1|  SRG1 like protein                                      302   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413319.1|  hypothetical protein EUTSA_v10025577mg             301   8e-97    
ref|XP_002527641.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    301   8e-97    Ricinus communis
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    302   9e-97    Ricinus communis
emb|CBI30791.3|  unnamed protein product                                303   1e-96    
emb|CBI30785.3|  unnamed protein product                                303   2e-96    
emb|CDX88453.1|  BnaC06g38970D                                          301   2e-96    
ref|NP_194261.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    300   2e-96    
ref|XP_010540139.1|  PREDICTED: protein SRG1-like                       301   3e-96    
gb|KCW74242.1|  hypothetical protein EUGRSUZ_E02880                     299   4e-96    
gb|KFK43894.1|  hypothetical protein AALP_AA1G187900                    300   4e-96    
ref|XP_002270138.1|  PREDICTED: protein SRG1                            300   5e-96    
emb|CDY35138.1|  BnaA06g11480D                                          300   7e-96    
ref|XP_007025223.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    298   8e-96    
ref|XP_007039569.1|  S-norcoclaurine synthase 1, putative               300   9e-96    
ref|XP_002267208.1|  PREDICTED: protein SRG1                            299   1e-95    
gb|KCW54631.1|  hypothetical protein EUGRSUZ_I00575                     296   1e-95    
gb|KFK33253.1|  hypothetical protein AALP_AA6G350500                    297   4e-95    
ref|XP_011028238.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    297   6e-95    
ref|XP_006301213.1|  hypothetical protein CARUB_v10021617mg             296   8e-95    
ref|XP_003614581.1|  Protein SRG1                                       296   8e-95    
gb|KEH27983.1|  flavonol synthase/flavanone 3-hydroxylase               293   1e-94    
ref|XP_009109221.1|  PREDICTED: protein SRG1-like                       296   1e-94    
ref|XP_006432912.1|  hypothetical protein CICLE_v10001626mg             293   1e-94    
ref|XP_006442331.1|  hypothetical protein CICLE_v10023464mg             296   1e-94    
ref|XP_010057198.1|  PREDICTED: protein SRG1-like isoform X2            295   1e-94    
dbj|BAE99802.1|  SRG1-like protein                                      296   2e-94    
ref|NP_194260.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    296   2e-94    
ref|XP_003529241.1|  PREDICTED: codeine O-demethylase-like              296   2e-94    
gb|KFK42230.1|  hypothetical protein AALP_AA2G228500                    295   2e-94    
gb|KDP21182.1|  hypothetical protein JCGZ_21653                         295   3e-94    
emb|CAN73449.1|  hypothetical protein VITISV_030817                     293   3e-94    
ref|XP_009106564.1|  PREDICTED: protein SRG1                            295   3e-94    
ref|XP_006467559.1|  PREDICTED: protein SRG1-like isoform X2            294   5e-94    
ref|NP_177976.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    294   6e-94    
ref|XP_010919592.1|  PREDICTED: S-norcoclaurine synthase 1-like         294   7e-94    
gb|KEH17544.1|  2OG-Fe(II) oxygenase family oxidoreductase              291   1e-93    
ref|XP_004301702.1|  PREDICTED: S-norcoclaurine synthase 1-like         293   2e-93    
ref|XP_010498038.1|  PREDICTED: protein SRG1-like                       293   2e-93    
ref|XP_002889198.1|  oxidoreductase                                     293   2e-93    
ref|XP_009140810.1|  PREDICTED: protein SRG1-like                       293   2e-93    
ref|XP_002269718.1|  PREDICTED: protein SRG1                            293   3e-93    
ref|XP_010417451.1|  PREDICTED: protein SRG1-like isoform X1            292   4e-93    
ref|XP_010664087.1|  PREDICTED: S-norcoclaurine synthase 1-like         291   4e-93    
ref|XP_011028237.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    292   5e-93    
ref|XP_006449603.1|  hypothetical protein CICLE_v10015853mg             291   6e-93    
ref|XP_010664098.1|  PREDICTED: S-norcoclaurine synthase 1 isofor...    291   8e-93    
ref|XP_010053577.1|  PREDICTED: S-norcoclaurine synthase 1-like         291   8e-93    
ref|XP_010537692.1|  PREDICTED: protein SRG1-like isoform X2            291   9e-93    
gb|EMT02970.1|  Protein SRG1                                            291   1e-92    
emb|CAN69330.1|  hypothetical protein VITISV_016336                     290   1e-92    
ref|XP_002270646.2|  PREDICTED: protein SRG1-like                       295   2e-92    
ref|XP_002279355.1|  PREDICTED: S-norcoclaurine synthase 1              290   2e-92    
ref|XP_010053574.1|  PREDICTED: S-norcoclaurine synthase 1-like         290   2e-92    
ref|XP_010476833.1|  PREDICTED: protein SRG1-like                       290   2e-92    
emb|CBI30787.3|  unnamed protein product                                288   2e-92    
ref|XP_008802804.1|  PREDICTED: S-norcoclaurine synthase 1-like         290   3e-92    
ref|XP_002267405.1|  PREDICTED: protein SRG1 isoform X1                 289   5e-92    
emb|CBI30792.3|  unnamed protein product                                288   5e-92    
gb|KCW74243.1|  hypothetical protein EUGRSUZ_E02880                     286   5e-92    
ref|XP_010096601.1|  Protein SRG1                                       289   8e-92    
ref|XP_002269890.1|  PREDICTED: protein SRG1                            288   1e-91    
emb|CDY11068.1|  BnaA03g47270D                                          288   2e-91    
ref|XP_010448855.1|  PREDICTED: protein SRG1-like                       288   2e-91    
emb|CDP21498.1|  unnamed protein product                                285   3e-91    
gb|EPS65204.1|  hypothetical protein M569_09574                         284   4e-91    
ref|XP_010104366.1|  S-norcoclaurine synthase 1                         287   4e-91    
gb|KDP21185.1|  hypothetical protein JCGZ_21656                         285   4e-91    
emb|CAN60619.1|  hypothetical protein VITISV_010885                     287   5e-91    
ref|XP_009620033.1|  PREDICTED: thebaine 6-O-demethylase-like iso...    286   5e-91    
ref|XP_011096570.1|  PREDICTED: protein SRG1-like                       286   7e-91    
ref|XP_009382428.1|  PREDICTED: S-norcoclaurine synthase 1-like         286   1e-90    
ref|XP_009382431.1|  PREDICTED: S-norcoclaurine synthase 1-like         286   1e-90    
ref|XP_002279422.2|  PREDICTED: S-norcoclaurine synthase 1 isofor...    285   3e-90    
ref|XP_003552185.2|  PREDICTED: protein SRG1-like isoform X1            285   3e-90    
gb|EYU28156.1|  hypothetical protein MIMGU_mgv1a009322mg                284   3e-90    
emb|CDM80650.1|  unnamed protein product                                284   4e-90    
emb|CBI30786.3|  unnamed protein product                                283   5e-90    
gb|KCW77264.1|  hypothetical protein EUGRSUZ_D01621                     285   5e-90    
ref|XP_006436777.1|  hypothetical protein CICLE_v10031948mg             284   5e-90    
gb|KHG08200.1|  S-norcoclaurine synthase 1                              284   6e-90    
gb|KEH40722.1|  2OG-Fe(II) oxygenase family oxidoreductase              283   9e-90    
gb|EMT26488.1|  S-norcoclaurine synthase 1                              283   1e-89    
gb|AFK47220.1|  unknown                                                 282   1e-89    
gb|KCW74238.1|  hypothetical protein EUGRSUZ_E02876                     283   1e-89    
ref|XP_009382430.1|  PREDICTED: S-norcoclaurine synthase 1-like         283   1e-89    
ref|XP_010429681.1|  PREDICTED: protein SRG1-like                       283   1e-89    
ref|XP_010059076.1|  PREDICTED: codeine O-demethylase-like              283   2e-89    
ref|XP_009382429.1|  PREDICTED: S-norcoclaurine synthase 1-like         282   3e-89    
ref|XP_009610869.1|  PREDICTED: protein SRG1-like isoform X2            280   3e-89    
ref|XP_002278096.3|  PREDICTED: protein SRG1-like                       282   4e-89    
ref|XP_010655797.1|  PREDICTED: protein SRG1-like                       282   4e-89    
ref|XP_008644315.1|  PREDICTED: S-norcoclaurine synthase 1-like         282   5e-89    
ref|XP_006575845.1|  PREDICTED: protein SRG1-like                       280   5e-89    
ref|XP_010095128.1|  putative xyloglucan endotransglucosylase/hyd...    290   6e-89    
emb|CBI30788.3|  unnamed protein product                                280   6e-89    
gb|EMT02972.1|  S-norcoclaurine synthase 1                              280   2e-88    
emb|CDP08365.1|  unnamed protein product                                280   2e-88    
gb|KDO78011.1|  hypothetical protein CISIN_1g017887mg                   278   2e-88    
ref|XP_002279404.1|  PREDICTED: S-norcoclaurine synthase 1              280   2e-88    
emb|CDX92689.1|  BnaC07g39470D                                          279   4e-88    
emb|CDP18107.1|  unnamed protein product                                277   4e-88    
ref|XP_008225388.1|  PREDICTED: protein SRG1-like                       279   8e-88    
ref|XP_003552186.2|  PREDICTED: protein SRG1-like                       279   1e-87    
ref|XP_003556637.1|  PREDICTED: protein SRG1-like                       278   1e-87    
ref|XP_007153174.1|  hypothetical protein PHAVU_003G013200g             278   1e-87    
ref|XP_007214463.1|  hypothetical protein PRUPE_ppa023992mg             278   1e-87    
gb|AHW42452.1|  GA2ox2                                                  278   1e-87    
ref|XP_003531421.1|  PREDICTED: protein SRG1-like                       278   2e-87    
gb|AAD50034.1|AC007651_29  Very similar to SRG1                         277   2e-87    
gb|KGN49353.1|  hypothetical protein Csa_6G521000                       276   3e-87    
gb|KHN29183.1|  Protein SRG1                                            277   3e-87    
ref|XP_006644153.1|  PREDICTED: protein SRG1-like                       276   3e-87    
ref|XP_009384465.1|  PREDICTED: S-norcoclaurine synthase 1-like         276   4e-87    
ref|XP_010664128.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    276   4e-87    
ref|XP_010664126.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    276   5e-87    
ref|XP_004296820.1|  PREDICTED: protein SRG1-like                       277   5e-87    
ref|XP_002282580.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    276   5e-87    
ref|XP_007009259.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    276   6e-87    
ref|XP_010919856.1|  PREDICTED: S-norcoclaurine synthase 1-like         276   1e-86    
ref|XP_004134920.1|  PREDICTED: protein SRG1-like                       275   1e-86    
ref|XP_010664106.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    275   1e-86    
ref|XP_010053023.1|  PREDICTED: codeine O-demethylase-like              275   2e-86    
ref|XP_006494098.1|  PREDICTED: protein SRG1-like                       272   2e-86    
ref|XP_010059077.1|  PREDICTED: codeine O-demethylase-like              275   2e-86    
ref|XP_006439037.1|  hypothetical protein CICLE_v10031934mg             275   2e-86    
ref|XP_003559044.1|  PREDICTED: S-norcoclaurine synthase 1-like         275   2e-86    
ref|XP_008803154.1|  PREDICTED: protein SRG1-like                       275   2e-86    
ref|XP_010919857.1|  PREDICTED: S-norcoclaurine synthase 1-like         275   3e-86    
ref|XP_006494096.1|  PREDICTED: codeine O-demethylase-like isofor...    272   3e-86    
ref|XP_008784673.1|  PREDICTED: S-norcoclaurine synthase 1-like         275   3e-86    
ref|XP_010662429.1|  PREDICTED: protein SRG1 isoform X2                 274   4e-86    
emb|CDY40002.1|  BnaC05g13130D                                          274   4e-86    
ref|XP_004980988.1|  PREDICTED: S-norcoclaurine synthase 1-like         274   7e-86    
ref|XP_007223329.1|  hypothetical protein PRUPE_ppa007361mg             274   8e-86    
emb|CDP14578.1|  unnamed protein product                                271   1e-85    
emb|CBI33962.3|  unnamed protein product                                283   1e-85    
ref|XP_010057194.1|  PREDICTED: codeine O-demethylase-like              273   1e-85    
ref|XP_004303202.1|  PREDICTED: protein SRG1-like                       272   1e-85    
ref|XP_004986102.1|  PREDICTED: S-norcoclaurine synthase 1-like         273   1e-85    
ref|XP_006435645.1|  hypothetical protein CICLE_v10033449mg             273   1e-85    
ref|XP_008438869.1|  PREDICTED: protein SRG1                            273   1e-85    
ref|XP_004134481.1|  PREDICTED: protein SRG1-like                       273   2e-85    
emb|CDP08368.1|  unnamed protein product                                273   2e-85    
gb|KDO69142.1|  hypothetical protein CISIN_1g047368mg                   273   2e-85    
ref|XP_008223172.1|  PREDICTED: protein SRG1                            272   3e-85    
gb|AHW42456.1|  GA2ox6                                                  273   3e-85    
gb|EAY79495.1|  hypothetical protein OsI_34623                          271   3e-85    
ref|XP_004967582.1|  PREDICTED: S-norcoclaurine synthase 1-like i...    271   4e-85    
ref|XP_006482819.1|  PREDICTED: protein SRG1-like                       271   5e-85    
gb|KEH22931.1|  2OG-Fe(II) oxygenase family oxidoreductase              271   5e-85    
gb|KDP39997.1|  hypothetical protein JCGZ_01995                         271   5e-85    
ref|XP_004159844.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...    271   8e-85    
ref|XP_006432904.1|  hypothetical protein CICLE_v10001623mg             268   9e-85    
ref|XP_009109588.1|  PREDICTED: protein SRG1-like                       271   1e-84    
gb|KDP21831.1|  hypothetical protein JCGZ_00618                         270   1e-84    
emb|CDY19267.1|  BnaC01g32130D                                          271   1e-84    
gb|AAL79798.1|AC079874_21  putative ethylene-forming enzyme             270   1e-84    
gb|KDO37893.1|  hypothetical protein CISIN_1g041579mg                   270   1e-84    
gb|AHW42458.1|  GA2ox8                                                  271   1e-84    
emb|CDY44337.1|  BnaC05g30560D                                          270   2e-84    
ref|XP_007035547.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    270   2e-84    
ref|XP_006471705.1|  PREDICTED: protein SRG1-like                       273   2e-84    
ref|XP_009382554.1|  PREDICTED: protein SRG1-like                       270   2e-84    
ref|XP_009352238.1|  PREDICTED: protein SRG1-like                       270   2e-84    
ref|NP_001042986.1|  Os01g0351800                                       269   2e-84    
ref|XP_008796105.1|  PREDICTED: S-norcoclaurine synthase 1-like         270   2e-84    
ref|XP_002300323.2|  hypothetical protein POPTR_0001s36520g             270   2e-84    
gb|KDO69078.1|  hypothetical protein CISIN_1g046496mg                   270   3e-84    
ref|XP_009145479.1|  PREDICTED: protein SRG1                            270   3e-84    
ref|XP_010672645.1|  PREDICTED: protein SRG1                            270   3e-84    
gb|KHF98860.1|  Protein SRG1 -like protein                              270   3e-84    
gb|EAY73950.1|  hypothetical protein OsI_01835                          269   3e-84    
ref|XP_010510193.1|  PREDICTED: protein SRG1-like                       270   3e-84    
gb|KFK39446.1|  hypothetical protein AALP_AA3G246100                    270   3e-84    
emb|CAN72515.1|  hypothetical protein VITISV_005838                     269   3e-84    
ref|XP_006467560.1|  PREDICTED: protein SRG1-like                       270   4e-84    
ref|XP_002313472.1|  hypothetical protein POPTR_0009s02780g             269   4e-84    
ref|XP_006435684.1|  hypothetical protein CICLE_v10033625mg             269   4e-84    
ref|XP_004295415.1|  PREDICTED: protein SRG1-like                       268   5e-84    
ref|XP_009109220.1|  PREDICTED: protein SRG1-like isoform X2            268   5e-84    
ref|XP_008658610.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    269   5e-84    
ref|XP_008390684.1|  PREDICTED: protein SRG1-like                       269   5e-84    
gb|AGT16051.1|  oxygenase                                               269   5e-84    
emb|CDY37294.1|  BnaA01g25140D                                          269   7e-84    
emb|CDP14581.1|  unnamed protein product                                266   8e-84    
gb|ABK24855.1|  unknown                                                 269   8e-84    
emb|CBI30780.3|  unnamed protein product                                266   8e-84    
ref|XP_010466382.1|  PREDICTED: protein SRG1-like                       268   8e-84    
ref|XP_010488155.1|  PREDICTED: protein SRG1-like                       268   8e-84    
dbj|BAJ98741.1|  predicted protein                                      268   1e-83    
ref|XP_002466070.1|  hypothetical protein SORBIDRAFT_01g000660          268   1e-83    
gb|ACU21203.1|  unknown                                                 265   1e-83    
emb|CBI30521.3|  unnamed protein product                                282   1e-83    
gb|KDP21179.1|  hypothetical protein JCGZ_21650                         268   1e-83    
ref|XP_007029342.1|  Senescence-related gene 1                          268   1e-83    
ref|XP_004983673.1|  PREDICTED: S-norcoclaurine synthase 1-like         268   1e-83    
ref|XP_002464937.1|  hypothetical protein SORBIDRAFT_01g029140          268   1e-83    
ref|XP_009369137.1|  PREDICTED: protein SRG1-like                       268   1e-83    
ref|XP_009339826.1|  PREDICTED: protein SRG1-like                       268   1e-83    
ref|XP_006406271.1|  hypothetical protein EUTSA_v10020997mg             268   1e-83    
ref|XP_009620034.1|  PREDICTED: thebaine 6-O-demethylase-like iso...    266   2e-83    
ref|XP_009792316.1|  PREDICTED: protein SRG1-like                       268   2e-83    
ref|XP_010417453.1|  PREDICTED: protein SRG1-like isoform X3            265   2e-83    
ref|XP_002272119.1|  PREDICTED: protein SRG1                            267   2e-83    
ref|XP_006584377.1|  PREDICTED: protein SRG1-like                       266   3e-83    
emb|CDO98885.1|  unnamed protein product                                267   3e-83    
ref|XP_011046706.1|  PREDICTED: codeine O-demethylase-like              267   4e-83    
ref|XP_007029339.1|  Senescence-related gene 1                          266   4e-83    
gb|KHG05552.1|  S-norcoclaurine synthase 1                              266   4e-83    
ref|XP_004983668.1|  PREDICTED: protein SRG1-like isoform X1            266   4e-83    
ref|NP_001065365.1|  Os10g0558700                                       266   5e-83    
ref|XP_006297976.1|  hypothetical protein CARUB_v10014020mg             266   5e-83    
ref|XP_011042009.1|  PREDICTED: protein SRG1-like                       266   5e-83    
ref|XP_006449602.1|  hypothetical protein CICLE_v10018344mg             267   5e-83    
ref|XP_009338608.1|  PREDICTED: protein SRG1-like                       266   5e-83    
ref|XP_009338589.1|  PREDICTED: protein SRG1-like                       266   6e-83    
ref|XP_010104367.1|  S-norcoclaurine synthase 1                         266   6e-83    
ref|XP_008371733.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    266   7e-83    
ref|XP_003546377.1|  PREDICTED: protein SRG1-like                       266   8e-83    
ref|XP_002468701.1|  hypothetical protein SORBIDRAFT_01g050490          266   8e-83    
gb|AGQ42613.1|  2ODDlike1                                               266   8e-83    
ref|XP_003533455.1|  PREDICTED: protein SRG1                            266   8e-83    
ref|XP_002528471.1|  Naringenin,2-oxoglutarate 3-dioxygenase, put...    264   8e-83    
gb|KHN47359.1|  Protein SRG1                                            265   9e-83    
ref|XP_006305429.1|  hypothetical protein CARUB_v10009827mg             264   1e-82    



>ref|XP_009772021.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=358

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 229/295 (78%), Gaps = 10/295 (3%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN--VPVIDM  224
            +AMEA    LG S+ VPSVQ+L K     +PSRY+ D  +     +SI++++  VPVIDM
Sbjct  1    MAMEAHTTELGGSMKVPSVQELAKQKLVTIPSRYVRDDQD-----RSISSLDKEVPVIDM  55

Query  225  QKLQSENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            Q L S +S   ELQKLH A KDWGFF LINHGV+ S+VE++K EIQ+FFNLPLEEK ++ 
Sbjct  56   QHLNSTDSMNLELQKLHFAAKDWGFFQLINHGVSSSVVEKMKSEIQEFFNLPLEEKAKFE  115

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q  GDTDGFGQLFVVS+EQKLDWAD+F LKT PT++R P +F KL   FR TIE YS E+
Sbjct  116  QLAGDTDGFGQLFVVSDEQKLDWADMFCLKTSPTHLRRP-IFSKLSLPFRETIEAYSEEV  174

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             +L+MKVL  L K LGI++EE+  LF +GMQS+RMNYYPPCP+ E VMGL PHSDA  L 
Sbjct  175  KELAMKVLDLLGKALGIEAEEVNNLFGKGMQSVRMNYYPPCPQPELVMGLCPHSDACALA  234

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNET GL+I+KDG W P+LP+PNAF+VNVGD +EIFSNGIYRSIEHR++VS
Sbjct  235  ILLQVNETDGLQIRKDGIWIPVLPLPNAFIVNVGDSLEIFSNGIYRSIEHRSVVS  289



>ref|XP_006355577.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=359

 Score =   368 bits (945),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 218/286 (76%), Gaps = 14/286 (5%)
 Frame = +3

Query  90   LPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN---VPVIDMQKLQSENSE---  251
            + VPSVQ+L K     +PSRY+ D  +     +SIA  N   VPVIDMQ+L + N     
Sbjct  9    MEVPSVQELAKKKLMTIPSRYVRDDQD-----RSIATSNYKQVPVIDMQRLINSNDHDSM  63

Query  252  --ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
              EL KLH A KDWGFF LINHGV+CS+VE++K E Q FF+LPLEEK+++ Q+ GDTDGF
Sbjct  64   NLELNKLHFAAKDWGFFQLINHGVSCSVVEKMKHETQKFFDLPLEEKKKFEQSSGDTDGF  123

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQLFVVS EQKLDWAD+FYLKT PT +R P +F KL  + R TIE Y+ E+  LSMKVL 
Sbjct  124  GQLFVVSNEQKLDWADLFYLKTAPTYLRKP-IFSKLYLSLRETIEEYADEIKTLSMKVLE  182

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
             L K LGI  +E++ LFEEGMQSMRMNYYPPCP+ + VMG++PHSDA GLTILLQVNET 
Sbjct  183  MLGKALGIDEKEVKSLFEEGMQSMRMNYYPPCPQPDKVMGITPHSDATGLTILLQVNETQ  242

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+I+KDG W PI P+PNAF+VNVGD  EIFSNGIY+SIEHR++VS
Sbjct  243  GLQIRKDGIWTPIEPLPNAFIVNVGDAFEIFSNGIYKSIEHRSVVS  288



>ref|XP_009610880.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=355

 Score =   368 bits (944),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 183/292 (63%), Positives = 223/292 (76%), Gaps = 7/292 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            MEA    L  S+ VPSVQ+L K     +PSRY+ D  +   S+   +   VPVID+Q+L 
Sbjct  1    MEAHTGELEDSMKVPSVQELAKQKLVTIPSRYVRDDQDRSISS---SDKEVPVIDLQRLN  57

Query  237  SENSE---ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
            S +     ELQKLH A KDWGFF LINHGV+ S+VE++K EIQ FFNLPLE K+++ Q  
Sbjct  58   STDHSMNLELQKLHFAAKDWGFFQLINHGVSSSVVEKMKSEIQKFFNLPLEAKEKFEQLP  117

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GDTDGFGQLFVVS++QKLDWAD+F LKT PT++R P +F KL  +FR TI+ YS E+ +L
Sbjct  118  GDTDGFGQLFVVSDDQKLDWADMFCLKTSPTHLRKP-IFSKLSLSFRETIDAYSEEVKEL  176

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            +MKVL  L K +GIK+EE+  LFE+GMQSMRMNYYPPCP+ + VMGL PHSDA  L ILL
Sbjct  177  AMKVLKVLGKAVGIKAEEVNNLFEKGMQSMRMNYYPPCPQPDLVMGLCPHSDACALAILL  236

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            QVNET GL+I+KDG W PILP+PNAFVVNVGD +EIFSNGIYRSIEHR++VS
Sbjct  237  QVNETEGLQIRKDGIWIPILPLPNAFVVNVGDSLEIFSNGIYRSIEHRSVVS  288



>gb|KDP32875.1| hypothetical protein JCGZ_12167 [Jatropha curcas]
Length=359

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/289 (61%), Positives = 220/289 (76%), Gaps = 6/289 (2%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSE  242
            A+ ++LG SL VPSVQ+L K+    +P RY+   + SP     I+++ VPVIDM KL S+
Sbjct  4    AEPKTLGSSLIVPSVQELAKEPLTDLPPRYLRPDIGSPI----ISSIQVPVIDMSKLFSQ  59

Query  243  N--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
                 EL K H ACKDWGFF LINHGV+ SLVE++K EIQ+FFNLP++EK++Y Q  G+ 
Sbjct  60   EFMDIELDKFHHACKDWGFFQLINHGVSSSLVEKLKVEIQEFFNLPMDEKKKYWQVPGEM  119

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQ FVVSEEQKLDW D+FY+ TLP N+R P+LFPKLP  FR T+E YS E   LSMK
Sbjct  120  EGFGQAFVVSEEQKLDWGDIFYMVTLPPNMRKPHLFPKLPLPFRETLEAYSAETKNLSMK  179

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L F+A+ LG+K EE++ LFEEG+Q MRMNYYPPCP+ E  MGL+ HSD  GLT+LLQVN
Sbjct  180  ILYFMAQALGMKPEEIKELFEEGLQQMRMNYYPPCPQPELAMGLNSHSDPNGLTVLLQVN  239

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL+IKKDG W  + P+P AF++N+GD VEIF+NGIYRSIEHRA V+
Sbjct  240  EVEGLQIKKDGKWVSVKPLPKAFIINIGDMVEIFTNGIYRSIEHRAAVN  288



>ref|XP_004233006.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=359

 Score =   366 bits (939),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 218/283 (77%), Gaps = 8/283 (3%)
 Frame = +3

Query  90   LPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE-----E  254
            + VPSVQ+L K     +PSRY+ D  +   S  S     VPVIDMQ+L + N       E
Sbjct  9    MEVPSVQELAKKKLVSIPSRYVRD--DQDRSIASSIYKEVPVIDMQRLINFNDHDSMNLE  66

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KLHLA KDWGFF LINHGV+CS+VE++K E Q FF+LPLEEK+++ ++ GDTDGFGQL
Sbjct  67   LNKLHLAAKDWGFFQLINHGVSCSVVEKMKDETQKFFDLPLEEKKKFEKSSGDTDGFGQL  126

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVS+EQKLDWAD+FYLKT PT +R P +F KL  + R TIE Y+ E+ KLSM+VL  L 
Sbjct  127  FVVSDEQKLDWADLFYLKTSPTYLRKP-VFSKLYLSLRETIEEYADEIKKLSMRVLETLG  185

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K LGI  +E++ +F+EGMQSMRMNYYPPCP+ E VMGL+PHSDA GLTILLQVNET GL+
Sbjct  186  KALGIDEDEVKSVFKEGMQSMRMNYYPPCPQPEKVMGLTPHSDATGLTILLQVNETQGLQ  245

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG W PI P+PNAF+VNVGD  EIFSNGIY+SIEHR++VS
Sbjct  246  IKKDGIWIPIEPLPNAFIVNVGDAFEIFSNGIYKSIEHRSVVS  288



>ref|XP_009772022.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=365

 Score =   361 bits (926),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/288 (59%), Positives = 222/288 (77%), Gaps = 3/288 (1%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE-SP-ASAKSIA-AVNVPVIDMQKLQS  239
            A +LG +L VPSVQ+L  D+P  VP+RY+ D  + SP  S+ SI+ + N+P+I+M+ L  
Sbjct  7    ATTLGGTLAVPSVQELATDSPEKVPARYVRDDQDFSPIKSSTSISFSDNIPIINMESLLL  66

Query  240  ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
             +  EL+KL  ACKDWGFF LINHGV+ SLVE+VK++ QDFFNLP++EK+ + Q +GD D
Sbjct  67   GDEIELKKLDSACKDWGFFQLINHGVSGSLVEKVKKDTQDFFNLPMDEKKMWKQVDGDLD  126

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQ FVVSEEQKLDWAD+F+L TLP  +R  ++FP+LP  FR T+E Y+ E+  L++K+
Sbjct  127  GFGQAFVVSEEQKLDWADLFFLTTLPPFLRKQHMFPRLPLPFRETVELYAAELKTLALKI  186

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            + F+AK L I  E M  LF EGMQ+MRMNYYPPCPE E V+GLSPHSD  GLTILLQ+N+
Sbjct  187  INFIAKALNIDEEYMSELFGEGMQAMRMNYYPPCPEPEKVIGLSPHSDGVGLTILLQLNQ  246

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
              GL+IKKDG W PI P+PNAF++N+GD +EI +NG YRSIEHRA V+
Sbjct  247  MEGLQIKKDGMWIPISPLPNAFIINIGDILEIVTNGTYRSIEHRATVN  294



>ref|XP_002268288.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=364

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/279 (60%), Positives = 219/279 (78%), Gaps = 3/279 (1%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSEN--SEELQKL  266
            VP VQ+LVK+    VP RY+    +SP  + +  ++ +VP+ID+ +L S +    EL+KL
Sbjct  14   VPCVQELVKEPLTAVPHRYVRPEQDSPVLSNATDSMPHVPIIDLHRLLSADFTHSELEKL  73

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
            H AC++WGFF LINHGV+ SLVE+VK E Q+FFNLPLEEK+++ Q  G+ +GFGQ FVVS
Sbjct  74   HRACQEWGFFQLINHGVSSSLVEKVKAETQEFFNLPLEEKKKFWQKPGEVEGFGQAFVVS  133

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EEQKLDW D+F++ TLPT+ R P+LFPKLP  FR+T+E Y VEM  L++ +L F+ K L 
Sbjct  134  EEQKLDWGDIFFMSTLPTHFRKPHLFPKLPLPFRDTLEVYVVEMRNLALTMLSFMEKALK  193

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            I+  EMR LFE+G+Q+MRMNYYPPCP+ E V+GL+PHSD+ GLTILLQVNE  GL+I+KD
Sbjct  194  IEVNEMRKLFEQGLQAMRMNYYPPCPKPEQVIGLTPHSDSVGLTILLQVNEVEGLQIRKD  253

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W PI P+PNAF+VN+GD +EIFSNGIY+SIEHRA+V+
Sbjct  254  GMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAVVN  292



>ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=355

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 220/280 (79%), Gaps = 10/280 (4%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN---VPVIDMQKLQSENSE-ELQK  263
            VPSVQ++ K     +PSRYI D  +      SIA+ N   VPVIDMQ+L +++   EL K
Sbjct  18   VPSVQEMAKTKLVTIPSRYIRDNQDP-----SIASSNYKEVPVIDMQRLINDSMNLELNK  72

Query  264  LHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVV  443
            LH+A K+WGFF LINHGVN S++E++K EI+  FNLPLEEK+++ Q+ G+ DGFGQLFVV
Sbjct  73   LHIAAKEWGFFQLINHGVNFSMMEKMKDEIKKLFNLPLEEKKKFEQSSGELDGFGQLFVV  132

Query  444  SEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNL  623
            S+EQKLDWAD+F LKT PT +R P +F KLP + R TIE YS E+++LSMKVL  L K L
Sbjct  133  SDEQKLDWADLFVLKTAPTYLRRP-IFSKLPLSLRETIEEYSKEVNELSMKVLEMLGKAL  191

Query  624  GIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
            GI  EE++ +FEEGMQSM+MNYYPPCP+ E VMGL PHSD+ GLTILLQVNE  GL+IKK
Sbjct  192  GIDEEEVKSVFEEGMQSMKMNYYPPCPQPEKVMGLCPHSDSSGLTILLQVNEIEGLQIKK  251

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            DG W PILP+PNAFVVNVGD +EIFSNGIY+SIEHR++V+
Sbjct  252  DGIWIPILPLPNAFVVNVGDALEIFSNGIYKSIEHRSVVN  291



>gb|KDP21186.1| hypothetical protein JCGZ_21657 [Jatropha curcas]
Length=364

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 219/293 (75%), Gaps = 2/293 (1%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            + ME +   LG SL VP VQ+L K+    VP RY+    +SP  + S     VP+IDM K
Sbjct  1    MEMEPELTKLGTSLLVPCVQELAKEPLTNVPPRYLRLDQDSPIVSNSAYLPQVPIIDMSK  60

Query  231  LQSENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S+ S   EL +L  ACK+WGFF LINHGV+ SLVE VK EIQ+FFNLP++EK++Y Q 
Sbjct  61   LFSQESMDFELDRLDRACKEWGFFQLINHGVSSSLVENVKVEIQEFFNLPVDEKKKYWQR  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
             G+ +GFGQ FVVSEEQKLDW D+FY+ TLP N+R P+LFP+LP  FR+T+E YS E+  
Sbjct  121  PGEMEGFGQAFVVSEEQKLDWGDIFYMITLPPNLRRPHLFPQLPLPFRDTLEAYSREIKD  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+M +L F+A+ LG++ EEM+  FEEG Q +RMNYYPPCP+ E VMGL+ HSDA GLTIL
Sbjct  181  LAMTILKFMARALGMEPEEMKQQFEEGCQKVRMNYYPPCPQPELVMGLNSHSDAVGLTIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+IKK+G W P+ P+PNAF+VNVGD +EI +NGIYRSIEHRA V+
Sbjct  241  LQVNEVEGLQIKKNGKWVPVKPLPNAFIVNVGDILEIVTNGIYRSIEHRATVN  293



>ref|XP_006355623.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase-like 
[Solanum tuberosum]
Length=361

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 222/291 (76%), Gaps = 5/291 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL--  233
            EA +++LG +L VPSV +L K     +PSRYI D +E  +S  SI    VPVIDM+KL  
Sbjct  3    EASSRNLGTTLKVPSVCELAKQELATIPSRYIRDDLEKISS--SILLPQVPVIDMEKLLI  60

Query  234  -QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
                ++ EL++LH ACK+WGFF ++NHGV+ SL+E+VK EI+ FF+LP+EEK+++ Q EG
Sbjct  61   IGDHDNSELERLHFACKEWGFFQVVNHGVSSSLLEKVKSEIRAFFDLPMEEKKKFDQQEG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FV SEEQKLDW D+FY+ TLPT +R P++FPKLP++ R  +E +S E   L+
Sbjct  121  DVEGFGQAFVFSEEQKLDWGDLFYMTTLPTYLRKPHIFPKLPDSLREIMEEHSKEFKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +++LC LAK L +  +EMR LF +GMQ +RMNYYPPCPE E  +G+SPHSDA  LTILLQ
Sbjct  181  IRILCELAKVLRMDEKEMRDLFNDGMQIIRMNYYPPCPEPEKTIGISPHSDADALTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NET GL+++KDG W P+ P+PNA +VNVGD +EI SNG+YRSIEHRA+V+
Sbjct  241  LNETEGLQVRKDGIWVPVKPLPNALIVNVGDMMEILSNGVYRSIEHRAVVN  291



>ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=355

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 217/294 (74%), Gaps = 7/294 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYI---HDGVESPASAKSIAAVNVPVIDMQ  227
            ME      G SL VPSVQ+L KDN   VP RYI   H  +    +  SI  + +PVIDM 
Sbjct  1    MEEIKNPSGTSLLVPSVQELAKDNILTVPPRYIQSQHQDLVITEADHSI--LEIPVIDMN  58

Query  228  KLQSE--NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             L S    S EL KLHLACKDWGFF L+NHGVN SLVE+VK EIQD FNLP+ EK+++ Q
Sbjct  59   NLLSLEFGSSELAKLHLACKDWGFFQLVNHGVNSSLVEKVKLEIQDLFNLPMSEKKKFWQ  118

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
            +    +GFGQ FVVSEEQKLDWAD+F++ TLP ++R P LFP+LP   R+T E YS+E+ 
Sbjct  119  SSQHMEGFGQAFVVSEEQKLDWADLFFMTTLPKHLRMPQLFPQLPLHMRDTFELYSIELK  178

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
            KL+M ++ ++ K L I  +EM +LFE+G+QSMRMNYYPPCP+ E V+GL+PHSD  GLTI
Sbjct  179  KLAMIIVEYMGKALKIDEKEMSILFEDGVQSMRMNYYPPCPQPEKVIGLTPHSDGSGLTI  238

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQ+NE  GL+++KDG W P+ P+PNAF+VN+GD +EI +NGIYRSIEHRA V+
Sbjct  239  LLQLNEVEGLQVRKDGMWVPVKPLPNAFIVNIGDILEIITNGIYRSIEHRATVN  292



>ref|XP_006477808.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 211/284 (74%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP ++       +PVIDMQ L SE S   
Sbjct  4    IGGSLLVPCVQELVKNPMLVVPPRYIRPDQDSPLNSDDTLISQIPVIDMQSLLSEESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACKDWGFF L+NHGV+ + +E++K+E+Q FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDSACKDWGFFQLVNHGVSSAFLEKLKKEVQGFFNLSMEEKKKYWQHPGDVEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP   R+T+E YS+E+  L+M ++  +
Sbjct  124  AFVVSEEQKLDWADIFSVITLPVHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             K L IK EE+R  F+ G QSMRMNYYPPCP+ E VMGL+PHSD   LTILLQ+NE  GL
Sbjct  184  GKVLNIKDEELREFFDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IK DG W PI P+PNAF+VN+GD +EI +NG YRSIEHRA+V+
Sbjct  244  QIKNDGKWIPITPLPNAFIVNIGDTLEIITNGTYRSIEHRAIVN  287



>ref|XP_004233005.2| PREDICTED: codeine O-demethylase-like [Solanum lycopersicum]
Length=361

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/291 (56%), Positives = 221/291 (76%), Gaps = 5/291 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL--  233
            E+ ++ +G +L VPSV++L K     +PSRYI D +E   ++ SI    VPVIDM+KL  
Sbjct  3    ESSSRKIGSTLKVPSVRELAKQELAAIPSRYIRDDLEK--TSCSILMPQVPVIDMEKLLI  60

Query  234  -QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
                ++ EL++LH ACK+WGFF ++NHGV+  L+E+VK EI+ FF+LP+EEK+++ Q EG
Sbjct  61   IGDHDTAELERLHFACKEWGFFQVVNHGVSSLLLEKVKSEIRAFFDLPMEEKKKFDQQEG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FV S+EQKLDW D+FY+ TLPTN+R P+LFPKLP + R T+E +S E   L+
Sbjct  121  DVEGFGQAFVFSQEQKLDWGDLFYMTTLPTNLRKPHLFPKLPHSLRETMEEHSKEFKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +++LC LAK LG+  +EMR L  +GMQ +RMNYYPPCPE E  +G+SPHSDA  LTILLQ
Sbjct  181  IRILCQLAKVLGMDEKEMRDLSNDGMQLIRMNYYPPCPEPEKTIGISPHSDADALTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NET GL+++KD  W P+ P+P+A +VNVGD +EI SNG+YRSIEHRA+V+
Sbjct  241  LNETEGLQVRKDSVWVPVKPLPDALIVNVGDMMEILSNGVYRSIEHRAVVN  291



>ref|XP_010057202.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Eucalyptus grandis]
 gb|KCW74241.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=372

 Score =   354 bits (909),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 217/297 (73%), Gaps = 9/297 (3%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
            L   M+A    LG SLPVPSVQ+  K+    +P RYI   ++   S      + VPVID+
Sbjct  9    LVATMDAIVNKLGSSLPVPSVQEFAKEAITELPPRYIRTDLDHGTSL-----LQVPVIDL  63

Query  225  QKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR  392
             KL S + +    EL+KLH AC+DWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK+R
Sbjct  64   SKLSSSDGDLTESELEKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKRR  123

Query  393  YGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSV  572
            + Q EGD  GFGQ FVVSEEQKLDW D+FY+++LP ++R P+LFP LP  FR+ ++ YS 
Sbjct  124  FWQQEGDLQGFGQAFVVSEEQKLDWGDMFYVESLPRHLRKPHLFPMLPSPFRDVLDKYST  183

Query  573  EMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            E+  L+MK+L  +AK L + ++EM  LF+EG+Q MRMNYYPPCP  E  +GL+PHSDA G
Sbjct  184  ELQDLAMKILLLIAKALKMDTKEMIELFDEGLQMMRMNYYPPCPRPELAIGLTPHSDAAG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +TILLQVNE  GL+++K+G W PI P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  244  VTILLQVNEVEGLQVRKEGKWVPIKPLPNAFVVNVGDILEIVTNGNYRSIEHRATVN  300



>ref|XP_010057200.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=364

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 216/297 (73%), Gaps = 9/297 (3%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
            L   M+A    LG SLPVPSVQ+L K     +P RYI   ++   S      + VPVID+
Sbjct  9    LVATMDAIVNKLGGSLPVPSVQELAKKAITELPPRYIRTDLDHGTSL-----LQVPVIDL  63

Query  225  QKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR  392
             KL S + +    EL+KLH AC+DWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK++
Sbjct  64   SKLSSSDGDLTESELEKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKRK  123

Query  393  YGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSV  572
            + Q EGD  GFGQ FVVSEEQKLDW D+FY+ +LP ++R P+LFP LP  FR+ ++ YS 
Sbjct  124  FWQQEGDLQGFGQAFVVSEEQKLDWGDMFYVVSLPRHLRKPHLFPMLPSPFRDVLDKYST  183

Query  573  EMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            E+  L+MK+L  +AK L + ++EM  LF+EG+Q MRMNYYPPCP  E  +GL+PHSDA G
Sbjct  184  ELQDLAMKILLLMAKALKMDTKEMIELFDEGLQGMRMNYYPPCPRPELAIGLTPHSDAVG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LTILLQVNE  GL+++K+G W PI P+PNAFVVNVGD +EI  NG YRSIEHRA+V+
Sbjct  244  LTILLQVNEVEGLQVRKEGKWVPIKPLPNAFVVNVGDILEIVMNGTYRSIEHRAMVN  300



>ref|XP_010273388.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=366

 Score =   353 bits (907),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 219/293 (75%), Gaps = 3/293 (1%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            + M     +LG S+ VP VQ+L K +  +VP RY+      P  +   +   +PVIDMQ 
Sbjct  5    MIMATKQWTLGSSILVPCVQELAKQHLVIVPPRYVRSQ-HPPIISNPDSIPTIPVIDMQS  63

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L SE S   EL +LH ACKDWGFF L+NHGV+ SLVE+ K EIQ+FFNLPLEEK+++ Q 
Sbjct  64   LLSEESMDSELSRLHAACKDWGFFQLVNHGVSSSLVEKTKLEIQEFFNLPLEEKKKFWQL  123

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            + + +GFGQ FVVSE+QKLDW D+F++ TLPT+ R P+LFPKLP   R+T+++YS EM +
Sbjct  124  QNEIEGFGQAFVVSEDQKLDWGDLFFMSTLPTHRRKPHLFPKLPLPLRDTLDSYSQEMKR  183

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+M +L  +AK L ++  E+R LFE+GMQSMRMNYYPPCPE E  +GL+PHSDA GLTIL
Sbjct  184  LAMNILELMAKALKMEVGEIRELFEDGMQSMRMNYYPPCPEPEKTIGLTPHSDASGLTIL  243

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+++KDG W P+ P+PNAF++N+GD +EIF+NG YRSIEH+A V+
Sbjct  244  LQVNEMEGLQVRKDGMWVPVKPLPNAFIINIGDILEIFTNGTYRSIEHQATVN  296



>ref|XP_002271080.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=354

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 221/294 (75%), Gaps = 8/294 (3%)
 Frame = +3

Query  66   DAQ---SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP---ASAKSIAAVNVPVIDMQ  227
            DAQ   SLG SLPVP VQ+L K     VP RY+    + P    S+ + ++++ PVID  
Sbjct  2    DAQKLTSLGGSLPVPCVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHAPVIDFN  61

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S +S   EL KLH ACK+WGFF L NHGV  +LVE+VK E+Q+FFNLP+EEK+++ Q
Sbjct  62   RLVSGDSMDSELDKLHYACKEWGFFQLTNHGVISTLVEKVKVEVQEFFNLPMEEKKKFWQ  121

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               D  GFGQ FVVSEEQKLDWAD+FY+ TLPT +R P+LFPKLP + R+++E Y+VE+ 
Sbjct  122  QPEDLQGFGQAFVVSEEQKLDWADMFYMITLPTYLRKPHLFPKLPISLRDSLEIYAVELR  181

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L+M +L F+AK L +++ +M+ LFEEG Q+MRMNYYPPCP+ + V+GL+PHSDA GLTI
Sbjct  182  NLAMTILGFIAKALKMEANDMKELFEEGHQAMRMNYYPPCPQPDQVIGLTPHSDAVGLTI  241

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL+I+KDG W PI P+P AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  242  LLQVNEMEGLQIRKDGMWVPIKPLPGAFIVNIGDILEIVTNGAYRSIEHRATVN  295



>ref|XP_006355578.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 219/291 (75%), Gaps = 4/291 (1%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDG---VESPASAKSIAAVNVPVIDMQK  230
            E +   LG SLPVPSVQQL K +P  VP+RY+ D    +  P   K     N+P+I+M+ 
Sbjct  6    ENNFAKLGGSLPVPSVQQLAKGSPENVPARYLRDDDHLLLVPPMMK-FDHYNIPIINMES  64

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L   +  E  KL  AC++WGFF +INHGV+ +LVE+VK++ QDFFNLPLEEK+   Q +G
Sbjct  65   LLRGDEFEFNKLDSACREWGFFQVINHGVSGTLVEKVKKDTQDFFNLPLEEKEMLKQVDG  124

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D DG+GQ FVVSE+QKLDWAD+F+L TLP+  R  ++FP LP+ FR T+E Y+VE+ KL+
Sbjct  125  DMDGYGQAFVVSEDQKLDWADMFFLTTLPSQFRKQHIFPHLPQPFRGTVELYAVELKKLA  184

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K++ FLAK L +  E +  LFEEGMQSMRMNYYPPCP+ + V+GL+PHSDA GLTILLQ
Sbjct  185  LKMIDFLAKALNMDEEYIMELFEEGMQSMRMNYYPPCPQPDKVIGLTPHSDAVGLTILLQ  244

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +N+  GL+IKKDG W PI P+P+AFV+N+GD +EI +NG YRSIEHRA+V+
Sbjct  245  LNQMEGLQIKKDGMWIPISPLPDAFVINIGDIMEIVTNGAYRSIEHRAVVN  295



>ref|XP_009610877.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=364

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 218/291 (75%), Gaps = 5/291 (2%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQKLQ  236
            A ++ +G SL VPSVQ+L K     VP RYI D +E+P    + +++   VPVIDM+KL 
Sbjct  5    ASSRKIGSSLKVPSVQELAKQQL-AVPPRYIRDDIETPVLTSNSSSILPQVPVIDMEKLL  63

Query  237  S--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            +   +  ELQ+LH ACK+WGFF L+NHGV+ SLVE VK EI+ FF+LPLEEK+++ Q EG
Sbjct  64   AIGNDDSELQRLHFACKEWGFFQLVNHGVSSSLVENVKSEIRAFFDLPLEEKKKFEQVEG  123

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +G+GQ FV SEEQKLDWAD+FY+ TLPT++R P+LFPKLP + R+ +E    E   L+
Sbjct  124  DVEGYGQAFVFSEEQKLDWADLFYMTTLPTHLRKPHLFPKLPISLRDIMEAQCQEFKSLA  183

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            + +LC LAK L +   EM+ LF +GMQ +RMN YPPCPE +  +GLSPHSDA  LTILLQ
Sbjct  184  ISILCQLAKALKMDENEMKDLFTDGMQLIRMNCYPPCPEPDKTIGLSPHSDADALTILLQ  243

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NET GL+++KDG W P+ P+PNA +VNVGD +EI SNG+YRSIEHRA+V+
Sbjct  244  LNETEGLQVRKDGIWVPVKPLPNALIVNVGDMIEIVSNGVYRSIEHRAVVN  294



>ref|XP_010272749.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAA---VNVPVIDMQ  227
            ME     LG SL VPSVQ+L KD  N +P RY+H G E P++  S +A    ++PVIDMQ
Sbjct  1    MEEQPPVLGSSLLVPSVQELAKDPMNTLPPRYVHPGQEPPSNPTSTSAPIVQDLPVIDMQ  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             L S  S   EL +L  AC+DWGFF  +NHGV+ SL+E++K +I +FFNLP+EEK++  Q
Sbjct  61   ALFSAESMDSELARLDTACRDWGFFQFVNHGVSSSLLEKLKSKIHEFFNLPMEEKKKLWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              GD +GFGQ FVVSE+QKLDWAD F++ +LPT++R P+LFPKLP  FR T+  Y++EM+
Sbjct  121  KPGDMEGFGQGFVVSEDQKLDWADQFFIISLPTHLRKPHLFPKLPLPFRETLNAYTLEMN  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
            KL+M +L  + K+L +K EEM   FE+GMQ +R+N+YP CP+ E  +GL+PHSDAGGLT+
Sbjct  181  KLAMNILLQMTKSLKMKGEEMNEFFEDGMQGIRINFYPQCPQPELAIGLTPHSDAGGLTL  240

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNET GLEI K GTW P+ P+PNAF+VN+ DC+EI +NG YRSI HRA V+
Sbjct  241  LLQVNETDGLEINKQGTWIPVKPLPNAFIVNIADCLEIATNGAYRSILHRATVN  294



>ref|XP_010057212.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=360

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/292 (55%), Positives = 223/292 (76%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKL  233
            ME  A   G SL VP VQ ++K NP +VP RYI D  E P    + + +  VPVID+ +L
Sbjct  1    METQADIRGRSLLVPCVQDILKANPTMVPKRYICDNQEHPVIMDACSGLPQVPVIDLGRL  60

Query  234  QSENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             SE+S   EL+KLH ACKDWGFF LINH V+  L+E+VK+  ++ FN+P+EEK+++ Q E
Sbjct  61   VSEDSAKPELEKLHQACKDWGFFQLINHDVSPKLIEKVKKGTEELFNMPMEEKKKFWQRE  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G++DGFGQ FV+SE+QKLDWAD+FY+ TLP ++R P+LFPKLP  +R+ ++ YS EM  L
Sbjct  121  GESDGFGQAFVLSEDQKLDWADIFYMVTLPASLRKPHLFPKLPLPYRDDLDAYSKEMQTL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            ++K+L  +AK LG++++++  +FE+G+Q MRMNYYPPCP+ E V+GL+ HSDA  +TILL
Sbjct  181  AIKLLYLMAKALGMEAKDLEGMFEDGLQGMRMNYYPPCPKPELVIGLNSHSDADAITILL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            QVNE  GL+I+KDG W P+ P+P+AF++NVGD VEI +NGIY+SIEHRA V+
Sbjct  241  QVNEMEGLQIRKDGKWIPVKPLPDAFIINVGDIVEIITNGIYQSIEHRATVN  292



>ref|XP_006428590.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 ref|XP_006480427.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR41830.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=362

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/291 (58%), Positives = 215/291 (74%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME    ++G SLPVP VQ L K     VP +YI    ESP    +  A NVPVIDM KL 
Sbjct  1    MELKQPNMGRSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLL  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S +    EL K H ACK+WGFF LINHGV+ SL+E++K EI +FFNLP+EEK++Y Q  G
Sbjct  61   SADFMDSELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEEKKKYWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D  GFGQ FVVSEEQKLDWAD+F + TLPT +R P+LFPKLP  FR+T+E+YS E+  L+
Sbjct  121  DIQGFGQAFVVSEEQKLDWADMFAMYTLPTYLRKPHLFPKLPVHFRDTLESYSAELRNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +++ LFEEG+Q MRMNYYPPCP+ + VMGL+PHSDAGGLTILLQ
Sbjct  181  LKILYQMAKALKMDPNDIKDLFEEGVQIMRMNYYPPCPQPKLVMGLTPHSDAGGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W PI  +P+AF++N+GD +EI +NG Y SIEHRA ++
Sbjct  241  INEMDGLQIKKDGLWVPIKALPDAFIINIGDALEIVTNGSYPSIEHRATIN  291



>ref|XP_011045559.1| PREDICTED: protein SRG1 [Populus euphratica]
Length=355

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/292 (57%), Positives = 220/292 (75%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKL  233
            ME++   LG SL VP VQ+L K NP  +P RYI    + P    S A+VN +PV+DM++L
Sbjct  1    MESNVVQLGSSLIVPCVQELAKVNPAAIPPRYIRPDQDQPTIIPSCASVNEIPVVDMRRL  60

Query  234  QSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
              + S   EL KLHLAC+DWGFF L+NH V+ SL+E+VK ++QDFFNLP+EEK+ + Q  
Sbjct  61   LDQESMDSELAKLHLACRDWGFFQLVNHEVSASLLEKVKTDVQDFFNLPMEEKKLFWQFP  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G+ +GFGQ FV+SEEQKLDW D+F++ T P ++R P+LFPKLP  FR+T+E +S+E+  L
Sbjct  121  GEVEGFGQAFVLSEEQKLDWGDLFFMITQPVHVRKPHLFPKLPLPFRDTVEAFSLELKNL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
             + +L  +AK L I++EE+  LF  G+QSMRMNYYPPCP+ + V+GL+PHSDA GLTILL
Sbjct  181  GITILGKMAKALKIEAEEVEELFGNGLQSMRMNYYPPCPQPDKVIGLTPHSDAVGLTILL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            QVNE  GL++KKDG W P+ P+ NAF++NVGD +EI +NG YRSIEHRA V+
Sbjct  241  QVNEVEGLQVKKDGKWVPVKPLRNAFILNVGDILEIITNGTYRSIEHRATVN  292



>ref|XP_010057205.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74248.1| hypothetical protein EUGRSUZ_E02888 [Eucalyptus grandis]
Length=370

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAA--VNVPVIDMQK  230
            M+A+   LG SLPVPSVQ++ K+    VP RY+    + P     +    +  PVID+ K
Sbjct  1    MDANLTKLGSSLPVPSVQEMAKEPITEVPPRYVRANQDHPFMHAELGTSLLQAPVIDLSK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S N +    EL+KLH+AC+DWGFF LINHGV+CSLVEEVK  IQ+FFNLP+EEK+ + 
Sbjct  61   LSSSNDDFMESELEKLHVACRDWGFFQLINHGVSCSLVEEVKLGIQEFFNLPMEEKRMFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ +VVSEEQKLDW+DVF++ +LP ++R P LFP LP  FR+ ++ YS E+
Sbjct  121  QEEGDMEGFGQTYVVSEEQKLDWSDVFFMVSLPRHLRKPRLFPMLPSPFRDVLQKYSSEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L + ++++  LF+ G Q++RMNYYPPCP  E V+GL+PHSDA  LT
Sbjct  181  RDLAMKILLLMAKPLKMDTKDVMELFDGGRQALRMNYYPPCPRPELVIGLTPHSDASALT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IK +G W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  241  ILLQVNEMEGLQIKTEGKWVPVKPLPNAFVVNVGDILEIVTNGTYRSIEHRATVN  295



>ref|XP_010057199.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
isoform X1 [Eucalyptus grandis]
 gb|KCW74245.1| hypothetical protein EUGRSUZ_E02882 [Eucalyptus grandis]
Length=372

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 216/297 (73%), Gaps = 9/297 (3%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
            L   M+A    LG SLPVPSVQ+L K     +P RYI   ++   S      + VPVID+
Sbjct  9    LVATMDAIVNKLGGSLPVPSVQELAKKAITELPPRYIRTDLDHGTSL-----LQVPVIDL  63

Query  225  QKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR  392
             KL S + +    EL+KLH AC+DWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK++
Sbjct  64   SKLSSSDGDLTESELEKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKRK  123

Query  393  YGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSV  572
            + Q EGD  GFGQ FVVSEEQKLDW D+FY+ +LP ++R P+LFP LP  FR+ ++ YS 
Sbjct  124  FWQQEGDLQGFGQAFVVSEEQKLDWGDMFYVVSLPRHLRKPHLFPMLPSPFRDVLDKYST  183

Query  573  EMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            E+  L+MK+L  +AK L + ++EM  LF+EG+Q MRMNYYPPCP  E  +GL+PHSDA G
Sbjct  184  ELQDLAMKILLLMAKALKMDTKEMIELFDEGLQGMRMNYYPPCPRPELAIGLTPHSDAVG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LTILLQVNE  GL+++K+G W PI P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  244  LTILLQVNEVEGLQVRKEGKWVPIKPLPNAFVVNVGDILEIATNGNYRSIEHRATVN  300



>ref|XP_007025217.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY27839.1| Senescence-related gene 1 [Theobroma cacao]
Length=368

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA---SAKSIAAVNVPVIDMQ  227
            ME     LG SL VP VQ+L K++   VPSRY+    E PA   S  + + + VPVIDMQ
Sbjct  1    METQPPKLGASLLVPCVQELAKEHLIEVPSRYLRSTDEDPAPFLSNANSSLLQVPVIDMQ  60

Query  228  KLQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            KL S++    E +KLH ACK+WGFF LINHGV+ +LVE VK  IQ+FFNLP+EEK+++ Q
Sbjct  61   KLSSKHLKDSESEKLHHACKEWGFFQLINHGVSAALVENVKLGIQEFFNLPMEEKKKFWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               + +GFGQ FVVSEEQKLDW D+FY+ TLPT++R P+LFP LP   R T+E YS ++ 
Sbjct  121  KPDEIEGFGQAFVVSEEQKLDWGDMFYMVTLPTHLRKPHLFPNLPLPLRETLELYSSDLK  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L+MK+L  +AK L +   +MR LFEEG Q MRMNYYPPCP+ +  +GL+ HSDAGGLTI
Sbjct  181  ILAMKMLDLMAKALRMDPNDMRTLFEEGFQGMRMNYYPPCPQPDCAIGLNSHSDAGGLTI  240

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQ+ E  GL+I+KDGTW P+ P+PNAFV+N+GD VEI SNGIYRSIEHRA V+
Sbjct  241  LLQITEVEGLQIRKDGTWIPVKPLPNAFVINIGDIVEIVSNGIYRSIEHRATVN  294



>gb|KDO54061.1| hypothetical protein CISIN_1g018035mg [Citrus sinensis]
Length=362

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/291 (58%), Positives = 215/291 (74%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME    ++G SLPVP VQ L K     VP +YI    ESP    +  A NVPVIDM KL 
Sbjct  1    MELKQPNMGGSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLL  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S +    EL K H ACK+WGFF LINHGV+ SL+E++K EI +FFNLP+EEK++Y Q  G
Sbjct  61   SADFMDSELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEEKKKYWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D  GFGQ FVVSEEQKLDWAD+F + TLPT +R P+LFPKLP  FR+T+E+YS E+  L+
Sbjct  121  DIQGFGQAFVVSEEQKLDWADMFAMYTLPTYLRKPHLFPKLPVHFRDTLESYSAELRNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +++ LFEEG+Q MRMNYYPPCP+ + VMGL+PHSDAGGLTILLQ
Sbjct  181  LKILYQMAKALKMDPNDIKDLFEEGVQIMRMNYYPPCPQPKLVMGLTPHSDAGGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W PI  +P+AF++N+GD +EI +NG Y SIEHRA ++
Sbjct  241  INEMDGLQIKKDGLWVPIKALPDAFIINIGDALEIVTNGSYPSIEHRATIN  291



>ref|XP_009610881.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=357

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 218/288 (76%), Gaps = 3/288 (1%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE-SPASAKSIAAV--NVPVIDMQKLQS  239
            A +LG +L VPSVQ+L KD+P  VP+RY+ D  + SP  +    +   N+P+I+M+ L  
Sbjct  7    AATLGGTLAVPSVQELAKDSPEKVPARYLRDDQDFSPIKSSHFISFSDNIPIINMESLLL  66

Query  240  ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
             +  EL+KL  ACKD GFF +INHGV+ SLVE+VK++ QDFFNLP+++K+ + Q +GD D
Sbjct  67   GDEIELKKLDSACKDGGFFQVINHGVSGSLVEKVKKDTQDFFNLPMDQKKMWKQVDGDLD  126

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQ FVVSE+QKLDWAD+F+L TLP  +R  ++FP LP  FR T+E Y+ E+  L++K+
Sbjct  127  GFGQAFVVSEDQKLDWADLFFLTTLPPFLRKQHIFPHLPLLFRETVELYAAELKTLALKI  186

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            +  +AK L +  E MR LF EGMQ+MRMNYYPPCPE E V+GLSPHSDA GLTILLQ+N+
Sbjct  187  IDLIAKVLNMDGEYMRELFGEGMQTMRMNYYPPCPEPEKVIGLSPHSDAVGLTILLQLNQ  246

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
              GL+IKKDG W PI P+PNAF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  247  MEGLQIKKDGLWIPISPLPNAFIVNIGDILEIVTNGTYRSIEHRATVN  294



>ref|XP_010057204.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=372

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 216/297 (73%), Gaps = 9/297 (3%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
            L   M+A    LG SLPVPSVQ+L K+    +P RYI   ++   S      + VPVID+
Sbjct  9    LVATMDAIVNKLGGSLPVPSVQELAKEAITELPPRYIRTDLDHGTSV-----LQVPVIDL  63

Query  225  QKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR  392
             KL S + +    EL+KLH AC+DWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK+R
Sbjct  64   SKLSSSDGDLTESELEKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKRR  123

Query  393  YGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSV  572
            + Q EGD  GFGQ FVVSEEQKLDW D+FY+ +LP ++R P+LFP LP  FR+ ++ YS 
Sbjct  124  FWQQEGDLQGFGQAFVVSEEQKLDWGDMFYVVSLPRHLRKPHLFPMLPSPFRDVLDKYST  183

Query  573  EMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            E+  L+MK+L  +AK L + ++EM  LF+EG+Q MRMNYYPPCP  E  +GL+PHSDA G
Sbjct  184  ELQDLAMKILLLMAKALKMDTKEMIELFDEGLQGMRMNYYPPCPRPELAIGLTPHSDAKG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LTILLQVNE  GL+++K+G W PI P+PNAFVVNVGD +EI +NG Y SIEHRA V+
Sbjct  244  LTILLQVNEVEGLQVRKEGKWVPIKPLPNAFVVNVGDILEIVTNGNYCSIEHRATVN  300



>ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85258.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=355

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 215/292 (74%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKL  233
            ME+     G SL VP VQ+L K N   +P RYI    + P    S A+VN +PV+DMQ+L
Sbjct  1    MESKVVQFGSSLIVPCVQELAKVNTAAIPPRYIRPDQDQPTIIPSCASVNEIPVVDMQRL  60

Query  234  QSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
              + S   EL KLHLAC+DWGFF L+NH V+ SL+E+VK ++QDFFNLP+EEK+ + Q  
Sbjct  61   LDQESMDSELAKLHLACRDWGFFQLVNHEVSASLLEKVKTDVQDFFNLPMEEKKLFWQYP  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G+ +GFGQ FVVSEEQKLDW D+F++ T P + R P+LFPKLP  FR+T+E +S+E+  L
Sbjct  121  GEVEGFGQAFVVSEEQKLDWGDLFFMVTQPVHARKPHLFPKLPLPFRDTVEAFSLELKNL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
             + +L  +AK L I++EE+  LF  G QSMRMNYYPPCP+ + V+GL+PHSDA GLTILL
Sbjct  181  GITILGKMAKALKIEAEEVEELFGNGFQSMRMNYYPPCPQPDKVIGLTPHSDAVGLTILL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            QVNE  GL++KKDG W P+ P+PNAF+ NVGD +EI +NG YRSIEHRA V+
Sbjct  241  QVNEVEGLQVKKDGKWVPVKPLPNAFIFNVGDILEIITNGTYRSIEHRATVN  292



>ref|XP_010057195.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74240.1| hypothetical protein EUGRSUZ_E02879 [Eucalyptus grandis]
Length=359

 Score =   350 bits (899),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            ME +   LG SLPVP VQ+L K+    VP RY+    + P       ++   VPVIDM K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S + +    EL+KLH+AC+DWGFF LINHGV C+LVEEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFFQLINHGVRCTLVEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ+FV SEEQKLDWAD+F++ +LP ++R P+LFP LP  FR  ++ YS E+
Sbjct  121  QEEGDVEGFGQMFVGSEEQKLDWADLFFMASLPRHLRKPHLFPMLPSPFREVLDEYSSEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L ++ ++M  LF+EG Q++RMNYYPPCP  E V GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALQMEPKDMIELFDEGRQALRMNYYPPCPRPELVTGLTPHSDSTGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+++K+G W  + P+PNAFVVNVGD +EI +NG YRSIEHRA+V+
Sbjct  241  ILLQVNEMEGLQVRKEGKWVSVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVN  295



>gb|KCW74251.1| hypothetical protein EUGRSUZ_E02892 [Eucalyptus grandis]
Length=359

 Score =   350 bits (899),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            ME +   LG SLPVP VQ+L KD    VP RY+    + P       ++   VPVIDM K
Sbjct  1    MEVNLMKLGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S + +    EL+KLH+AC+DWGFF LINHGV+C+L+EEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFFQLINHGVSCTLMEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ+FV S EQKLDWAD+F++ +LP ++R P+LFP LP  FR  ++ Y++E+
Sbjct  121  QEEGDLEGFGQMFVGSAEQKLDWADLFFMASLPRHLRKPHLFPMLPSPFREVLDEYTLEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L ++S++M  LF+EG Q++RMNYYPPCP  E V GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALQMESKDMIELFDEGRQALRMNYYPPCPRPELVTGLTPHSDSNGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILL+VNE  GL+++K+G W  + P+PNAFVVNVGD +EI +NG YRSIEHRA+V+
Sbjct  241  ILLEVNEMEGLQVRKEGKWISVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVN  295



>ref|XP_010057201.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74244.1| hypothetical protein EUGRSUZ_E02881 [Eucalyptus grandis]
Length=359

 Score =   350 bits (898),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            ME +   LG SLPVP VQ+L K+    VP RY+    + P       ++   VPVIDM K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S + +    EL+KLH+AC+DWGFF LINHGV+C+LVEEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFFQLINHGVSCTLVEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ+FV SEEQKLDWADVF++ +LP ++R P+LFP LP  FR  ++ YS E+
Sbjct  121  QEEGDVEGFGQMFVGSEEQKLDWADVFFMASLPRHLRKPHLFPMLPSPFREVLDEYSSEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L ++ ++M  LF+EG Q+ RMNYYPPCP  E V GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALQMEFKDMIELFDEGRQAFRMNYYPPCPRPELVTGLTPHSDSTGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+++K+G W  + P+PNAFVVNVGD +EI +NG YRSIEHRA+V+
Sbjct  241  ILLQVNEMEGLQVRKEGKWVSVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVN  295



>ref|XP_006442330.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
 gb|ESR55570.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
Length=355

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 212/284 (75%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP  +       +PVIDMQ L SE S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDTLISQIPVIDMQSLLSEESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACK+WGFF L+NHG++ + +E++K+E++ FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDFACKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQHPGDMEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP + R T+E YS+E+  L+  ++  +
Sbjct  124  AFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             + L IK EEMR  FE G+Q+MRMNYYPPCP+ E VMGLSPHSDA  LTILLQ+NE  GL
Sbjct  184  GEVLNIKDEEMREFFENGVQAMRMNYYPPCPQPEKVMGLSPHSDAAALTILLQLNEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA+V+
Sbjct  244  QVKKDGKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAVVN  287



>ref|XP_006477804.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 216/283 (76%), Gaps = 2/283 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--EE  254
            G SL VPSV++L ++    VP RYI    ++P  + +      PVIDM+ L SE S   E
Sbjct  5    GGSLLVPSVKELAENPMVAVPPRYIRPKQDAPVISDNTLISKFPVIDMESLLSEESMDSE  64

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KL  AC++WGFF L+NHGV+ +LV++VK+EIQ+FFNL +EEK++Y Q  G+ +GFGQ 
Sbjct  65   LAKLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEEKKKYWQYPGEVEGFGQA  124

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQKLDW D+F++ TLP ++R P+LFPKLP + R+T+E YS+E++ L+M ++  +A
Sbjct  125  FVVSEEQKLDWGDLFFMTTLPVHLRKPHLFPKLPPSLRDTLEVYSMEVNALAMNLISGMA  184

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L IK EE+R  FE G+QSMRMNYYPPCP+ E V GL+PHSDA  LTILLQ+NE  GL+
Sbjct  185  KVLHIKDEEVREFFENGLQSMRMNYYPPCPQPEKVTGLTPHSDAVALTILLQINEAEGLQ  244

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG WFPI P+PNAF+VN+GD +E+ +NG+Y SIEHRA+V+
Sbjct  245  IKKDGKWFPIRPLPNAFIVNIGDVLEVITNGVYPSIEHRAVVN  287



>ref|XP_006355575.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=358

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/281 (62%), Positives = 210/281 (75%), Gaps = 7/281 (2%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE-----ELQ  260
            VPSVQ++ K+    +PSRY+ D  +    A S     VPVIDMQ+L + +       EL 
Sbjct  16   VPSVQEMAKNKLVTIPSRYVRDNQDRSFVASS-NNKEVPVIDMQRLINSSDHDSMNLELN  74

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KLH A K+WGFF LINHGVN  LVE++K EI++ FNLPLEEK+++ Q+ G+ DGFGQ FV
Sbjct  75   KLHFAAKEWGFFQLINHGVNSLLVEKMKNEIKELFNLPLEEKKKFEQSSGELDGFGQHFV  134

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VS+EQKLDWAD+FYLKT P  +R P +F KLP + R TIE YS E  +LS+KVL  L K 
Sbjct  135  VSDEQKLDWADLFYLKTAPPYLRMP-IFSKLPLSLRETIEEYSEEAKELSIKVLKMLGKA  193

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            LGI  EE++ LFEEGMQSMRMNYYPPCP+ E VMGL+PHSDA GLTILLQVN+  GL+IK
Sbjct  194  LGIDEEEVKSLFEEGMQSMRMNYYPPCPQPEKVMGLAPHSDATGLTILLQVNDIQGLQIK  253

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KD  W  ILP+P AF+VNVGD  EIFSNGIY+SIEHR++VS
Sbjct  254  KDEIWISILPLPRAFIVNVGDVFEIFSNGIYKSIEHRSVVS  294



>ref|XP_004233003.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=366

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 214/285 (75%), Gaps = 4/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE---SPASAKSIAAVNVPVIDMQKLQSENS  248
            LG SLPVPSVQQL K +P  VP+RY  D  +    P   K     N+P+I+M+ L   + 
Sbjct  12   LGGSLPVPSVQQLTKSSPENVPARYRRDDDQLLLVPPMMK-FDHYNIPIINMESLLRGDE  70

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             E  KL  AC++WGFF +INHGV+ +LVE+VK++ QDFFNLPLEEK+   Q +GD DG+G
Sbjct  71   IEFNKLDSACREWGFFQVINHGVSGTLVEKVKKDTQDFFNLPLEEKEMLKQVDGDIDGYG  130

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDWAD+F+L TLP   R  ++FP LP+ FR T+E Y+VE+ KL++K++ F
Sbjct  131  QAFVVSEDQKLDWADMFFLTTLPPQFRKKHIFPHLPQPFRGTVELYAVELKKLALKIIDF  190

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  E +R LF EG QSMRMNYYPPCP+ + V+GL+PHSDA GLTILLQ+N+  G
Sbjct  191  LAKGLNMDKEYIRELFGEGSQSMRMNYYPPCPQPDKVIGLTPHSDAVGLTILLQLNQMEG  250

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKDG W PI P+P+AF++N+GD +EI +NG YRSIEHRA+V+
Sbjct  251  LQIKKDGMWIPISPLPDAFIINIGDIMEIVTNGAYRSIEHRAVVN  295



>ref|XP_006489681.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=362

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 219/291 (75%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            MEA + ++G SL VP +Q+L K+ P +VPSR+  +  +      S   V +PVIDMQKL 
Sbjct  1    MEAKSTTMGSSLVVPLIQELAKNTPTIVPSRFTVNDEDHVPLISSSEQVLIPVIDMQKLL  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S +    EL KL  AC++WGFF L+NHGV+ SLVE+VK EIQ+FFNLP+EEK+++    G
Sbjct  61   SGDFMDSELGKLDHACREWGFFQLVNHGVSSSLVEKVKVEIQEFFNLPMEEKEKFWMRPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            +T+GFGQ FVVSEEQ+LDWA  F + TLPT +R P+LFPKLP   R+T+E +S E+  LS
Sbjct  121  ETEGFGQNFVVSEEQRLDWAYGFTMFTLPTYLRKPHLFPKLPLPLRDTLEAWSAELGNLS  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
             K+L  +AK LGI + +++ LFEE MQ+MRMNYYPPCP+ E V+G   HSDA  +TILLQ
Sbjct  181  QKLLHQMAKALGIDANDVKALFEEAMQTMRMNYYPPCPKPEQVIGFKSHSDASSITILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NET GL+IKKDG W P++P+P+AF++NVGD +E+F+NGIYRSIEHRA V+
Sbjct  241  LNETVGLQIKKDGMWVPVIPLPDAFIINVGDILEVFTNGIYRSIEHRATVN  291



>ref|XP_006442333.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
 gb|ESR55573.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
Length=355

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 210/284 (74%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP  +       +PVIDMQ L SE S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDTLISQIPVIDMQSLHSEESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL   CK+WGFF L+NHG++ + +E++K+E++ FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDFVCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQRPGDMEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP + R T+E YS+E+  L+  ++  +
Sbjct  124  AFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             + L IK EEMR  FE G+Q MRMNYYPPCP+ E VMGLSPHSDA  LTILLQ+NE  GL
Sbjct  184  GEVLNIKDEEMREFFENGLQGMRMNYYPPCPQPEKVMGLSPHSDAAALTILLQLNEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA+V+
Sbjct  244  QVKKDGKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAVVN  287



>ref|XP_010057209.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74253.1| hypothetical protein EUGRSUZ_E02897 [Eucalyptus grandis]
Length=371

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP--ASAKSIAAVNVPVIDMQK  230
            M+A+   LG SL VPSV +L K+  + VP+RY+    +       ++ +++ VPVID+ K
Sbjct  1    MDANLTKLGSSLLVPSVLELAKEAISEVPTRYVRTDQDYMFMHDDQATSSLQVPVIDLSK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S N      EL+KLH AC+DWGFF LINHGV+CSLVEEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSNDHTMESELEKLHAACRDWGFFQLINHGVSCSLVEEVKSGIQEFFKLPIEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ FVVSEEQKLDWAD+F++ +LP ++R P+LFP LP  FR+ ++ YS ++
Sbjct  121  QEEGDMEGFGQAFVVSEEQKLDWADLFFMVSLPRHLRKPHLFPLLPSPFRDVLDEYSSKL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L + ++EM  LF+EG QS+RMNYYPPCP  + V+GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALKMDTKEMMELFDEGRQSIRMNYYPPCPRPDLVIGLTPHSDSAGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+++K G W  + P+P AFVVNVGD +EI +NG YRSIEHRA+V+
Sbjct  241  ILLQVNEVEGLQVRKQGKWVLVKPLPEAFVVNVGDILEIVTNGTYRSIEHRAIVN  295



>ref|XP_002269087.1| PREDICTED: protein SRG1 [Vitis vinifera]
 emb|CBI30797.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 219/294 (74%), Gaps = 8/294 (3%)
 Frame = +3

Query  66   DAQ---SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP---ASAKSIAAVNVPVIDMQ  227
            DAQ   SLG SL VPSVQ+L K     VP RY+    + P    S+ + ++++VPVID  
Sbjct  2    DAQKLTSLGGSLMVPSVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHVPVIDFH  61

Query  228  KLQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S +    EL KLH ACKDWGFF L NHGV+ +LVE VK E+Q+FFNLP+EEK+++ Q
Sbjct  62   RLVSGDVLDSELDKLHYACKDWGFFQLTNHGVSSTLVERVKVEVQEFFNLPMEEKKKFWQ  121

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               D +GFGQ FV+SEEQKLDWAD+FY+ TLPT +R P+LFPKLP + R+++E Y+VE+ 
Sbjct  122  EPEDLEGFGQAFVISEEQKLDWADMFYMITLPTYLRKPHLFPKLPISLRDSLEIYAVELR  181

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L+M +L F+AK L +++ +M+ LFEEG Q MRMNYYP CP+ + V+GL+PHSDA GLTI
Sbjct  182  NLAMTILGFIAKALKMEANDMKELFEEGHQGMRMNYYPLCPQPDQVIGLTPHSDAVGLTI  241

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL+I+KDG W PI P+P AF+VN+GD +EI +N  YRSIEHRA V+
Sbjct  242  LLQVNEMEGLQIRKDGMWVPIKPLPGAFIVNMGDILEIVTNAAYRSIEHRATVN  295



>ref|XP_002519766.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42739.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=366

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/290 (57%), Positives = 218/290 (75%), Gaps = 2/290 (1%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQS  239
            +A+A  LG SLPVPSVQ+L K+    VP +Y+   +E P  + + A + VPV+DMQKL S
Sbjct  3    QANATKLGSSLPVPSVQELAKELLTQVPLKYVRPDLEPPLLSNTAALLQVPVVDMQKLLS  62

Query  240  ENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD  413
            E+S   EL KL  ACK+WGFF +INHG   SLV+++K E+++ FNLP+EEK++  Q  G 
Sbjct  63   EDSVDLELNKLDRACKEWGFFQVINHGAKKSLVDKMKIELRELFNLPMEEKKKLWQEPGQ  122

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQ FVVSE+QKLDWAD+FYL TLP ++R  ++F  LP +FR T+E YS E+  L+M
Sbjct  123  MEGFGQHFVVSEDQKLDWADLFYLITLPIHMRKTHVFSALPPSFRETVEAYSAELRILAM  182

Query  594  KVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQV  773
            ++L  +AK LGI   E+   +E G QSMRMNYYPPCP+ +HV+GL+PHSDAGGLTILLQV
Sbjct  183  RILEQMAKALGINFHEIEENYEAGWQSMRMNYYPPCPQPDHVIGLNPHSDAGGLTILLQV  242

Query  774  NETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            NE  GL+I+KDG W P+ P+P+AFV+N+GD +EI +NGIY SIEHRA V+
Sbjct  243  NEIEGLQIRKDGNWIPVKPLPDAFVINIGDSLEIMTNGIYPSIEHRATVN  292



>ref|XP_010057206.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74250.1| hypothetical protein EUGRSUZ_E02891 [Eucalyptus grandis]
Length=370

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 215/295 (73%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAA--VNVPVIDMQK  230
            M+A+   LG SLP PSVQ++ K+    VP RY+    + P     +    +  PVID+ K
Sbjct  1    MDANLTKLGSSLPAPSVQEMAKEPITEVPPRYVRVDQDHPFMHAELGTSLLQAPVIDLSK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S N +    EL+KLH+AC+DWGFF LINHGV+CSLVEEVK  IQ+FF LP+EEK+ + 
Sbjct  61   LSSSNDDFMESELEKLHVACRDWGFFQLINHGVSCSLVEEVKLGIQEFFKLPMEEKRMFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ +VVSEEQKLDW+DVF + +LP ++R P LFP LP  FR+ +E YS E+
Sbjct  121  QEEGDMEGFGQTYVVSEEQKLDWSDVFSMVSLPRHLRKPRLFPMLPSPFRDVLEKYSSEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L + ++++  LF+ G Q++RMNYYPPCP  E V+GL+PHSDA  LT
Sbjct  181  RDLAMKILLLVAKPLKMDTKDVIELFDGGRQALRMNYYPPCPRPELVIGLTPHSDASALT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKK+G W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA ++
Sbjct  241  ILLQVNEMEGLQIKKEGKWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATIN  295



>ref|XP_006442335.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
 gb|ESR55575.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
Length=355

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 211/284 (74%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP ++       +PVIDMQ L SE S   
Sbjct  4    IGGSLLVPCVQELVKNPMLVVPPRYIRPDQDSPINSDDTLISQIPVIDMQSLLSEESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACK+WGFF L+NHGV+ + +E++K+E+Q FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDFACKEWGFFQLVNHGVSSAFLEKLKKEVQGFFNLSMEEKKKYWQHPGDVEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP + R T+E YS+E+  L+  ++  +
Sbjct  124  AFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             + L IK EEMR  FE G+Q+MRMNYYPPCP+ E VMGLSPHSDA  LTIL Q+NE  GL
Sbjct  184  GEVLNIKDEEMREFFENGVQAMRMNYYPPCPQPEKVMGLSPHSDAAALTILRQLNEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKKDG W P+ P+P+AF+VN+GD +EI +NG Y SIEHRA+V+
Sbjct  244  QIKKDGKWIPVTPLPDAFIVNIGDTLEIITNGTYPSIEHRAVVN  287



>ref|XP_006477806.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 ref|XP_006477807.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 211/284 (74%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP  +  I    +PVIDMQ L S+ S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDILISQIPVIDMQSLLSKESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACK+WGFF L+NHG++ + +E++K+E++ FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDFACKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQRPGDMEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP + R T+E YS+E+  L+  ++  +
Sbjct  124  AFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             + L IK EEM   FE G+Q MRMNYYPPCP+ E VMGLSPHSDA  LTILLQ+NE  GL
Sbjct  184  GEVLNIKDEEMIEFFENGLQGMRMNYYPPCPQPEKVMGLSPHSDAAALTILLQLNEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA+V+
Sbjct  244  QVKKDGKWIPVTPLPDAFIVNIGDTLEIITNGTYRSIEHRAVVN  287



>ref|XP_006442325.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|ESR55565.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|KDO39141.1| hypothetical protein CISIN_1g018510mg [Citrus sinensis]
Length=355

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 214/283 (76%), Gaps = 2/283 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--EE  254
            G SL VPSVQ+L ++    VP RYI    ++P  + +      PVIDMQ L SE S   E
Sbjct  5    GGSLLVPSVQELAENPMVAVPPRYIRPEQDAPVISDNTLISKFPVIDMQSLLSEESVDSE  64

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L  L  AC++WGFF L+NHGV+ +LV++VK+EIQ+FFNL +EEK++Y Q  G+ +GFGQ 
Sbjct  65   LANLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEEKKKYWQYPGEVEGFGQA  124

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQ+LDW D+F++ TLP ++R P+LFPKLP + R+T+E YS E++ L+M ++  +A
Sbjct  125  FVVSEEQRLDWGDLFFMTTLPVHLRKPHLFPKLPPSLRDTLEVYSTEVNALAMNLISRMA  184

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L IK EE+R  FE G+QSMRMNYYPPCP+   VMGL+PHSD+  LTILLQ+NE  GL+
Sbjct  185  KVLHIKDEEVREFFENGLQSMRMNYYPPCPQPGKVMGLTPHSDSVALTILLQINEAEGLQ  244

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG WFP+ P+PNAF+VN+GD +E+ +NG+Y SIEHRA+V+
Sbjct  245  IKKDGKWFPVRPLPNAFIVNIGDMLEVITNGVYPSIEHRAVVN  287



>ref|XP_010057210.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74255.1| hypothetical protein EUGRSUZ_E02899 [Eucalyptus grandis]
Length=367

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 212/295 (72%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA--SAKSIAAVNVPVIDMQK  230
            M+ +   LG SLPVP+VQ+L K+    VP RY+    + P          + VPVID+  
Sbjct  1    MDPNLTKLGSSLPVPNVQELAKEVIAEVPPRYVRTDQDHPLMDDDHGTLLLEVPVIDLNN  60

Query  231  LQSENS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S +      EL+KLH ACKDWGFF LINHGV+CSLVEEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSDGNLRESELEKLHTACKDWGFFQLINHGVSCSLVEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q  GD +GFGQ FVVSEEQKLDW D+F+L +LP ++R P+LFP LP  FR+ ++ YS  +
Sbjct  121  QEAGDLEGFGQAFVVSEEQKLDWGDMFFLMSLPRHLRKPHLFPMLPSPFRDVLDEYSSAL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  + K L + ++EM  LF+EG+Q  RMNYYPPCP   HV+GL+PHSDA GLT
Sbjct  181  RDLAMKILLLMGKALKMDTKEMIELFDEGVQYFRMNYYPPCPRPNHVIGLTPHSDAVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+I+K+G W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  241  ILLQVNEMEGLQIRKEGKWIPVKPLPNAFVVNVGDILEIVTNGTYRSIEHRATVN  295



>ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 212/285 (74%), Gaps = 3/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSENS--  248
            LG SLPVP VQ+L K+    VP RY+           +++++  +PVIDMQKL  + S  
Sbjct  5    LGGSLPVPIVQELAKEKLATVPPRYVRPDQHQQTILSTLSSLPQIPVIDMQKLLDKYSVD  64

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL+ L+ AC++WGFF LINHGV+ ++VE++K E+Q+FFNLP+EEK ++ Q E D +G+G
Sbjct  65   SELEALNHACQEWGFFQLINHGVDSTVVEKMKLEVQEFFNLPIEEKNKFMQKEEDIEGYG  124

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSEEQKLDW D+F++ T PT +R P L PKLP  FR+ IE Y+ E+  L+MK+L  
Sbjct  125  QAFVVSEEQKLDWGDMFFVGTSPTYLRKPYLIPKLPPTFRDAIELYASELKVLAMKILKL  184

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            +AK L IK+EEM  LF EG+QSMRMNYYPPCP+ E V GL PHSDA GLTILLQ NE  G
Sbjct  185  MAKALNIKAEEMNTLFAEGVQSMRMNYYPPCPQPELVTGLCPHSDAVGLTILLQANEMEG  244

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKDG W P+ P+PNAFV+N+GD +EI++NG YRSIEHRA V+
Sbjct  245  LQIKKDGAWIPVSPLPNAFVINIGDILEIWTNGAYRSIEHRATVN  289



>ref|XP_003524845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=359

 Score =   345 bits (886),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 216/284 (76%), Gaps = 5/284 (2%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPA--SAKSIAAVNVPVIDMQKLQSENSEE--  254
            SL VP VQ++ KD    VP RY+    E P   SA +     VPVID+ KL S++ +E  
Sbjct  5    SLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEPE  64

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD-TDGFGQ  431
            L+KLH ACK+WGFF LINHGV+ SLVE+VKR  QDFFNLP+EEK++ GQ EG+  +G+GQ
Sbjct  65   LEKLHYACKEWGFFQLINHGVSTSLVEKVKRGAQDFFNLPIEEKKKLGQREGEGVEGYGQ  124

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKL+WAD+F++ TLP +IR P LFP +P  FR+ +ETYS  + KL+++++  +
Sbjct  125  AFVVSEEQKLEWADMFFMLTLPPHIRKPYLFPNIPLPFRDDLETYSAGLKKLAIQIVELM  184

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            A  L + S+E+R LF EG+QSMRMNYYPPCP+ E VMGL+PH+D G LTILLQ+NE  GL
Sbjct  185  ANALNVDSKEIRELFGEGVQSMRMNYYPPCPQPELVMGLNPHTDGGSLTILLQLNEVEGL  244

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IK DG+W PI P+PNAF+VN+GD +EI +NGIYRSIEHRA V+
Sbjct  245  QIKIDGSWIPIKPLPNAFIVNLGDMMEIMTNGIYRSIEHRATVN  288



>ref|XP_011085300.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=356

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/293 (56%), Positives = 212/293 (72%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            M+     LG SLPVP VQ+L K+    VP RY+        +  S+ +    +PVIDMQK
Sbjct  1    MDPKLTKLGSSLPVPIVQELAKEESATVPPRYVRPDQHQQMTLSSLNSSFPQIPVIDMQK  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
                ++   EL  LH AC++WGFF L+  GV+ ++VE++K EIQ+FFNLP+EEK+++ Q 
Sbjct  61   FSDIHTMDSELHALHDACQEWGFFQLMWGGVDSAVVEKMKSEIQEFFNLPIEEKKKFRQK  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            EGD +G+GQ FVVSEEQKLDWAD+FY+ T PT +R P+L P+LP  FR+ IE Y+ E+  
Sbjct  121  EGDVEGYGQAFVVSEEQKLDWADMFYIVTSPTYLRKPHLIPQLPPTFRDAIEVYASELKI  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+MK+L  +AK L +K+EEM  LF +GMQ +RMNYYPPCP+ E V GL PHSDA GLTIL
Sbjct  181  LAMKILKLMAKALDMKAEEMETLFAQGMQGLRMNYYPPCPQPELVTGLYPHSDAVGLTIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+IKKDG W P+ P+PNAFV+NVGD +EI +NG YRSIEHRA V+
Sbjct  241  LQVNEMEGLQIKKDGVWIPVCPLPNAFVINVGDVLEIVTNGAYRSIEHRATVN  293



>ref|XP_011085299.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 211/285 (74%), Gaps = 3/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSENS--  248
            LG SLPVP VQ+L K+    VP RY+           S++++  +PVIDMQKL  + S  
Sbjct  5    LGGSLPVPIVQELGKEKLATVPPRYVRPDQHQQMILSSLSSLPPIPVIDMQKLSDKYSLD  64

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQ LH AC++WGFF LINHGV+ ++VE++K ++Q+FFNLP+EEK+++ Q EGD  G+G
Sbjct  65   SELQALHNACQEWGFFQLINHGVDAAVVEKMKLQVQEFFNLPIEEKRKFRQEEGDLQGYG  124

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSEEQKLDWAD+FY+ T PT +R P+L  KLP  FR+ IE Y+ E+  L+MK+L  
Sbjct  125  QAFVVSEEQKLDWADLFYIVTSPTYLRKPHLILKLPSTFRDAIEEYASELKILAMKILKL  184

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            +AK L +K EEM  LF EGMQSMRMNYYPPCP+ E V GL PH+DA G+TILLQ+NE   
Sbjct  185  MAKALDMKVEEMETLFAEGMQSMRMNYYPPCPQPELVTGLYPHTDAAGITILLQLNEVDA  244

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKDG W P+ P+PNAF++N+GD +EI +NG YRSIEH A V+
Sbjct  245  LQIKKDGFWIPVAPLPNAFIINIGDILEIVTNGAYRSIEHMATVN  289



>gb|KDO52127.1| hypothetical protein CISIN_1g045260mg [Citrus sinensis]
Length=355

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 215/283 (76%), Gaps = 2/283 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--EE  254
            G SL VPSV++L ++    VP RYI    ++P  + +      PVIDM+ L SE S   E
Sbjct  5    GGSLLVPSVKELAENPMVAVPPRYIRPKQDAPVISDNTLISKFPVIDMESLLSEESMDSE  64

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KL  AC++WGFF L+NHGV+ +LV++VK+EIQ+FFNL +EEK++Y Q  G+ +GFGQ 
Sbjct  65   LAKLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEEKKKYWQYPGEVEGFGQA  124

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQKLDW D+F++ TLP ++R P+LFPKL  + R+T+E YS+E++ L+M ++  +A
Sbjct  125  FVVSEEQKLDWGDLFFMTTLPVHLRKPHLFPKLHPSLRDTLEVYSMEVNALAMNLISGMA  184

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L IK EE+R  FE G+QSMRMNYYPPCP+ E V GL+PHSDA  LTILLQ+NE  GL+
Sbjct  185  KVLHIKDEEVREFFENGLQSMRMNYYPPCPQPEKVTGLTPHSDAVALTILLQINEAEGLQ  244

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG WFPI P+PNAF+VN+GD +E+ +NG+Y SIEHRA+V+
Sbjct  245  IKKDGKWFPIRPLPNAFIVNIGDVLEVITNGVYPSIEHRAVVN  287



>ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85256.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=359

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 210/291 (72%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-  233
            M +   SLG SL VP VQ+L KD    VP RYI    E P  A       VPVIDMQ+L 
Sbjct  1    MASKPSSLGSSLLVPCVQELAKDLLVAVPPRYIRYDQEHPIIASHDPVSEVPVIDMQRLL  60

Query  234  -QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
             Q     EL +LH ACK WGFF L+NH V+ SL++++K ++QDFFNLP+EEK+R+ Q  G
Sbjct  61   DQETMDSELGRLHFACKTWGFFQLVNHCVSSSLLDKMKTQLQDFFNLPMEEKKRFWQYPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            + +GFGQ FVVSEEQKLDW D+F++ T P N+R P+LFPKLP  FR+T+E+YS+E+  L+
Sbjct  121  EIEGFGQAFVVSEEQKLDWGDLFFMVTQPANLRKPHLFPKLPLPFRDTLESYSLEVKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
              +L  + K L IK+EEMR   E   QSMRMNYYP CP+ E V+GL+PHSDA GLTILLQ
Sbjct  181  SAILEQMGKALNIKAEEMRDFTEGIRQSMRMNYYPQCPQPEQVIGLTPHSDATGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+++KDG W PI P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  241  VNEVEGLQLRKDGKWVPIKPLPNAFVVNVGDILEIVTNGAYRSIEHRATVN  291



>ref|XP_007022032.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13557.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 218/312 (70%), Gaps = 23/312 (7%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M+  A   G SLPVPSVQ+L K +   +P RY+   +E P  + + +   +PVIDM+ L 
Sbjct  1    MDPKAVKYGSSLPVPSVQELAKKSIATIPPRYLRPDLEKPIVSDAGSMSEIPVIDMEGLV  60

Query  237  SENS--EELQKLHLACKDWGFF---------------------HLINHGVNCSLVEEVKR  347
            S+ S   EL KL  ACK+WGFF                     +LINHG++ SLVE+VK 
Sbjct  61   SKESMDSELAKLDFACKEWGFFQVCLALYICHLNPYSILVSCEYLINHGMSLSLVEKVKT  120

Query  348  EIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFP  527
            EIQDFFNLP+EEK++Y Q  G+ +GFGQ FVVS+EQKLDW D+F+L TLP   R P+LFP
Sbjct  121  EIQDFFNLPVEEKKKYWQNPGEVEGFGQAFVVSDEQKLDWGDMFFLTTLPVYSRKPHLFP  180

Query  528  KLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPE  707
            KLP  FR T+  YS+E+ KL+M +L  +AK + +  EEMR LFE G+Q++RMNYYPPC E
Sbjct  181  KLPLPFRETLNQYSLELEKLAMAILLQIAKAINMNIEEMRELFEGGLQAIRMNYYPPCDE  240

Query  708  SEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNG  887
             E V+G++PHSDA  LTILLQVN+  GL++KKDG W P+ P+PNAF+VN+GD +EI +NG
Sbjct  241  PEQVIGITPHSDASALTILLQVNDVEGLQVKKDGKWVPVKPLPNAFIVNIGDILEIITNG  300

Query  888  IYRSIEHRALVS  923
            +YRSIEHRA V+
Sbjct  301  VYRSIEHRATVN  312



>ref|XP_010273386.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
 ref|XP_010273387.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score =   343 bits (879),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/291 (56%), Positives = 212/291 (73%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M ++   LG S+PVP+VQ+L +     VP RY+    + P    + +   +PVID+  L 
Sbjct  1    MASELLRLGSSIPVPNVQELARKPMVTVPPRYLRPDQDPPVITNANSLPTIPVIDLNNLL  60

Query  237  SENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S  S   E  +LH ACKDWGFF L NHGV  SLVE++K EIQ+FF LPLEEK+++ Q  G
Sbjct  61   SAESMDSESARLHSACKDWGFFQLTNHGVTSSLVEKIKLEIQEFFKLPLEEKRKFWQEPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FV+SE+QKLDWAD+FY+ TLP ++R PNLFPKLP   R T++ YS+E+  L+
Sbjct  121  DLEGFGQAFVLSEDQKLDWADMFYITTLPMHLRRPNLFPKLPLPLRETLDAYSLELKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  +AK L +K+EEMR L E+G+QSMR+NYYPPCP+ E V+GL+PHSD   LTILLQ
Sbjct  181  MILLEQIAKALQMKAEEMRELLEDGIQSMRINYYPPCPQPELVVGLTPHSDFVVLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GLEI+K G W P+ P+PNAF+VNVGD +EI +NG YRS+EHRA V+
Sbjct  241  VNEVEGLEIRKQGMWIPVKPLPNAFIVNVGDIMEIVTNGAYRSVEHRATVN  291



>gb|KEH38517.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=359

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 213/291 (73%), Gaps = 3/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKD-NPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL  233
            ME      G SL VPSVQ+L KD N + VP RYI    +    ++    + +PVIDM KL
Sbjct  1    MEGIKNPSGTSLLVPSVQELSKDGNISTVPPRYIQPNHQDLILSEVDTNLQIPVIDMYKL  60

Query  234  QSE--NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             SE   S EL KLHLACKDWGFF L+NHGV+ +L+E++K EIQDFFNLP+ EK+++ Q  
Sbjct  61   HSEELGSSELVKLHLACKDWGFFQLVNHGVSSNLIEKIKLEIQDFFNLPMSEKKKFWQTP  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
               +GFGQ FV+SEEQKLDWAD+FY+ TLP + R P+LFP+LP   R+T+E YS EM   
Sbjct  121  QHMEGFGQAFVMSEEQKLDWADMFYMTTLPKHSRMPHLFPQLPHPLRDTLELYSQEMKNK  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            +M ++  + K L IK  E+R LFE+G+Q MRMNYYPPCP+ E V+GL+ HSD  G+T+LL
Sbjct  181  AMVIVGHIEKALKIKENEIRELFEDGIQMMRMNYYPPCPQPEKVIGLTNHSDPQGVTLLL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALV  920
            Q+NE  GL+I+KDG W P+ P+PNAF+VN+GD +EI +NGIYRSIEHRA+V
Sbjct  241  QLNEVEGLQIRKDGMWVPVKPLPNAFIVNIGDVLEILTNGIYRSIEHRAIV  291



>emb|CBI16708.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 198/242 (82%), Gaps = 2/242 (1%)
 Frame = +3

Query  204  NVPVIDMQKLQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPL  377
            +VP+ID+ +L S +    EL+KLH AC++WGFF LINHGV+ SLVE+VK E Q+FFNLPL
Sbjct  3    HVPIIDLHRLLSADFTHSELEKLHRACQEWGFFQLINHGVSSSLVEKVKAETQEFFNLPL  62

Query  378  EEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTI  557
            EEK+++ Q  G+ +GFGQ FVVSEEQKLDW D+F++ TLPT+ R P+LFPKLP  FR+T+
Sbjct  63   EEKKKFWQKPGEVEGFGQAFVVSEEQKLDWGDIFFMSTLPTHFRKPHLFPKLPLPFRDTL  122

Query  558  ETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPH  737
            E Y VEM  L++ +L F+ K L I+  EMR LFE+G+Q+MRMNYYPPCP+ E V+GL+PH
Sbjct  123  EVYVVEMRNLALTMLSFMEKALKIEVNEMRKLFEQGLQAMRMNYYPPCPKPEQVIGLTPH  182

Query  738  SDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRAL  917
            SD+ GLTILLQVNE  GL+I+KDG W PI P+PNAF+VN+GD +EIFSNGIY+SIEHRA+
Sbjct  183  SDSVGLTILLQVNEVEGLQIRKDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAV  242

Query  918  VS  923
            V+
Sbjct  243  VN  244



>ref|XP_011045561.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=359

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 210/291 (72%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-  233
            M +   SLG SL VP VQ+L KD    VP RY+    E P  A       VPVIDMQ+L 
Sbjct  1    MASKPSSLGSSLLVPCVQELAKDPLVAVPPRYLRYDQEHPIIASHDPVSEVPVIDMQRLL  60

Query  234  -QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
             Q     EL +LHLACK WGFF L+NH V+ SL++++K ++QDFFNLP+EEK+++ Q  G
Sbjct  61   DQETMDSELGRLHLACKTWGFFQLVNHCVSSSLLDKMKTQLQDFFNLPMEEKKKFWQYPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            + +GFGQ FVVSEEQKLDW D+F++ T P N+R P+LFPKLP   R+T+E+YS+E+  L+
Sbjct  121  EIEGFGQAFVVSEEQKLDWGDLFFMVTQPANLRKPHLFPKLPLPLRDTLESYSLEVKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
              +L  + K L IK+EEMR   E   QSMRMNYYP CP+ E V+GL+PHSDA GLTILLQ
Sbjct  181  TAILEQMGKALNIKAEEMRDFTEGIRQSMRMNYYPQCPQPEQVIGLTPHSDATGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+I+KDG W PI  +PNAFVVNVGD +EI +NG+YRSIEHRA V+
Sbjct  241  VNEVEGLQIRKDGKWVPIKALPNAFVVNVGDILEIVTNGVYRSIEHRATVN  291



>ref|XP_010057211.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74256.1| hypothetical protein EUGRSUZ_E02902 [Eucalyptus grandis]
Length=363

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/292 (55%), Positives = 213/292 (73%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKL  233
            ME    +   SL VP VQ ++K+NP  V  RYI D  ESP    + + +  VPVID+ +L
Sbjct  1    METQVNTRERSLLVPCVQDILKENPTTVSKRYIRDDQESPVITDACSGLPQVPVIDLGRL  60

Query  234  QSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
              E     EL+KLH ACKDWGFF LINH V   L+E+VK+ I++ FN+P+EEK+++ Q +
Sbjct  61   VLEEVAKPELEKLHHACKDWGFFQLINHEVRPKLLEKVKKGIEELFNMPMEEKKKFWQRD  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G+ DGFGQ FV SE+QKLDWAD+FY+ TLP ++R P LFPKLP  FR+ ++ YS EM  L
Sbjct  121  GELDGFGQAFVFSEDQKLDWADIFYINTLPASLRKPYLFPKLPLPFRDDLDAYSKEMQAL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            ++K+L  + K LGI+++++  +FEEG+Q MRMNYYPPCP+ E  +GL+ HSDA  +TILL
Sbjct  181  AIKLLYLIVKALGIEAKDLEGMFEEGLQGMRMNYYPPCPQPELAIGLNSHSDADAITILL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            QVNE  GL+I+KDG W P+ P+P AF+VNVGD VEI +NGIY+SIEHRA V+
Sbjct  241  QVNEMEGLQIRKDGKWVPVKPLPGAFIVNVGDIVEIMTNGIYQSIEHRAAVN  292



>gb|KHN25971.1| Protein SRG1 [Glycine soja]
Length=483

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 216/284 (76%), Gaps = 5/284 (2%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPA--SAKSIAAVNVPVIDMQKLQSENSEE--  254
            SL VP VQ++ KD    VP RY+    E P   SA +     VPVID+ KL S++ +E  
Sbjct  129  SLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEPE  188

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD-TDGFGQ  431
            L+KLH ACK+WGFF LINHGV+ SLVE+VKR  QDFFNLP+EEK++ GQ EG+  +G+GQ
Sbjct  189  LEKLHYACKEWGFFQLINHGVSTSLVEKVKRGAQDFFNLPIEEKKKLGQREGEGVEGYGQ  248

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKL+WAD+F++ TLP +IR P LFP +P  FR+ +ETYS  + KL+++++  +
Sbjct  249  AFVVSEEQKLEWADMFFMLTLPPHIRKPYLFPNIPLPFRDDLETYSAGLKKLAIQIVELM  308

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            A  L + S+E+R LF EG+QSMRMNYYPPCP+ E VMGL+PH+D G LTILLQ+NE  GL
Sbjct  309  ANALNVDSKEIRELFGEGVQSMRMNYYPPCPQPELVMGLNPHTDGGSLTILLQLNEVEGL  368

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IK DG+W PI P+PNAF+VN+GD +EI +NGIYRSIEHRA V+
Sbjct  369  QIKIDGSWIPIKPLPNAFIVNLGDMMEIMTNGIYRSIEHRATVN  412


 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +3

Query  315  VNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTL  494
            ++ SLVE+VKR  Q  F+L +EEK+++GQ EG+ +G+GQLFV+ EEQ +   +       
Sbjct  71   MDSSLVEKVKRGAQGLFDLSMEEKKKFGQREGEAEGYGQLFVILEEQNVCSVEAME----  126

Query  495  PTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            PT++  P +     +A     E Y   +H+
Sbjct  127  PTSLTVPFVQEIAKDALTRVPERYVRPLHE  156



>ref|XP_006489639.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 217/293 (74%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME    +LG SL VP VQ+LVK+    +P RY+    + P +  +  +  +P+IDM KL 
Sbjct  1    MEPKPTTLGSSLAVPYVQELVKEPLTAIPPRYLRPDQDPPFACNTNLSQQLPIIDMDKLL  60

Query  237  SENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            S++ +    EL+ LH+AC+DWGFF LINHGV+ SL+E++K+EI +FF LP+EEK++Y Q 
Sbjct  61   SDSGDSTHSELENLHMACRDWGFFQLINHGVSSSLIEKLKQEIPEFFKLPMEEKKKYWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
             GD +G+GQ FV+SEE KLDW+D+FY+ TLPT +R P+LF KLP   R+T+E +S EM+ 
Sbjct  121  PGDVEGYGQAFVMSEETKLDWSDMFYMSTLPTYLRKPHLFAKLPLPLRDTLEAHSKEMNN  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+ KVL  +AK L +   +M+ LFE G+QSMRMNY PPCP+ E V+GL+ HSDA GL+IL
Sbjct  181  LAQKVLNQMAKALRMDPNDMKELFEGGLQSMRMNYCPPCPQPELVIGLNSHSDAAGLSIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQ+NE  GL+IKKDG W PI P+P+AF++N+GD +EI +NGIYRSIEHR  V+
Sbjct  241  LQINEVDGLQIKKDGMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHRGTVN  293



>ref|NP_001240998.1| uncharacterized protein LOC100786574 [Glycine max]
 gb|ACU19370.1| unknown [Glycine max]
 gb|KHN28885.1| Protein SRG1 [Glycine soja]
Length=356

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 210/281 (75%), Gaps = 2/281 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEE--LQ  260
            + PVP VQ++ K+   +VP RY+    E P  + S     +PVID+ KL S++ +E  L 
Sbjct  5    AAPVPYVQEIAKEALTIVPERYVRPVHERPILSNSTPLPEIPVIDLSKLLSQDHKEHELD  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            +LH ACK+WGFF LINHGV+ SLVE+VKR  Q  F+LP+EEK+++GQ EG+ +G+GQLFV
Sbjct  65   RLHYACKEWGFFQLINHGVDSSLVEKVKRGAQGLFDLPMEEKKKFGQREGEAEGYGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSEEQKL+WAD+F++ TLP N R P+LFP LP  FR  ++ Y  E+ KL++++L  +A +
Sbjct  125  VSEEQKLEWADLFFMFTLPPNKRKPHLFPNLPLPFRGDLDAYCEELRKLAIQILDQMANS  184

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L I   E+R LF E  QSMRMNYYPPCP+ E VMGL+PHSD GGLTILLQ NE  GL+I+
Sbjct  185  LAIDPMEIRELFGEAEQSMRMNYYPPCPQPELVMGLNPHSDGGGLTILLQANEVEGLQIR  244

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W P+ P+PNAF++N+GD +E+ SNGIY+SIEHRA V+
Sbjct  245  KDGLWIPVKPLPNAFIINLGDMLEVMSNGIYQSIEHRATVN  285



>ref|XP_003638405.1| Protein SRG1 [Medicago truncatula]
Length=359

 Score =   341 bits (874),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 212/291 (73%), Gaps = 3/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKD-NPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL  233
            ME      G SL VPSVQ+L KD N + VP RYI    +    ++    + +PVIDM KL
Sbjct  1    MEGIKNPSGTSLLVPSVQELSKDGNISTVPPRYIQPNHQDLILSEVDTNLQIPVIDMYKL  60

Query  234  QSE--NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             SE   S EL K HLACKDWGFF L+NHGV+ +L+E++K EIQDFFNLP+ EK+++ Q  
Sbjct  61   HSEEFGSSELLKFHLACKDWGFFQLVNHGVSSNLIEKIKLEIQDFFNLPMSEKKKFWQTP  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
               +GFGQ FV+SEEQKLDWAD+FY+ TLP + R P+LFP+LP   R+T+E YS EM   
Sbjct  121  QHMEGFGQAFVMSEEQKLDWADMFYMTTLPKHSRMPHLFPQLPHPLRDTLELYSQEMKNK  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            +M ++  + K L IK  E+R LFE+G+Q MRMNYYPPCP+ E V+GL+ HSD  G+T+LL
Sbjct  181  AMVIVGHIEKALKIKENEIRELFEDGIQMMRMNYYPPCPQPEKVIGLTNHSDPQGVTLLL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALV  920
            Q+NE  GL+I+KDG W P+ P+PNAF+VN+GD +EI +NGIYRSIEHRA+V
Sbjct  241  QLNEVEGLQIRKDGMWVPVKPLPNAFIVNIGDVLEILTNGIYRSIEHRAIV  291



>ref|XP_007025218.1| Senescence-related gene 1, putative [Theobroma cacao]
 gb|EOY27840.1| Senescence-related gene 1, putative [Theobroma cacao]
Length=357

 Score =   340 bits (873),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 214/293 (73%), Gaps = 5/293 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQKL  233
            ME++   LG S+PVPSVQ++ K+    VP RY     + P  S  + +   VPVIDM KL
Sbjct  1    MESELTKLGSSIPVPSVQEVAKEALGRVPQRYQRPDQDPPFTSIDTCSPQQVPVIDMLKL  60

Query  234  QSEN---SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
             S +     EL+KLH ACK+WGFF LINHGV+ SLV++VK+ IQ  FNLP+EEK++  Q 
Sbjct  61   LSGDHFMDVELEKLHYACKEWGFFQLINHGVSKSLVDKVKKGIQGLFNLPMEEKKKLWQR  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            EGD +GFGQ FVVSEEQKLDW D+F++  LPT++R P LFP LP  FR+ IE YS E+  
Sbjct  121  EGDLEGFGQAFVVSEEQKLDWGDMFFMTALPTHLRKPYLFPNLPLPFRDDIEAYSAELRD  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L++K+L F AK LG+   ++  +FEEG Q+ RMNYYPPCP+ E  +GLSPHSDA G+TIL
Sbjct  181  LALKILAFQAKALGMDPNDLS-IFEEGWQAFRMNYYPPCPQPELAIGLSPHSDAVGITIL  239

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQ+NE  GL+I+KDG W PI P+P+AFVVN+GD +E+ +NGIY SIEHRA V+
Sbjct  240  LQINEMEGLQIRKDGAWVPIKPLPDAFVVNIGDIMELVTNGIYGSIEHRATVN  292



>gb|KEH19983.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=357

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 211/286 (74%), Gaps = 1/286 (0%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSE-N  245
             + LG SL VPSVQ+LVK     VP RY+    E    + +I+   VPVID++KL SE +
Sbjct  6    VKKLGTSLLVPSVQELVKQPIAKVPERYVQQNQEPSVVSSTISLPQVPVIDLKKLLSEED  65

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
              EL+K   ACK+WGFF LINHGVN  LVE  K+ +QDFFNLP+EEK+   Q  GD +GF
Sbjct  66   GTELEKFDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEEKKILSQKPGDMEGF  125

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ+FVVS+E KL+WAD+FY+ T P+ +R+PNLFP +P+ FR  +E YS+E+ KL + ++ 
Sbjct  126  GQMFVVSDEHKLEWADLFYIITHPSYMRNPNLFPSIPQPFRENLEMYSLELKKLCVTIVE  185

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
            F++K L I+  E+  LFEEG Q+MRMNYYPPCP+ + V+GL+PHSD   LTILLQ+NE  
Sbjct  186  FMSKALKIQKNELLELFEEGGQAMRMNYYPPCPQPDKVIGLNPHSDGTALTILLQLNEIE  245

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+IKKDG W PI P+ NAFV+N+GD +EI +NGIYRSIEHRA ++
Sbjct  246  GLQIKKDGMWIPIKPLTNAFVINIGDMLEIMTNGIYRSIEHRATIN  291



>ref|XP_010057217.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=359

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 215/291 (74%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G  L +P VQ ++K+NP  VP RY+   +E P    + + + VPVID+ +L 
Sbjct  1    METQLNIPGRLLHMPCVQDVLKENPTTVPERYVRSDLEPPMIMDACSGLQVPVIDLGRLV  60

Query  237  SENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            SE+    EL+KLH ACKDWGFF LINH V+  L+EEVK+  ++ FN+P+EEK+++ Q +G
Sbjct  61   SEDCSKLELKKLHHACKDWGFFQLINHEVSPKLIEEVKKGTEELFNMPMEEKKKFWQRDG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            ++ GFGQ FV SE+QKLDWAD+F + TLP ++R P+LFPKLP  FR+ ++ YS E   L+
Sbjct  121  ESGGFGQAFVFSEDQKLDWADIFRMFTLPASMRKPHLFPKLPLPFRDDLDAYSKETKALA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK LG++++++  +FE+GMQSMRMNYYPPCP+ E VMGL+ HSD   +TILLQ
Sbjct  181  IKLLYLMAKALGMEAKDLEGVFEDGMQSMRMNYYPPCPQPELVMGLNSHSDGDAVTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+I+KDG W P+ P+P AF++NVGD VEI +NGIY+SIEHRA V+
Sbjct  241  VNEMEGLQIRKDGKWVPVKPLPGAFIINVGDVVEIITNGIYQSIEHRATVN  291



>gb|KEH19984.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=362

 Score =   340 bits (872),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 211/286 (74%), Gaps = 1/286 (0%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSE-N  245
             + LG SL VPSVQ+LVK     VP RY+    E    + +I+   VPVID++KL SE +
Sbjct  11   VKKLGTSLLVPSVQELVKQPIAKVPERYVQQNQEPSVVSSTISLPQVPVIDLKKLLSEED  70

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
              EL+K   ACK+WGFF LINHGVN  LVE  K+ +QDFFNLP+EEK+   Q  GD +GF
Sbjct  71   GTELEKFDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEEKKILSQKPGDMEGF  130

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ+FVVS+E KL+WAD+FY+ T P+ +R+PNLFP +P+ FR  +E YS+E+ KL + ++ 
Sbjct  131  GQMFVVSDEHKLEWADLFYIITHPSYMRNPNLFPSIPQPFRENLEMYSLELKKLCVTIVE  190

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
            F++K L I+  E+  LFEEG Q+MRMNYYPPCP+ + V+GL+PHSD   LTILLQ+NE  
Sbjct  191  FMSKALKIQKNELLELFEEGGQAMRMNYYPPCPQPDKVIGLNPHSDGTALTILLQLNEIE  250

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+IKKDG W PI P+ NAFV+N+GD +EI +NGIYRSIEHRA ++
Sbjct  251  GLQIKKDGMWIPIKPLTNAFVINIGDMLEIMTNGIYRSIEHRATIN  296



>ref|XP_006355571.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=357

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 210/283 (74%), Gaps = 4/283 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEE  254
            + G SL VPSVQ+L K +   +PSRY+    ESP  +   AA +VP+ID+QKL S +SE 
Sbjct  9    NFGKSLLVPSVQELAKQHLTNIPSRYVRSEQESPVIS---AAASVPIIDLQKLISGDSE-  64

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            LQKLH AC+ WGF  +INHGV  SL+E+ KRE+ + F LP+EEK++  Q E + +GFGQL
Sbjct  65   LQKLHFACQQWGFLQVINHGVTPSLLEDFKREVIELFKLPMEEKKKLWQQEDNHEGFGQL  124

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQKLDW+D+FY+ TLP++IR  +LF KLP   R  +E Y  E+  L+M +LC LA
Sbjct  125  FVVSEEQKLDWSDIFYITTLPSHIRQMDLFQKLPSKLREIMEAYCKEIKNLAMIILCQLA  184

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L +  +EMR LF +G+QS+RMNYYPPCP  E  +GL PHSDA  LT+L Q+NET GL+
Sbjct  185  KVLRMDEKEMRDLFSDGVQSIRMNYYPPCPAPEKTIGLRPHSDADALTVLFQLNETEGLQ  244

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++KDG W P+ P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  245  VRKDGIWVPVKPLPNALIVNIGDIMEIVSNGVYRSIEHRAIVN  287



>gb|AFK37891.1| unknown [Medicago truncatula]
Length=308

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/283 (56%), Positives = 214/283 (76%), Gaps = 4/283 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN----SEE  254
            SL VPSVQ++VK+    VP RY+    + P  + +   + +PVID  KL S++      E
Sbjct  12   SLIVPSVQEIVKEPLTRVPERYVRPHHDRPIISTTTPLLELPVIDFSKLFSQDLTIKGLE  71

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KLH ACK+WGFF LINHGV+ SLVE VK   ++F+NLP+EEK+++ Q EGD +G+GQ 
Sbjct  72   LDKLHSACKEWGFFQLINHGVSTSLVENVKMGAKEFYNLPIEEKKKFSQKEGDVEGYGQA  131

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FV+SEEQKLDWAD+F++ TLP+++R P+LFPKLP  FR+ +ETYS E+ KL+++++ F+A
Sbjct  132  FVMSEEQKLDWADMFFMITLPSHMRKPHLFPKLPLPFRDDLETYSAELKKLAIQIIDFMA  191

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
              L + ++E+R LF EG QS R+NYYPPCP+ E V+GL+ HSD GGLTILLQ NE  GL+
Sbjct  192  NALKVDAKEIRELFGEGTQSTRINYYPPCPQPELVIGLNSHSDGGGLTILLQGNEMDGLQ  251

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG W P+ P+PNAF++N+GD +EI +NGIY SIEHRA V+
Sbjct  252  IKKDGFWIPVKPLPNAFIINLGDMLEIITNGIYPSIEHRATVN  294



>ref|XP_010273389.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=363

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 213/285 (75%), Gaps = 2/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN--S  248
            + G SL VPSVQ+LVK     VP RYI    + P  +   +   VP+ID+Q L S +  +
Sbjct  8    TFGKSLLVPSVQELVKQPIVEVPPRYIRVRQDPPIISDDSSFPAVPIIDIQSLLSGDFVN  67

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL+++H ACK+WGFF + NHG++ SL+E+VK+EI+DFF LP EEKQ+  Q   D +GFG
Sbjct  68   SELERMHSACKEWGFFQVANHGISSSLLEKVKQEIEDFFQLPSEEKQKLWQNPDDHEGFG  127

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVSEEQKLDW+D+FY+ TLPT++R   LF KLP +FR  +E YS E+ KL++K+L  
Sbjct  128  QLFVVSEEQKLDWSDMFYITTLPTSLRKSYLFEKLPLSFRECLEVYSSELRKLALKILDQ  187

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            +AK L I++EEMR LF +G+QSMRMNYYPPCP+ E  +G +PHSDA  LTILLQ+NET G
Sbjct  188  MAKALKIEAEEMRELFSDGVQSMRMNYYPPCPQPEMAIGFTPHSDADALTILLQLNETEG  247

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+I+K G W P+ P+PNA VVN+GD +EI SNGIYRSIEHRA V+
Sbjct  248  LQIRKQGKWVPVNPLPNALVVNIGDIMEIVSNGIYRSIEHRATVN  292



>ref|XP_010059078.1| PREDICTED: uncharacterized protein LOC104446988 [Eucalyptus grandis]
Length=741

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            ME +   LG SLPVP VQ+L KD    VP RY+    + P       ++   VPVIDM K
Sbjct  1    MEVNLMKLGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S + +    EL+KLH+AC+DWGFF LINHGV+C+L+EEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFFQLINHGVSCTLMEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ+FV S EQKLDWAD+F++ +LP ++R P+LFP LP  FR  ++ Y++E+
Sbjct  121  QEEGDLEGFGQMFVGSAEQKLDWADLFFMASLPRHLRKPHLFPMLPSPFREVLDEYTLEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L ++S++M  LF+EG Q++RMNYYPPCP  E V GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALQMESKDMIELFDEGRQALRMNYYPPCPRPELVTGLTPHSDSNGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILL+VNE  GL+++K+G W  + P+PNAFVVNVGD +EI +NG YRSIEHRA+V+
Sbjct  241  ILLEVNEMEGLQVRKEGKWISVKPLPNAFVVNVGDILEIVTNGTYRSIEHRAMVN  295


 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 210/303 (69%), Gaps = 18/303 (6%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            I  + +   LG SLPVPSVQ+L K+    +P RYI   ++   S      + VPVID+ K
Sbjct  373  IERDREKSKLGGSLPVPSVQELAKEAITKLPPRYIRTDLDHGTSL-----LQVPVIDLSK  427

Query  231  LQSENS-------EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQ  389
            L S +         EL+KLH ACKDWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK+
Sbjct  428  LSSSDGNLGALTESELEKLHSACKDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKR  487

Query  390  RYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYS  569
            ++ Q +GD  GF Q FVVSEEQKLDW D+FY+ +LP ++R P+LFP LP  FR+ ++ YS
Sbjct  488  KFWQ-QGDLQGFRQAFVVSEEQKLDWGDLFYVVSLPRHLRKPHLFPMLPSPFRDVLDKYS  546

Query  570  VEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAG  749
             E+  L+MK+L  +AK L + ++EM  LF+EG+Q +RMNYY PCP  E  +GL+PHSDA 
Sbjct  547  TELQDLAMKILLLMAKALKMDTKEMIELFDEGLQGIRMNYYSPCPRPELAIGLTPHSDAI  606

Query  750  GLTILLQVNETTGLEIKKDGTWFPIL-----PIPNAFVVNVGDCVEIFSNGIYRSIEHRA  914
            GLTILLQVNE  GL+++K+G W PI      P+PNAFVVNVGD +EI  NG YR IEH+ 
Sbjct  607  GLTILLQVNEVEGLQVRKEGKWVPIAATPIKPLPNAFVVNVGDILEIVMNGNYRIIEHQV  666

Query  915  LVS  923
             V+
Sbjct  667  TVN  669



>emb|CDP20503.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/291 (59%), Positives = 216/291 (74%), Gaps = 5/291 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME+    LG SL VP VQ+L K+    VP RYI      P     ++   +PVIDMQ+L 
Sbjct  1    MESSMIKLGGSLKVPYVQELAKEKFASVPPRYIRP---DPTKLHGVSTEEIPVIDMQRLL  57

Query  237  SENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S+ S   EL+KLH ACK+WGFF LINHGV+ SLV+++K E+Q FFNL +EEK R+ Q  G
Sbjct  58   SDESVNPELEKLHFACKEWGFFQLINHGVSSSLVDKLKLEMQKFFNLRIEEKMRFAQEPG  117

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +G+GQ FVVSEEQKLDW D+FY+  LPT++R P+L PKLP  FR T++ YS E+  L+
Sbjct  118  DVEGYGQAFVVSEEQKLDWGDMFYMVALPTHLRKPHLLPKLPLPFRETLDQYSRELKILA  177

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +KVL  + K LG+K E+M MLF+EGMQSMRMNYYPPCP+ E VMGL PHSDA GLTILLQ
Sbjct  178  IKVLEQMTKALGMKLEDMTMLFQEGMQSMRMNYYPPCPQPELVMGLCPHSDAVGLTILLQ  237

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+IKK G W P++P+P AF+VNVGD +EI +NGIY+S+EHRA V+
Sbjct  238  VNEVEGLQIKKAGAWVPVVPLPYAFIVNVGDILEIVTNGIYKSVEHRATVN  288



>gb|KHN19470.1| Protein SRG1 [Glycine soja]
Length=358

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 214/286 (75%), Gaps = 5/286 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA---SAKSIAAVNVPVIDMQKLQSENSE  251
            G SL VPSVQ+L K+  + VP RYI    E      S ++ +++ +PVIDMQ L SE S 
Sbjct  10   GTSLLVPSVQELAKEKISNVPQRYIQPQHEEDIVILSEEANSSLEIPVIDMQSLLSEESG  69

Query  252  EL--QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
                 KLHLACK+WGFF LINHGV+ SLVE+VK EIQDFF LP+ EK+++ Q+    +GF
Sbjct  70   SSELDKLHLACKEWGFFQLINHGVSSSLVEKVKLEIQDFFKLPMSEKKKFWQSPQHMEGF  129

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ FVVSE+QKLDWAD+F++ TLP ++R P+LFP+LP  FR+ +E YS E+ KL+M V+ 
Sbjct  130  GQAFVVSEDQKLDWADLFFMTTLPKHLRIPHLFPQLPLPFRDALEIYSQELKKLAMVVVE  189

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
             + K L ++  EMR  FE+GMQSMRMNYYPPCP+ E V+GL+PHSD  GLTILLQV E  
Sbjct  190  QMGKALKMEETEMREFFEDGMQSMRMNYYPPCPQPEKVIGLTPHSDGVGLTILLQVTEVE  249

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+I KDG W PI P+PNAF++N+GD +EI SNGIYRS+EHRA+V+
Sbjct  250  GLQITKDGMWVPIKPLPNAFIINIGDMLEIISNGIYRSVEHRAMVN  295



>ref|XP_006442327.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
 gb|ESR55567.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
Length=356

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 213/282 (76%), Gaps = 3/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSENS--EEL  257
            SL V  VQ+L K+   VVP RYI    ++       A V+ +PVIDMQ L SE S   EL
Sbjct  7    SLSVHCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSEL  66

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             KL  ACK+WGFF ++NHGV+ + +E+VK+E+ +FFNL +EEK++Y Q+  D +GFGQ F
Sbjct  67   AKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEEKKKYWQSPEDLEGFGQAF  126

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSEEQ+LDW D+F++ TLP ++R P+LFPKLP + R+T+E YS+E++ L+M ++  +AK
Sbjct  127  VVSEEQRLDWGDLFFMTTLPVHLRKPHLFPKLPPSLRDTLEVYSMEVNALAMNLISGMAK  186

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L IK EE+R  FE G+QSMRMNYYPPCP+ E V GL+PHSDA  LTILLQ+NE  GL+I
Sbjct  187  VLHIKDEEVREFFENGLQSMRMNYYPPCPQPEKVTGLTPHSDAVALTILLQINEAEGLQI  246

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKDG WFPI P+PNAF+VN+GD +E+ +NG+Y SIEHRA+V+
Sbjct  247  KKDGKWFPIRPLPNAFIVNIGDVLEVITNGVYPSIEHRAVVN  288



>ref|XP_007214442.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
 gb|EMJ15641.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
Length=362

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 213/295 (72%), Gaps = 7/295 (2%)
 Frame = +3

Query  60   EADAQSL-GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSI--AAVNVPVIDMQK  230
            E  ++SL G SL VPSVQ+L K +   +P RYI          + I  +   +P IDM K
Sbjct  3    EKASRSLYGGSLIVPSVQELAKKHIITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDMHK  62

Query  231  LQSENS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S++S     EL KLH ACK+WGFF L+NHGV+ SL+E++K E+QDFFNLP+EEK++  
Sbjct  63   LLSQDSIDSESELAKLHFACKEWGFFQLVNHGVSSSLMEKIKTEVQDFFNLPMEEKKKLW  122

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q  GD +GFGQ FVVSE+QKLDWAD+F++ TLP  IR P LFP LP  FR T++ YS+E+
Sbjct  123  QTPGDVEGFGQAFVVSEDQKLDWADLFFMTTLPVQIRRPRLFPNLPSPFRETLDDYSLEL  182

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              LSM +L  +   L ++ +E+  L+E+GMQ MRMNYYPPCP    V+GL+PHSD+ GLT
Sbjct  183  RNLSMTILSQMETALQMEDKEVTKLYEDGMQQMRMNYYPPCPHPGKVIGLTPHSDSVGLT  242

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL++KKDG W P+ P+P+AF+VNVGD +EI +NG+YRSIEHRA V+
Sbjct  243  ILLQVNEMDGLQVKKDGIWVPVKPLPDAFIVNVGDILEIQTNGVYRSIEHRATVN  297



>ref|XP_006477891.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 208/285 (73%), Gaps = 3/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSEN--S  248
            +G SL VP VQ+L K++  VVP RYI     +       A V+ +PVIDMQ L SE    
Sbjct  4    VGGSLSVPCVQELAKNDTLVVPPRYIRPDQNATTIISDDALVSKLPVIDMQSLLSEELMD  63

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL KL  ACKDWGFF ++NHGV+ + +E+VK+E+Q+FFNL +EEK++Y Q  GD +GFG
Sbjct  64   SELAKLDSACKDWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEEKKKYWQCPGDVEGFG  123

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q  VVSEEQKLDW+D F + +LP N+R P+LFPKLP   R+T+E YS+E+  L+M ++  
Sbjct  124  QSNVVSEEQKLDWSDTFIMISLPENLRKPHLFPKLPLPLRDTLEVYSMELKSLAMNLILK  183

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L IK +EMR  FE GMQ MRMNYYPPCP+ E V+GL+PHSD  GLTILLQ+NE  G
Sbjct  184  MGKVLNIKDQEMRNFFENGMQVMRMNYYPPCPQPEKVVGLTPHSDGCGLTILLQINEVEG  243

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKD  W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  244  LQIKKDRMWIPLTPLPNAFVVNVGDIMEIITNGKYRSIEHRATVN  288



>ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42734.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=360

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 211/287 (74%), Gaps = 3/287 (1%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQKLQSEN  245
            A +LG SLPVPSVQ+L   +   VP+RY+    + P     S ++  VPVIDM+KL SE 
Sbjct  7    ALTLGSSLPVPSVQELANKSLATVPTRYVRSDQDPPFIPTSSSSSSQVPVIDMEKLLSEQ  66

Query  246  --SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
                EL++ H ACKDWGFF LINHGV+ SLVE++K E+Q+FFNLP +EK+++ Q EGD +
Sbjct  67   FMDAELERFHHACKDWGFFQLINHGVSLSLVEKLKIEVQNFFNLPTDEKKKFCQKEGDVE  126

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQ FVVSEEQKLDW+D+ Y+ TLPT++R P+L P  P   R+ +E YS EM  L+ ++
Sbjct  127  GFGQSFVVSEEQKLDWSDMVYVTTLPTHLRKPHLLPYFPFPLRDVVEAYSKEMENLATEI  186

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            L  +AK L +++  M  +FE G QSMRMNYYPPCP+ E V+GL+ HSDA GLTILLQ NE
Sbjct  187  LNLMAKALKMETTNMMEIFEGGWQSMRMNYYPPCPQPELVVGLAQHSDAAGLTILLQANE  246

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALV  920
            T GL+IKK G W PI P+ NAFV+NVGD +EI +NG+Y SIEHRA+V
Sbjct  247  TDGLQIKKHGKWVPIKPLANAFVINVGDILEILTNGMYPSIEHRAIV  293



>ref|XP_006420337.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
 gb|ESR33577.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
Length=356

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 216/293 (74%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME     LG SL VP VQ+LVK+    +P +Y+    + P +  +  +  +P+IDM KL 
Sbjct  1    MEPKPIVLGSSLEVPYVQELVKEPLTAIPPQYLRPDQDPPFACNTNLSQQLPIIDMDKLL  60

Query  237  SENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            S++ +    EL+ LH+AC+DWGFF LINHGV+ SL+E++K+EI +FF LP+EEK++Y Q 
Sbjct  61   SDSGDSTHSELENLHMACRDWGFFQLINHGVSSSLIEKLKQEIPEFFKLPMEEKKKYWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
             GD +G+GQ FV+SEE KLDW+D+F + TLPT +R P+LFPKLP   R+T+E +S EM+ 
Sbjct  121  PGDVEGYGQAFVMSEETKLDWSDMFLMSTLPTYLRKPHLFPKLPLPLRDTLEAHSKEMNN  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+ KVL  +AK L +   +M+ LFE GMQSMRMNY PPCP+ E V+GL+ HSDA GL+IL
Sbjct  181  LAQKVLNQMAKTLRMDPNDMKELFEGGMQSMRMNYCPPCPQPELVIGLNSHSDAAGLSIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQ+NE  GL+IKKDG W PI P+P+AF++N+GD +EI +NGIYRSIEHR  V+
Sbjct  241  LQINEVDGLQIKKDGMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHRGTVN  293



>ref|XP_007149498.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
 gb|ESW21492.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
Length=357

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 214/285 (75%), Gaps = 4/285 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYI--HDGVESPASAKSIAAVNVPVIDMQKLQSENSE-  251
            G SL VPSVQ+L K N   VP RYI  H        ++   ++ +PVIDM  L S  S+ 
Sbjct  10   GTSLLVPSVQELSKQNLRTVPQRYIQPHHDQHMLLISQEAHSLEIPVIDMHNLLSAESKS  69

Query  252  -ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL+KLHLACKDWGFF L+NHGV+ SL+E+VK EI++FFNLP+ EK+++ Q     +GFG
Sbjct  70   LELEKLHLACKDWGFFQLVNHGVSISLLEKVKLEIEEFFNLPMSEKKKFWQNSEHMEGFG  129

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDWAD++Y+ TLP ++R P+LFPKLP  FR+T+E YS E+  L++ ++  
Sbjct  130  QAFVVSEDQKLDWADLYYMITLPKHLRMPHLFPKLPHPFRHTLEVYSQEIKDLALVIIAH  189

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L I+ +E++ LFE+G+Q MRMNYYPPCP+ + V+GL+PHSD+ GLTILLQ+N   G
Sbjct  190  MGKALKIEEKEIKGLFEDGIQMMRMNYYPPCPQPDKVIGLTPHSDSIGLTILLQLNHVEG  249

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+I+KDG W P+ P PNAF+VNVGD +EI +NGIY+SIEHRA V+
Sbjct  250  LQIRKDGLWVPVNPFPNAFIVNVGDILEITTNGIYKSIEHRATVN  294



>ref|XP_003543178.1| PREDICTED: protein SRG1 [Glycine max]
Length=357

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/292 (56%), Positives = 211/292 (72%), Gaps = 4/292 (1%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA--SAKSIAAVNVPVIDMQKL  233
            E +    G SL VPSV +L K+N   VP RYI    +     S +  + + +PVIDM +L
Sbjct  3    EINKNPSGTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRL  62

Query  234  QS--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             S    S EL KLHLACK+WGFF L+NHGVN SLVE+V+ E QDFFNLP+ EK+++ Q  
Sbjct  63   LSVESGSSELDKLHLACKEWGFFQLVNHGVNSSLVEKVRLETQDFFNLPMSEKKKFWQTP  122

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
               +GFGQ FVVSE+QKLDWAD++Y+ TLP + R P+LFP+LP  FR+T+E YS E+  L
Sbjct  123  QHMEGFGQAFVVSEDQKLDWADLYYMTTLPKHSRMPHLFPQLPLPFRDTLEAYSQEIKDL  182

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
            ++ ++  + K L I+  E+R LFE+G+Q MRMNYYPPCPE E V+GL+PHSD  GL ILL
Sbjct  183  AIVIIGLMGKALKIQEREIRELFEDGIQLMRMNYYPPCPEPEKVIGLTPHSDGIGLAILL  242

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            Q+NE  GL+I+KDG W P+ P+ NAF+VNVGD +EI +NGIYRSIEHRA V+
Sbjct  243  QLNEVEGLQIRKDGLWVPVKPLINAFIVNVGDILEIITNGIYRSIEHRATVN  294



>ref|XP_006432906.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46146.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=356

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/291 (56%), Positives = 210/291 (72%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+ +L  + P   VP RY+   ++ P       +A  +PVIDM  
Sbjct  1    MEAKATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHT  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGFF L+NHGV+ SLVE+VK EIQ+FFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFITSEEQKLDWGYGFTMFTLPTHLRKPHLFPKLPLPFRDDLEVYLTELKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE GMQS+RMNYYPPCP+ E V+G  PHSD   LTILLQ
Sbjct  181  LKILDLMAKALRMDPNDMKELFENGMQSLRMNYYPPCPQPEQVLGFKPHSDGSVLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG WF + P+P+AF+VNVGD +EIFSNG YRSIEHRA V+
Sbjct  241  INEMDGLQIKKDGKWFAVKPLPDAFIVNVGDVLEIFSNGTYRSIEHRATVN  291



>ref|XP_006355625.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/293 (56%), Positives = 223/293 (76%), Gaps = 5/293 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL--  233
            E  ++ LG SL VP+VQ+L K     VP RYI D +E+ + +  +    VPVIDM+KL  
Sbjct  3    EGKSRKLGGSLKVPNVQELAKQQLAAVPPRYIRDDIENQSYSSIVILPQVPVIDMKKLLE  62

Query  234  --QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
                ++  EL++LHLACK+WGFF L+NHGVN SL+++VK EI+ FF+LP+EEK+++ Q E
Sbjct  63   IGDIDDDSELERLHLACKEWGFFQLVNHGVNSSLMKKVKSEIKAFFDLPMEEKKKFEQEE  122

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GD +G+GQ FVVSEEQKLDWAD+ Y+ TLPT +R P+LFPKLP + R+ +E YS  + +L
Sbjct  123  GDLEGYGQAFVVSEEQKLDWADILYMITLPTQLRKPHLFPKLPVSLRDELEQYSTALKEL  182

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEE-GMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            +MK+L  +A+ LG+K+E+M +LFE+ G Q MR+NYYPPCP+ E VMGL  H+D+ GLTIL
Sbjct  183  AMKILYVMARALGMKAEDMNVLFEQDGTQMMRINYYPPCPQPERVMGLCHHTDSVGLTIL  242

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNET GL+IKKDG W P+   P+AFVVN+GD +EI +N IY+SIEHRA+V+
Sbjct  243  LQVNETEGLQIKKDGAWIPVPYCPDAFVVNIGDILEIVTNRIYKSIEHRAIVN  295



>emb|CAN72414.1| hypothetical protein VITISV_032872 [Vitis vinifera]
Length=395

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 216/310 (70%), Gaps = 34/310 (11%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSE--NSEELQKL  266
            VP VQ+LVK+    VP RY+    +SP  + +  ++ +VP+ID+ +L S      EL+KL
Sbjct  14   VPCVQELVKEPLTAVPHRYVRPEQDSPVLSNATDSMPHVPIIDLHRLLSAAFTHSELEKL  73

Query  267  HLACKDWGFFH-------------------------------LINHGVNCSLVEEVKREI  353
            H AC++WGFF                                LINHGV+ SLVE+VK E 
Sbjct  74   HRACQEWGFFQTKQSVGLQLMGGQGYCDEQVGEKTEKGRCYQLINHGVSSSLVEKVKAET  133

Query  354  QDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKL  533
            Q+FFNLPLEEK+++ Q   + +GFGQ FVVSEEQKLDW D+F++ TLPT+ R P+LFPKL
Sbjct  134  QEFFNLPLEEKKKFWQKPREVEGFGQAFVVSEEQKLDWGDIFFMSTLPTHFRKPHLFPKL  193

Query  534  PEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESE  713
            P  FR+T+E Y VEM  L++ +L F+ K L I+  EMR LFE+G+Q MRMNYYPPCP+ E
Sbjct  194  PLPFRDTLEVYVVEMRNLALTMLSFMEKALKIEVNEMRKLFEQGLQGMRMNYYPPCPKPE  253

Query  714  HVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIY  893
             V+GL+PHSD+ GLTILLQVNE  GL+I+KDG W PI P+PNAF+VN+GD +EIFSNGIY
Sbjct  254  QVIGLTPHSDSVGLTILLQVNEVEGLQIRKDGMWIPITPLPNAFIVNIGDILEIFSNGIY  313

Query  894  RSIEHRALVS  923
            +SIEHRA+V+
Sbjct  314  KSIEHRAVVN  323



>emb|CBI16709.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   338 bits (867),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 215/294 (73%), Gaps = 15/294 (5%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVID  221
            L  AME+   SLG SL VP VQ+LVK+    VP RY+    + P  + +  ++ +VP+ID
Sbjct  16   LPTAMESGLSSLGSSLLVPCVQELVKEPLTAVPHRYLRPEQDPPVLSNTTDSMPHVPIID  75

Query  222  MQKLQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
                          LH AC++WGFF LINHGV+ SLVE+VK E Q+FFNLP++EK+++ Q
Sbjct  76   --------------LHHACQEWGFFQLINHGVSSSLVEKVKAETQEFFNLPMDEKKKFWQ  121

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              G+ +GFGQ FVVSEEQKLDW D+F++ TLPT+ R P LFPK P  FR+T+E Y VEM 
Sbjct  122  KPGEVEGFGQAFVVSEEQKLDWGDLFFMSTLPTHFRKPRLFPKFPLPFRDTLEIYVVEMR  181

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L++ +L F+ K L I+  EMR LFE+G+Q MRMNYYPPCP+ E V+G +PHSD+ GLTI
Sbjct  182  NLALTMLSFMEKALKIEVNEMRELFEQGLQGMRMNYYPPCPQPEQVIGQTPHSDSVGLTI  241

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL+I+KDG W PI P+PNAF+VN+GD +EIFSNGIY+SIEHRA+V+
Sbjct  242  LLQVNEVEGLQIRKDGMWIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAVVN  295



>ref|XP_006494094.1| PREDICTED: codeine O-demethylase-like isoform X1 [Citrus sinensis]
Length=359

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 210/291 (72%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+ +L  + P   VP RY+   ++ P       +A  +PVIDM  
Sbjct  1    MEAKATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHT  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGFF L+NHGV+ SLVE+VK EIQ+FFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFITSEEQKLDWGYGFTMFTLPTHLRKPHLFPKLPLPFRDDLEVYLTELKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE GMQS+RMNYYPPCP+ E V+G  PHSD   LTILLQ
Sbjct  181  LKILDLMAKALRMDPNDMKELFENGMQSLRMNYYPPCPQPEQVLGFKPHSDGSVLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG WF + P+P+AF+VNVGD +EIF+NG YRSIEHRA V+
Sbjct  241  INEMDGLQIKKDGKWFAVKPLPDAFIVNVGDVLEIFTNGTYRSIEHRATVN  291



>ref|XP_003517890.1| PREDICTED: protein SRG1-like isoform X1 [Glycine max]
 gb|KHN15647.1| Protein SRG1 [Glycine soja]
Length=354

 Score =   337 bits (865),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 216/289 (75%), Gaps = 1/289 (0%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M++    LG SL VPSV +L K     VP RY+    + P  + +I+   VPVID+ KL 
Sbjct  1    MDSQMTKLGTSLLVPSVHELAKQPMTKVPERYVRLN-QDPVVSDTISLPQVPVIDLNKLF  59

Query  237  SENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
            SE+  E++KL+ ACK+WGFF LINHGVN  LV+ VK  +Q+FF L +EEK++  Q +G+ 
Sbjct  60   SEDGTEVEKLNQACKEWGFFQLINHGVNPLLVQNVKIGVQEFFGLQMEEKRKLWQKQGEL  119

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +G+GQ+FVVSEEQKL+WAD+FY+ TLP+  R+P++F  +P+ FRN +E+YS+E+ KLS+ 
Sbjct  120  EGYGQMFVVSEEQKLEWADIFYINTLPSCARNPHIFASIPQPFRNDLESYSLELGKLSIA  179

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            ++  ++K L I + E+  LFE+  QSMRMN YPPCP+ EHV+GL+PHSDAG LTILLQVN
Sbjct  180  IIKLISKALEINTNELLELFEDLSQSMRMNCYPPCPQPEHVIGLNPHSDAGALTILLQVN  239

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL+I+KDG W PI P+ NAFV+NVGD +EI +NGIYRS+EHRA ++
Sbjct  240  EMEGLQIRKDGMWIPIKPLSNAFVINVGDILEILTNGIYRSVEHRATIN  288



>ref|XP_010057215.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=358

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/280 (55%), Positives = 214/280 (76%), Gaps = 3/280 (1%)
 Frame = +3

Query  90   LPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE--ELQK  263
            L VP VQ ++K+NP  VP RY+ D +E P    + + + +PVID+ +L SE+    EL+K
Sbjct  12   LHVPWVQDIMKENPTTVPERYVRDDLE-PVIMGACSGLQLPVIDLGRLVSEDCAKLELKK  70

Query  264  LHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVV  443
            LH ACKDWGFF LINH V+  L+E+VK+  ++ FN+P+EEK+++ Q +G++ GFGQ FV 
Sbjct  71   LHHACKDWGFFQLINHEVSPKLIEKVKKGTEELFNMPMEEKKKFWQRDGESSGFGQAFVF  130

Query  444  SEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNL  623
            SE+QKLDWAD+FY+ TLP ++R P+LFPKLP  FR+ ++ YS E   L++K+L  +AK L
Sbjct  131  SEDQKLDWADIFYMFTLPASMRKPHLFPKLPLPFRDDLDAYSKETKTLAIKLLYLMAKAL  190

Query  624  GIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
            G++++++  +FE+G+QSMRMNYYPPCP+ E VMGL+ HSD   +TILLQVNE  GL+I+K
Sbjct  191  GMEAKDVEGIFEDGLQSMRMNYYPPCPQPELVMGLNSHSDGDAVTILLQVNEMEGLQIRK  250

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            DG W P+ P+P AF++NVGD VEI +NGIY+SIEHRA V+
Sbjct  251  DGKWVPVKPLPGAFIINVGDVVEIITNGIYQSIEHRATVN  290



>ref|XP_006467558.1| PREDICTED: protein SRG1-like isoform X1 [Citrus sinensis]
 gb|KDO78009.1| hypothetical protein CISIN_1g017887mg [Citrus sinensis]
Length=364

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 215/289 (74%), Gaps = 1/289 (0%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQS  239
            EA   + G S+ VPSVQ+L  +    VP RY+    + P+        +VP+ID+QKL  
Sbjct  6    EATTVNFGRSIIVPSVQELTNETIINVPPRYVRTDQDPPSVTADTWLPSVPLIDLQKLVD  65

Query  240  E-NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
            +  ++EL++LH +C++WGFF +INHGV+ SL+E++K EI++FF LP EEK++  Q   + 
Sbjct  66   DVRADELERLHSSCREWGFFQVINHGVSSSLLEKLKFEIENFFKLPYEEKKKLWQVADNH  125

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQLFVVSEEQKLDW+D+FY+ TLP ++R  +LF KLP + R T+E+YS EM KL+M 
Sbjct  126  EGFGQLFVVSEEQKLDWSDMFYIATLPLHLRKTDLFHKLPPSLRETLESYSAEMKKLAMT  185

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  +AK L +  EEMR LF +G+QSMRMNYYPPCP+ + V+G SPHSDA  LTILLQ++
Sbjct  186  ILGHMAKALRMDGEEMRDLFSDGVQSMRMNYYPPCPQPDKVIGFSPHSDADALTILLQLD  245

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +T GL+I+  G W P+ P+PNAFV+N+GD +EI SNGIYRSIEHRALV+
Sbjct  246  DTQGLQIRNQGRWVPVKPLPNAFVINIGDIMEIVSNGIYRSIEHRALVN  294



>ref|XP_009376707.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=372

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 211/291 (73%), Gaps = 10/291 (3%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIA------AVNVPVIDMQKL---  233
            G SL VPSVQ+LVK     +P RYI    +       +       A  +P IDMQKL   
Sbjct  13   GGSLLVPSVQELVKKPITTIPPRYIQPHHQDGNQEHEMIINSDHHAHQIPSIDMQKLLSQ  72

Query  234  -QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
              + +  EL +LH ACK+WGFF L+NHGV+ SLV ++K EIQDFFNLP EEK+++ Q  G
Sbjct  73   ESTSSESELARLHFACKEWGFFQLVNHGVSSSLVGKIKTEIQDFFNLPTEEKKKFWQQPG  132

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FV+SE+QKLDWAD+F+L TLP  +R P+LFPKLP  FR T ETYS+E+  L+
Sbjct  133  DVEGFGQAFVISEDQKLDWADMFFLNTLPVQLRRPHLFPKLPSPFRETFETYSLELKNLA  192

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  + K L  +++E+  LFE+G+Q++RMNYYPPCP+ E V+GL+PHSDA GLT+LLQ
Sbjct  193  MTILSHMEKALQTEAKEVTNLFEDGLQAVRMNYYPPCPQPETVIGLTPHSDAIGLTVLLQ  252

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL++KKDG WFP+ P+P+AF+VN+GD +EI +NG Y SIEHRA V+
Sbjct  253  INEMDGLQVKKDGIWFPVKPLPDAFIVNIGDILEIITNGTYHSIEHRATVN  303



>gb|KDO52129.1| hypothetical protein CISIN_1g018426mg [Citrus sinensis]
Length=356

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 208/285 (73%), Gaps = 3/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSEN--S  248
            +G SL VP VQ+L K+   VVP RYI    ++       A V+ +PVIDMQ L SE    
Sbjct  4    VGGSLSVPCVQELAKNATLVVPPRYIRADQDATTIISDDALVSKLPVIDMQSLLSEELMD  63

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL KL  ACK+WGFF ++NHGV+ + +E+VK+E+Q+FFNL +EEK++Y Q  GD +GFG
Sbjct  64   SELAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEEKKKYWQRPGDVEGFG  123

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q  VVSEEQKLDW+D F + +LP N+R P+LFPKLP   R+T+E YS+E+  L+M ++  
Sbjct  124  QSNVVSEEQKLDWSDTFIMISLPENLRKPHLFPKLPLPLRDTLEVYSMELKSLAMNLILK  183

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L IK +EMR  FE GMQ MRMNYYPPCP+ E V+GL+PHSD  GLTILLQ+NE  G
Sbjct  184  MGKVLNIKDQEMRNFFENGMQVMRMNYYPPCPQPEKVVGLTPHSDGCGLTILLQINEVEG  243

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKD  W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  244  LQIKKDRMWIPLTPLPNAFVVNVGDIMEIITNGKYRSIEHRATVN  288



>ref|XP_004294174.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=375

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 216/294 (73%), Gaps = 18/294 (6%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYI----HDG-----VESPASAKSIAAVN--VPVIDMQKLQS-  239
            VPSVQ+L K     +P RYI    HDG     V    S ++ +++   +P I+ +KL S 
Sbjct  19   VPSVQELAKKPITTLPPRYIQQDLHDGDARDQVNKIGSNEASSSIQPEIPTINFKKLLSR  78

Query  240  ------ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
                  ++S+EL +LHLA K+WGFF L+NHGV+ SL+E++K EIQDFFNL ++EK+R+ Q
Sbjct  79   KESNSFQDSDELARLHLASKEWGFFQLVNHGVSSSLLEKIKTEIQDFFNLSIDEKKRFWQ  138

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               D +GFGQLFVVSEEQKLDWADVF++ TLP  +R P+LFP+LP  F++T+E YS+E++
Sbjct  139  RPEDMEGFGQLFVVSEEQKLDWADVFFMTTLPVQMRKPHLFPELPSPFKDTLEIYSLELN  198

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L+M +L  +   L + + E+  LFE+GMQSMRMNYYPPCP+ E V+G +PHSDA GLTI
Sbjct  199  NLAMAILTQMEHALKVDANELTELFEDGMQSMRMNYYPPCPQPEKVIGFTPHSDASGLTI  258

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL+IKKDG W P+ P+P AF+VN+GD +EI +NG YRSIEHRA+V+
Sbjct  259  LLQVNELEGLQIKKDGNWLPVKPLPEAFIVNIGDALEIKTNGTYRSIEHRAIVN  312



>ref|XP_010057208.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=365

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 211/295 (72%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH-DGVESPASAK-SIAAVNVPVIDMQK  230
            M+A+   LG SLPVPSVQ+L K+    VP RY+  D   S   A    + + VPVID+ K
Sbjct  1    MDANLTKLGGSLPVPSVQELAKEAITEVPPRYVRPDQDHSFMHADLGTSLLQVPVIDLSK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S N +    EL+ LH+AC+DWGFF LINHGV CSLVEEVK  IQ+FF LP+EEK++  
Sbjct  61   LSSSNEDLMESELENLHVACRDWGFFQLINHGVRCSLVEEVKLGIQEFFELPMEEKRKLW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ FVV EEQKLDW D F++ +LP ++R+P  FP LP  FR+ ++ YS ++
Sbjct  121  QEEGDVEGFGQTFVVWEEQKLDWGDRFFMVSLPRHLRNPRFFPMLPSPFRDDLDEYSSKL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L +  E+M  LF+ GMQ++RMNYYPPCP  E V+GL+PHSD   LT
Sbjct  181  RDLAMKMLLLMAKPLKMDPEDMIELFDGGMQTLRMNYYPPCPRPELVIGLTPHSDGSALT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             LLQVNE  GL+I+K+G W  I P+PNAFVVNVGD +EI +NG YRSI+HRA V+
Sbjct  241  FLLQVNEMEGLQIRKEGKWVAIKPLPNAFVVNVGDLLEIVTNGTYRSIDHRATVN  295



>ref|XP_003546739.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN47490.1| Protein SRG1 [Glycine soja]
Length=353

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 211/291 (73%), Gaps = 7/291 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME     LG SL VPSVQ+L K N + VP RYI      P + ++I+   +P+IDMQ L 
Sbjct  1    MEEFFNPLGTSLLVPSVQELAKQNLSTVPHRYIQ-----PQNEEAISIPEIPIIDMQSLL  55

Query  237  S--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S    S EL KLHLACK+WGFF LINHGV+ SL+E+VK EIQDFFNLP+ EK+++ Q   
Sbjct  56   SVESCSSELAKLHLACKEWGFFQLINHGVSSSLLEKVKLEIQDFFNLPMSEKKKFWQTPQ  115

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
              +GFGQ FVVSE+QKLDW D+F + TLPT  R P+LFP+LP  FR+T+E YS +M  L+
Sbjct  116  HMEGFGQAFVVSEDQKLDWGDLFIMTTLPTQSRMPHLFPQLPLPFRDTLELYSHKMKNLA  175

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M ++  + K L I+  ++R LFE+G+Q MRMNYYPP P+ E V+GL+ HSDA  LTILLQ
Sbjct  176  MVIIGHMGKALNIEEMKIRELFEDGIQLMRMNYYPPSPQPEKVIGLTNHSDATALTILLQ  235

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+I+KD  W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  236  VNEVEGLQIRKDDMWVPVRPMPNAFVVNVGDILEINTNGTYRSIEHRATVN  286



>ref|XP_009799622.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=360

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 219/289 (76%), Gaps = 5/289 (2%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQS-  239
            A ++ +G +L VPSVQ+L+K     VP RYI D +E P ++  +    VPVIDM+KL + 
Sbjct  5    ASSRKIGSTLKVPSVQELIKQQ-VAVPPRYIRDDIEMPMTSSILP--QVPVIDMEKLLAI  61

Query  240  -ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
              +  EL++LH AC DWGFF L+NHGV+ SLVE+VK EI+ FF+LPLEEK+++ Q EGD 
Sbjct  62   GNDGSELERLHFACVDWGFFQLVNHGVSSSLVEKVKLEIRAFFDLPLEEKKKFEQEEGDV  121

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +G+GQ FV SEEQKLDWAD+FY+ TLPT +R P+LFPKL  + R+ +E +  E   L++ 
Sbjct  122  EGYGQAFVFSEEQKLDWADLFYMTTLPTRLRKPHLFPKLHVSLRDIMEAHCQEFKSLTIS  181

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +LC LAK L +  +EM+ LF +GMQ +RMNYYPPCP+ + ++GLSPHSDA  LTILLQ+N
Sbjct  182  ILCQLAKALKMDEKEMKNLFTDGMQLIRMNYYPPCPKPDKIIGLSPHSDADALTILLQLN  241

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ET GL+I+KDG W PI P+PNA +VNVGD +EI SNG+YRSIEHRA+V+
Sbjct  242  ETDGLQIRKDGIWVPIKPLPNALIVNVGDMMEIVSNGVYRSIEHRAVVN  290



>ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF33892.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=364

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 211/283 (75%), Gaps = 12/283 (4%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN----VPVIDMQKLQSENS--EEL  257
            VP VQ+LVK+    VP RYI      P    SIAA      VPVIDMQ+L   +S   EL
Sbjct  19   VPCVQELVKEPMATVPPRYIR-----PDQDYSIAAPGDDGEVPVIDMQRLYDPDSIDSEL  73

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             KLHLACKDWGFF L+NHG++ SL+E++K E+QDFFNLP+ EK+++ Q  G+ +GFGQ F
Sbjct  74   AKLHLACKDWGFFQLVNHGISSSLLEKMKMEVQDFFNLPMAEKKKFWQYPGEVEGFGQSF  133

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSEEQKLDW D+F++ T P ++R P+LFPKLP  FR+T+E+YS E+  L++ +L  +AK
Sbjct  134  VVSEEQKLDWGDLFFMVTQPAHLRKPHLFPKLPLPFRDTLESYSSEVKNLAVAILEQMAK  193

Query  618  NLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
             L +K EEMR  F EG+ Q+ RMNYYPPCP+ E V+GL+PHSD  GLTILLQVN+  GL+
Sbjct  194  VLNLKPEEMRDQFTEGIRQTKRMNYYPPCPQPEKVIGLTPHSDGTGLTILLQVNDVEGLQ  253

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKDG W P+ P+PNAFV+N+GD +EI +NGIYRSI HRA V+
Sbjct  254  IKKDGKWVPVKPLPNAFVINIGDILEIITNGIYRSILHRATVN  296



>ref|XP_007211480.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
 gb|EMJ12679.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
Length=362

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 211/294 (72%), Gaps = 6/294 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSI--AAVNVPVIDMQKL  233
            +A     G SL VPSVQ+L K     +P RYI          + I  +   +P IDM KL
Sbjct  4    KASRSFYGGSLIVPSVQELAKKPVITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDMHKL  63

Query  234  QSENS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             S++S     EL KLH ACK+WGFF L+NHGV+ SL+E++K E+QDFFNLP+E K+++ Q
Sbjct  64   LSQDSIDSESELAKLHFACKEWGFFQLVNHGVSSSLMEKIKTEVQDFFNLPMEVKKKFWQ  123

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
            + GD +GFGQ FVVSE+QKLDWAD+F++ TLP  IR P+LFP LP  FR T++ YS+E+ 
Sbjct  124  SPGDVEGFGQAFVVSEDQKLDWADLFFMTTLPVQIRKPHLFPNLPSPFRETLDDYSLELR  183

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
             L+M +L  +   L ++ +E+  L+E+GMQ MRMNYYPPCP    V+GL+PHSD+ GLTI
Sbjct  184  NLAMTILSQIETALQMEDKEVTKLYEDGMQQMRMNYYPPCPHPGEVIGLTPHSDSVGLTI  243

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL++KKDG W P+ P+P+AF+VNVGD +EI +NG+YRSIEHRA V+
Sbjct  244  LLQVNEMDGLQVKKDGIWVPVKPLPDAFIVNVGDILEIQTNGVYRSIEHRATVN  297



>ref|XP_006428589.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 gb|ESR41829.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=283

 Score =   333 bits (854),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 205/281 (73%), Gaps = 2/281 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME    ++G SLPVP VQ L K     VP +YI    ESP    +  A NVPVIDM KL 
Sbjct  1    MELKQPNMGRSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLL  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S +    EL K H ACK+WGFF LINHGV+ SL+E++K EI +FFNLP+EEK++Y Q  G
Sbjct  61   SADFMDSELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEEKKKYWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D  GFGQ FVVSEEQKLDWAD+F + TLPT +R P+LFPKLP  FR+T+E+YS E+  L+
Sbjct  121  DIQGFGQAFVVSEEQKLDWADMFAMYTLPTYLRKPHLFPKLPVHFRDTLESYSAELRNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +++ LFEEG+Q MRMNYYPPCP+ + VMGL+PHSDAGGLTILLQ
Sbjct  181  LKILYQMAKALKMDPNDIKDLFEEGVQIMRMNYYPPCPQPKLVMGLTPHSDAGGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIY  893
            +NE  GL+IKKDG W PI  +P+AF++N+GD +E+   G +
Sbjct  241  INEMDGLQIKKDGLWVPIKALPDAFIINIGDALEVIVYGCH  281



>ref|XP_006442328.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
 gb|ESR55568.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
Length=356

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 208/285 (73%), Gaps = 3/285 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSEN--S  248
            +G SL VP VQ+L K+   VVP RYI    ++       A V+ +PVIDMQ L SE    
Sbjct  4    VGGSLSVPCVQELAKNATLVVPPRYIRADQDATTIISDDALVSKLPVIDMQSLLSEELMD  63

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL KL  ACK+WGFF ++NHGV+ + +E+VK+E+Q+FFNL +EEK++Y Q  GD +GFG
Sbjct  64   SELAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEEKKKYWQRPGDVEGFG  123

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q  VVSEEQKLDW+D F + +LP N+R P+LFPKLP   R+T+E YS+++  L+M ++  
Sbjct  124  QSNVVSEEQKLDWSDTFIMISLPENLRKPHLFPKLPLPLRDTLEVYSMQLKSLAMNLILK  183

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L IK +EMR  FE GMQ MRMNYYPPCP+ E V+GL+PHSD  GLTILLQ+NE  G
Sbjct  184  MGKVLNIKDQEMRNFFENGMQVMRMNYYPPCPQPEKVVGLTPHSDGCGLTILLQINEVEG  243

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKKD  W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA V+
Sbjct  244  LQIKKDRMWIPLTPLPNAFVVNVGDIMEIITNGKYRSIEHRATVN  288



>ref|NP_001242069.1| uncharacterized protein LOC100777264 [Glycine max]
 gb|ACU23067.1| unknown [Glycine max]
Length=358

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 212/286 (74%), Gaps = 5/286 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA---SAKSIAAVNVPVIDMQKLQSENSE  251
            G SL VPSVQ+L K+  + VP RYI    E      S ++ +++ +PVIDMQ L SE S 
Sbjct  10   GTSLLVPSVQELAKEKISNVPQRYIQPQHEEDIVILSEEANSSLEIPVIDMQSLLSEESG  69

Query  252  EL--QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
                 KLHLACK+WGFF LINHGV+ SLVE+VK EIQDFF LP+ EK+++ Q+    +GF
Sbjct  70   SSELDKLHLACKEWGFFQLINHGVSSSLVEKVKLEIQDFFKLPMSEKKKFWQSPQHMEGF  129

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ FVVSE+QKLDWAD+F++ TLP ++R P+LFP+LP  FR+ +E YS E+ KL+M  + 
Sbjct  130  GQAFVVSEDQKLDWADLFFMTTLPKHLRIPHLFPQLPLPFRDALEIYSQELKKLAMVAVE  189

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
             + K L ++  EMR  FE+GMQSMRMNYYPPCP+ E V+GL+PHSD  GLTILLQ  E  
Sbjct  190  QMGKALKMEETEMREFFEDGMQSMRMNYYPPCPQPEKVIGLTPHSDGVGLTILLQATEVE  249

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+I KDG W PI P+PNAF++N+GD +EI SNGIYRS+EHRA+V+
Sbjct  250  GLQITKDGMWVPIKPLPNAFIINIGDMLEIISNGIYRSVEHRAMVN  295



>ref|XP_011005822.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=356

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 214/287 (75%), Gaps = 4/287 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA-SAKSIAAV-NVPVIDMQKLQS--E  242
            +LG SL VP VQ+L K++P  VP+RY+    + P  +   +A++  +PVIDMQ+L S  +
Sbjct  5    TLGKSLAVPCVQELAKESPATVPARYLRLDQDPPIINNNEMASLPQIPVIDMQRLVSGEQ  64

Query  243  NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDG  422
               EL K+  ACK+WG F LINHGV+ SLV EVK  IQ+ FNLP+EEK++Y Q   + +G
Sbjct  65   MDIELDKMDRACKEWGVFQLINHGVDDSLVNEVKEGIQELFNLPMEEKRKYWQRPEEMEG  124

Query  423  FGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVL  602
            FGQ FVVSEEQKLDW D+FY+ TLP + R P+LFP LP+  R+T+E YS E+  L+MK+L
Sbjct  125  FGQAFVVSEEQKLDWGDIFYMITLPKHERKPHLFPMLPQPLRDTLEAYSAELKNLAMKIL  184

Query  603  CFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNET  782
              +AK LG+K +E++ +FEEG Q MRMNYYPPCP+ E VMGL+ HSD+ GLTILLQV+E 
Sbjct  185  YLMAKALGMKPDEIKDMFEEGCQMMRMNYYPPCPQPELVMGLNSHSDSIGLTILLQVSEV  244

Query  783  TGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             GL+I+K G W P+ P+PNAFV+NVGD +EI +NGIYRS EHRA V+
Sbjct  245  EGLQIRKSGKWIPVQPLPNAFVINVGDMLEIVTNGIYRSNEHRATVN  291



>ref|XP_002268794.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=369

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 217/289 (75%), Gaps = 7/289 (2%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE-----SPASAKSIAAVNVPVIDMQKLQSE  242
             G S+ VPSV++LVK+    VP RY+H+  +     + A+A  I   +VPVID+  L   
Sbjct  10   FGKSIIVPSVRELVKEPITKVPPRYVHNQQDLQMAAAAAAAADIWLQSVPVIDLHCLLHG  69

Query  243  NS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
            +S   EL++LH ACKDWGFF ++NHGV+ SL+EE K E+QDFF LPLEEK++  Q   + 
Sbjct  70   DSMGSELERLHSACKDWGFFQVVNHGVSSSLLEEFKGEVQDFFELPLEEKKKLWQQPDNH  129

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQLFVVSEEQ+LDW+D+FYL TLP N+R  ++F KLP+  R T+E YSVEM KL+M 
Sbjct  130  EGFGQLFVVSEEQRLDWSDMFYLTTLPFNLRKSDIFQKLPQKLRETLEAYSVEMKKLAMT  189

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  + K L +K+EE+R +F +G+QSMRMNYYPPCPE +  +G +PHSDA  LTIL Q+N
Sbjct  190  ILSQMTKALKMKAEEIRDMFSDGVQSMRMNYYPPCPEPDMTIGFAPHSDADALTILFQLN  249

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +T GL+I+K+G W P+ P+PNAFVVN+GD +EI SNGIY+SIEHRA+V+
Sbjct  250  DTEGLQIRKEGRWVPVKPLPNAFVVNIGDIMEIVSNGIYQSIEHRAMVN  298



>ref|XP_007211481.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
 gb|EMJ12680.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
Length=362

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/289 (55%), Positives = 209/289 (72%), Gaps = 8/289 (3%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYI----HDGVESPASAKSIAAVNVPVIDMQKLQSENS  248
            G SL VPSVQ+L K     +P+RYI    H+  +            +P IDMQKL S+ S
Sbjct  11   GGSLIVPSVQELAKKPITAIPARYIQTRHHEQQDDVMFNPDHGQAEIPFIDMQKLLSQES  70

Query  249  ----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
                 EL  LH ACK+WGFF L+NHGV+ SL+++VK EIQDFFNL +E+K++  Q  GD 
Sbjct  71   TDSESELAMLHFACKEWGFFQLVNHGVSSSLMDKVKIEIQDFFNLAMEDKKKLWQTPGDL  130

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQ FVVSE+QKLDWAD+F++ TLP  +R P+LFP LP  FR T+E YS+E+  L++ 
Sbjct  131  EGFGQAFVVSEDQKLDWADIFFMTTLPVEMRRPHLFPNLPSPFRETLEVYSLELKNLALT  190

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  +   L ++++E+  LFE+GMQSMRMNYYPPCP    V+GL+PHSD+ GLTILLQVN
Sbjct  191  ILSQMETALQMEAKELTKLFEDGMQSMRMNYYPPCPLPAEVIGLTPHSDSVGLTILLQVN  250

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL++KKDG W P+ P+P+AF+VN+GD +EI +NGIYRSIEHRA V+
Sbjct  251  EMDGLQVKKDGIWVPVKPLPDAFIVNIGDILEIQTNGIYRSIEHRATVN  299



>ref|XP_002269432.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=348

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/277 (57%), Positives = 205/277 (74%), Gaps = 15/277 (5%)
 Frame = +3

Query  96   VPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSENSEELQKLHL  272
            VP VQ+LVK+    VP RY+    + P  + +  ++ +VP+ID              LH 
Sbjct  14   VPCVQELVKEPLTAVPHRYLRPEQDPPVLSNTTDSMPHVPIID--------------LHH  59

Query  273  ACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEE  452
            AC++WGFF LINHGV+ SLVE+VK E Q+FFNLP++EK+++ Q  G+ +GFGQ FVVSEE
Sbjct  60   ACQEWGFFQLINHGVSSSLVEKVKAETQEFFNLPMDEKKKFWQKPGEVEGFGQAFVVSEE  119

Query  453  QKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIK  632
            QKLDW D+F++ TLPT+ R P LFPK P  FR+T+E Y VEM  L++ +L F+ K L I+
Sbjct  120  QKLDWGDLFFMSTLPTHFRKPRLFPKFPLPFRDTLEIYVVEMRNLALTMLSFMEKALKIE  179

Query  633  SEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGT  812
              EMR LFE+G+Q MRMNYYPPCP+ E V+G +PHSD+ GLTILLQVNE  GL+I+KDG 
Sbjct  180  VNEMRELFEQGLQGMRMNYYPPCPQPEQVIGQTPHSDSVGLTILLQVNEVEGLQIRKDGM  239

Query  813  WFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            W PI P+PNAF+VN+GD +EIFSNGIY+SIEHRA+V+
Sbjct  240  WIPITPLPNAFIVNIGDILEIFSNGIYKSIEHRAVVN  276



>ref|XP_007022024.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao]
Length=351

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 209/284 (74%), Gaps = 4/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            LG SL VP VQ+L K+    +P RY+   +E   +      + +PVIDM+ L  + S   
Sbjct  7    LGNSLLVPCVQELAKETMTTLPPRYLRPDLEQ--TTVPADGLEIPVIDMKSLLCDESMDS  64

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACK+WGFF L+NHGV+ SL+E+ K EIQDFFNLP+EEKQ++ Q +G+ +GFGQ
Sbjct  65   ELAKLDYACKEWGFFQLVNHGVSSSLMEKTKTEIQDFFNLPMEEKQKFWQYQGEVEGFGQ  124

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDW D+F++ +LP + R P+LFP LP   R+T+++YS+E+  LSM +L  +
Sbjct  125  SFVVSEEQKLDWGDLFFMTSLPPHFRKPHLFPNLPLPLRDTLDSYSLELKTLSMTLLTNM  184

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            AK L ++ EEM  +FE GMQS RMNYYPPCP+ E  +GL PHSDA GLTILLQ+N+  GL
Sbjct  185  AKALDMRVEEMNEMFEGGMQSFRMNYYPPCPQPEQAIGLRPHSDAVGLTILLQLNQVEGL  244

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKKDG W P+ P+P+AF+VNVGD +E+ +NG YRSIEHRA V+
Sbjct  245  QIKKDGKWTPVKPLPDAFIVNVGDILEMVTNGAYRSIEHRATVN  288



>ref|XP_007013636.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY31255.1| Senescence-related gene 1 [Theobroma cacao]
Length=356

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 209/293 (71%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQKL  233
            ME     LG SL VP VQQL K+    VP +Y+  D   S  S  S     VPVIDMQKL
Sbjct  1    MEPQLTKLGGSLLVPCVQQLSKEPLVKVPPQYVRTDEDPSFISNSSSCLAQVPVIDMQKL  60

Query  234  QSENS---EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
                     EL++LH ACK WGFF LINHGV+ +LVE+VK EI+ FFNL +EEK+++ Q 
Sbjct  61   HYSKDLKDTELEQLHHACKHWGFFQLINHGVSTALVEKVKLEIEGFFNLTMEEKKKFWQT  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSEEQKL+W D+FY+ TLPT++R P+LFPKLP   R  +E YS E+  
Sbjct  121  PEEIEGFGQAFVVSEEQKLNWGDMFYMITLPTHLRKPHLFPKLPLPLREALEAYSTELKN  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L++ +L  +AK L +   +MR+LF+EG Q MRMNYYPPCP+ EH +G++ HSDA GLTIL
Sbjct  181  LAINMLDLMAKALKMDPNDMRILFDEGHQGMRMNYYPPCPQPEHAIGINSHSDAVGLTIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQ+NE  GL+I+KDG W PI P+PNAFV+N+GD +EI SNGIYRSIEHRA V+
Sbjct  241  LQINEMEGLQIRKDGAWIPIKPLPNAFVINIGDILEIVSNGIYRSIEHRATVN  293



>ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 
[Solanum lycopersicum]
Length=1114

 Score =   355 bits (912),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 225/293 (77%), Gaps = 7/293 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL--  233
            EA  + LG SL VP+VQ+L K     VPSRY+ D +E+ + +  +    VPVIDM+KL  
Sbjct  3    EAKLRKLGGSLKVPNVQELAKQQLAAVPSRYMRDDIENQSYSSILP--QVPVIDMKKLLE  60

Query  234  --QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
                ++  EL +LHLACK+WGFF L+NHGVN SL+++VK EI+ FF+LP+EEK ++ Q E
Sbjct  61   IGDIDDDSELVRLHLACKEWGFFQLVNHGVNSSLMKKVKSEIRAFFDLPMEEKTKFEQEE  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GD +G+GQ FVVSEEQKLDWAD+ Y+ TLPT++R P+LFPKLP +FR+ +E YS  + +L
Sbjct  121  GDLEGYGQAFVVSEEQKLDWADILYMITLPTHLRKPHLFPKLPASFRDALEQYSRTLKEL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEE-GMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            +MK+L  +A+ LG+K+E+M +LFE+ G Q MR+NYYPPCP+ E VMGL PH+DA GL IL
Sbjct  181  AMKILYVMARALGMKTEDMNVLFEQDGTQMMRINYYPPCPQPERVMGLCPHTDAIGLAIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNET GL+IKKDG W P+  +P+AFVVN+GD +EI +NGIY+S EHRA+V+
Sbjct  241  LQVNETEGLQIKKDGAWTPVPYLPDAFVVNIGDILEILTNGIYKSTEHRAIVN  293


 Score =   328 bits (842),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 216/290 (74%), Gaps = 7/290 (2%)
 Frame = +3

Query  60    EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH-DGVESPASAKSIAAVN--VPVIDMQK  230
             EA ++ LG SL V +VQ+L K     VPSRYI  +  E+     SI   +   PVIDM+K
Sbjct  757   EARSRKLGGSLKVSNVQELAKQQLAGVPSRYIRVNDDENQLYNSSILLPHELAPVIDMKK  816

Query  231   LQS---ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             L     +   EL + HLACK+ GFF L+NHGV+ SL+E+VK EI+ FF+LP+EEK ++ Q
Sbjct  817   LLKIIKDGDTELNRFHLACKEXGFFQLVNHGVSSSLMEKVKSEIRAFFDLPMEEKTKFEQ  876

Query  402   AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              EGD +G+GQ FVVSEE+KLDWAD+ Y+ TLPT++R P+LFPKLP +FR+ +E YS  + 
Sbjct  877   EEGDLEGYGQAFVVSEEKKLDWADILYMITLPTHLRKPHLFPKLPASFRDALEQYSRALK  936

Query  582   KLSMKVLCFLAKNLGIKSEEMRMLFEE-GMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             +L+MK+L  +A+ LG+K+E+M +LFE+ G Q MR+NYYPPCP+ E VMGL PH+DA GL 
Sbjct  937   ELAMKILYVMARALGMKTEDMNVLFEQDGTQMMRINYYPPCPQPERVMGLCPHTDAIGLA  996

Query  759   ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEH  908
             ILLQVNET GL+IKKDG W P+  +P+AFVVN+GD +EI +NGIY+SI+H
Sbjct  997   ILLQVNETEGLQIKKDGAWIPVPYLPDAFVVNIGDILEIVTNGIYKSIDH  1046


 Score =   317 bits (812),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/293 (54%), Positives = 203/293 (69%), Gaps = 7/293 (2%)
 Frame = +3

Query  57   MEADAQSL--GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            ME+  + L  G SL VPSVQ+L K +   +P+RY+    E+P  +      +VPVID+QK
Sbjct  371  MESTPEKLYFGKSLLVPSVQELAKQHLTNIPARYVRPEQETPVIS---TGASVPVIDLQK  427

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S +S   ELQ+LH AC+ WGF  +INHGV  SL+E+ KRE+   F LP+EEK++  Q 
Sbjct  428  LISGDSMDSELQELHSACQQWGFLQVINHGVTPSLLEDFKREVIQLFKLPMEEKKKLWQQ  487

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            E   +GFG  FVVSEEQKLDW+D+F + TLP  IR  +LF KLP   R+ +E Y  E+  
Sbjct  488  EDSLEGFGNAFVVSEEQKLDWSDMFGIMTLPPRIRKVDLFQKLPSNLRDVLEAYCKEIKS  547

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+  ++C L K L +  EEMR LF +GMQSMRMNYYPPCPE    +GLS HSD G LTIL
Sbjct  548  LARIIVCQLTKALRMDEEEMRDLFSDGMQSMRMNYYPPCPEPNRAIGLSTHSDPGVLTIL  607

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             Q+NET GL+++KD  W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  608  FQLNETEGLQVRKDDIWVPIKPLPNALIVNIGDMMEILSNGVYRSIEHRAIVN  660



>ref|XP_010057216.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=360

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 215/292 (74%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G  L +P VQ ++K+NP  VP RY+   +E P    + + + VPVID+ +L 
Sbjct  1    METQLNIPGRLLHMPCVQDVLKENPTTVPERYVRSDLEPPMIMDACSGLQVPVIDLGRLV  60

Query  237  SENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            SE+    EL+KLH ACKDWGFF LINH V+  L+EEVK+  ++ FN+P+EEK+++ Q +G
Sbjct  61   SEDCSKLELKKLHHACKDWGFFQLINHEVSPKLIEEVKKGTEELFNMPMEEKKKFWQRDG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            ++ GFGQ FV SE+QKLDWAD+F + TLP ++R P+LFPKLP  FR+ ++ YS E   L+
Sbjct  121  ESGGFGQAFVFSEDQKLDWADIFRMFTLPASMRKPHLFPKLPLPFRDDLDAYSKETKALA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK LG++++++  +FE+GMQSMRMNYYPPCP+ E VMGL+ HSD   +TILLQ
Sbjct  181  IKLLYLMAKALGMEAKDLEGVFEDGMQSMRMNYYPPCPQPELVMGLNSHSDGDAVTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVE-IFSNGIYRSIEHRALVS  923
            VNE  GL+I+KDG W P+ P+P AF++NVGD VE I +NGIY+SIEHRA V+
Sbjct  241  VNEMEGLQIRKDGKWVPVKPLPGAFIINVGDVVEQIITNGIYQSIEHRATVN  292



>gb|KDO52128.1| hypothetical protein CISIN_1g035879mg [Citrus sinensis]
Length=356

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 207/282 (73%), Gaps = 3/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSENS--EEL  257
            SL VP VQ+L K+   VVP RYI    ++       A V+ +PVIDMQ L SE S   EL
Sbjct  7    SLSVPCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSEL  66

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             KL  ACK+WGFF ++NHGV+ + +E+VK+E+ +FFNL +EEK++Y Q+  D +GFGQ F
Sbjct  67   AKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEEKKKYWQSPEDLEGFGQAF  126

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSEEQKLDW D+F++ TLP ++R P+LFPKLP   R+T+E YS+E+  L+M ++  + K
Sbjct  127  VVSEEQKLDWGDLFFMTTLPVHLRKPHLFPKLPLPLRDTLEVYSMELKSLAMNLILKMGK  186

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L IK EEM+  FE G+Q MRMNYYPPCP+ E V+GL+PHSD   LTILLQ+NE  GL+I
Sbjct  187  VLNIKDEEMKNFFENGLQVMRMNYYPPCPQPEKVVGLTPHSDGPALTILLQINEVEGLQI  246

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR  V+
Sbjct  247  KKDGVWIPVTPLPNAFIVNIGDIMEIITNGKYRSIEHRVTVN  288



>ref|XP_010057207.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=363

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 208/288 (72%), Gaps = 6/288 (2%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAA--VNVPVIDMQKLQSENSE  251
            + L    PSVQ++ K+    VP RY+    + P     +    +  PVID+ KL S N +
Sbjct  1    MALFKSAPSVQEMAKEPITEVPPRYVRVDQDHPFMHAELGTSLLQAPVIDLSKLSSSNDD  60

Query  252  ----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
                EL+KLH+AC+DWGFF LINHGV+CSLVEEVK  IQ+FF LP+EEK+ + Q EGD +
Sbjct  61   FMESELEKLHVACRDWGFFQLINHGVSCSLVEEVKLGIQEFFKLPMEEKRMFWQEEGDME  120

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQ +VVSEEQKLDW+DVF + +LP ++R P LFP LP  FR+ +E YS E+  L+MK+
Sbjct  121  GFGQTYVVSEEQKLDWSDVFSMVSLPRHLRKPRLFPMLPSPFRDVLEKYSSELRDLAMKI  180

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            L  +AK L + ++++  LF+ G Q++RMNYYPPCP  E V+GL+PHSDA  LTILLQVNE
Sbjct  181  LLLVAKPLKMDTKDVIELFDGGRQALRMNYYPPCPRPELVIGLTPHSDASALTILLQVNE  240

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
              GL+IKK+G W P+ P+PNAFVVNVGD +EI +NG YRSIEHRA ++
Sbjct  241  MEGLQIKKEGKWVPVKPLPNAFVVNVGDILEIVTNGAYRSIEHRATIN  288



>gb|KHN29927.1| Protein SRG1-like protein [Glycine soja]
Length=330

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 205/264 (78%), Gaps = 1/264 (0%)
 Frame = +3

Query  132  NVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQKLHLACKDWGFFHLINH  311
             +VP RYIH   + P S +   +  VPVID+ KL SE+  EL+K  LACK+WGFF LINH
Sbjct  2    TIVPERYIHPN-QDPPSVEFATSHQVPVIDLNKLLSEDENELEKFDLACKEWGFFQLINH  60

Query  312  GVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKT  491
            G+N S +E+VK  +++FF+LP++EK+++ Q +GD +G+GQ FVVSEEQKL+WAD+FY+ T
Sbjct  61   GINPSTLEKVKISVEEFFSLPMKEKKKFWQNQGDLEGYGQNFVVSEEQKLEWADLFYIFT  120

Query  492  LPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQ  671
            LP+ +R+P+LFP +P+ FR  +E+YS+E+ KL M ++  +AK L IK  E+  LFE+  Q
Sbjct  121  LPSYVRNPHLFPCIPQPFREAVESYSLELEKLCMTIIKLMAKTLKIKPNELLELFEDVSQ  180

Query  672  SMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVV  851
            +MRMN YPPCP+ EHV+GL+PHSDAG LTILLQVN+T GLEI+KDG W PI P  NAFV+
Sbjct  181  AMRMNCYPPCPQPEHVIGLNPHSDAGALTILLQVNDTEGLEIRKDGMWVPIKPFSNAFVI  240

Query  852  NVGDCVEIFSNGIYRSIEHRALVS  923
            N+GD +EI +NGIYRSIEHRA ++
Sbjct  241  NIGDILEILTNGIYRSIEHRATIN  264



>gb|AFK39688.1| unknown [Lotus japonicus]
Length=356

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 204/279 (73%), Gaps = 0/279 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
            LG SL VPSVQ+L K     VP +Y+    E P  + + +   VPVID  KL S++  EL
Sbjct  9    LGTSLAVPSVQELAKQPITKVPEQYVRPNQEPPVISNTTSLPQVPVIDFNKLFSDDGAEL  68

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KL  ACK+WGFF LINHGVN SLVE++K ++Q FFNLP +EK+ + Q  G+ +G GQ+F
Sbjct  69   EKLDHACKEWGFFQLINHGVNHSLVEKMKMDVQKFFNLPKDEKKVFAQKPGEMEGLGQMF  128

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            + SEE KL+WAD+F + TLP NIR+P+LFP LP+ FR+ +E Y++E+  L + +L  +AK
Sbjct  129  IASEETKLEWADLFLIVTLPENIRNPHLFPNLPQPFRDHLERYALELKNLYVSILELMAK  188

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L  +  E+  LFEEG Q+MRMNYYPPCP+ E VMGL+PHSD   LT+LLQVNE  GLE+
Sbjct  189  ALKFQPSELPELFEEGGQAMRMNYYPPCPQPEKVMGLNPHSDNSILTLLLQVNEIVGLEV  248

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRA  914
            +K G W PI P+PNAF++NVGD +EI +NGIYRSIEHRA
Sbjct  249  RKGGRWVPIKPLPNAFIINVGDALEIMTNGIYRSIEHRA  287



>ref|XP_003540518.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN19469.1| Protein SRG1 [Glycine soja]
Length=359

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 215/295 (73%), Gaps = 8/295 (3%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH----DGVESPASAKSIAAVNVPVIDMQ  227
            E + + L  SL VPSVQ+L K N + VP RYI     D V       S +++ +PVIDM 
Sbjct  3    EINTKPLATSLLVPSVQELAKQNFSSVPQRYIQHQHEDMVLICEETNSTSSLEIPVIDMH  62

Query  228  KL---QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
             L   ++ENSE L KLHLACK+WGFF LINHGV+ SL++++K EIQDFFNLP+ EK+++ 
Sbjct  63   NLLSIEAENSE-LDKLHLACKEWGFFQLINHGVSPSLLKKLKLEIQDFFNLPMSEKKKFW  121

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q     +GFGQ +VVSE+QKLDW D+FY+ TLPT+ R P+LFP+LP  FR+T+E YS  M
Sbjct  122  QTPQHIEGFGQAYVVSEDQKLDWGDMFYMTTLPTHSRIPHLFPQLPLPFRDTLELYSCNM  181

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              ++M ++  + K L I+  E+R LFE+ +Q MRMNYYPPCP+ E V+GL+ HSD  GLT
Sbjct  182  KNIAMAIIGQMGKALKIEEMEIRELFEDEIQKMRMNYYPPCPQPEKVIGLTNHSDGVGLT  241

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILL VNE  GL+IKKDG W PI P+PNAFVVN+G+ +EI +NGIY+SIEHRA V+
Sbjct  242  ILLHVNEVEGLQIKKDGVWVPIKPLPNAFVVNIGEILEIVTNGIYQSIEHRATVN  296



>gb|KEH38519.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=358

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/291 (55%), Positives = 214/291 (74%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G SL VPSVQ+L K+  + VP+RYI    E     ++ + + +PVIDM+KL 
Sbjct  1    MEEIKNPSGTSLLVPSVQELAKEKISTVPARYIQSQHEELVINEANSILEIPVIDMKKLL  60

Query  237  S--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S    S EL KLHLACKDWGFF L+NH V+ SL+E+VK EI DFFNLP+ EK+++ Q   
Sbjct  61   SLEYGSLELSKLHLACKDWGFFQLVNHDVSSSLLEKVKMEIMDFFNLPMSEKKKFWQTPQ  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
              +GFGQ FV+SEEQKLDWAD+F++ TLP ++R P+LFP+LP   R+T+E YS E+  L+
Sbjct  121  HMEGFGQAFVLSEEQKLDWADLFFMTTLPKHLRMPHLFPQLPLPLRDTLELYSQEIKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  + K+L ++  E+R LFE+G+Q MR NYYPPCP+ E V+GL+ HSD  GLTILLQ
Sbjct  181  MVILGHIEKSLKMEEMEIRELFEDGIQMMRTNYYPPCPQPEKVIGLTNHSDPVGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+I+K+  W P+ P+PNAF+VN+GD +EI +NGIYRSIEHRA+V+
Sbjct  241  LNEVEGLQIRKNCMWVPVKPLPNAFIVNIGDMLEIITNGIYRSIEHRAIVN  291



>ref|XP_010057213.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=359

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 217/292 (74%), Gaps = 4/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            MEA        L VP VQ ++K+NP  VP RY+ D +E P    + + + +PVID+ +L 
Sbjct  1    MEARVNIPARLLHVPWVQDIMKENPTTVPERYVRDDLE-PVIMGACSGLQLPVIDLGRLV  59

Query  237  SENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            SE+    EL+KLH ACKDWGFF LINH V+  L+E+VK+  ++ FN+P+EEK+++ Q +G
Sbjct  60   SEDCAKLELKKLHHACKDWGFFQLINHEVSPKLIEKVKKGTEELFNMPMEEKKKFWQRDG  119

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            ++ GFGQ FV SE+QKLDWAD+FY+ TLP ++R P+LFPKLP  FR+ ++ YS E   L+
Sbjct  120  ESSGFGQAFVFSEDQKLDWADIFYMFTLPASMRKPHLFPKLPLPFRDDLDAYSKETKTLA  179

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK LG++++++  +FE+G+QSMRMNYYPPCP+ E VMGL+ HSD   +TILLQ
Sbjct  180  IKLLYLMAKALGMEAKDVEGIFEDGLQSMRMNYYPPCPQPELVMGLNSHSDGDAVTILLQ  239

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVE-IFSNGIYRSIEHRALVS  923
            VNE  GL+I+KDG W P+ P+P AF++NVGD VE I +NGIY+SIEHRA V+
Sbjct  240  VNEMEGLQIRKDGKWVPVKPLPGAFIINVGDVVEQIITNGIYQSIEHRATVN  291



>emb|CDP14579.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 208/285 (73%), Gaps = 2/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K   + +P RY+H   ESP  +   +   VPVID+++L SENS  
Sbjct  10   NFGKSLIVPSVQELAKQPISKIPPRYVHHDEESPIVSHETSLPAVPVIDVERLLSENSMD  69

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL+KLHLACKDWGFF ++NHGV+ SL++ ++ EI DFF LP EEK+   Q   + +GFG
Sbjct  70   SELEKLHLACKDWGFFQVVNHGVSTSLLDCLRNEITDFFKLPFEEKKALWQEPENHEGFG  129

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVSEEQKLDW+D+FY+ TLP  +R   LF KLP   R+ +E YS+E+  L+M +L  
Sbjct  130  QLFVVSEEQKLDWSDMFYITTLPDKLRKVELFEKLPLKLRDAMEAYSLEVKILAMTLLRE  189

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            +AK L I  EE++ LF +G+QSMRMNYYPPCPE E  +G +PHSDA  LTIL Q+N T G
Sbjct  190  MAKVLKIDEEELKGLFSDGVQSMRMNYYPPCPEPEMAIGFNPHSDADALTILFQLNGTPG  249

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+I+KDG W P+ P+P+A +VNVGD +EI SNG+YRSIEHRA V+
Sbjct  250  LQIRKDGRWLPVTPLPDALIVNVGDIIEILSNGLYRSIEHRATVN  294



>gb|AFK41350.1| unknown [Lotus japonicus]
Length=356

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 204/279 (73%), Gaps = 0/279 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
            LG SL VPSVQ+L K     VP +Y+    E P  + + +   VPVID  KL S++  EL
Sbjct  9    LGTSLAVPSVQELAKQPITKVPEQYVRPNQEPPVISNTTSLPQVPVIDFNKLFSDDGVEL  68

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KL  ACK+WGFF LINHGVN SLVE++K ++Q FFNLP +EK+ + Q  G+ +G GQ+F
Sbjct  69   EKLDHACKEWGFFQLINHGVNHSLVEKMKMDVQKFFNLPKDEKKVFAQKPGEMEGLGQMF  128

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            + SEE KL+WAD+F + TLP NIR+P+LFP LP+ FR+ +E Y++E+  L + +L  +AK
Sbjct  129  IASEETKLEWADLFLIVTLPENIRNPHLFPNLPQPFRDHLERYALELKNLYVSILELMAK  188

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L  +  E+  LFEEG Q+MRMNYYPPCP+ E VMGL+PHSD   LT+LLQVNE  GLE+
Sbjct  189  ALKFQPSELPELFEEGGQAMRMNYYPPCPQPEKVMGLNPHSDNSILTLLLQVNEIVGLEV  248

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRA  914
            +K G W PI P+PNAF++NVGD +EI +NGIYRSIEHRA
Sbjct  249  RKGGRWVPIKPLPNAFIINVGDALEIMTNGIYRSIEHRA  287



>ref|XP_007025222.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY27844.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=366

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 210/290 (72%), Gaps = 2/290 (1%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQS  239
            +A+  + G S+ VPSVQ+L K+    +P RY+    E  +        +VP+ID+QKL +
Sbjct  6    DAEVVNFGKSIIVPSVQELAKEPITKIPHRYLRPEQEPHSVLGDELLPSVPIIDLQKLVA  65

Query  240  EN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD  413
             +    EL++LH ACKDWGFF ++NHGV  SL+EE + EI++FFNLP EEK+   Q   +
Sbjct  66   GDFVDSELERLHSACKDWGFFQVVNHGVGSSLLEEFRLEIENFFNLPHEEKKLLWQQPDN  125

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQLFVVSEEQKLDW+D+FY+ TLP N+R  +LF KLP   R T+E YS+E   L+M
Sbjct  126  HEGFGQLFVVSEEQKLDWSDMFYITTLPHNLRKTDLFEKLPLKLRETLEVYSMEAKNLAM  185

Query  594  KVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQV  773
             +L ++A+ L + +EEMR LF  G+QSMRMNYYPPCPE +  +G SPHSDA  LTIL Q+
Sbjct  186  IILAYMARALEMDAEEMRELFTNGVQSMRMNYYPPCPEPDMAIGFSPHSDADALTILFQL  245

Query  774  NETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            NET GL+I+KDG W  I P+PNAFVVN+GD +EI SNGIYRSIEHRA+V+
Sbjct  246  NETEGLQIRKDGKWVSIKPLPNAFVVNIGDIMEIVSNGIYRSIEHRAMVN  295



>gb|KCW74247.1| hypothetical protein EUGRSUZ_E02887 [Eucalyptus grandis]
Length=311

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 204/281 (73%), Gaps = 9/281 (3%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
            L   M+A    LG SLPVPSVQ+L K+    +P RYI   ++   S      + VPVID+
Sbjct  9    LVATMDAIVNKLGGSLPVPSVQELAKEAITELPPRYIRTDLDHGTSV-----LQVPVIDL  63

Query  225  QKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR  392
             KL S + +    EL+KLH AC+DWGFF LINHGV+ SL+EEVK  IQ+FF LP+EEK+R
Sbjct  64   SKLSSSDGDLTESELEKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEEKRR  123

Query  393  YGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSV  572
            + Q EGD  GFGQ FVVSEEQKLDW D+FY+ +LP ++R P+LFP LP  FR+ ++ YS 
Sbjct  124  FWQQEGDLQGFGQAFVVSEEQKLDWGDMFYVVSLPRHLRKPHLFPMLPSPFRDVLDKYST  183

Query  573  EMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            E+  L+MK+L  +AK L + ++EM  LF+EG+Q MRMNYYPPCP  E  +GL+PHSDA G
Sbjct  184  ELQDLAMKILLLMAKALKMDTKEMIELFDEGLQGMRMNYYPPCPRPELAIGLTPHSDAKG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEI  875
            LTILLQVNE  GL+++K+G W PI P+PNAFVVNVGD +E+
Sbjct  244  LTILLQVNEVEGLQVRKEGKWVPIKPLPNAFVVNVGDILEV  284



>ref|XP_004488689.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=352

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/291 (56%), Positives = 211/291 (73%), Gaps = 4/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G SL VPSVQ+L K+N + VP RYI    E     K    + +P+IDM +L 
Sbjct  1    MEDFKNPSGTSLLVPSVQELAKENISEVPPRYIQSQHEGLVLTKIDNILEIPIIDMHRLL  60

Query  237  SE--NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S    S EL KLHLACKDWGFF L+NHG++  LVE+VK EIQ+FF LP+ EK+++ Q+  
Sbjct  61   SLEFGSSELTKLHLACKDWGFFQLVNHGISSCLVEKVKLEIQEFFKLPMSEKKKFWQSSE  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
              +GFGQ FVVSEEQKLDWAD+FY+ TLP + R P+LFP+LP   R+T+E YS E+  ++
Sbjct  121  HMEGFGQAFVVSEEQKLDWADMFYMTTLPKHSRMPHLFPQLPLPLRDTLELYSEEIKNIA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M ++  + K L I  EE+R LFEEG+Q MRMNYYPPCP+ E V+GL+ HSD  G+TILLQ
Sbjct  181  MAIVSNIGKALKI--EEIRELFEEGIQMMRMNYYPPCPQPEKVIGLTNHSDPVGVTILLQ  238

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +N+  GL+IKKDG W  + P+PNAF+VN+GD +EI +NGIYRSIEHRA+V+
Sbjct  239  LNDVEGLQIKKDGMWVTVNPLPNAFIVNIGDMLEIITNGIYRSIEHRAIVN  289



>gb|KDP25011.1| hypothetical protein JCGZ_23994 [Jatropha curcas]
Length=344

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/283 (54%), Positives = 210/283 (74%), Gaps = 6/283 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEE  254
            +LG SL VPSVQ+L K   +V+P RYI    +S      ++ + +PV+DMQKL S+ SE 
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESDS-----GVSVMEIPVVDMQKLLSQESE-  56

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KLH AC+ WGFF L+NH V  SL+E++K+E++D FNL +EEK+++ Q  G+ +GFGQ 
Sbjct  57   LDKLHYACRHWGFFQLVNHEVEHSLLEKIKKEVKDLFNLSMEEKKKFWQYPGEVEGFGQA  116

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSE+QKLDW D+F++ T P + R P+LFP  P   R+T++TYS E+  L+M +L  +A
Sbjct  117  FVVSEDQKLDWGDLFFMVTQPIHARKPHLFPNFPLPLRDTLDTYSTEVKNLAMVILAHMA  176

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L ++++EM+ +FE+G QSMRMNYYPPCP+ + V+GL+PHSDA GLTILLQVNE  GL+
Sbjct  177  KALHMEADEMKEIFEDGHQSMRMNYYPPCPQPDKVIGLTPHSDATGLTILLQVNEVEGLQ  236

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKD  W  + P PNAF++N+GD +EI +NG Y SIEHRA V+
Sbjct  237  IKKDNKWLSVKPFPNAFIINIGDILEIVTNGTYSSIEHRATVN  279



>gb|KHN36942.1| Protein SRG1 [Glycine soja]
Length=360

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 209/288 (73%), Gaps = 7/288 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA--SAKSIAAVNVPVIDMQKLQS--ENS  248
            G SL VPSV +L K+N   VP RYI    +     S +  + + +PVIDM +L S    S
Sbjct  10   GTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRLLSVESGS  69

Query  249  EELQKLHLACKDWGFFH---LINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
             EL KLHLACK+WGFF    L+NHGVN SLVE+V+ E QDFFNLP+ EK+++ Q     +
Sbjct  70   SELDKLHLACKEWGFFQTLELVNHGVNSSLVEKVRLETQDFFNLPMSEKKKFWQTPQHME  129

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQ FVVSE+QKLDWAD++Y+ TLP + R P+LFP+LP  FR+T+E YS E+  L++ +
Sbjct  130  GFGQAFVVSEDQKLDWADLYYMTTLPKHSRMPHLFPQLPLPFRDTLEAYSQEIKDLAIVI  189

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            +  + K L I+  E+R LFE+G+Q MRMNYYPPCPE E V+GL+PHSD  GL ILLQ+NE
Sbjct  190  IGLMGKALKIQEREIRELFEDGIQLMRMNYYPPCPEPEKVIGLTPHSDGIGLAILLQLNE  249

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
              GL+I+KDG W P+ P+ NAF+VNVGD +EI +NGIYRSIEHRA V+
Sbjct  250  VEGLQIRKDGLWVPVKPLINAFIVNVGDILEIITNGIYRSIEHRATVN  297



>ref|XP_006477805.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=431

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 207/282 (73%), Gaps = 3/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSENS--EEL  257
            SL VP VQ+L K+   VVP RYI    ++       A V+ +PVIDMQ L SE S   EL
Sbjct  82   SLSVPCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSEL  141

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             KL  ACK+WGFF ++NHGV+ + +E+VK+E+ +FFNL +EEK++Y Q+  D +GFGQ F
Sbjct  142  AKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEEKKKYWQSPEDLEGFGQAF  201

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSEEQKLDW D+F++ TLP ++R P+LFPKLP   R+T+E YS+E+  L+M ++  + K
Sbjct  202  VVSEEQKLDWGDLFFMTTLPVHLRKPHLFPKLPLPLRDTLEVYSMELKSLAMNLILKMGK  261

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L IK EEM+  FE G+Q MRMNYYPPCP+ E V+GL+PHSD   LTILLQ+NE  GL+I
Sbjct  262  VLNIKDEEMKNFFENGLQVMRMNYYPPCPQPEKVVGLTPHSDGPALTILLQINEVEGLQI  321

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKDG W P+ P+PNAF+VNVGD +EI +NG YRSIEHR  V+
Sbjct  322  KKDGVWIPVTPLPNAFIVNVGDIMEIITNGKYRSIEHRVTVN  363



>ref|XP_008366518.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=365

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 210/289 (73%), Gaps = 8/289 (3%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIH----DGVESPASAKSIAAVNVPVIDMQKL---QS  239
            G SL VPSVQ+ VK     +P RY+     DG           A  +P IDMQKL   +S
Sbjct  13   GGSLHVPSVQEFVKKPILTIPPRYLQPHYQDGEHEMIINSDHHAHQIPSIDMQKLLSQZS  72

Query  240  ENSE-ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
             NSE EL +LH ACK+WGFF L+NHGV+ S++E++K E Q+FFNLP+EEK+++ Q  GD 
Sbjct  73   TNSEAELARLHFACKEWGFFQLVNHGVSSSVLEKMKTETQEFFNLPMEEKKKFSQQPGDI  132

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +G+GQ FVVSE+QKLDW+D+F+L TLP  +R P+L PKLP  FR T+ETYS E+  L+M 
Sbjct  133  EGYGQAFVVSEDQKLDWSDMFFLTTLPVQLRKPHLLPKLPSPFRETLETYSSELKNLAMT  192

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  + K L ++++E+  +FE G+Q++R+NYYPPCP+   V+GL PHSD G LTILLQVN
Sbjct  193  ILSQMEKALQMEAKEVTNIFEGGLQAVRVNYYPPCPQPGKVLGLPPHSDGGALTILLQVN  252

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  253  EMDGLQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  301



>ref|XP_003518803.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN29929.1| Protein SRG1-like protein [Glycine soja]
Length=358

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 206/286 (72%), Gaps = 1/286 (0%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN-  245
             + LG SL VPSVQ+L K     VP RY+    +      + +   VPVID+ KL SE+ 
Sbjct  6    VKKLGSSLLVPSVQELAKQGITKVPERYVRPNEDPCVEYDTTSLPQVPVIDLSKLLSEDD  65

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
            + EL+KL  ACK+WGFF LINHGVN  LVE +K+ +Q+ FNLP EEK+   Q  G+ +GF
Sbjct  66   AAELEKLDHACKEWGFFQLINHGVNPCLVEYMKKNVQELFNLPHEEKKLLWQKPGEMEGF  125

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ+FVVSEE KL+WAD+FY+ TLP+  R P+LFP +P  FR+ +E YS+E+ KL + +  
Sbjct  126  GQMFVVSEEHKLEWADLFYISTLPSYARHPHLFPNIPRQFRDNLEKYSLELKKLCILIFE  185

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
            F+ K L I+  E+   FEEG Q+MRMNYYPPCP+ E V+GL+PHSDAG LTILLQVNE  
Sbjct  186  FMTKALKIQPNELLDFFEEGGQAMRMNYYPPCPQPEQVIGLNPHSDAGALTILLQVNEMD  245

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+I+KDG W PI P+ NAFV+NVGD +EI +NGIYRSIEH+A V+
Sbjct  246  GLQIRKDGMWIPIKPLSNAFVINVGDMLEIMTNGIYRSIEHKATVN  291



>ref|XP_009376720.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=360

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 206/285 (72%), Gaps = 5/285 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS----  248
            G SL VPSVQ+LVK     +P RYI    +   S+    A  +P IDMQKL S+ S    
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQPHHQEIISSDH-HAHQIPSIDMQKLLSQESTISE  71

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL +LH AC++WGFF L+NHGV+ SL+E++K E Q+FFNLP+EEK+ + Q  GD +GFG
Sbjct  72   AELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEEKKIFSQQPGDIEGFG  131

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDWAD F+L TLP  +R P L PKLP  FR T+ETYS+E+  L+M +L  
Sbjct  132  QSFVVSEDQKLDWADTFFLTTLPVQLRKPRLLPKLPSPFRETLETYSLELKNLAMTILSQ  191

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L +++ E   +FE  +Q++R+NYYPPCP+   V+GL+PHSD G LTILLQVNE  G
Sbjct  192  MEKALQMETNEATNIFEGALQAVRVNYYPPCPQPGKVLGLTPHSDGGALTILLQVNEMDG  251

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  252  LQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  296



>gb|AGL52587.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=378

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/290 (56%), Positives = 216/290 (74%), Gaps = 8/290 (3%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYI---HDGVESPASAKSIAAVNVPVIDMQKLQSE--  242
            LG +L VPSVQ+L K +   VP+RYI   HD + +  +A S+   +VPVI++QK+ S   
Sbjct  9    LGGTLFVPSVQELAKQSLAEVPARYIRDDHDTLGNNVTATSMMDQSVPVINLQKVLSPEP  68

Query  243  --NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD-  413
                 EL++LH ACK+WGFF ++NHGV+  LVE+VK +I+ FF LP+EEK+++ Q EGD 
Sbjct  69   IIGELELERLHSACKEWGFFQVVNHGVDNLLVEKVKSDIEGFFKLPMEEKKKFWQEEGDG  128

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQ FV SE+QKLDW D+FY+ TLP ++R P LFPKLP   R TIE+YS E+ KLS+
Sbjct  129  LEGFGQAFVHSEDQKLDWGDLFYMVTLPKHMRKPRLFPKLPLPLRETIESYSSELSKLSL  188

Query  594  KVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQV  773
             ++  + K L +K+  M  LFE+G+Q MR+NYYPPCP+ EHV+GL+PHSD GGLTILLQ+
Sbjct  189  TLIKSMEKALQLKTNVMAELFEDGVQQMRINYYPPCPQPEHVIGLTPHSDVGGLTILLQL  248

Query  774  NETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            NE  GL+IKK+  W PI P+PNAFVVN+GD  EI SNGIYRS+EHRA ++
Sbjct  249  NEVDGLQIKKEKMWVPIKPLPNAFVVNIGDAFEIMSNGIYRSVEHRATIN  298



>ref|XP_004490337.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=348

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 206/282 (73%), Gaps = 0/282 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
            LG SL VPSV +L K +   +P +Y+    +    + + +   VPVID+ KL  E+  EL
Sbjct  4    LGTSLLVPSVHELAKQSILEIPEQYLQSNQDPIVISNTTSLPQVPVIDLSKLLHEDETEL  63

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KLH ACK+WGFF LINH VN SLVE VK  +Q+F N+P+EEK+++ Q   D +GFGQLF
Sbjct  64   EKLHHACKEWGFFQLINHEVNPSLVENVKIGVQEFLNIPMEEKKKFWQTPEDIEGFGQLF  123

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE QKL+WAD+FY+ TLP+N R+P LFP  P+ FRN ++TY +E+ K+ + ++  + K
Sbjct  124  VVSENQKLEWADLFYIDTLPSNARNPRLFPNFPQPFRNNLDTYCLELKKVCITIIKHMEK  183

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++  EM  LF++  QSMR+NYYPPCP+ E+V+GL+PHSDAG LTILLQ N+  GL+I
Sbjct  184  ALKVEPNEMVELFDDLSQSMRLNYYPPCPQPENVIGLNPHSDAGALTILLQANDIEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W PI PI NAFV+NVGD  EI +NGIYRSIEHRA V+
Sbjct  244  RKDGQWIPIKPITNAFVINVGDISEILTNGIYRSIEHRATVN  285



>ref|XP_009376719.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 210/289 (73%), Gaps = 13/289 (4%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN----VPVIDMQKLQSENS  248
            G SLPVPSVQ+LV+     +P RY+      P   + I++ +    +P IDMQKL S+ S
Sbjct  13   GGSLPVPSVQELVQKPILTIPPRYVQ-----PLHQEIISSDHHTHQIPSIDMQKLLSQES  67

Query  249  ----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
                 EL +LH AC++WGFF L+NHGV+ SL++++K E Q+FFNLP+EEK+++ Q  GD 
Sbjct  68   TISESELARLHFACQEWGFFQLVNHGVSSSLLDKMKTETQEFFNLPMEEKKKFSQQPGDI  127

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQ FVVSE+QKLDWAD F L TLP  +R P+L PKLP  FR T+ETYS+E+  L+M 
Sbjct  128  EGFGQSFVVSEDQKLDWADTFVLTTLPVQLRRPHLLPKLPSPFRETLETYSLELKNLAMT  187

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  + K L +++ E   +FE  +Q++R+NYYPPCP+   V+GL+PHSD G LTILLQVN
Sbjct  188  ILSQMEKALQMETNEATYIFEGALQAVRVNYYPPCPQPGKVIGLTPHSDGGALTILLQVN  247

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  248  EMDGLQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  296



>ref|XP_009376718.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=363

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 210/289 (73%), Gaps = 13/289 (4%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN----VPVIDMQKLQSENS  248
            G SLPVPSVQ+LV+     +P RY+      P   + I++ +    +P IDMQKL S+ S
Sbjct  16   GGSLPVPSVQELVQKPILTIPPRYVQ-----PLHQEIISSDHHTHQIPSIDMQKLLSQES  70

Query  249  ----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
                 EL +LH AC++WGFF L+NHGV+ SL++++K E Q+FFNLP+EEK+++ Q  GD 
Sbjct  71   TISESELARLHFACQEWGFFQLVNHGVSSSLLDKMKTETQEFFNLPMEEKKKFSQQPGDI  130

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQ FVVSE+QKLDWAD F L TLP  +R P+L PKLP  FR T+ETYS+E+  L+M 
Sbjct  131  EGFGQSFVVSEDQKLDWADTFVLTTLPVQLRRPHLLPKLPSPFRETLETYSLELKNLAMT  190

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  + K L +++ E   +FE  +Q++R+NYYPPCP+   V+GL+PHSD G LTILLQVN
Sbjct  191  ILSQMEKALQMETNEATYIFEGALQAVRVNYYPPCPQPGKVIGLTPHSDGGALTILLQVN  250

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  251  EMDGLQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  299



>ref|XP_006355570.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/285 (56%), Positives = 208/285 (73%), Gaps = 5/285 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K +   +P RY+H   ESP  +      +VPVID+QKL S ++  
Sbjct  9    NFGKSLLVPSVQELAKQHLTNIPDRYLHPEQESPVIS---TGASVPVIDIQKLISGDAMD  65

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  +INHGV  SL+E+ K E+ + F LP+EEK++  Q E + +GFG
Sbjct  66   SELQKLHSACQQWGFLQVINHGVTPSLLEDFKSEVIELFKLPMEEKKKLWQQEDNFEGFG  125

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
             +FVVSEEQKLDW D+F + TLP  IR  +LFPKLP   R+ +E YS E+  L+M ++C 
Sbjct  126  SIFVVSEEQKLDWGDMFVIATLPPCIRKIDLFPKLPSKLRDIMEEYSKEIKNLAMIIVCQ  185

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EM+ LF +GMQSMRMNYYPPCPES+  +GLSPHSDA  LTILLQ+NET G
Sbjct  186  LAKALRMDEKEMQDLFSDGMQSMRMNYYPPCPESDRAIGLSPHSDADALTILLQLNETEG  245

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KD  W PI P+PNA +VN+GD +EI SNG+Y+SIEHRA+V+
Sbjct  246  LQVRKDDIWVPIKPLPNALIVNIGDMMEIVSNGVYKSIEHRAIVN  290



>gb|KCW74257.1| hypothetical protein EUGRSUZ_E02903 [Eucalyptus grandis]
Length=334

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 208/266 (78%), Gaps = 3/266 (1%)
 Frame = +3

Query  135  VVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSENSE--ELQKLHLACKDWGFFHLI  305
            +VP RYI D  E P    + + +  VPVID+ +L SE+S   EL+KLH ACKDWGFF LI
Sbjct  1    MVPKRYICDNQEHPVIMDACSGLPQVPVIDLGRLVSEDSAKPELEKLHQACKDWGFFQLI  60

Query  306  NHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYL  485
            NH V+  L+E+VK+  ++ FN+P+EEK+++ Q EG++DGFGQ FV+SE+QKLDWAD+FY+
Sbjct  61   NHDVSPKLIEKVKKGTEELFNMPMEEKKKFWQREGESDGFGQAFVLSEDQKLDWADIFYM  120

Query  486  KTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEG  665
             TLP ++R P+LFPKLP  +R+ ++ YS EM  L++K+L  +AK LG++++++  +FE+G
Sbjct  121  VTLPASLRKPHLFPKLPLPYRDDLDAYSKEMQTLAIKLLYLMAKALGMEAKDLEGMFEDG  180

Query  666  MQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAF  845
            +Q MRMNYYPPCP+ E V+GL+ HSDA  +TILLQVNE  GL+I+KDG W P+ P+P+AF
Sbjct  181  LQGMRMNYYPPCPKPELVIGLNSHSDADAITILLQVNEMEGLQIRKDGKWIPVKPLPDAF  240

Query  846  VVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++NVGD VEI +NGIY+SIEHRA V+
Sbjct  241  IINVGDIVEIITNGIYQSIEHRATVN  266



>ref|XP_007025221.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY27843.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=445

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 213/295 (72%), Gaps = 3/295 (1%)
 Frame = +3

Query  45   LYIAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDM  224
             Y+A +A+  + G S+ VPSVQ+L K+    +P RY+    E  +        +VP+ID+
Sbjct  81   FYLA-DAEVVNFGKSIIVPSVQELAKEPITKIPHRYLRPEQEPHSVLGDELLPSVPIIDL  139

Query  225  QKLQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            QKL + +    EL++LH ACKDWGFF ++NHGV  SL+EE + EI++FFNLP EEK+   
Sbjct  140  QKLVAGDFVDSELERLHSACKDWGFFQVVNHGVGSSLLEEFRLEIENFFNLPHEEKKLLW  199

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q   + +GFGQLFVVSEEQKLDW+D+FY+ TLP N+R  +LF KLP   R T+E YS+E 
Sbjct  200  QQPDNHEGFGQLFVVSEEQKLDWSDMFYITTLPHNLRKTDLFEKLPLKLRETLEVYSMEA  259

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+M +L ++A+ L + +EEMR LF  G+QSMRMNYYPPCPE +  +G SPHSDA  LT
Sbjct  260  KNLAMIILAYMARALEMDAEEMRELFTNGVQSMRMNYYPPCPEPDMAIGFSPHSDADALT  319

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IL Q+NET GL+I+KDG W  I P+PNAFVVN+GD +EI SNGIYRSIEHRA+V+
Sbjct  320  ILFQLNETEGLQIRKDGKWVSIKPLPNAFVVNIGDIMEIVSNGIYRSIEHRAMVN  374



>ref|XP_006355624.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase-like 
[Solanum tuberosum]
Length=349

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 207/286 (72%), Gaps = 9/286 (3%)
 Frame = +3

Query  66   DAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN  245
            +A+S  L  P  +VQ+L K     +P RYIHDG+E  + +  +    +PVIDM  +  +N
Sbjct  3    EARSRNLKAPY-NVQELAKQQVGTIPRRYIHDGIEKISDSSML----LPVIDMLAIGDDN  57

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
            SE    LH ACK+WGFF ++NHGV+ SLVE+VK EIQ FFNLP+EEK+++ Q EGD +G+
Sbjct  58   SE----LHFACKEWGFFQVVNHGVSSSLVEKVKSEIQAFFNLPMEEKKKFEQQEGDVEGY  113

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ  V +EEQKL+W D+FY+ TLP N R P+LFPKLP + R+ +E Y  EM  L+M ++ 
Sbjct  114  GQDVVFTEEQKLEWGDIFYMTTLPINFRKPHLFPKLPHSLRDIMEEYCKEMKSLTMIIIR  173

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
             L K L +  +EMR L  +GMQ +RMNYYPPCPE +  +G+SPHSD   LTILLQ+NET 
Sbjct  174  QLGKALRMDEKEMRDLSNDGMQLIRMNYYPPCPEPDKTIGVSPHSDTDTLTILLQLNETD  233

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+++KD  W PI P+PNAF+VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  234  GLQVRKDDIWVPIKPLPNAFIVNIGDLMEILSNGVYRSIEHRAVVN  279



>ref|XP_007022030.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13555.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 210/312 (67%), Gaps = 23/312 (7%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M+  A   G SL VPSVQ+L K     +P RY+   +E P  + + +   +PVIDM+ L 
Sbjct  1    MDPKAVKYGSSLLVPSVQELAKKPIATIPPRYLRPDLEKPIVSNAGSISEIPVIDMEGLV  60

Query  237  SENS--EELQKLHLACKDWGFF---------------------HLINHGVNCSLVEEVKR  347
            S+ S    L KL  ACK+WGFF                     +LINHG++ SLVE+VK 
Sbjct  61   SKESMDSSLAKLDFACKEWGFFQVQLALCIYHLNPYSTLVPGEYLINHGMSLSLVEKVKT  120

Query  348  EIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFP  527
            EIQDFFNL +EEK++Y    GD +GFGQ FVVS+EQKLDW D+F+L TLP   R P+LFP
Sbjct  121  EIQDFFNLAMEEKKKYWLYPGDVEGFGQAFVVSDEQKLDWGDMFFLTTLPVYSRKPHLFP  180

Query  528  KLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPE  707
            KLP  FR+T+  YS+E+ KL+M +L   A+ + +  EEMR  FE G+QSMR NYYPPC E
Sbjct  181  KLPLPFRDTLNQYSLELEKLAMAILVQKAEAINMNVEEMREFFEGGLQSMRTNYYPPCGE  240

Query  708  SEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNG  887
             E V+GLSPHSDA GLTIL QVNE  GL++KKDG W P+ P+PNAF+VN+GD +EI +N 
Sbjct  241  PEQVIGLSPHSDATGLTILHQVNEVEGLQVKKDGKWLPVKPLPNAFIVNIGDALEIITNV  300

Query  888  IYRSIEHRALVS  923
            +YRSIEHRA V+
Sbjct  301  VYRSIEHRATVN  312



>ref|XP_006432901.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
 gb|ESR46141.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
Length=359

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/291 (54%), Positives = 209/291 (72%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA+A  +G SL  PS+ +L  + P + +P RY+   ++ P       +A  +PVIDM K
Sbjct  1    MEAEATDIGSSLVEPSILELAHNKPLITIPPRYVRPEMDHPLIRTDDSSAQQLPVIDMHK  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGF  L+NHGV+ SLVE+VK EIQDFFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDRACKEWGFCQLMNHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F L T PT++R P+LFPKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFITSEEQKLDWGYGFTLTTFPTHLRKPHLFPKLPLPFRDDLEVYLTELKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE GMQS+RMNYYPPCP+ E V+G + H D   LT+LLQ
Sbjct  181  LKILDQMAKALRMDPNDMKELFENGMQSLRMNYYPPCPQPEQVVGHNSHCDTSALTLLLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+IKKDG W  + P+P+AFVVN+GD +EIF+NG YRSIEHRA V+
Sbjct  241  VNEMDGLQIKKDGKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHRATVN  291



>ref|XP_009376721.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 206/285 (72%), Gaps = 5/285 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS----  248
            G SL VPSVQ+LVK     +P RYI    +   S+    A  +P IDMQKL S+ S    
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQPHHQEIISSDH-HAHQIPSIDMQKLLSQESTISE  71

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL +LH AC++WGFF L+NHGV+ SL+E++K E Q+FFNLP+EEK+ + Q  GD +GFG
Sbjct  72   AELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEEKKIFSQQPGDIEGFG  131

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDWAD F+L TLP  +R P L PKLP  FR T+ETYS+E+  L+M +L  
Sbjct  132  QSFVVSEDQKLDWADTFFLTTLPVQLRKPRLLPKLPSPFRETLETYSLELKNLAMTILSQ  191

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L +++ E   +FE  +Q++R+NYYPPCP+   V+GL+PHSD G LTILLQVNE  G
Sbjct  192  MEKALQMETNEATNIFEGALQAVRVNYYPPCPQPGKVLGLTPHSDGGALTILLQVNEMDG  251

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L++KKDG W P+ P+P+AF+VN+GD +E+ +NG YRSIEHRA V+
Sbjct  252  LQVKKDGIWVPVKPLPDAFIVNIGDVLEVITNGTYRSIEHRATVN  296



>gb|KHG25230.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=358

 Score =   330 bits (846),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/292 (55%), Positives = 212/292 (73%), Gaps = 3/292 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKL  233
            ME++A ++G SL VPSVQ+L K   + +P+RY+   +E    A     V  +PVIDMQKL
Sbjct  1    MESEASNVGSSLLVPSVQELAKQPLSGIPNRYLRPELEQDVVADGGGPVLEIPVIDMQKL  60

Query  234  QSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             SE   + EL KL  ACK+WGFF L+NHGV+ +L+E+V  +IQDFFNLP EEK R+ Q  
Sbjct  61   VSEEPMNSELDKLDFACKEWGFFQLVNHGVSLTLLEKVNTQIQDFFNLPKEEKNRFWQYP  120

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G  +GFGQ FVVSE+QKLDWAD+FY+ TLP ++R P+LF  LP   R+T+E+YS E++ L
Sbjct  121  GQVEGFGQSFVVSEDQKLDWADIFYILTLPLHLRKPHLFHNLPLPLRDTLESYSSELNNL  180

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILL  767
               +L  + + L +K+EEM     EG QS+R+NYYPPCP  E V+GL+PHSDA  +TILL
Sbjct  181  FKAILAKIVEALSMKTEEMEEFIGEGRQSIRVNYYPPCPLPEQVVGLTPHSDASIITILL  240

Query  768  QVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            Q+NE  GL+I+KDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  241  QLNEVEGLQIRKDGKWVPVKPLPNAFIVNIGDLLEIITNGTYRSIEHRATVN  292



>ref|XP_004233004.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=350

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/283 (57%), Positives = 203/283 (72%), Gaps = 4/283 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEE  254
            + G SL VPSVQ+L K +   +P+RY+    ESP      A  +VPVID+QKL S +SE 
Sbjct  2    NFGKSLLVPSVQELAKQHLTNIPARYVRPEEESPVI---YAGASVPVIDLQKLISMDSE-  57

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            LQKLH AC+ WGF  +INHGV  SL+E+ KRE+ D F LP+EEK++  Q E   +GFG  
Sbjct  58   LQKLHSACQQWGFLQVINHGVTSSLLEDFKREVIDLFKLPMEEKKKLWQQEDSFEGFGNA  117

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQKLDW+D+F + TLP  IR  +LF KLP   R  IE YS E+  L+M ++C LA
Sbjct  118  FVVSEEQKLDWSDMFGIMTLPLRIRKVDLFHKLPSDLRGIIEAYSNEIKSLAMIIVCHLA  177

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L I   EMR LF +G+QSMRMNYYPPCPE +  +GLSPHSDA  LTIL Q++ET GL+
Sbjct  178  KALRIDENEMRELFSDGVQSMRMNYYPPCPEPDRAIGLSPHSDADALTILFQLDETEGLQ  237

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++KD  W PI P+PNA +VN+GD +EI SNG+Y+SIEHRA+V+
Sbjct  238  VRKDDIWVPIKPLPNALIVNIGDMMEILSNGVYKSIEHRAIVN  280



>emb|CBI30795.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 217/289 (75%), Gaps = 7/289 (2%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE-----SPASAKSIAAVNVPVIDMQKLQSE  242
             G S+ VPSV++LVK+    VP RY+H+  +     + A+A  I   +VPVID+  L   
Sbjct  133  FGKSIIVPSVRELVKEPITKVPPRYVHNQQDLQMAAAAAAAADIWLQSVPVIDLHCLLHG  192

Query  243  NS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
            +S   EL++LH ACKDWGFF ++NHGV+ SL+EE K E+QDFF LPLEEK++  Q   + 
Sbjct  193  DSMGSELERLHSACKDWGFFQVVNHGVSSSLLEEFKGEVQDFFELPLEEKKKLWQQPDNH  252

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQLFVVSEEQ+LDW+D+FYL TLP N+R  ++F KLP+  R T+E YSVEM KL+M 
Sbjct  253  EGFGQLFVVSEEQRLDWSDMFYLTTLPFNLRKSDIFQKLPQKLRETLEAYSVEMKKLAMT  312

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L  + K L +K+EE+R +F +G+QSMRMNYYPPCPE +  +G +PHSDA  LTIL Q+N
Sbjct  313  ILSQMTKALKMKAEEIRDMFSDGVQSMRMNYYPPCPEPDMTIGFAPHSDADALTILFQLN  372

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +T GL+I+K+G W P+ P+PNAFVVN+GD +EI SNGIY+SIEHRA+V+
Sbjct  373  DTEGLQIRKEGRWVPVKPLPNAFVVNIGDIMEIVSNGIYQSIEHRAMVN  421



>ref|XP_007022033.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao]
Length=639

 Score =   339 bits (869),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 209/293 (71%), Gaps = 2/293 (1%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            I M+      G SL VPSVQ+L K +   +P RY+   +E P  + +     +PVIDM+ 
Sbjct  284  IDMDPKVIKYGSSLLVPSVQELAKKSIATIPPRYLRPDLEKPIVSDASLMSEIPVIDMEG  343

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S+ S   EL KL  ACK+WGFF LINHG++ SLVE+VK EIQDFFNLP+EEK++Y Q 
Sbjct  344  LVSKESMDSELAKLDFACKEWGFFQLINHGMSLSLVEKVKTEIQDFFNLPMEEKKKYWQN  403

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
             G+ +GFGQ FVVS+EQKL W D+F+L TLP   R P+LFPKLP  FR T+  YS+E+ K
Sbjct  404  PGEVEGFGQAFVVSDEQKLGWNDMFFLTTLPVYSRKPHLFPKLPLPFRETLNQYSLELEK  463

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+M +L  +AK + +  EEMR  FE  +Q+MRMNYYPPC E E V+G +PHSDA  LTIL
Sbjct  464  LAMAILLQIAKAINMNIEEMREFFEGVLQAMRMNYYPPCGEPEQVIGAAPHSDASALTIL  523

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL++KKDG W P+ P+PN+F+VN+GD +E+ +NG Y SIEHRA V+
Sbjct  524  LQVNEVEGLQVKKDGKWVPVKPLPNSFIVNIGDALEVITNGAYCSIEHRATVN  576


 Score =   295 bits (755),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 196/291 (67%), Gaps = 30/291 (10%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M+  A   G SL VPSVQ+L K +   +P RY+   +E P  + + +   + VIDM+ L 
Sbjct  1    MDPKAVKYGSSLLVPSVQELGKKSIATIPPRYLRPYLEKPIVSDAGSMSEIRVIDMEGLV  60

Query  237  SENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S+ S   EL KL  ACK+WGFF LINHG++ SLVE+VK EIQDFFNLP+EEK++Y Q  G
Sbjct  61   SKESMDSELAKLDFACKEWGFFQLINHGMSLSLVEKVKTEIQDFFNLPMEEKKKYWQFPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            + +GFGQ FVVS+EQKLDW D+F+L TLP   R P+LFPKLP  FR+T+  YS+ + KL+
Sbjct  121  EVEGFGQAFVVSDEQKLDWGDMFFLTTLPVYSRKPHLFPKLPLPFRDTLNQYSLALEKLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M VL  +A                  +++ MN          V+GL+PHSDA GLTILLQ
Sbjct  181  MAVLVQIA------------------EAINMN----------VIGLTPHSDATGLTILLQ  212

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL++KKDG W P+ P+PNAF+VN+GD +EI +NG+YRSIEHRA V+
Sbjct  213  VNEVEGLQVKKDGKWVPVKPLPNAFIVNIGDVLEIITNGVYRSIEHRATVN  263



>ref|XP_009757227.1| PREDICTED: protein SRG1-like isoform X2 [Nicotiana sylvestris]
Length=364

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 206/285 (72%), Gaps = 2/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L  ++   +P+RY+    ESPA +       VPVID++KL S +S  
Sbjct  10   NFGKSLLVPSVQELANEHLTNIPARYVRPEQESPAVSDGTVGPTVPVIDLKKLVSGDSMD  69

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  ++NHGV  S++E  KRE+ + F+L +EEK++  Q EG+ +GFG
Sbjct  70   SELQKLHSACQHWGFLQVVNHGVTPSILENFKREVIELFSLTMEEKKKLWQQEGNHEGFG  129

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVSEEQKLDW+D+FY+ TLP +IR   LF  LP   R+ +E Y  E+  L M +LC 
Sbjct  130  QLFVVSEEQKLDWSDMFYITTLPPHIRQMELFQNLPSNLRDIMEAYCNEIKSLGMIILCQ  189

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EMR LF +G+QS+RMNYYPPCPE +  +G SPHSDA  LTIL Q+NET G
Sbjct  190  LAKALRMDEKEMRELFSDGVQSIRMNYYPPCPEPDRTIGFSPHSDADALTILFQLNETEG  249

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KDG W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  250  LQVRKDGIWVPIKPLPNALIVNIGDIMEIVSNGVYRSIEHRAVVN  294



>ref|XP_009799618.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009799619.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009799620.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
Length=362

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 207/281 (74%), Gaps = 2/281 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--EELQ  260
            +L VPSVQ+L K +   +P+RY+    ESPA     A  +VPVID+++L S +S   ELQ
Sbjct  12   NLLVPSVQELAKQHLTNIPTRYVRPEQESPAIFAGTAVPSVPVIDLKELMSGDSMDSELQ  71

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KLH AC+ WGF  +INHGV  S+VEE KRE+ + F LP+EEK++  Q     +GFG LFV
Sbjct  72   KLHSACQQWGFLQVINHGVTPSVVEEFKREVTELFKLPMEEKKKLWQQGDSYEGFGHLFV  131

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            +SE+QKLDW+D+F + TLP ++R  +LF KLP   R+++E Y  EM  L++ +LC LAK 
Sbjct  132  LSEDQKLDWSDMFGITTLPPHMRKMDLFQKLPPKLRHSMEAYCKEMKSLAISILCQLAKA  191

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L +  +EMR LF +GMQSMRMNYYPPCPE +  +GLSPHSDA GLTIL+Q+NE  GL+++
Sbjct  192  LRMDEKEMRDLFSDGMQSMRMNYYPPCPEPDKTIGLSPHSDADGLTILIQLNEIEGLQVR  251

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W P+ P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  252  KDGVWVPVKPLPNALIVNIGDMMEIVSNGVYRSIEHRAVVN  292



>ref|XP_009376717.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=363

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 207/285 (73%), Gaps = 5/285 (2%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE---  251
            G SLPVPSVQ+LV+     +P RY+    +   S+    A  +P IDMQKL S+ S    
Sbjct  16   GGSLPVPSVQELVQKPILTIPPRYVQPLHQEIISSDH-HAHQIPSIDMQKLLSQESTISE  74

Query  252  -ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             EL +LH AC++WGFF L+NHGV+ SL+E++K E Q+FFNLP+EEK+++ Q  GD +GFG
Sbjct  75   PELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEEKKKFSQQPGDIEGFG  134

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDW+D F L TLP   R P+L PKLP  FR T+ETYS+E+  L+M +L  
Sbjct  135  QSFVVSEDQKLDWSDTFVLTTLPAQRRRPHLLPKLPSPFRETLETYSLELKNLAMTILSQ  194

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + K L +++ E   +FE  +Q++R+NYYPPCP+   V+GL+PHSD G LTILLQVNE  G
Sbjct  195  MEKALQMETNEATNIFEGALQAVRVNYYPPCPQPGKVIGLTPHSDGGALTILLQVNEMDG  254

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  255  LQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  299



>ref|XP_004134919.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004155625.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=358

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 202/280 (72%), Gaps = 3/280 (1%)
 Frame = +3

Query  90   LPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE--ELQK  263
            LPVP VQ+LVK + + VP RY+    + P      A+  VPVIDM KL S N E  EL K
Sbjct  14   LPVPCVQELVKSSLSTVPLRYVRPDQDPPFEFTD-ASAEVPVIDMHKLFSNNFENSELDK  72

Query  264  LHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVV  443
            LH ACKDWGFF +INHGV+  L+E VK  IQ  FNLP+ EK++  Q  GD +GFGQ FVV
Sbjct  73   LHHACKDWGFFQVINHGVSDVLIENVKSGIQSLFNLPMVEKRKLWQRPGDVEGFGQSFVV  132

Query  444  SEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNL  623
            SEEQKL+W D+F +  LPT +R P+LFP LP  FR+ ++ Y++EM  L MK+   +AK L
Sbjct  133  SEEQKLNWGDLFGIFLLPTYLRKPHLFPNLPLPFRDDLDAYTLEMKNLGMKLFDLMAKAL  192

Query  624  GIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
             + S EMR L+EEG+ S RMNYYPPCP+ E VMGL+ HSDA  +TILLQVNE  GL+I+K
Sbjct  193  EMDSSEMRELYEEGVLSTRMNYYPPCPQPELVMGLNNHSDASAITILLQVNEMEGLQIRK  252

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            DG W P+ P+PNAFVVN+GD +EI +NGIYRSIEHRA V+
Sbjct  253  DGRWTPVKPLPNAFVVNIGDILEIITNGIYRSIEHRATVN  292



>ref|XP_006432905.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
 ref|XP_006494091.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR46145.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
Length=359

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 208/291 (71%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA++ ++G SL  PS+ +L  + P + VP RY+   ++ P       +A   PVIDM K
Sbjct  1    MEAESTAIGSSLVEPSILELANNKPLITVPPRYVRPEIDHPLIRNDDSSAQQFPVIDMHK  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGFF L+NHG++ SLVE+V+ EIQDFFNLP++EK ++ Q  G
Sbjct  61   LLSGDDSELEKLDRACKEWGFFQLMNHGMSSSLVEKVRVEIQDFFNLPIDEKTKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDWA  F L + PT++R  +LFPKLP  FR+ +E YS E+  L+
Sbjct  121  DIEGFGQLFIASEEQKLDWAYGFTLISFPTHLRKSHLFPKLPLPFRDDLEVYSTELKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LF  G QS+RMNYYPPCP+ E V+G  PHSD   LTILLQ
Sbjct  181  LKILDQMAKALRMDPNDMKELFGNGRQSLRMNYYPPCPKPEQVLGFKPHSDGAALTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W  + P+P+AF+VN+GD +EIF+NG YRSIEHR  V+
Sbjct  241  INEMDGLQIKKDGKWVAVKPLPDAFIVNIGDALEIFTNGTYRSIEHRVTVN  291



>ref|XP_009757223.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
Length=378

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 206/285 (72%), Gaps = 2/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L  ++   +P+RY+    ESPA +       VPVID++KL S +S  
Sbjct  24   NFGKSLLVPSVQELANEHLTNIPARYVRPEQESPAVSDGTVGPTVPVIDLKKLVSGDSMD  83

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  ++NHGV  S++E  KRE+ + F+L +EEK++  Q EG+ +GFG
Sbjct  84   SELQKLHSACQHWGFLQVVNHGVTPSILENFKREVIELFSLTMEEKKKLWQQEGNHEGFG  143

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVSEEQKLDW+D+FY+ TLP +IR   LF  LP   R+ +E Y  E+  L M +LC 
Sbjct  144  QLFVVSEEQKLDWSDMFYITTLPPHIRQMELFQNLPSNLRDIMEAYCNEIKSLGMIILCQ  203

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EMR LF +G+QS+RMNYYPPCPE +  +G SPHSDA  LTIL Q+NET G
Sbjct  204  LAKALRMDEKEMRELFSDGVQSIRMNYYPPCPEPDRTIGFSPHSDADALTILFQLNETEG  263

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KDG W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  264  LQVRKDGIWVPIKPLPNALIVNIGDIMEIVSNGVYRSIEHRAVVN  308



>gb|KEH27885.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=358

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 207/284 (73%), Gaps = 2/284 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQSENSE-  251
            LG SL VPSVQ+LVK     VP RY+    +      S  ++  VPVID+ KL SE  E 
Sbjct  9    LGSSLLVPSVQELVKQPITKVPERYLQQNQDPSLVVSSTKSLPQVPVIDLSKLLSEEDET  68

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            ELQKL  ACK+WGFF LINHGVN  LVE  K+ +QDFFNLP+EEK+   Q  G+ +GFGQ
Sbjct  69   ELQKLDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEEKKILSQKPGNIEGFGQ  128

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
            LFVVSE+ KL+WAD+F++ T P+ +R+P LFP +P+ FR ++E YS+ + KL + ++ F+
Sbjct  129  LFVVSEDHKLEWADLFHIITHPSYMRNPQLFPSIPQPFRESLEMYSLVLKKLCVMIIEFM  188

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            +K L I+  E+   FEEG QSMRMNYYPPCP+ + V+GL+PHSD   LTILLQ+NE  GL
Sbjct  189  SKALKIQKNELLEFFEEGGQSMRMNYYPPCPQPDKVIGLNPHSDGTALTILLQLNEIEGL  248

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKKDG W PI P+ NAFV+N+GD +EI +NGIYRSIEHRA ++
Sbjct  249  QIKKDGMWIPIKPLTNAFVINIGDMLEIMTNGIYRSIEHRATIN  292



>gb|KHN29925.1| Protein SRG1-like protein [Glycine soja]
Length=354

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 205/281 (73%), Gaps = 0/281 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G S  VPSVQ+L K     VP RY+H   +    + +I+   VP+ID+ +L SE+  EL+
Sbjct  5    GTSCLVPSVQELAKQPIIEVPERYVHANQDPHILSNTISLPQVPIIDLHQLLSEDPSELE  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KL  ACK+WGFF LINHGV+  +VE +K  +Q+FFNLP+EEKQ++ Q   D  GFGQLFV
Sbjct  65   KLDHACKEWGFFQLINHGVDPPVVENMKIGVQEFFNLPMEEKQKFWQTPEDMQGFGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSEEQKL+WAD+FY  T P + R+P+L PK+P+ FR  +E Y +E+ K+ + ++  + K 
Sbjct  125  VSEEQKLEWADMFYAHTFPLHSRNPHLIPKIPQPFRENLENYCLELRKMCITIIGLMKKA  184

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L IK+ E+  LFE+  Q +RMNYYPPCP+ E V+G++PHSD+G LTILLQVNE  GL+I+
Sbjct  185  LKIKTNELSELFEDPSQGIRMNYYPPCPQPERVIGINPHSDSGALTILLQVNEVEGLQIR  244

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W P+ P+ NAFV+NVGD +EI +NGIYRSIEHR +V+
Sbjct  245  KDGKWIPVKPLSNAFVINVGDMLEILTNGIYRSIEHRGIVN  285



>ref|XP_009376708.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=367

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 211/291 (73%), Gaps = 10/291 (3%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYI--HDGVESPASAKSI----AAVNVPVIDMQKLQSE  242
            G SL VPSVQ+ VK     +P+RY+  HD   +      I     A  +P IDMQKL S+
Sbjct  13   GGSLHVPSVQEFVKKPILTIPTRYLQPHDQDGNQEHEMIINSDHHAPQIPSIDMQKLLSQ  72

Query  243  NS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
             S     EL +LH ACK+WGFF ++NH V+ S++E++K E Q+FFNLP+EEK+++ Q  G
Sbjct  73   ESTDSEAELARLHFACKEWGFFQMVNHDVSSSVLEKMKTETQEFFNLPMEEKKKFSQQPG  132

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FVVSE+QKLDW+D+F+L TLP  +R P+L PKLP  FR T+ETYS E+  L+
Sbjct  133  DIEGFGQAFVVSEDQKLDWSDIFFLTTLPVQLRKPHLLPKLPSPFRETLETYSSELKNLA  192

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  + K L ++++E+  +FE G+Q++R+NYYPPCP+   V+GL+PHSD G LTILLQ
Sbjct  193  MAILSQMEKALQMEAKEVTNIFEGGLQAVRVNYYPPCPQPGKVLGLTPHSDGGALTILLQ  252

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL++KKDG W P+ P+P+AF+VN+GD +EI +NG YRSIEHRA V+
Sbjct  253  VNEMDGLQVKKDGIWVPVKPLPDAFIVNIGDVLEIITNGTYRSIEHRATVN  303



>ref|XP_010095129.1| Protein SRG1 [Morus notabilis]
 gb|EXB58295.1| Protein SRG1 [Morus notabilis]
Length=367

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/298 (55%), Positives = 213/298 (71%), Gaps = 8/298 (3%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPNV--VPSRYIHDGVESPASAKSIAAV-NVPVID  221
            +A       LG SL VPSVQ+L K+   +  VP RY+    + P    +I ++  VPVID
Sbjct  1    MAEATSIAKLGGSLAVPSVQELAKETTTLKAVPERYVRRD-QDPTFIPNITSLPQVPVID  59

Query  222  MQKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQ  389
            M  L S   +    ELQKLHLA K+WGFF LINHGV+  +VE VK  I++ FNLP+EEK+
Sbjct  60   MNNLLSLEKDVLQSELQKLHLASKEWGFFQLINHGVSSLVVEGVKTGIKELFNLPMEEKK  119

Query  390  RYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYS  569
            ++ Q  GD +GFGQ FVVS++QKLDWAD F+L TLP + R P+L  K    FR +IETYS
Sbjct  120  KFWQQPGDMEGFGQAFVVSDDQKLDWADTFHLFTLPKHFRKPHLLAKFHPQFRYSIETYS  179

Query  570  VEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAG  749
             E+ K++  +L  +AK L ++  EMR LF+ G Q++RMNYYPPCP+++ V+GL+PHSDA 
Sbjct  180  AELEKIANTILDLMAKALKMEPHEMRELFDNGGQTLRMNYYPPCPQADLVIGLNPHSDAT  239

Query  750  GLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GLTILLQ+NET GL+I+KDG W P+ P+PNAF+VNVGD +EI +NGIYRSIEHRA V+
Sbjct  240  GLTILLQINETEGLQIRKDGMWIPVKPLPNAFIVNVGDILEILTNGIYRSIEHRATVN  297



>ref|XP_006355572.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/285 (56%), Positives = 203/285 (71%), Gaps = 5/285 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K +   +P+RY+H   ESP  +   A  +VPVID+QKL S +S  
Sbjct  9    NFGKSLLVPSVQELAKQHLTNIPARYVHPEEESPVIS---AGASVPVIDVQKLISRDSMD  65

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  +INHGV  SL+E+ KRE+ + F LP+EEK++  Q E   +GFG
Sbjct  66   SELQKLHSACQQWGFLQVINHGVTPSLLEDFKREVIELFKLPIEEKKKLWQQEDSFEGFG  125

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
              FVVSEEQKLDW+D+F + TLP  IR  +LF  LP   R+ +E YS EM  L+  ++C 
Sbjct  126  NAFVVSEEQKLDWSDMFAIMTLPPYIRKEDLFQNLPSKLRDIMEAYSKEMKNLARIIVCQ  185

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  EEMR LF +GMQSMRMNYYPPCPE +  +GLS HSD   LTIL Q+NET G
Sbjct  186  LAKALRMDEEEMRDLFSDGMQSMRMNYYPPCPEPDRAIGLSSHSDPDALTILFQLNETEG  245

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KD  W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  246  LQVRKDDVWVPIEPLPNALIVNIGDMMEIVSNGVYRSIEHRAIVN  290



>ref|XP_008226353.1| PREDICTED: protein SRG1-like [Prunus mume]
Length=363

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 206/291 (71%), Gaps = 12/291 (4%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIA------AVNVPVIDMQKLQSE  242
            G SL VPSVQ+L K     +P RYI      P     +          +P IDMQKL S+
Sbjct  11   GGSLIVPSVQELAKKPITAIPPRYIQP--HHPEQQDHVMFNPDHDHAEMPFIDMQKLLSQ  68

Query  243  NS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
             S     EL +LH ACK+WGFF L+NHGV+ SLV++VK E QDFFNL +E+K++  Q  G
Sbjct  69   ESTDSESELARLHFACKEWGFFQLVNHGVSSSLVDKVKTESQDFFNLAMEDKKKLWQTPG  128

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ FVVSE+QKLDWAD+F++ TLP  +R P+LFP +P  FR T+E YS+E+  L+
Sbjct  129  DVEGFGQAFVVSEDQKLDWADIFFMTTLPVEMRRPHLFPNVPSPFRETLEVYSLELKNLA  188

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  +   L ++++E+  LFE+GMQSMRMNYYP CP    V+GL+PHSD+ GLTILLQ
Sbjct  189  MTILSQMETALQMEAKEVTKLFEDGMQSMRMNYYPRCPLPAEVIGLTPHSDSVGLTILLQ  248

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+++KDG W P+ P+P+AF+VN+GD +EI +NGIYRSIEHRA V+
Sbjct  249  VNEMDGLQVRKDGIWVPVKPLPDAFIVNIGDILEIQTNGIYRSIEHRATVN  299



>gb|KDP47183.1| hypothetical protein JCGZ_25692 [Jatropha curcas]
Length=344

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/283 (54%), Positives = 207/283 (73%), Gaps = 6/283 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEE  254
            +LG SL VPSVQ+L K   +V+P RYI    +S      ++ + +PV+DMQKL S+ SE 
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESDS-----GVSVMEIPVVDMQKLLSQESE-  56

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
            L KLH AC+ WGFF L+NH V  SL+E++K+E++D FNL +EEK+++ Q  G+ +GFGQ 
Sbjct  57   LDKLHYACRHWGFFQLVNHEVEYSLLEKIKKEVKDLFNLSMEEKKKFWQYPGEVEGFGQA  116

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSE+QKLDW D+F++ T P + R P+LFP  P   R+T++TYS  +  L+M +L  +A
Sbjct  117  FVVSEDQKLDWGDLFFMVTQPIHARKPHLFPNFPLPLRDTLDTYSTAVKNLAMVILAHMA  176

Query  615  KNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLE  794
            K L ++ +EM+ +FE+G QSMRMNYYPPC + + V+GL+PHSDA GLTILLQVNE  GL+
Sbjct  177  KALHMEVDEMKEIFEDGHQSMRMNYYPPCLQPDKVIGLTPHSDASGLTILLQVNEVEGLQ  236

Query  795  IKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IKKD  W  + P PNAF++NVGD +EI +NG Y SIEHRA V+
Sbjct  237  IKKDNKWLSVKPFPNAFIINVGDILEIVTNGTYSSIEHRATVN  279



>ref|XP_006452693.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
 gb|ESR65933.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
Length=359

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 208/291 (71%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA+A  +  SL  PS+ +L  + P + +P RY+   ++ P       +A  +PVIDM K
Sbjct  1    MEAEATDIRSSLVEPSILELAHNKPLITIPPRYVRPEMDHPLIRTDDSSAQQLPVIDMHK  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGF  L+NHGV+ SLVE+VK EIQDFFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDRACKEWGFCQLMNHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F L T PT++R P+LFPKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFITSEEQKLDWGYGFTLTTFPTHLRKPHLFPKLPLPFRDDLEVYLTELKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE GMQ +RMNYYPPCP+ E V+G + H DA  LT+LLQ
Sbjct  181  LKILDQMAKALRMDPNDMKELFENGMQLLRMNYYPPCPQPEQVVGHNSHCDAAALTVLLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+IKKDG W  + P+P+AFVVN+GD +EIF+NG YRSIEHRA V+
Sbjct  241  VNEMDGLQIKKDGKWVAVKPLPDAFVVNIGDALEIFTNGTYRSIEHRATVN  291



>gb|AGL52586.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=373

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 214/289 (74%), Gaps = 7/289 (2%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYI---HDGVESPASAKSIAAVNVPVIDMQKLQSE--  242
            LG SL VPSVQ+L K +   VP+RYI    D +    +  S+   +VPVID+QK+ S   
Sbjct  9    LGGSLLVPSVQELAKQSLAEVPARYIRTDQDTLGDNVTVTSMIDQSVPVIDLQKVLSPEP  68

Query  243  --NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
                 EL++LH ACK+WGFF ++NHGV+  LVE+VK +I+ FF LP++EK+++ Q EGD 
Sbjct  69   IIGELELERLHSACKEWGFFQVVNHGVDNLLVEKVKSDIEGFFKLPMDEKKKFWQEEGDI  128

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +GFGQ FV SE+QKLDWAD+FY+  LP ++R   LFPKLP   R T+E+Y  E++KLS+ 
Sbjct  129  EGFGQAFVHSEDQKLDWADMFYMLILPKHMRKLRLFPKLPLPLRETLESYLSELNKLSLA  188

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            ++  + K L +K+  M  LFE+G+Q +R+NYYPPCP++EHV+GL+PHSD GGLTILLQ+N
Sbjct  189  LIKSMEKALQMKTNVMAELFEDGIQQVRINYYPPCPQTEHVIGLTPHSDPGGLTILLQLN  248

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            E  GL+I+K+  W PI P+PNAFVVN+GD  EI SNGIYRS+EHRA+V+
Sbjct  249  EVHGLQIRKEKIWVPIKPLPNAFVVNLGDAFEIMSNGIYRSVEHRAIVN  297



>ref|XP_008345138.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=368

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 207/298 (69%), Gaps = 11/298 (4%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-------VPVID  221
            A     G SL VPSVQ+LVK     +P RYI    +     +    +N       +P ID
Sbjct  15   AGKSMYGGSLLVPSVQELVKKPIVKIPPRYIQPHHQDGNYQEHDMNINSEHLADQIPSID  74

Query  222  MQKLQSENS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQ  389
            M KL S  S     EL +LH ACK+WGFF L+ HGV+ SL+E++K E Q+FFNLP+EEK+
Sbjct  75   MHKLLSXESTXSEAELARLHFACKEWGFFQLVXHGVSSSLLEKMKTETQEFFNLPMEEKK  134

Query  390  RYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYS  569
            ++ Q  GD +GFGQ F++SE QKLDW D+F+L TLP  +R P+LFP LP  FR T+ETYS
Sbjct  135  KFWQQPGDVEGFGQAFIISENQKLDWVDMFFLNTLPVQMRRPHLFPNLPSPFRETLETYS  194

Query  570  VEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAG  749
            +E+  L+M +L  + K L ++ +E+  LFE+G+Q+ RMNYYPPCP+ E V+GL+PHSD  
Sbjct  195  LELKNLAMTILSHIEKALQMEXKEVTKLFEDGLQATRMNYYPPCPQPEAVIGLTPHSDPV  254

Query  750  GLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GLT+LLQVNE  GL++K+DG W PI P+P AFVVN+GD +EI +NG YRSIEHRA V+
Sbjct  255  GLTVLLQVNEMDGLQVKRDGIWVPIKPLPXAFVVNIGDILEILTNGTYRSIEHRATVN  312



>gb|KEH27901.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 202/281 (72%), Gaps = 0/281 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G SL VPSVQ+LVK     +P RY+H   +  A + + +   VPVID+ KL S+++ ELQ
Sbjct  5    GTSLLVPSVQELVKQPITNIPERYLHPNQDPIAVSNTSSLPQVPVIDLHKLLSDDATELQ  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
                AC+ WGFF LINHGVN  +VE +K  ++ F  LP+EEK+++ Q   D  GFGQLFV
Sbjct  65   NFDHACRGWGFFQLINHGVNTPIVENMKIGVEQFLKLPMEEKKKFWQTPNDVQGFGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VS+EQKL+WAD+FY+ T P + R P+L P +P+ FR+ +E Y +E+ KL++ ++  + K 
Sbjct  125  VSDEQKLEWADMFYINTFPPDARHPHLIPNIPKPFRDHLENYCLELKKLAVTIIGRMEKA  184

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L IKS E+   FE+  Q MRMNYYPPCP+ EHV+GL PHSD+G LTILLQVNE  GL+I+
Sbjct  185  LKIKSNELVEFFEDIYQGMRMNYYPPCPQPEHVIGLKPHSDSGALTILLQVNEVEGLQIR  244

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W PI P+ +AFVVN+GD +EI +NGIYRSIEHRA ++
Sbjct  245  KDGMWIPIKPLSDAFVVNIGDMLEILTNGIYRSIEHRATIN  285



>ref|XP_004233001.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=354

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 204/285 (72%), Gaps = 5/285 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K     +P+RY+    E P      A   VPVID+QKL S +S  
Sbjct  9    NFGKSLLVPSVQELSKQRLTNIPARYVRSEQEPPVIN---AGEAVPVIDLQKLISGDSMD  65

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  +INHGV  SL+E+ KRE+ +FF LP+EEK++  Q E + +GFG
Sbjct  66   SELQKLHFACQQWGFLQVINHGVTPSLLEDFKREVIEFFGLPMEEKKKLWQQEDNHEGFG  125

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVSEEQKLDW+D+FY+ TLP++IR  +LF KL    R  +E Y  E+  L+M +LC 
Sbjct  126  QLFVVSEEQKLDWSDMFYITTLPSHIRQMDLFQKLHSKLREIMEAYCNEIKNLAMIILCQ  185

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EMR LF +G+QS+RMNYYPPCP  E  +G SPHSDA  LT+L Q+NET G
Sbjct  186  LAKALRMDEKEMRELFSDGVQSIRMNYYPPCPAPEKTIGFSPHSDADALTVLFQLNETAG  245

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KDG W  + P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  246  LQVRKDGVWVTVKPLPNALIVNIGDIMEIVSNGVYRSIEHRAIVN  290



>ref|XP_009610870.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
 ref|XP_009610871.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=364

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 205/285 (72%), Gaps = 2/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K++   +P+RY+    ES A +       VPVID++KL S +S  
Sbjct  10   NFGKSLLVPSVQELAKEHLTNIPARYVRPEQESQAISDEAVGPIVPVIDLKKLISGDSMD  69

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH  C+ WGF  +INHGV  S++E  KRE+   F LP+EEK++  Q E + +GFG
Sbjct  70   SELQKLHSTCQQWGFLQVINHGVTPSILENFKREVIQLFRLPMEEKKKLWQQEDNHEGFG  129

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QLFVVS+EQKLDW+D+FYL TLP +IR  +LF KLP   R+ +E Y  E+  L+M +L  
Sbjct  130  QLFVVSDEQKLDWSDMFYLTTLPPHIRQMDLFQKLPSNLRDIMEAYCKEIKSLAMIILSQ  189

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EMR LF +G+QS+RMNYYPPCPE +  +G SPHSDA  LTIL Q+NET G
Sbjct  190  LAKALSMDEKEMRELFSDGVQSIRMNYYPPCPEPDKTIGFSPHSDADALTILFQLNETEG  249

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KDG W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  250  LQVRKDGIWVPIKPLPNALIVNIGDIMEIVSNGVYRSIEHRAVVN  294



>ref|XP_010027975.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW54630.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=364

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 211/286 (74%), Gaps = 3/286 (1%)
 Frame = +3

Query  69   AQSLGLSLPVPSVQQLVKDNPNVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQKLQSEN  245
            A + G S+ VPSVQ+L +     +P RY+     E P S    A+ +VPV+D+Q+L   +
Sbjct  14   AVNFGRSIIVPSVQELARKPIVNLPPRYVRCSDDEDPVSGD--ASESVPVVDVQRLARGD  71

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
              EL+KLH ACKDWGFF ++NHGV+  L+EE K+EI+ FF+L  EEKQ+  Q   + +GF
Sbjct  72   PVELEKLHFACKDWGFFQVVNHGVSVLLLEEFKQEIKSFFDLSYEEKQKLWQQPENHEGF  131

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQL VVSEEQKLDW+D+FY+ TLP  +R  +LF KLPE  RN +E YS+E+ KL++ +L 
Sbjct  132  GQLLVVSEEQKLDWSDMFYITTLPLGLRKADLFEKLPENLRNKLEEYSLEVKKLALLILG  191

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
             +A+ L +++EE+R +F +G+QSMRMNYYPPCPE +  +G +PHSDA  LTIL Q+NET 
Sbjct  192  HMARALKMEAEEIREMFGDGVQSMRMNYYPPCPEPDMTIGFTPHSDAVALTILFQLNETV  251

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+IK++G W P+ P+ NAFVVN+GD +EIFSNGIYRSIEHRA V+
Sbjct  252  GLQIKREGRWVPVKPLHNAFVVNIGDIMEIFSNGIYRSIEHRATVN  297



>ref|XP_002519769.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42742.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=363

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/293 (54%), Positives = 217/293 (74%), Gaps = 5/293 (2%)
 Frame = +3

Query  54   AMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPA-SAKSIAAVNVPVIDMQK  230
            ++EAD  + G S+ VPSVQ+L K +   +P+RY     +SP  S   ++ + VPVID+ +
Sbjct  4    SLEAD--NFGKSIIVPSVQELAKASLIEIPTRYARLNQDSPIISGDGLSHLCVPVIDLDR  61

Query  231  LQSENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L + +S   EL++LHLAC++WGFF L+NHGV+ +L+E  K E ++FF LP EEK++  Q 
Sbjct  62   LNAGDSVDLELERLHLACREWGFFQLVNHGVSTTLLEVFKLETENFFKLPYEEKKKLWQQ  121

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQLFVVS+EQKLDW+D+FY+ TLP N+R  +LF KLP   R T+ETYS E+ K
Sbjct  122  PENHEGFGQLFVVSDEQKLDWSDMFYITTLPFNLRKDDLFNKLPPNLRETLETYSNEVKK  181

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L++ +L  +AK L +  +E++ LF +G+QSMRMNYYPPCPE E  +G +PHSDA  LTIL
Sbjct  182  LAIGILGHMAKALKMDEKELKELFSDGVQSMRMNYYPPCPEPEKAIGFTPHSDADALTIL  241

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             Q+NET GL+I+K+G W  I P+PNAFVVN+GD +EI SNG+YRSIEHRA+V+
Sbjct  242  FQLNETEGLQIRKEGRWVSIKPLPNAFVVNIGDIMEIVSNGVYRSIEHRAIVN  294



>ref|XP_010057196.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=279

 Score =   322 bits (826),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 202/278 (73%), Gaps = 6/278 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV--NVPVIDMQK  230
            ME +   LG SLPVP VQ+L K+    VP RY+    + P       ++   VPVIDM K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  231  LQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S + +    EL+KLH+AC+DWGFF LINHGV C+LVEEVK  IQ+FF LP+EEK+++ 
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFFQLINHGVRCTLVEEVKLGIQEFFKLPMEEKRKFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q EGD +GFGQ+FV SEEQKLDWAD+F++ +LP ++R P+LFP LP  FR  ++ YS E+
Sbjct  121  QEEGDVEGFGQMFVGSEEQKLDWADLFFMASLPRHLRKPHLFPMLPSPFREVLDEYSSEL  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+MK+L  +AK L ++ ++M  LF+EG Q++RMNYYPPCP  E V GL+PHSD+ GLT
Sbjct  181  RDLAMKILLLMAKALQMEPKDMIELFDEGRQALRMNYYPPCPRPELVTGLTPHSDSTGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVE  872
            ILLQVNE  GL+++K+G W  + P+PNAFVVNVGD +E
Sbjct  241  ILLQVNEMEGLQVRKEGKWVSVKPLPNAFVVNVGDILE  278



>ref|XP_003518805.1| PREDICTED: protein SRG1 [Glycine max]
Length=354

 Score =   325 bits (833),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 204/281 (73%), Gaps = 0/281 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G S  VPSV +L K     VP RY+H   +    + +I+   VP+ID+ +L SE+  EL+
Sbjct  5    GTSCLVPSVLELAKQPIIEVPERYVHANQDPHILSNTISLPQVPIIDLHQLLSEDPSELE  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KL  ACK+WGFF LINHGV+  +VE +K  +Q+FFNLP+EEKQ++ Q   D  GFGQLFV
Sbjct  65   KLDHACKEWGFFQLINHGVDPPVVENMKIGVQEFFNLPMEEKQKFWQTPEDMQGFGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSEEQKL+WAD+FY  T P + R+P+L PK+P+ FR  +E Y +E+ K+ + ++  + K 
Sbjct  125  VSEEQKLEWADMFYAHTFPLHSRNPHLIPKIPQPFRENLENYCLELRKMCITIIGLMKKA  184

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L IK+ E+  LFE+  Q +RMNYYPPCP+ E V+G++PHSD+G LTILLQVNE  GL+I+
Sbjct  185  LKIKTNELSELFEDPSQGIRMNYYPPCPQPERVIGINPHSDSGALTILLQVNEVEGLQIR  244

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W P+ P+ NAFV+NVGD +EI +NGIYRSIEHR +V+
Sbjct  245  KDGKWIPVKPLSNAFVINVGDMLEILTNGIYRSIEHRGIVN  285



>ref|XP_011085296.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=356

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 205/293 (70%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH--DGVESPASAKSIAAVNVPVIDMQK  230
            M+     LG SLPVP VQ+L K+    VP RY+       +  SA + +   +PVIDMQK
Sbjct  1    MDPKLTKLGSSLPVPIVQELAKEKLATVPPRYVRPDQHQHTILSALNSSFPQIPVIDMQK  60

Query  231  LQS--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
                     ELQ LH AC++WGFF LINHGV  +++E++K EIQ+FFNLP+EEK++    
Sbjct  61   FSDIYTMDSELQALHNACQEWGFFQLINHGVGSAVMEKMKIEIQEFFNLPIEEKKKLKHE  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            EGD  G+GQ FVVSE+QKLDW D+F + T P  +R P+L  KLP  FR+  E Y+ E+  
Sbjct  121  EGDIQGYGQAFVVSEDQKLDWGDMFAIVTSPIYLRKPHLIAKLPATFRDATEVYASELKV  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            L+MK+L  +AK L +K+EEM  LF EGM SMRMNYYPPCP+ E V GL PHSDA GLTIL
Sbjct  181  LAMKILKLMAKALDMKAEEMETLFAEGMHSMRMNYYPPCPQPELVTGLCPHSDADGLTIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+IKKDG W P+ P+PNAFV+N+GD +EI +NG YRSIEHRA V+
Sbjct  241  LQVNEMEGLQIKKDGVWIPVSPLPNAFVINIGDNLEILTNGAYRSIEHRATVN  293



>gb|KDP21180.1| hypothetical protein JCGZ_21651 [Jatropha curcas]
Length=362

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/290 (54%), Positives = 211/290 (73%), Gaps = 4/290 (1%)
 Frame = +3

Query  66   DAQSLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESPA-SAKSIAAVNVPVIDMQKLQS  239
            +A + G S+ VPSVQ LV+    V +P RY     + P  S+      +VPVID+QKL +
Sbjct  7    EAVNFGRSIIVPSVQNLVEKESLVKIPPRYARSEQDCPIISSDGSLTSSVPVIDLQKLVA  66

Query  240  ENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD  413
             +S   E ++L  AC++WGFF ++NHGV+ +L+E+ K E ++FF LP EEK++  Q   +
Sbjct  67   GDSIDSESKRLDAACREWGFFQIVNHGVDTNLLEDFKLETKNFFKLPYEEKKKLWQQPDN  126

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQLFVVSEEQKLDW+D+FY+ TLP ++R  +LF KLP + R ++ETY  EM KL+M
Sbjct  127  HEGFGQLFVVSEEQKLDWSDMFYVTTLPQHLRKVDLFDKLPLSLRESLETYGSEMRKLAM  186

Query  594  KVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQV  773
             +LC +AK L +  EEM+ LF +G+QSMRMNYYPPCPE E  +G +PHSDA  LTILLQ+
Sbjct  187  AILCHMAKALKMDVEEMKELFSDGVQSMRMNYYPPCPEPEKAIGFTPHSDADALTILLQL  246

Query  774  NETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            NET GL+I+KDG W P+ P+PNAFVVN+GD ++I SN +YRSIEHRA V+
Sbjct  247  NETEGLQIRKDGKWIPVKPLPNAFVVNIGDIMQIVSNCVYRSIEHRATVN  296



>gb|KDP21184.1| hypothetical protein JCGZ_21655 [Jatropha curcas]
Length=369

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 212/293 (72%), Gaps = 5/293 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKL  233
            MEA ++ LG ++ VPSV++L K+    +P RY+H   + P++     ++  +PVIDM KL
Sbjct  7    MEAKSR-LGSTVLVPSVKELAKEQFISIPPRYVHHDQQPPSTVIDTNSLPQIPVIDMAKL  65

Query  234  QSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             S+     ELQK H AC+DWGFF L+NHGV+  L+E+VK E + FFNLP+E+K++  Q  
Sbjct  66   LSQEFMDSELQKFHHACRDWGFFQLVNHGVSTELLEKVKVETEKFFNLPMEKKEKLWQKA  125

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            G+ +GFGQ FV SEEQKL+WAD+FY+ TLP   R P+LF   P +FR+TIE YS E+  +
Sbjct  126  GEIEGFGQHFVNSEEQKLEWADLFYVVTLPPRSRKPHLFDNFPPSFRDTIEAYSEELQGV  185

Query  588  SMKVLCFLAKNLGI-KSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            + K+   + K LGI + + +R LFEEG Q+MRMNYYP CP+ + V+GL PHSDA GLTIL
Sbjct  186  ANKIFKLVIKALGIMEVDYIRELFEEGWQAMRMNYYPSCPQPDLVIGLKPHSDATGLTIL  245

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             Q+N+  GL+IKKDG W P+ PIPNAF++N+GD +EI +NGIYRSIEHRA +S
Sbjct  246  FQLNDIVGLQIKKDGLWIPVKPIPNAFIINIGDMLEIVTNGIYRSIEHRATIS  298



>gb|KHF98196.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=362

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 216/291 (74%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            M+ +  +LG S+ VPSVQ+L K     +P+RY+    E  + + +    +VP+ID+ KL 
Sbjct  1    MDTEFVNLGKSMIVPSVQELAKYPLTKIPARYLRMHEELHSISPNHHLPSVPIIDLHKLA  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            + +    ELQ LH AC+ WGFF ++NHGV+ SL++E K EI +FF LP E+K+   Q   
Sbjct  61   AGDFVDSELQTLHAACRHWGFFQVVNHGVSISLLDEFKLEIVNFFKLPHEDKKLLWQKPD  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            + +GFGQ FVVS++QKLDW+D+FY+ TLP N+R+ ++F KLP   R T+E YSV++  L+
Sbjct  121  NHEGFGQAFVVSQDQKLDWSDMFYITTLPYNLRNVDVFEKLPFKLRETLEVYSVQVKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M++L ++AK L + ++E+++LF +G+Q+MRMNYYPPCPE + V+G SPHSDA  LTIL Q
Sbjct  181  MRILGYMAKALNMDADEIKVLFNDGVQAMRMNYYPPCPEPDMVIGFSPHSDADALTILFQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++ET GL+++KDG W PI+P+PNAFVVN+GD +EI SNGIYRSIEHRA+V+
Sbjct  241  LDETDGLQVRKDGKWVPIMPLPNAFVVNIGDIMEILSNGIYRSIEHRAVVN  291



>ref|XP_004490334.1| PREDICTED: protein SRG1-like isoform X1 [Cicer arietinum]
Length=354

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 202/281 (72%), Gaps = 0/281 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G SL VPSVQ+LVK     +P RY+H   +    + + +   VPVID+ KL S ++ ELQ
Sbjct  5    GTSLLVPSVQELVKQPITKIPERYVHPNQDPIVVSNTTSLPQVPVIDLHKLFSHDTIELQ  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KLH +C +WGFF LINHGV+ SLVE +K  +Q FFNL +EEK+++ Q   + +GFGQLFV
Sbjct  65   KLHHSCTEWGFFQLINHGVDPSLVENMKIGVQKFFNLSMEEKKKFWQTPNNMEGFGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VS+EQKL+WAD+FY+ T P   R P+L P + + FR+ +E YS+E+  L +K++  + K 
Sbjct  125  VSDEQKLEWADMFYVSTFPLYSRHPHLIPSISQPFRDHLELYSLELKNLCIKIIGHMEKA  184

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L IK+ E+   FE+  Q M+MNYYPPCP+ E V+G +PHSDAG LTILLQVNE  GL+IK
Sbjct  185  LKIKTNELVEFFEDAGQGMKMNYYPPCPQPEQVIGHNPHSDAGALTILLQVNEMEGLQIK  244

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W PI P+ NAFV+N+GD +EI +NG YRSIEHRA V+
Sbjct  245  KDGMWIPIKPLSNAFVINIGDMLEILTNGTYRSIEHRATVN  285



>ref|XP_003516325.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN03628.1| Protein SRG1 [Glycine soja]
Length=350

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/282 (55%), Positives = 206/282 (73%), Gaps = 2/282 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G SL VPSV +LVK     VP +Y+H   + P    +     VPVID+ KL SE+  EL+
Sbjct  5    GTSLLVPSVHELVKQPITKVPDQYLHPN-QDPPDISNTTLPQVPVIDLSKLLSEDVTELE  63

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KL  ACK+WGFF LINHGVN S+VE VKR++Q+F NLP+E+K+++ Q   + +GFGQLFV
Sbjct  64   KLDDACKEWGFFQLINHGVNPSMVENVKRDVQEFLNLPMEKKKQFWQIPDELEGFGQLFV  123

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSE+QKL+WAD+F++ TLP N R+  LFP  P+  R+ IE YS ++ KL + ++  +A  
Sbjct  124  VSEDQKLEWADMFFIHTLPINARNLRLFPNFPQPLRDNIENYSSQLKKLCLTIIERMAMA  183

Query  621  LGIKSEE-MRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
            L I+S E +  +FE+  Q+MR  YYPPCP+ E+V+G++PHSDA  LTILLQ NET GL+I
Sbjct  184  LKIESNELLDYVFEDVFQTMRWTYYPPCPQPENVIGINPHSDACALTILLQANETEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKDG W P+ P+PNAFV+NVGD +EI +NGIYRSIEHRA ++
Sbjct  244  KKDGNWIPVKPLPNAFVINVGDILEILTNGIYRSIEHRATIN  285



>ref|XP_006477892.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=272

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 194/264 (73%), Gaps = 2/264 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--E  251
            +G SL VP VQ+LVK+   VVP RYI    +SP ++       +PVIDMQ L SE S   
Sbjct  4    IGGSLLVPCVQELVKNPMLVVPPRYICPDEDSPLNSDDTLISQIPVIDMQSLLSEESMDS  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL KL  ACK+WGFF L+NHGV+ + +E+VK+E++ FFNL +EEK++Y Q  GD +GFGQ
Sbjct  64   ELAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F + TLP ++R P+LFPKLP   R+T+E YS+E+  L+M ++  +
Sbjct  124  AFVVSEEQKLDWADIFSVITLPVHLRKPHLFPKLPPLLRDTLEVYSMELKSLAMNLISKM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             K L IK EE+R  F+ G QSMRMNYYPPCP+ E VMGL+PHSD   LTILLQ+NE  GL
Sbjct  184  GKVLNIKDEELREFFDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGD  863
            +IK DG W PI P+PNAF+VN+GD
Sbjct  244  QIKNDGKWIPITPLPNAFIVNIGD  267



>ref|XP_003614575.1| SRG1-like protein [Medicago truncatula]
 gb|AES97533.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=355

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 205/280 (73%), Gaps = 1/280 (0%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQKL  266
            S+ VPSVQ+L+K     +P RY H   ++     + +  +VP+ID+ KL S++S EL+KL
Sbjct  7    SIIVPSVQELIKQPITEIPERYFHSNQDTIVVTNTTSLPHVPIIDLHKLLSDDSAELEKL  66

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQR-YGQAEGDTDGFGQLFVV  443
               CK+WGFF LINHGVN SLVE +K  ++ FFNLP+EEK++ + Q   D  GFGQLFVV
Sbjct  67   DQTCKEWGFFQLINHGVNTSLVENMKIGVEQFFNLPMEEKKKKFWQTPNDIQGFGQLFVV  126

Query  444  SEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNL  623
            SEEQKL+WAD+FY+ TLP + R  +L P +P  FR+ +E Y + + KL++ ++  + K L
Sbjct  127  SEEQKLEWADMFYINTLPLDSRHQHLIPSIPTPFRDHLENYCLVVKKLAITIIGRMEKAL  186

Query  624  GIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
             IKS E+  LF++  Q MRMNYYPPCP+ E+V+GL+PHSD G LTILLQ N+  GL+I+K
Sbjct  187  KIKSNELVELFDDINQGMRMNYYPPCPQPENVIGLNPHSDMGMLTILLQANDIEGLQIRK  246

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            DG W P+ P+PNAFVVN+GD +EIF+NGIYRSIEHR +V+
Sbjct  247  DGQWIPVQPLPNAFVVNLGDMLEIFTNGIYRSIEHRGIVN  286



>ref|XP_010476835.1| PREDICTED: protein SRG1 [Camelina sativa]
Length=359

 Score =   322 bits (825),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 209/296 (71%), Gaps = 7/296 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASAKSIAAVN--VPVIDMQ  227
            MEA   +   S+ VPSVQ++VK+     VPSRY+    +          +N  +P+IDM+
Sbjct  1    MEAKGAAQWSSIIVPSVQEMVKEKIITTVPSRYVRSDQDKTDVVDDSGRLNTEIPIIDMK  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L +      E++KL  ACK+WGFF L+NHG++   +++ K EI DFFNLP+EEK+++ Q
Sbjct  61   RLSTSTDMDSEVEKLDFACKEWGFFQLVNHGIDPIFLDKTKSEIHDFFNLPMEEKKKFWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               + +GFGQ FVVSE+QKLDWAD+F+ +  P  +R P+LFPKLP  FR+T+ETYS E+ 
Sbjct  121  QPNEIEGFGQAFVVSEDQKLDWADLFFHRVKPVELRRPHLFPKLPLPFRDTLETYSTEVQ  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGL  755
             +S  ++  +AK L I+ EEM  LF   +  QSMRMNYYPPCP+ + V+GL+PHSD+ GL
Sbjct  181  SVSKILIAKMAKALEIRPEEMEKLFNDVDSAQSMRMNYYPPCPQPDQVIGLTPHSDSVGL  240

Query  756  TILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            TIL+QVNE  GL+IKKDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  TILMQVNEVEGLQIKKDGKWIPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVN  296



>ref|XP_010089186.1| Protein SRG1 [Morus notabilis]
 gb|EXC36144.1| Protein SRG1 [Morus notabilis]
Length=293

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/270 (57%), Positives = 199/270 (74%), Gaps = 3/270 (1%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL--QSENSE-  251
            G SL VPSVQ+LVK+    VPSRYI        S K I+   +PVI+ Q L    E SE 
Sbjct  4    GSSLLVPSVQELVKEPIITVPSRYIRPDQYDKTSNKIISVSEIPVINFQNLLCHGELSES  63

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL   H AC+DWGFF LINHG++ SLVE++K +IQDFFNLP+EEK++  Q  G+ +GFGQ
Sbjct  64   ELASFHSACRDWGFFQLINHGISSSLVEKIKTDIQDFFNLPMEEKKKLWQHSGEVEGFGQ  123

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FV SEEQKLDW D+F+L TLP ++R P+LFPKLP  FR+ +ET ++E+  L+  ++  +
Sbjct  124  AFVKSEEQKLDWNDIFFLTTLPVSLRKPHLFPKLPTPFRDNLETCALELKNLAKAIISQM  183

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
             K L IK +EM  +FE+GMQ+MRMNYYPPCP+ E VMGL+PHSD+ GLTILLQ++E  GL
Sbjct  184  EKALEIKGKEMTRMFEDGMQAMRMNYYPPCPQPEQVMGLTPHSDSVGLTILLQISEVEGL  243

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFS  881
            +IKKDG W P+ P+PNAF+VN+GD VE+ +
Sbjct  244  QIKKDGMWVPVKPLPNAFIVNIGDIVEVIN  273



>ref|XP_006355573.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 203/285 (71%), Gaps = 5/285 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            +LG SL VPSVQ+L + +   +P RY+    E+P  +   A   VPVI +QK  S +S  
Sbjct  9    NLGKSLLVPSVQELAEQHLTNIPDRYLRPEQETPVIS---AGAEVPVIHLQKFISGDSMD  65

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  +INHGV  SL+E+ KRE+ + F+LP+EEK++  + E   +GFG
Sbjct  66   SELQKLHSACQQWGFLQVINHGVTPSLLEDFKREVIELFSLPMEEKKKLWKQEDSLEGFG  125

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
              FVVSEEQKLDW+D F + TLP +IR  +LF KLP   R+ +E Y  E+  LSM +LC 
Sbjct  126  HAFVVSEEQKLDWSDRFGILTLPPHIRKVDLFQKLPSKLRDIMEAYCKEIKSLSMSILCQ  185

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  +EMR LF +GMQSMRMNYYPPCPE +  +G+SPHSDA  LTIL Q+NET G
Sbjct  186  LAKALRMDEKEMRDLFTDGMQSMRMNYYPPCPEPDKAIGISPHSDADALTILFQLNETEG  245

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+I+KD  W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  246  LQIRKDDVWVPIKPLPNALIVNIGDMMEIVSNGVYRSIEHRAIVN  290



>ref|XP_007158816.1| hypothetical protein PHAVU_002G184400g [Phaseolus vulgaris]
 gb|ESW30810.1| hypothetical protein PHAVU_002G184400g [Phaseolus vulgaris]
Length=359

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 205/282 (73%), Gaps = 3/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN--SEELQ  260
            SL VP VQ++ K+    VP RY+    E P  + +     VP+ID+ KL S +    ELQ
Sbjct  7    SLTVPFVQEIAKEALTSVPERYVRPLHERPILSTTTPLPQVPIIDLSKLFSPDLKETELQ  66

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD-TDGFGQLF  437
             LH ACK+WGFF LINHGV+ SLVE+VKR   + FNLP+EEK+ + Q EG+  +G+GQ+F
Sbjct  67   NLHCACKEWGFFQLINHGVSSSLVEKVKRGAHELFNLPIEEKKMFRQREGEGVEGYGQVF  126

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSEEQKL+W D+F++ TLP  +R P LFP +P  FR+ +++Y  E+  L+MK++  +  
Sbjct  127  VVSEEQKLEWGDMFFMLTLPPRLRKPYLFPNIPLPFRDDLDSYCTELKNLAMKIIDLMEN  186

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++++E+  LF +G+QSMR+NYYPPCP+ E VMGL+PHSD GGLTILLQ NE  GL+I
Sbjct  187  ALSVETKEISELFGDGVQSMRLNYYPPCPQPELVMGLNPHSDGGGLTILLQANEMEGLQI  246

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKD  W PI P+PN+F++N+GD +EI +NGIYRSIEHRA V+
Sbjct  247  KKDELWIPIKPLPNSFIINLGDMLEIMTNGIYRSIEHRATVN  288



>ref|XP_006355629.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 221/293 (75%), Gaps = 5/293 (2%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGV-ESPASAKSIAAVNV--PVIDMQK  230
            EA ++ LG SL VP+VQ+L K   + VP RYI +   E+     SI   +   PVIDM+ 
Sbjct  3    EARSRKLGGSLKVPNVQELAKQQLSGVPPRYIRNNDDENQLYNSSILLPHQLPPVIDMEI  62

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            ++ ++  EL + HLACK+WGFF L+NHGV+ SL+E+VK EIQ FFNLP+EEK+++ Q EG
Sbjct  63   IKDDDETELNRFHLACKEWGFFQLVNHGVSSSLMEKVKSEIQAFFNLPMEEKKKFEQEEG  122

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D++G+GQ FVVSEEQKLDWAD+ Y+ TLPT+ R P+LFPKLP + R+ +E YS  + +L+
Sbjct  123  DSEGYGQAFVVSEEQKLDWADMLYMITLPTHFRKPHLFPKLPASLRDALEQYSTALKELA  182

Query  591  MKVLCFLAKNLGIKSEEMRMLFE-EGMQSMRMNYYPPCPESEHVMGLSPHSDA-GGLTIL  764
            MK+L  +A+ LG+K+EE+ +LFE +  Q MR+NYYPPCP+ + VMG+ PH+D+   L IL
Sbjct  183  MKILYMMARVLGMKAEELNVLFEKDATQMMRLNYYPPCPQPDRVMGICPHTDSIALLAIL  242

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNET GL+IKKDG W P+   P+AFVVN+GD +EI +NGIY+SIEHRA+V+
Sbjct  243  LQVNETEGLQIKKDGAWIPVPYRPDAFVVNIGDILEIVTNGIYKSIEHRAIVN  295



>ref|XP_006355574.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/293 (55%), Positives = 210/293 (72%), Gaps = 7/293 (2%)
 Frame = +3

Query  57   MEADAQSL--GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK  230
            ME+  + L  G SL VPSVQ+L K +   +P RY+    ESP  +      +VPVID+QK
Sbjct  1    MESTPEKLNFGNSLLVPSVQELAKQHLTNIPDRYVRPQQESPVIS---PGPSVPVIDLQK  57

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S +S   ELQKLH AC++WGF  +INHGV  SL+E+ K E+ + F LP+EEK++  Q 
Sbjct  58   LISGDSMDSELQKLHSACQEWGFLQVINHGVTPSLLEDFKSEVIELFKLPMEEKKKLWQQ  117

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
            +   +GFG LFVVSE+QKLDW+D+F + TLP +IR  +LF KLP   R+ +E YS E+  
Sbjct  118  KDSFEGFGHLFVVSEKQKLDWSDMFGIITLPPHIRKVDLFQKLPSKLRDIMEEYSKEIKN  177

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            LS+ ++C LAK L +  +EMR LF +GMQSMRMNYYPPCPE +  +GLSPHSDA  LTIL
Sbjct  178  LSVIIVCQLAKALRMNEKEMRDLFSDGMQSMRMNYYPPCPEPDRAIGLSPHSDADALTIL  237

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             Q+NET GL+++KD  W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  238  FQLNETEGLQVRKDDIWVPINPLPNALIVNIGDMMEIVSNGVYRSIEHRAIVN  290



>ref|NP_173145.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
 sp|Q39224.1|SRG1_ARATH RecName: Full=Protein SRG1; Short=AtSRG1; AltName: Full=Protein 
SENESCENCE-RELATED GENE 1 [Arabidopsis thaliana]
 gb|AAD50032.1|AC007651_27 SRG1 Protein [Arabidopsis thaliana]
 emb|CAA55654.1| SRG1 [Arabidopsis thaliana]
 gb|AAK82564.1| F6I1.30/F6I1.30 [Arabidopsis thaliana]
 gb|AAM98100.1| At1g17020/F6I1.30 [Arabidopsis thaliana]
 gb|AEE29531.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
Length=358

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 213/295 (72%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            MEA   +   S+ VPSVQ++VK+     VP RY+  D  ++         + +P+IDM++
Sbjct  1    MEAKGAAQWSSILVPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+NHG++ S +++VK EIQDFFNLP+EEK+++ Q 
Sbjct  61   LCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQR  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+F+    P  +R P+LFPKLP  FR+T+E YS E+  
Sbjct  121  PDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQS  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  ++  +A+ L IK EE+  LF+  + +QSMRMNYYPPCP+ + V+GL+PHSD+ GLT
Sbjct  181  VAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +L+QVN+  GL+IKKDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  VLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVN  295



>gb|KEH16106.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=352

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 202/279 (72%), Gaps = 0/279 (0%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQKL  266
            S+  PSVQ+L K     VP +Y+    +    + + +   +P+I+  KL  E++ EL+KL
Sbjct  5    SILAPSVQELAKQGITKVPKQYLQPNQDPIVVSNTTSLPQIPIINFDKLLCEDATELEKL  64

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
              ACK+WGFF LINHGVN SLVE VK  ++ FFNLP+EEK+++ Q   +  GFGQ ++ S
Sbjct  65   DHACKEWGFFQLINHGVNPSLVENVKIRVEQFFNLPVEEKKKFWQTPKELQGFGQAYIRS  124

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EE+KL W D+FY+KTLP   R+P+L P +P+ FR+ +E YS+E++KL + ++ FL+K L 
Sbjct  125  EEEKLIWGDMFYIKTLPMYSRNPHLIPSIPQPFRDNLENYSLELNKLCVTIIEFLSKALK  184

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            IK  E+  LFEEG QSMRMNYYPPCP+ E V+GL PHSDA  LTILL+VN+  GL+IKKD
Sbjct  185  IKPNELLDLFEEGSQSMRMNYYPPCPQPEQVIGLDPHSDATVLTILLEVNDIQGLQIKKD  244

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W PI PI +AFVVNVGD +EI +NGIYRSIEHRA V+
Sbjct  245  GMWIPINPISDAFVVNVGDTLEILTNGIYRSIEHRATVN  283



>gb|KDO54069.1| hypothetical protein CISIN_1g023533mg [Citrus sinensis]
Length=281

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 205/275 (75%), Gaps = 2/275 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            MEA + ++G SL VP +Q+L K+ P +VPSR+  +  +      S   V +PVIDMQKL 
Sbjct  1    MEAKSTTMGSSLVVPLIQELAKNTPTIVPSRFTVNDEDHVPLISSSEQVLIPVIDMQKLL  60

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S +    EL KL  AC++WGFF L+NHGV+ SLVE+VK EIQ+FFNLP++EK+++    G
Sbjct  61   SGDFMDSELGKLDHACREWGFFQLVNHGVSSSLVEKVKVEIQEFFNLPMKEKEKFWMRPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            +T+GFGQ FVVSEEQ+LDWA  F + TLPT +R P+LFPKLP   R+T+E +S E+  LS
Sbjct  121  ETEGFGQNFVVSEEQRLDWAYGFTMFTLPTYLRKPHLFPKLPLPLRDTLEAWSAELGNLS  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
             K+L  +AK LGI + +++ LFEE MQ+MRMNYYPPCP+ E V+G + HSDA  +TILLQ
Sbjct  181  QKLLHQMAKALGIDANDVKALFEEAMQTMRMNYYPPCPKPEQVIGFNSHSDASSITILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEI  875
            +NET GL+IKKDG W P++P+P+AF++NVGD +E+
Sbjct  241  LNETVGLQIKKDGMWVPVIPLPDAFIINVGDILEV  275



>emb|CDX81796.1| BnaC08g38050D [Brassica napus]
Length=358

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 213/295 (72%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDN-PNVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            ME+   +   S+ VPSVQ++VK+     VP RY+  D  ++  + +S     +P+IDM++
Sbjct  1    MESKESAQWSSIVVPSVQEMVKEKMVTTVPPRYVRPDQDKTEVTDRSGLNTEIPIIDMKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+NHG++ S ++++K EIQ FFNLP+EEK+++ Q 
Sbjct  61   LCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDPSFLDKIKLEIQGFFNLPMEEKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+FY    P   R P+LFPKLP  FR+T+ETYS E+  
Sbjct  121  PNEIEGFGQAFVVSEDQKLDWADMFYHIVQPIEARKPHLFPKLPLPFRDTLETYSTEVQS  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  ++  +A+ L +K EEM  LF+  + +Q MRMNYYPPCP+ + V+GLSPHSD+ GLT
Sbjct  181  IAKILIAKMARALEVKPEEMLKLFDDVDSVQMMRMNYYPPCPQPDKVIGLSPHSDSVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKKDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVEGLQIKKDGKWVPVKPLPNAFIVNIGDVIEIITNGTYRSIEHRGVVN  295



>ref|XP_002314207.1| hypothetical protein POPTR_0009s03100g [Populus trichocarpa]
 gb|EEE88162.1| hypothetical protein POPTR_0009s03100g [Populus trichocarpa]
Length=363

 Score =   320 bits (820),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 215/294 (73%), Gaps = 4/294 (1%)
 Frame = +3

Query  54   AMEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESP--ASAKSIAAVNVPVIDMQ  227
            ++E +A + G S+ +PSVQ++ K++   +P RY     + P  ++  S+   ++PVID++
Sbjct  4    SLELEAVNFGKSIIIPSVQEMAKESMTKIPPRYERPDQDPPIISTDASLLLSSIPVIDLE  63

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L  E+S   EL  LH AC++WGFF ++NH V+ +L+EE K ++++FF LP E+K++  Q
Sbjct  64   RLAIEDSMDSELDILHSACREWGFFQVVNHRVSSTLLEEFKMQVENFFKLPYEDKKKLWQ  123

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               + +GFGQLFVVSEEQKLDW+D+FY+ TLP  +R  +LF KLP   R T+ETY  E+ 
Sbjct  124  KPDNHEGFGQLFVVSEEQKLDWSDMFYVTTLPLYLRMNDLFDKLPPNLRETLETYCSEVK  183

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
            KL+ ++L  +AK L + +EEM+ LF +G+QS+RMNYYPPCPE +  +G SPHSDA  LTI
Sbjct  184  KLASEILGHMAKGLKMDAEEMKELFSDGVQSIRMNYYPPCPEPDKAIGFSPHSDADALTI  243

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L Q+++T GLEI+K+G WFP+ P+PNAFVVNVGD  EI SNG+YRS+EHRA V+
Sbjct  244  LFQLSDTEGLEIRKEGRWFPVKPLPNAFVVNVGDITEIISNGVYRSVEHRAKVN  297



>ref|XP_010041379.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW44395.1| hypothetical protein EUGRSUZ_L02122 [Eucalyptus grandis]
Length=305

 Score =   318 bits (814),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 211/291 (73%), Gaps = 11/291 (4%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            MEA        L VP VQ ++K+NP  VP RY+ D +E P    + + + +PVID+ +L 
Sbjct  1    MEAHVNIPARLLHVPWVQDMMKENPTTVPERYVRDDLE-PVIMGACSGLQLPVIDLGRLV  59

Query  237  SENSE--ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            SE+    EL+KLH ACKDWGFFHLINH V+  L+E+VK+  ++ FN+P+EEK+++ Q++G
Sbjct  60   SEDCAKLELKKLHHACKDWGFFHLINHEVSPKLIEKVKKGTEELFNMPMEEKKKFWQSDG  119

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            ++ GFGQ FV SE+QKLDWAD+F + TLP ++R P+LFPKLP  FR+ ++ YS E   L+
Sbjct  120  ESGGFGQAFVFSEDQKLDWADIFRMFTLPASMRKPHLFPKLPLPFRDDLDAYSKETKTLA  179

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK LG++++++  +FE+G+Q+MRMNYYPPCP+ E VMGL+ HSD   +TILLQ
Sbjct  180  IKLLYLMAKALGMEAKDLEGMFEDGVQAMRMNYYPPCPQPELVMGLNSHSDGNAVTILLQ  239

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            VNE  GL+I+KDG W P+ P+P AF++NVGD VE        SIEHRA V+
Sbjct  240  VNEMEGLQIRKDGKWVPVKPLPGAFIINVGDVVE--------SIEHRATVN  282



>ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66457.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 210/295 (71%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            ME    +   S+ VPSVQ++VK+     VP RY+  D  ++           +P+ID+++
Sbjct  1    METKGAAQWSSILVPSVQEMVKEKTITTVPPRYVRSDQDKTKVDDDFDVKTEIPIIDLKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+NHG+  S +++VK EIQDFFNLP+EEK+++ Q 
Sbjct  61   LCSSTTMDSEVEKLDFACKEWGFFQLVNHGIEPSFLDKVKSEIQDFFNLPMEEKKKFWQR  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+F+    P  +R P+LFPKLP +FR+T+ETYS E+  
Sbjct  121  PDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLSFRDTLETYSAEVQS  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  ++  +A  L  K EE+  LF+  + +QSMRMNYYPPCP+ + V+GL+PHSD+ GLT
Sbjct  181  VAKILIAKMASALETKPEELEKLFDDVDSIQSMRMNYYPPCPQPDQVIGLTPHSDSVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +L+QVNE  GL+IKKDG W P+ PIPNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  VLMQVNEVEGLQIKKDGKWVPVKPIPNAFIVNIGDVLEIITNGTYRSIEHRGVVN  295



>ref|XP_004232992.1| PREDICTED: protein SRG1 [Solanum lycopersicum]
Length=360

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 202/285 (71%), Gaps = 5/285 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L K +  ++P RY+    E+P  +   A   VPVID+QKL S +S  
Sbjct  9    NFGKSLLVPSVQELAKQHLTIIPDRYLRPEQETPVIS---AGAEVPVIDVQKLISGDSMD  65

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC+ WGF  +INHGV   L+E+ KRE+ + F LP+EEK++  + E   +GFG
Sbjct  66   SELQKLHSACQQWGFLQVINHGVTPLLLEDFKREVIELFKLPMEEKKKLWKQEDSLEGFG  125

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
              FVVSE+QKLDW+D F + TLP +IR  +LF KLP   R+ +E Y  E+  L+  ++C 
Sbjct  126  HAFVVSEDQKLDWSDRFGILTLPPHIRKVDLFQKLPSKLRDIMEAYCKEIKSLATSIICQ  185

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LAK L +  EEMR LF +GMQ++RMNYYPPCPE +  +G+SPHSDA  +TIL Q+NET G
Sbjct  186  LAKALRMDEEEMRDLFNDGMQTLRMNYYPPCPEPDKAIGISPHSDADAITILFQLNETEG  245

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+I+KD  W PI P+PNA +VN+GD +EI SNG+YRSIEHRA+V+
Sbjct  246  LQIRKDDVWVPIRPLPNALIVNIGDMMEIVSNGVYRSIEHRAIVN  290



>ref|XP_006305827.1| hypothetical protein CARUB_v10010858mg [Capsella rubella]
 gb|EOA38725.1| hypothetical protein CARUB_v10010858mg [Capsella rubella]
Length=357

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 213/294 (72%), Gaps = 5/294 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYI-HDGVESPASAKSIAAVNVPVIDMQK  230
            MEA  ++   S+ VPSVQ++V +     VP RY+ +D  ++ A   S  +  +P+IDM++
Sbjct  1    MEAKVETSWSSIIVPSVQEMVDEKTITTVPPRYVRYDEDKTEAVDDSGLSNKIPIIDMER  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+NHG++ S ++++K EIQDFFNLPLEEK+++ Q 
Sbjct  61   LCSLTAVDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKIKSEIQDFFNLPLEEKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
                +GFGQ FVVSE+QKLDWAD+F+L T P   R P+LFPKLP  FR+T+E YS ++  
Sbjct  121  PKVMEGFGQAFVVSEDQKLDWADMFFLVTQPAQYRKPHLFPKLPLPFRDTLEMYSTQVKD  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
            ++  ++  +A+ L IK+EE+  LF + M QSMRMNYYPPCP+   V GL+PHSDA GLTI
Sbjct  181  IAKILIGKMAEALQIKAEEIEELFGDDMTQSMRMNYYPPCPQPNQVTGLTPHSDAVGLTI  240

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LLQVNE  GL+IKK+G W  + P+PNAFVVNVGD +EI +NG YRSIEHR +V+
Sbjct  241  LLQVNEVDGLQIKKNGKWVFVKPLPNAFVVNVGDILEIITNGAYRSIEHRGMVN  294



>ref|XP_010665637.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=366

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 217/298 (73%), Gaps = 9/298 (3%)
 Frame = +3

Query  57   MEADAQSL--GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVN-----VPV  215
            M+A+ Q+L  G S+ VPSVQ+L + +   VP RYI    E           N     VP+
Sbjct  1    MDAENQNLRLGKSILVPSVQELAQKSLESVPERYIQLNQEPIILGADDELSNHNDFQVPI  60

Query  216  IDMQKLQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRY  395
            IDM+ L S +  EL K+H ACK+WGFF LINHG++ SLVE+ K E Q+FFNLPLEEK+RY
Sbjct  61   IDMKTLVSGDVLELDKMHSACKEWGFFQLINHGIDASLVEKFKLETQEFFNLPLEEKKRY  120

Query  396  GQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVE  575
             Q   + +GFGQ FVVSEEQKLDWAD+F+L TLP ++R PNL P LP  +R+T+ETYS E
Sbjct  121  WQTPSEVEGFGQAFVVSEEQKLDWADIFFLTTLPKHLRKPNLLPMLPLPYRDTLETYSAE  180

Query  576  MHKLSMKVLCFLAKNLGIKSEEMRMLF-EEGM-QSMRMNYYPPCPESEHVMGLSPHSDAG  749
            +HKL+M++L  ++K L I ++ MR +F  +G+ QSMRMNYYPPCP+ + V+GL+PHSD  
Sbjct  181  LHKLAMELLDCMSKALTIDTKAMRAMFGNQGLFQSMRMNYYPPCPQPDKVIGLTPHSDGV  240

Query  750  GLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             LTILLQ+NE  GL+I+KDG W  I+P+ +AFVVN+GD +EI SNGIYRSI HR++V+
Sbjct  241  ALTILLQLNEVEGLQIRKDGKWVSIMPLSDAFVVNIGDILEIMSNGIYRSILHRSVVN  298



>gb|KEH27888.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=352

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 203/282 (72%), Gaps = 2/282 (1%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G SL VPSVQ+L K N   VP +Y+H   + P    S   + VPVID+ KL  E++ EL
Sbjct  4    FGTSLLVPSVQELAKKNTTEVPEQYLHPN-QDPIVV-SNTTLQVPVIDLSKLVCEDATEL  61

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KL  ACK+WGFF LINHGVN SLVE VK  +Q+F NL ++EK+++ Q   D +GFGQLF
Sbjct  62   EKLDQACKEWGFFQLINHGVNPSLVENVKIGVQEFLNLSVDEKKKFWQTPDDIEGFGQLF  121

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE QKL+WAD+F++ TLP+  R+  LFP +P+ FR+ +ETYS+E+ K+ + ++  + K
Sbjct  122  VVSENQKLEWADLFFITTLPSYARNSRLFPNIPQPFRDNLETYSLELKKVCITIIKHMEK  181

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++  EM  LF++  QSMRM  YPPCP+ E+V+GL+PHSDA  LTILLQ N+  GL+I
Sbjct  182  ALKVEPNEMLELFDDITQSMRMTCYPPCPQPENVIGLNPHSDAAALTILLQANDVEGLQI  241

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W  + P+ NAFV+NVGD  EI +NG+YRSIEHRA V+
Sbjct  242  RKDGQWVSVKPLTNAFVINVGDIFEILTNGVYRSIEHRATVN  283



>gb|KHG06473.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=372

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 210/291 (72%), Gaps = 3/291 (1%)
 Frame = +3

Query  60   EADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAV-NVPVIDMQKLQ  236
            +A+  + G S+ VPSVQ+L KD    +P RY+      P S      + +VP+ID+QKL 
Sbjct  6    DAEFVNFGKSIIVPSVQELAKDPIAKIPPRYLRPLQGQPHSISPNHHLPSVPIIDLQKLA  65

Query  237  SEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            + +    ELQ+LH ACK+WGFF ++NH V+ SL+E+ K EI +FF LP E+K+   Q   
Sbjct  66   AGDFVDSELQRLHSACKEWGFFQVVNHSVSISLLEDFKLEIGNFFKLPHEDKKLLWQKPD  125

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            + +GFGQLFVVSE+QKLDW+D+FY+ TLP N+R+  LF KLP   R  +E YS E+  L+
Sbjct  126  NHEGFGQLFVVSEDQKLDWSDMFYITTLPHNLRNIELFEKLPLKLRQAMEVYSTEVKNLA  185

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +++L ++A+ L + +EEMR LF +G+QSMR+NYYPPCPE +  +G SPHSDA  LTIL Q
Sbjct  186  LRILDYMARALNMGTEEMRELFNDGIQSMRINYYPPCPEPDMTIGFSPHSDADALTILFQ  245

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ++ET GL+++KDG W  I P+PNA VVN+GD +EIFSNGIYRSIEHRA+V+
Sbjct  246  LSETEGLQVRKDGKWVSIKPLPNALVVNIGDIMEIFSNGIYRSIEHRAVVN  296



>ref|XP_008463796.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Cucumis melo]
Length=361

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 203/290 (70%), Gaps = 7/290 (2%)
 Frame = +3

Query  66   DAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGV--ESPASAKSIAAVNVPVIDMQKLQS  239
            D    G S+ VPSVQ+L K     +P RYIH  +   SP S+    A  +PVIDM  L+S
Sbjct  7    DTLRYGSSILVPSVQELAKHPITEIPHRYIHPDLLHHSPISSD---ASQIPVIDMSNLRS  63

Query  240  ENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD  413
             ++   EL +LH ACK+WGFF L+ HGV+ SLVE +K E Q  F LP+EEK++  Q EGD
Sbjct  64   HDTMDSELSRLHSACKNWGFFQLVKHGVSDSLVERMKMETQKLFELPIEEKKKLWQREGD  123

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQ FV SEEQKLDW D+F++ TLP + R P LF  LP + R T+E YS  +  ++ 
Sbjct  124  VEGFGQAFVTSEEQKLDWCDIFFIATLPLHFRKPRLFQNLPLSLRETLEEYSAAVKDVAA  183

Query  594  KVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQV  773
            ++L  + K LGIK  E+  LF++G QSMRMNYYPPCPE E V+GL+PHSDA GLTILLQ+
Sbjct  184  EILDGVEKALGIKEGELSELFKDGNQSMRMNYYPPCPEPEKVIGLTPHSDAAGLTILLQI  243

Query  774  NETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            N+  GL+IKK+G W  ++P+PNAF+VN+GD +E+ +NG Y+SIEH A V+
Sbjct  244  NKVEGLKIKKEGNWITVMPLPNAFIVNIGDILEMVTNGEYKSIEHCATVN  293



>ref|XP_006432916.1| hypothetical protein CICLE_v10001622mg [Citrus clementina]
 gb|ESR46156.1| hypothetical protein CICLE_v10001622mg [Citrus clementina]
Length=359

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 203/291 (70%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+  L  + P   VP R++   ++ P       +   +PVIDM +
Sbjct  1    MEAKATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHR  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL   CK+WGFF LINHGV+ SLVE+VK EIQDFFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D++GFGQ F+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E YS E+  L+
Sbjct  121  DSEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M  LFE GMQ+ RMNYYPPC + E V+G + H DA  LT+LLQ
Sbjct  181  LKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W  + P+P+AFVVN+GD +EI +NG Y SIEHRA V+
Sbjct  241  INEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVN  291



>ref|XP_009117729.1| PREDICTED: protein SRG1 [Brassica rapa]
Length=358

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 211/295 (72%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDN-PNVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            ME+   +   S+ VPSVQ++VK+     VP RY+  D  ++  +  S     +P+IDM++
Sbjct  1    MESKGAAQWSSIIVPSVQEMVKEKMVTTVPPRYVRPDQDKTEVTDGSGLNTEIPIIDMKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+NHG++ S ++++K EIQ FFNLP+EEK+++ Q 
Sbjct  61   LCSSTTMGSEVEKLDFACKEWGFFQLVNHGIDPSFLDKIKLEIQGFFNLPMEEKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+FY    P   R P+LFPKLP  FR+T+ETYS E+  
Sbjct  121  PNEIEGFGQAFVVSEDQKLDWADMFYHIVQPIEERKPHLFPKLPLPFRDTLETYSTEVQS  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  ++  +A+ L +K EEM  LF+  + +Q MRMNYYPPCP+ + V+GLSPHSD  GLT
Sbjct  181  IAKILIAKMARVLDVKPEEMLKLFDDVDSVQMMRMNYYPPCPQPDKVIGLSPHSDPNGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKKDG W P+ P+PN+F+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVEGLQIKKDGKWVPVKPLPNSFIVNIGDVIEIITNGTYRSIEHRGVVN  295



>gb|KDP22220.1| hypothetical protein JCGZ_26051 [Jatropha curcas]
Length=363

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 207/291 (71%), Gaps = 5/291 (2%)
 Frame = +3

Query  66   DAQS-LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPAS-AKSIAAVNVPVIDMQKL--  233
            D +S LG ++ VPSV+++ KD    +P RY+    + P++   S +   +PVIDM KL  
Sbjct  2    DGKSRLGSTVLVPSVKEIAKDQLISIPPRYVRLDHQPPSTVTNSTSLPQIPVIDMAKLFP  61

Query  234  QSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGD  413
            Q     ELQK HLACKDWGFF L+NHGV   L+E++K E   FFNLP+E+K+++ Q  G+
Sbjct  62   QQFLDSELQKFHLACKDWGFFQLVNHGVTTELLEKMKIETAAFFNLPIEKKKKFWQKAGE  121

Query  414  TDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSM  593
             +GFGQ FV SEEQKL+W D+FY+ TLPT+ R P+LF   P +FR+ IE YS E+  L+ 
Sbjct  122  AEGFGQHFVHSEEQKLEWGDLFYIVTLPTHSRKPHLFDNFPPSFRDAIEAYSEELQGLAN  181

Query  594  KVLCFLAKNLGI-KSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            K+   + K LGI + + +   FE+G Q+MRMNYYPPCP+ E VMG++PHSDA GLTIL Q
Sbjct  182  KIFNLVIKALGILEVDYITESFEKGWQAMRMNYYPPCPQPELVMGVNPHSDASGLTILFQ  241

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +N+  GL+IKKDG W P+ PIPNAF++N+GD +EI +NGIY SIEHRA ++
Sbjct  242  LNDVVGLQIKKDGVWIPVKPIPNAFIINIGDMLEILTNGIYPSIEHRATIN  292



>gb|KDO39329.1| hypothetical protein CISIN_1g018221mg [Citrus sinensis]
Length=359

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 203/291 (70%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+  L  + P   VP R++   ++ P       +   +PVIDM +
Sbjct  1    MEAKATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHR  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL   CK+WGFF LINHGV+ SLVE+VK EIQDFFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D++GFGQ F+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E YS E+  L+
Sbjct  121  DSEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M  LFE GMQ+ RMNYYPPC + E V+G + H DA  LT+LLQ
Sbjct  181  LKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W  + P+P+AFVVN+GD +EI +NG Y SIEHRA V+
Sbjct  241  INEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVN  291



>gb|AFK43235.1| unknown [Lotus japonicus]
Length=356

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 208/282 (74%), Gaps = 1/282 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIA-AVNVPVIDMQKLQSENSEEL  257
            G SL VPSVQ+L K +   VP +Y+H   E    A S   ++ VP+ID+ KL SE++ EL
Sbjct  5    GTSLLVPSVQELAKQHMIKVPEQYLHPNQEPINVAPSTTTSLQVPIIDLNKLLSEDAIEL  64

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             KL+ ACK+WGFF LINHGV  SLVE VK  +Q+FF LP+E+K+++ Q   D +GFGQLF
Sbjct  65   DKLNSACKEWGFFQLINHGVKPSLVENVKIGVQEFFGLPMEQKKKFWQTPEDIEGFGQLF  124

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE+QKLDWAD+F++ TLP+  R+P LFP +P+  R  +E+Y +E+ ++   ++  + K
Sbjct  125  VVSEDQKLDWADLFFINTLPSYARNPRLFPNIPQPLRENLESYCLELERVFNTMINCMEK  184

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++  E+  LF+   Q+MR NYYPPCP+ E+V+G++PH+DAG LT+LLQVNET GL+I
Sbjct  185  ALEMEPNEVLKLFDVVSQTMRWNYYPPCPQPENVIGINPHTDAGVLTLLLQVNETEGLQI  244

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W P+ P+ NAFV+NVGD +EI +NGIYRSIEHRA ++
Sbjct  245  RKDGKWVPVTPLSNAFVINVGDIMEILTNGIYRSIEHRATIN  286



>ref|XP_006432911.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
 gb|ESR46151.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
Length=359

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 202/291 (69%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+  L  + P   VP R++   ++ P       +   +PVIDM +
Sbjct  1    MEAKATVIGSSLVEPSILDLANNQPLTTVPPRFVRPEIDHPLIRNDDTSTQQLPVIDMHR  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL   CK+WGFF LINHGV+ SLVE+VK EIQDFFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQ F+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E YS E+  L+
Sbjct  121  DIEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M  LFE GMQ+ RMNYYPPC + E V+G + H DA  LT+LLQ
Sbjct  181  LKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +NE  GL+IKKDG W  + P+P+AFVVN+GD +EI +NG Y SIEHRA V+
Sbjct  241  INEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVN  291



>gb|KEH17543.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 207/286 (72%), Gaps = 3/286 (1%)
 Frame = +3

Query  66   DAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSEN  245
            D  S+ L+   PSVQ+L K     VP +Y+    +S   + + +   +PVID+ KL  E+
Sbjct  2    DGSSVVLA---PSVQELEKQGITKVPKQYLQPNQDSILVSNTTSLPQLPVIDLSKLLCED  58

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
            + EL+ L  ACKDWGFF LINHGVN  LVE +K  +Q FFNLP+EEK+++ Q   +  GF
Sbjct  59   AIELENLDHACKDWGFFQLINHGVNPLLVENIKIGVQKFFNLPIEEKKKFWQTTEEMQGF  118

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQ++V  EE+KL W D+F++KT P + R P+L P +P+ FR+ +E+YS+E++KL + ++ 
Sbjct  119  GQVYVALEEEKLRWGDMFFIKTFPLHTRHPHLIPCIPQPFRDNLESYSLEVNKLCVTLIE  178

Query  606  FLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
            F++K L IK  E+  +FEEG Q+MRMNYYPPCP+ + V+GL+PHSDAG LTILLQVNE  
Sbjct  179  FMSKALKIKPNELLDIFEEGSQAMRMNYYPPCPQPDQVIGLNPHSDAGTLTILLQVNEME  238

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+IKKDG W PI P+ +AFVVNVGD +E+ +NGIYRSIEHRA V+
Sbjct  239  GLQIKKDGIWIPIRPLSDAFVVNVGDILEVQTNGIYRSIEHRATVN  284



>ref|XP_003614583.1| Protein SRG1 [Medicago truncatula]
 gb|AES97541.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=355

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 201/282 (71%), Gaps = 1/282 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G SL VPSVQ+LVK     VP +Y+    +      + +   VPVI++ KL S ++ EL+
Sbjct  5    GTSLLVPSVQELVKQPITKVPEQYLQPNQDLVVVCNTTSLPKVPVINLHKLLSNDTIELE  64

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
                AC++WGFF LINHGVN  LVE +K+ ++ FFNLP++EK++Y Q   D  GFGQLFV
Sbjct  65   NFDHACREWGFFQLINHGVNTLLVENMKKGVEQFFNLPIDEKKKYWQTPNDMQGFGQLFV  124

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VS+EQKL+W D+FY+ TLP + R P+L P +P+ FR+ +ETY +E+ +L+  ++  + K 
Sbjct  125  VSDEQKLEWQDMFYINTLPLDSRHPHLIPSIPKPFRDHLETYCLELKQLAFTIIGRMEKT  184

Query  621  LGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
            L IK+ E+   FE+ + Q MR+NYYPPCP+ EHV+G+SPHSD G LTILLQ N+  GL+I
Sbjct  185  LKIKTNELVEFFEDAIHQGMRINYYPPCPQPEHVIGVSPHSDMGALTILLQANDVEGLQI  244

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W  + P+PNAFV+N+GD +EI +NGIYRSIEHR  V+
Sbjct  245  RKDGQWISVQPLPNAFVINIGDMLEILTNGIYRSIEHRGTVN  286



>ref|XP_010476836.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/296 (51%), Positives = 210/296 (71%), Gaps = 8/296 (3%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASAKSIAAVNV--PVIDMQ  227
            MEA  ++   S+ VPSVQ++VK+     VPSRY+   VE        + +NV  P+IDM+
Sbjct  1    MEAKRETSWSSIIVPSVQEMVKEKMITTVPSRYVR-SVEDKTEVADDSGLNVEIPIIDMK  59

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S  +   E+QKL  ACK+WGFF L++HG++ S +++ K EIQ FFNLP+EEK+++ Q
Sbjct  60   RLCSPTAMDSEVQKLDFACKEWGFFQLVDHGIDPSFLDKTKSEIQHFFNLPMEEKKKFWQ  119

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               + +GFGQ FVVSE+QKLDWAD+FY    P  +R P+LFPKLP  FR+ +E YS E+ 
Sbjct  120  QPNEVEGFGQAFVVSEDQKLDWADLFYHTVKPVELRKPHLFPKLPLPFRDILEKYSAEVQ  179

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGL  755
             ++  ++  +A+ L IK EEM   F   + +Q+MRMNYYPPCP+ + V+GL+PHSD+ GL
Sbjct  180  NIANILIVKMARALEIKPEEMEKFFNDVDSIQAMRMNYYPPCPQPDQVIGLTPHSDSVGL  239

Query  756  TILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            TIL+QVNE  GL++K DG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  240  TILMQVNEVEGLQVKNDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHRGVVN  295



>ref|XP_010665638.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=367

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 155/288 (54%), Positives = 204/288 (71%), Gaps = 7/288 (2%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDG---VESPASAKSIAAVNVPVIDMQKLQSEN  245
            + G S  VPSVQ+L K++   +PSRY+ D    +E P S  S  + +VPVID+Q+L    
Sbjct  9    NFGSSFIVPSVQELAKESIVSIPSRYVRDNGDQLEYPNSQSS--SFSVPVIDLQRLLHAE  66

Query  246  --SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTD  419
                EL KLH ACK+WGFF +INHGV+ SL+E  + E+ +FF LPLEEK++  Q   + +
Sbjct  67   YIDSELHKLHSACKEWGFFQVINHGVSTSLLETFEGEVINFFQLPLEEKKKLWQQPDNHE  126

Query  420  GFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKV  599
            GFGQLFVVSE+QKLDW+D+FY+ TLP  +R P LF  LP+  R T+E Y   +  L+  +
Sbjct  127  GFGQLFVVSEDQKLDWSDMFYITTLPPKLRQPELFKNLPQKIRVTMEAYIEAVKDLAQTL  186

Query  600  LCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNE  779
            L  +AK LGI+ EEM  LF EG+QS+RMNYYPPCPE    +G +PHSDA  LTIL Q+N+
Sbjct  187  LNQMAKALGIQEEEMVKLFSEGVQSIRMNYYPPCPEPHKAIGFTPHSDADALTILFQLND  246

Query  780  TTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            T GL+++KDG W  I P+ +AFVVNVGD +EI SNG+YRSIEHRA+V+
Sbjct  247  THGLQVRKDGNWVSIQPLEDAFVVNVGDIMEIVSNGVYRSIEHRAIVN  294



>ref|XP_007209291.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
 gb|EMJ10490.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
Length=358

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 205/287 (71%), Gaps = 4/287 (1%)
 Frame = +3

Query  72   QSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSE---  242
            + LG SLPV +VQ L  +N   +P RYI   +E    +    ++ +PV+DM KL  +   
Sbjct  9    KDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSME-DSLQIPVVDMSKLIGDPLG  67

Query  243  NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDG  422
            + EEL KLHLACKDWGFF LINHGV+  ++E++K + ++FF LPLEEK+ Y Q     +G
Sbjct  68   HGEELAKLHLACKDWGFFQLINHGVSEEVIEKIKSDTKEFFQLPLEEKKAYAQLPNHIEG  127

Query  423  FGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVL  602
            +GQ FVVSEEQKLDW D+ +L + P ++R+   +P LP +FR T++ YSVE+ +++  + 
Sbjct  128  YGQAFVVSEEQKLDWGDMLFLLSQPVSLRNLTFWPTLPTSFRETLDKYSVELQEVTKYLW  187

Query  603  CFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNET  782
              + KNLG+ SE++  +FE+G Q +RMNYYPPCP++  VMGL+PHSDA GLT+L+QVN+ 
Sbjct  188  KLICKNLGLNSEKLASMFEDGTQGLRMNYYPPCPQASRVMGLTPHSDAVGLTLLIQVNDV  247

Query  783  TGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             GL+IK +G W PI P+P A +VN+GD +EI SNG Y+SIEHRA+V+
Sbjct  248  QGLQIKNNGKWVPIKPVPGALIVNIGDIIEILSNGEYKSIEHRAVVN  294



>ref|XP_003614574.1| Protein SRG1 [Medicago truncatula]
 gb|AES97532.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 205/284 (72%), Gaps = 2/284 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE  251
            +LG SL VP VQ+L K  PN+ VP +Y+    +    + + +   VPVID+ KL SE++ 
Sbjct  3    NLGTSLLVPYVQELAK-QPNIEVPEQYLQPNQDPINVSNTSSLQQVPVIDLNKLLSEDAT  61

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            EL+ L  ACK+WGFF LINHGV+  LVE VK  +Q+F +LP+EEK++  Q   D  GFGQ
Sbjct  62   ELENLDQACKEWGFFQLINHGVDHLLVENVKIGVQEFLSLPVEEKKKLRQTPEDMQGFGQ  121

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
            LFVVSE QKL+WAD+FY  TLP+  R+  LFP +P+ FR+ +ETY +E+  + + ++  +
Sbjct  122  LFVVSENQKLEWADLFYTTTLPSYARNTRLFPNIPQPFRDNLETYCLELQNVCITIIKHM  181

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            AK L ++  E+  LFE+G Q MRMNYYPPCP+ E+V+GL+PHSDAG LTILLQ N+  GL
Sbjct  182  AKALKVEPNEILELFEDGGQQMRMNYYPPCPQPENVIGLNPHSDAGALTILLQANDIEGL  241

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +I+KDG W  + P+ +AFV+NVGD +EI +NGIYRSIEHRA V+
Sbjct  242  QIRKDGQWISVKPLTDAFVINVGDILEIITNGIYRSIEHRATVN  285



>gb|KEH27895.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 199/277 (72%), Gaps = 1/277 (0%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQKL  266
            S+  PSVQ+L +     VP +Y+    +S   + + ++  +P+ID  KL  E+  EL+KL
Sbjct  5    SILAPSVQELAEQGITKVPEQYLQPNQDSILVSNTTSSPQLPIIDFDKLLCEDGIELEKL  64

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
              ACK+WGFF LINHGVN SLVE VK  +Q FF+LP+EEK+++ Q E +  GFGQ++V  
Sbjct  65   DNACKEWGFFQLINHGVNPSLVESVKIGVQQFFHLPMEEKKKFWQTEEELQGFGQVYVAL  124

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EEQKL W D+FY+KT P +IR P+L P +P+ FR+  E YS+E+ KL  K++  + K L 
Sbjct  125  EEQKLRWGDMFYVKTFPLHIRLPHLIPCMPQPFRDDFENYSLELKKLCFKIIERMTKALK  184

Query  627  IKS-EEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
            I+   E+   FEEG QS+RMNYYPPCP+ + V+GL+PHSDA  LTILLQVNE  GL+IKK
Sbjct  185  IQQPNELLDFFEEGDQSIRMNYYPPCPQPDQVIGLNPHSDASALTILLQVNEMQGLQIKK  244

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRA  914
            DG W PI P+PNAFVVN+GD +EI +NGIYRSIEHRA
Sbjct  245  DGMWVPINPLPNAFVVNIGDLLEIMTNGIYRSIEHRA  281



>emb|CDY24858.1| BnaA08g14520D [Brassica napus]
Length=358

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 207/295 (70%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLG-LSLPVPSVQQLVKDN-PNVVPSRYIHDGVESPASA-KSIAAVNVPVIDMQ  227
            MEA+  S    S+ VPSVQ++VK+     VP RY+   ++    A +S     +PVIDM 
Sbjct  1    MEANGASKHHSSIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACESGLKAEIPVIDMS  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S  +   E++KL LACK+WGFF L+NHGV+   +++ K +IQDFFNLP+EEK++  Q
Sbjct  61   RLSSSTTMDSEIEKLDLACKEWGFFQLVNHGVDSGFLDKFKSQIQDFFNLPMEEKKKLWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              GD +GFGQ FVVSEEQKLDWAD+F+L  LP   R P++FPK+P   R+T+ETYS E+ 
Sbjct  121  KPGDIEGFGQAFVVSEEQKLDWADMFHLTVLPARFRKPHVFPKIPLPLRDTLETYSAELK  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             ++  +   +A  L I  EEM  LF++ + Q MRMNYYPPCPE + V+GL+ HSD+ G+T
Sbjct  181  SIAKILFAKMAVALKINPEEMEKLFDDDLGQIMRMNYYPPCPEPDQVIGLTSHSDSTGVT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKK G W  + P+PNAFVVNVGD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVEGLQIKKKGKWVSVKPLPNAFVVNVGDMIEIVTNGTYRSIEHRGVVN  295



>ref|XP_010540138.1| PREDICTED: protein SRG1-like [Tarenaya hassleriana]
Length=387

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 211/300 (70%), Gaps = 11/300 (4%)
 Frame = +3

Query  51   IAMEADAQSLGLSLPVPSVQQLVKDNPN--VVPSRYIHDGVESPASAKSIA-----AVNV  209
            +AME + +    SL VPSVQ+LVKD+ N   VP RY+      P  A  I         +
Sbjct  27   VAMEVEGKRQWSSLIVPSVQELVKDHENNADVPPRYVR--WSDPDKADEIVDGFGPRPEI  84

Query  210  PVIDMQKLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEE  383
            P+IDM +L SE++   E+QKL  AC++WGFF L+NHG++   +++VK EIQDFF+LP+EE
Sbjct  85   PIIDMNRLCSESAMDSEIQKLDFACREWGFFQLVNHGIDSCFLDKVKDEIQDFFDLPMEE  144

Query  384  KQRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIET  563
            K+++ Q   + +GFGQ FVVSE+QKLDW+D+F++   P   R P+LF KLP  FR+T+ET
Sbjct  145  KRKFWQKPSEIEGFGQAFVVSEDQKLDWSDMFFVTIQPPRSRKPHLFRKLPLPFRDTLET  204

Query  564  YSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSD  743
            YS  +  ++  +L  +A  L IK +EM  LF++ MQ MRMN  PPCP+ + V G++PHSD
Sbjct  205  YSSGVKDIAKLLLAKMAHALKIKPDEMEDLFDDLMQGMRMNSSPPCPKPDQVTGITPHSD  264

Query  744  AGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            A GLT+LLQVNE  GL+IKKDG W P+ P+PNAF+VN+GD +EI +NG YRS+EHRA+V+
Sbjct  265  AVGLTVLLQVNEVEGLQIKKDGKWVPVKPLPNAFIVNIGDILEIITNGTYRSVEHRAMVN  324



>ref|XP_010459259.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 208/295 (71%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASA--KSIAAVNVPVIDMQ  227
            MEA  ++   S+ VPSVQ++V++     VP RY+    E        S  +  +P+IDM+
Sbjct  1    MEAKGETSWSSIIVPSVQEMVEEKMITTVPPRYVRYDHEDKTEVLDDSGLSTEIPIIDMK  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L +  +   E++KL  ACK+WGFF L+NHG++ S VE++K EIQDFFNLP+EEK++  Q
Sbjct  61   RLCASTAVDSEIEKLDFACKEWGFFQLVNHGMDPSFVEKIKSEIQDFFNLPMEEKKKLWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
                 +GFGQ FVVS++QKLDW D+F+L T P   R P+LFPKLP  FR+T+E YS ++ 
Sbjct  121  QPKVMEGFGQAFVVSDDQKLDWGDLFFLVTQPVQFRKPHLFPKLPLPFRDTVEMYSTQVG  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             ++  ++  +A+ L IK EEM  LF + M QSMRMNYYPPCP+ + V GL+PHSDA GLT
Sbjct  181  NIAKILIAKMAEALQIKPEEMEELFGDDMSQSMRMNYYPPCPQPDQVTGLTPHSDAVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKK+G W  + P+PNAF+VNVGD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVDGLQIKKNGKWVSVKPLPNAFIVNVGDILEIITNGTYRSIEHRGMVN  295



>ref|XP_002270474.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=355

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 201/289 (70%), Gaps = 2/289 (1%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-QS  239
            A  QS     P+ SVQ+L+K+    VP  +I D  + P  + S     +P IDM+ L  S
Sbjct  2    ALTQSSSFRAPIQSVQELIKEPIPAVPQPFILDDPQPPILSASTPLPLLPTIDMKHLIMS  61

Query  240  ENS-EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDT  416
            E +  EL+KLH  CK WGFF L+NHGV+ SLVE++K EI +F+ LPLEE+ +Y    GD 
Sbjct  62   ETAGSELEKLHSTCKQWGFFQLVNHGVSSSLVEKLKSEIGEFYKLPLEERMKYKMRPGDV  121

Query  417  DGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMK  596
            +G+G L + SE+QKLDWAD FY+ T P + R P L P+LP + R+++E Y  E+ KL+M 
Sbjct  122  EGYGHLPIRSEDQKLDWADRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLAMM  181

Query  597  VLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVN  776
            +L F+AK L ++  EM  LFE+GMQS+RM YYPPCPE E VMGL+PHSDA G+TILLQ+N
Sbjct  182  LLGFMAKALKLEKGEMEELFEDGMQSVRMTYYPPCPEPELVMGLTPHSDATGITILLQIN  241

Query  777  ETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
               GL+IKKDG W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  242  GVDGLQIKKDGVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  290



>ref|XP_002869680.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45939.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 202/284 (71%), Gaps = 5/284 (2%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQKLQSEN--SEE  254
            S+ VPSVQ++VK+N    VP RY+  D  ++  +  S     +P+IDM  L S      E
Sbjct  10   SIIVPSVQEMVKENMITAVPPRYVRSDQDKAEIAVDSGLRNQIPIIDMCLLCSPTCMDSE  69

Query  255  LQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQL  434
              KL  ACK+WGFF L+NHG++ S +++ K EIQDFFNLP+EEK++  Q  GD +GFGQ 
Sbjct  70   TDKLDFACKEWGFFQLVNHGMDSSFLDKFKTEIQDFFNLPMEEKKKLWQQPGDIEGFGQA  129

Query  435  FVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLA  614
            FVVSEEQKLDWAD+F+L   P  +R P+LFPKLP  FR+T++ YS E+  ++  +   +A
Sbjct  130  FVVSEEQKLDWADMFFLTMQPVQLRKPHLFPKLPLPFRDTLDMYSAEVKSIAKVLFGKIA  189

Query  615  KNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
              L IK EEM  LF++ + Q +RMNYYPPCPE + V+GL+PHSDA GLTILLQVNE  GL
Sbjct  190  SALKIKPEEMEKLFDDELGQRIRMNYYPPCPEPDKVIGLTPHSDATGLTILLQVNEVDGL  249

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKKDG W  + P+PNAFVVNVGD +EI +NG YRSIEHR +V+
Sbjct  250  QIKKDGKWVSVKPLPNAFVVNVGDILEIITNGTYRSIEHRGVVN  293



>ref|XP_010498039.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=361

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASAKSIA--AVNVPVIDMQKLQSENS--E  251
            S+ VPSVQ++VK+     VPSRY+    +           +  +P+IDM++L S  +   
Sbjct  13   SIIVPSVQEMVKEKIITTVPSRYVRSDQDKTDVVDDSGRLSTEIPIIDMKRLCSSTAMDS  72

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            E++KL  ACK+WGFF L+NHG++   +++ K EI DFFNLP+EEK+++ Q   + +GFGQ
Sbjct  73   EVEKLDFACKEWGFFQLVNHGIDPDFLDKTKSEIHDFFNLPMEEKKKFWQQPNEIEGFGQ  132

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVSEEQKLDWAD+F+    P  IR P+L PKLP  FR+T+ETYS E+  ++  ++  +
Sbjct  133  AFVVSEEQKLDWADLFFHTVKPVEIRRPHLVPKLPLPFRDTLETYSTEVQSIAKILIAKM  192

Query  612  AKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETT  785
            AK L I+ EEM  LF+  +  QSMRMNYYPPCP+ + V+G++PHSD+ GLTIL+QVNE  
Sbjct  193  AKALEIRPEEMEKLFDDVDSAQSMRMNYYPPCPQPDQVIGVTPHSDSVGLTILMQVNEVE  252

Query  786  GLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+IKKDG W P+ P+PN+F+VN+GD +EI +NG YRSIEHR +V+
Sbjct  253  GLQIKKDGKWVPVKPLPNSFIVNIGDVLEIITNGTYRSIEHRGVVN  298



>ref|XP_009610868.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana tomentosiformis]
Length=361

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 204/285 (72%), Gaps = 4/285 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENS--  248
            + G SL VPSVQ+L  ++   +P+RY+    ES   +       VPVID++KL S +S  
Sbjct  9    NFGKSLLVPSVQELATEHLTKIPARYVRPEQESLVISDGAVVPAVPVIDLKKLISGDSMD  68

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
             ELQKLH AC++WGF  +INHG+  S +E+ KRE+ + F LP+ EK++  Q E   +GFG
Sbjct  69   SELQKLHSACQEWGFLQVINHGLTPSTLEDFKREVTELFKLPMAEKKKLWQHEDSYEGFG  128

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            QL VVSEEQKLDW+D+F + TLP +IR  NLF KLP   R+ +E Y  E+  L++ +LC 
Sbjct  129  QLNVVSEEQKLDWSDMFGITTLPPHIR--NLFQKLPLKLRDIMEAYCKEIKSLAIIILCQ  186

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            LA+ L +  +EMR LF +GMQS+R+NYYPPCPE +  +G SPHSDAG LTIL Q+NET G
Sbjct  187  LAQTLRMDEKEMRDLFGDGMQSIRVNYYPPCPEPDKTIGFSPHSDAGALTILFQLNETEG  246

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+++KDG W P+ P+PNA +VN+GD +EI SNG+YRS+EHRA+V+
Sbjct  247  LQVRKDGIWVPVKPLPNALIVNIGDMMEIVSNGVYRSVEHRAVVN  291



>emb|CDY08970.1| BnaC08g12000D [Brassica napus]
Length=358

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 208/295 (71%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLG-LSLPVPSVQQLVKDN-PNVVPSRYIHDGVESPASA-KSIAAVNVPVIDMQ  227
            MEA+  S    S+ VPSVQ++VK+     VP RY+   ++    A  S     +PVIDM 
Sbjct  1    MEANGASKHHSSIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACDSGLKAEIPVIDMS  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S  +   E++KL LACK+WGFF L+NHGV+   +++ K EIQ+FFNLP+EEK++  Q
Sbjct  61   RLCSSTTMDSEIEKLDLACKEWGFFQLVNHGVDSGFLDKFKSEIQNFFNLPMEEKKKLWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              GD +GFGQ FVVSEEQKLDWAD+F+L   P  +R P++FPK+P   R+T+ETYS E+ 
Sbjct  121  KPGDMEGFGQAFVVSEEQKLDWADMFHLTVQPARLRKPHVFPKIPLPLRDTLETYSAELK  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             ++  +   +A  L I  EEM  LF++ + Q MRMNYYPPCPE + V+GL+PHSD+ G+T
Sbjct  181  SIAKILFAKMAVALKINPEEMEKLFDDDLGQIMRMNYYPPCPEPDQVIGLTPHSDSTGVT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKK+G W  + P+PNAFVVNVGD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVEGLQIKKNGKWVSVKPLPNAFVVNVGDMIEIVTNGTYRSIEHRGVVN  295



>ref|XP_006416751.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
 gb|ESQ35104.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
Length=360

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 210/297 (71%), Gaps = 8/297 (3%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVE-SPASAKSIAAVNVPVIDMQK  230
            ME+   +   S+ VPSVQ++VK+     VP RY+   ++ +  +  S     +P+IDM++
Sbjct  1    MESKGAAQWSSIIVPSVQEMVKEKMITTVPPRYVRSDLDKTEITDGSGLNTEIPIIDMKR  60

Query  231  LQSENS----EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S  +     E++KL  ACK+WGFF L+NHG++ S +E+ K  I  FFNLP+EEK++  
Sbjct  61   LCSSTAIAMDSEVEKLDFACKEWGFFQLVNHGIDPSFLEKTKAGIHGFFNLPMEEKKKLW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q   + +GFGQ FV+SE+QKLDWAD+F+L   P   R P+LFPKLP  FR+T+ETYS E+
Sbjct  121  QLSNEIEGFGQAFVISEDQKLDWADLFFLTVQPVESRKPHLFPKLPLHFRDTLETYSAEV  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
              ++  ++  +A+ L IK EEM  LF+  + +QSMRMNYYPPCP+ + V+GL+PHSD+ G
Sbjct  181  QNVAKILVARMARALEIKPEEMLKLFDDVDSIQSMRMNYYPPCPQPDQVIGLTPHSDSVG  240

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LTILLQVN+  GL+IKKDG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  LTILLQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIVTNGTYRSIEHRGVVN  297



>ref|XP_010459260.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 207/295 (70%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            MEA       S+ VPSVQ++VK+     VPSRY+  D  ++  +  S   + +P+IDM +
Sbjct  1    MEAKGAVQWSSILVPSVQEMVKEKMITNVPSRYVRSDEDKTEVADDSGLNIEIPIIDMNR  60

Query  231  LQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S      E++KL  ACK+WGFF L+NHG++ S +++ K EIQDFFNLP+E K+++ Q 
Sbjct  61   LCSPTIMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKTKLEIQDFFNLPMEAKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+FY    P  +R P+LFPKLP  FR+T+E YS E+  
Sbjct  121  PNEIEGFGQAFVVSEDQKLDWADLFYHTVKPVELRKPHLFPKLPLPFRDTLEKYSGEVQN  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  +   +A+ L IK EEM   F   + +Q+MRMNYYPPCP+ + V+GL+PHSD+ GLT
Sbjct  181  IANILTVKMARALEIKPEEMEKFFNNVDSIQAMRMNYYPPCPQPDQVIGLTPHSDSVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IL+QVNE  GL+IK DG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR +V+
Sbjct  241  ILMQVNEVEGLQIKNDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHRGVVN  295



>ref|XP_010525534.1| PREDICTED: protein SRG1-like [Tarenaya hassleriana]
Length=356

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 204/295 (69%), Gaps = 8/295 (3%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKD-NPNVVPSRYI---HDGVESPASAKSIAAVNVPVIDM  224
            M+A+ +    SL VPSVQ+LVKD N   VP RY+    D VE      S   + +PVI+M
Sbjct  1    MDAEGERQWNSLIVPSVQELVKDKNITTVPPRYVRSDQDKVE--IVDDSGIGLEIPVINM  58

Query  225  QKLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            + L S  +   EL KL  ACK+WGFF L+NHG+    ++ +K EIQDFFN P EEK+++ 
Sbjct  59   KSLCSTTTMNSELAKLDFACKEWGFFQLVNHGIEPYFLDNLKAEIQDFFNFPTEEKKKFW  118

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q  G+ +GFGQ+FVVSE+QKLDW D F+L T P  +R P+L PKLP   R+ ++TYS E+
Sbjct  119  QRSGEIEGFGQVFVVSEDQKLDWGDSFFLTTQPVRLRKPSLLPKLPIPLRDLLDTYSTEV  178

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
              L+  +L  +A  L IK EE+   FE+  QS+RMNYYPPCPE + V+GL+ HSD   LT
Sbjct  179  KNLTKILLAKMAIALKIKPEEIEDWFEDLWQSIRMNYYPPCPEPDKVIGLTHHSDVVALT  238

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQ+NE  GL+IKKDG W PI P+PNA VVNVGD +EI +NGIYRSIEHRA+V+
Sbjct  239  ILLQMNEVEGLQIKKDGKWVPIKPLPNALVVNVGDSLEIITNGIYRSIEHRAMVN  293



>gb|KDP21181.1| hypothetical protein JCGZ_21652 [Jatropha curcas]
Length=366

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 208/287 (72%), Gaps = 4/287 (1%)
 Frame = +3

Query  75   SLGLSLPVPSVQQLVKDNPNV-VPSRYIHDGVESPAS-AKSIAAVNVPVIDMQKLQSENS  248
            +LG S+ VPSVQ+LV++   + +P RY     +SP         ++VPVID+ KL + +S
Sbjct  10   NLGKSIIVPSVQKLVEEGSLLKIPPRYAILDQDSPTVFGDGSLLLSVPVIDLGKLVAGDS  69

Query  249  --EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDG  422
               EL++L  ACK+WGFF ++NHGV   L+E  K E+++ F LP E+K++  Q   + +G
Sbjct  70   MDSELERLDAACKEWGFFQIVNHGVGTDLIESFKLEVKNLFKLPFEDKKKLWQQPDNFEG  129

Query  423  FGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVL  602
            FGQLFVVSEEQKLDW+D+F L TLP N+R+ + F K+P   R T+ETY+ EM KL++K+L
Sbjct  130  FGQLFVVSEEQKLDWSDMFGLHTLPLNVRNNDFFNKIPPILRETLETYATEMKKLAIKIL  189

Query  603  CFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNET  782
              +AK L + +EEM+ L  +G QSMRMNYYPPCPE E  +GL+PHSDA  LTILLQ+NE 
Sbjct  190  GQIAKALKMDTEEMKELTNDGYQSMRMNYYPPCPEPEKAIGLTPHSDADILTILLQLNEI  249

Query  783  TGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             GL+++K+G W P+ P+PNAFVVN+GD +EI SNG+YRSIEHRA V+
Sbjct  250  EGLQVRKEGKWIPVKPLPNAFVVNIGDMMEIVSNGVYRSIEHRATVN  296



>ref|XP_006432907.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46147.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=283

 Score =   309 bits (792),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 196/275 (71%), Gaps = 2/275 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +G SL  PS+ +L  + P   VP RY+   ++ P       +A  +PVIDM  
Sbjct  1    MEAKATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHT  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACK+WGFF L+NHGV+ SLVE+VK EIQ+FFNLP++EK+++ Q  G
Sbjct  61   LLSGDDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDEKKKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F + TLPT++R P+LFPKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFITSEEQKLDWGYGFTMFTLPTHLRKPHLFPKLPLPFRDDLEVYLTELKNLT  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE GMQS+RMNYYPPCP+ E V+G  PHSD   LTILLQ
Sbjct  181  LKILDLMAKALRMDPNDMKELFENGMQSLRMNYYPPCPQPEQVLGFKPHSDGSVLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEI  875
            +NE  GL+IKKDG WF + P+P+AF+VNVGD +E+
Sbjct  241  INEMDGLQIKKDGKWFAVKPLPDAFIVNVGDVLEV  275



>emb|CAN62525.1| hypothetical protein VITISV_002347 [Vitis vinifera]
Length=356

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 199/279 (71%), Gaps = 2/279 (1%)
 Frame = +3

Query  93   PVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-QSENS-EELQKL  266
            P+ SVQ+L+K+    VP  +I D  + P  + S     +P IDM+ L  SE +  EL+KL
Sbjct  13   PIQSVQELIKEPIPAVPQPFILDBPQPPILSASTPLPLLPTIDMKHLIMSETAGSELEKL  72

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
            +  CK+WGFF L+NHGVN SLVE++K EI +F+ LPLEE+ +Y    GD +G+G L + S
Sbjct  73   NSTCKEWGFFQLVNHGVNSSLVEKLKSEIGEFYKLPLEERMKYKMRPGDVEGYGHLPIRS  132

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EEQKLDWAD FY+ T P + R P L P+LP + R+++E Y  E+ KL+M +L F+AK L 
Sbjct  133  EEQKLDWADRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLAMMLLGFMAKALK  192

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            ++  EM  LFE+GMQS+RM YYPPCP+ E VMGL+PHSDA G+TILLQ+N   GL+IKKD
Sbjct  193  LEKXEMEELFEDGMQSVRMTYYPPCPQPELVMGLTPHSDATGITILLQINGVDGLQIKKD  252

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  253  GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  291



>ref|XP_006302461.1| hypothetical protein CARUB_v10020553mg [Capsella rubella]
 gb|EOA35359.1| hypothetical protein CARUB_v10020553mg [Capsella rubella]
Length=353

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 206/282 (73%), Gaps = 4/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            SL VPSVQ++V++     VP RY+  D  ++  S+++     +P+IDM  L S +SE + 
Sbjct  10   SLIVPSVQEMVEEKMITAVPPRYVRSDQDKAEISSETGLRNEIPIIDMSLLSSLDSE-ID  68

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KL  ACK+WGFF L+NHG++ + +E+ K EIQDFFN P+EEK++  Q   D +GFGQ+FV
Sbjct  69   KLDFACKEWGFFQLVNHGMDSTFLEKFKSEIQDFFNFPMEEKKKLWQQPDDIEGFGQVFV  128

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSEEQKLDW+D+F+L   P  +R P+LFP LP  FR T++TYS E+  ++  +L  +A  
Sbjct  129  VSEEQKLDWSDMFFLTMQPVQLRKPHLFPNLPLPFRETLDTYSAEVKSIAKILLAKVAVA  188

Query  621  LGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
            L IKSEEM  LF++ + Q +R+NYYPPCPE + V+GL+PHSD+ GLTILLQVNE  GL+I
Sbjct  189  LKIKSEEMEELFDDELGQRLRLNYYPPCPEPDKVIGLTPHSDSTGLTILLQVNEVDGLQI  248

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KK+G W  + P+PNAFVVN+GD +EI +NG YRSIEHR +V+
Sbjct  249  KKNGKWVSVKPLPNAFVVNIGDILEIITNGTYRSIEHRGVVN  290



>ref|XP_009109218.1| PREDICTED: protein SRG1-like [Brassica rapa]
Length=358

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/295 (52%), Positives = 205/295 (69%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLG-LSLPVPSVQQLVKDN-PNVVPSRYIHDGVESPASAKSIA-AVNVPVIDMQ  227
            MEA+  S    S+ VPSVQ++VK+     VP RY+   ++    A        +PVIDM 
Sbjct  1    MEANGASKHHSSIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACEFGLKAEIPVIDMS  60

Query  228  KLQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
            +L S  +   E++KL LACK+WGFF L+NHGV+   +++ K +IQDFFNLP+EEK++  Q
Sbjct  61   RLCSSTTMDSEIEKLDLACKEWGFFQLVNHGVDSGFLDKFKSQIQDFFNLPMEEKKKLWQ  120

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
              GD +GFGQ FVVSEEQKLDWAD+F+L  LP   R P++FPK+P   R+T+ETYS E+ 
Sbjct  121  KPGDIEGFGQAFVVSEEQKLDWADMFHLTVLPARFRKPHVFPKIPLPLRDTLETYSAELK  180

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
             ++  +   +A  L I  EEM  LF++ + Q MRMNYYPPCPE + V+GL+ HSD+ G+T
Sbjct  181  SIAKILFAKMAVALKINPEEMEKLFDDDLGQIMRMNYYPPCPEPDQVIGLTSHSDSTGVT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            ILLQVNE  GL+IKK G W  + P+PNAFVVNVGD +EI +NG YRSIEHR +V+
Sbjct  241  ILLQVNEVEGLQIKKKGKWVSVKPLPNAFVVNVGDMIEIVTNGTYRSIEHRGVVN  295



>ref|XP_003614589.1| SRG1-like protein [Medicago truncatula]
 gb|AES97547.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 204/282 (72%), Gaps = 0/282 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G S+ VPSVQ+L K     +P +Y+H   +    + + +   VPVID+ KL SE++ EL
Sbjct  4    FGSSILVPSVQELAKQPNTEIPEQYLHPNQDPINVSNTTSLQQVPVIDLSKLLSEDATEL  63

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KL  ACK+WGFF LINHGV+  LVE VK  +Q+F +LPLEEK+++ Q + D +GFGQLF
Sbjct  64   EKLDQACKEWGFFQLINHGVDPLLVENVKIGVQEFLSLPLEEKKKFWQNQNDIEGFGQLF  123

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            V+SE QKL+WAD+F+  TLP+  R+  LFP +P+ FR+ +ETY +E+  + + ++  ++K
Sbjct  124  VLSENQKLEWADLFFTTTLPSYARNTRLFPNIPQPFRDNLETYCLELKNVCITIIKHMSK  183

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++  E+    ++  QSMRMNYYPPCP+ E+V+GL+PHSDAG LTILLQ N+  GL+I
Sbjct  184  ALKVEPNELLDSIDDITQSMRMNYYPPCPQPENVIGLNPHSDAGALTILLQANDIEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W  + P+ +AFV+NVGD +EI +NGIYRSIEHRA ++
Sbjct  244  RKDGQWISVKPLTDAFVINVGDILEILTNGIYRSIEHRATIN  285



>ref|XP_009139101.1| PREDICTED: protein SRG1-like isoform X1 [Brassica rapa]
Length=355

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 204/293 (70%), Gaps = 5/293 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDN-PNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL  233
            MEA       S+ VPSVQ++V++N    VP RY+   ++  A   S     +P+IDM  L
Sbjct  1    MEAKRGIQWSSIIVPSVQEMVEENLITTVPPRYLRSDLDK-AEIDSDLRTEIPIIDMNLL  59

Query  234  QSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             S  S   E+ KL  ACK+WGFF LINHG++ S +++VK E+QDFFNLP+EEK++  Q  
Sbjct  60   CSSTSMDSEINKLDFACKEWGFFQLINHGMDSSFLDKVKSEVQDFFNLPMEEKRKLRQRP  119

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GD +GFGQ FVVSEEQKLDW D+F L   P ++R P+LFPKLP  FR+ +E YS E+   
Sbjct  120  GDIEGFGQAFVVSEEQKLDWGDMFLLTMQPFHLRKPHLFPKLPPPFRDALEKYSSEVKST  179

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            +  +L  +A+ L IK +EM  LF + + Q +RMNYYPPCPE + V GL+PHSDA GLTIL
Sbjct  180  AKILLANMARALKIKPDEMEYLFGDDLGQKLRMNYYPPCPEPDQVYGLTPHSDATGLTIL  239

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+IKK+G W  + P+PNAFVVN+GD +E+ +NG Y+SIEHR +V+
Sbjct  240  LQVNEVEGLQIKKNGKWVSVKPLPNAFVVNIGDMLEMITNGTYKSIEHRGVVN  292



>ref|XP_010433658.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=353

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 202/282 (72%), Gaps = 4/282 (1%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASAKSIAAVN-VPVIDMQKLQSENSEELQ  260
            S+ VPSVQ++VK+N    VP RY+  G +    +      N +P+IDM  L S +SE ++
Sbjct  10   SIIVPSVQEMVKENIITAVPPRYVRSGQDKAEISSETGLRNQIPIIDMSLLSSLDSE-IE  68

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KL  ACK+WGFF L+NHG++ + +E+ K EIQDFFNLP+EEK++  Q   + +GFGQLFV
Sbjct  69   KLDFACKEWGFFQLVNHGMDSTFLEKFKSEIQDFFNLPMEEKKKLWQKPDEIEGFGQLFV  128

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
            VSEEQKLDWAD+F L   P   R  +LFPKLP  FR++++ YS E+  ++  +L  +A  
Sbjct  129  VSEEQKLDWADMFLLTMQPVRFREAHLFPKLPLPFRDSLDKYSAEVKSITKILLAKIAVA  188

Query  621  LGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
            L IK EEM  LF++ + Q +RMNYYPPCPE + V+GL+PHSD+ GLTILLQVN+  GL+I
Sbjct  189  LKIKPEEMEELFDDELGQRIRMNYYPPCPEPDKVIGLTPHSDSTGLTILLQVNDVDGLQI  248

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KKDG W  + P+PNA VVN+GD +EI +NG YRSIEHR +V+
Sbjct  249  KKDGKWVTVKPLPNALVVNIGDILEIITNGTYRSIEHRGVVN  290



>gb|AFK45966.1| unknown [Medicago truncatula]
Length=353

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 198/277 (71%), Gaps = 1/277 (0%)
 Frame = +3

Query  87   SLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQKL  266
            S+  PSVQ+L +     VP +Y+    +S   + + ++  +P+ID  KL  E+  EL+KL
Sbjct  5    SILAPSVQELAEQGITKVPEQYLQPNQDSILVSNTTSSPQLPIIDFDKLLCEDGIELEKL  64

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
              ACK+WGFF LINHGVN SLVE VK  +Q FF+LP+EEK+++ Q E +  G GQ++V  
Sbjct  65   DNACKEWGFFQLINHGVNPSLVESVKIGVQQFFHLPMEEKKKFWQTEEELQGSGQVYVAL  124

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EEQKL W D+FY+KT P +IR P+L P +P+ FR+  E YS+E+ KL  K++  + K L 
Sbjct  125  EEQKLRWGDMFYVKTFPLHIRLPHLIPCMPQPFRDDFENYSLELKKLCFKIIERMTKALK  184

Query  627  IKS-EEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKK  803
            I+   E+   FEEG QS+RMNYYPPCP+ + V+GL+PHSDA  LTILLQVNE  GL+IKK
Sbjct  185  IQQPNELLDFFEEGDQSIRMNYYPPCPQPDQVIGLNPHSDASALTILLQVNEMQGLQIKK  244

Query  804  DGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRA  914
            DG W PI P+PNAFVVN+GD +EI +NGIYRSIEHRA
Sbjct  245  DGMWVPINPLPNAFVVNIGDLLEIMTNGIYRSIEHRA  281



>ref|XP_003638414.1| SRG1-like protein [Medicago truncatula]
Length=400

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/348 (47%), Positives = 213/348 (61%), Gaps = 59/348 (17%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G SL VPSVQ+L K+  + VP RYI    +     ++ + + +PVIDM+KL 
Sbjct  1    MEEIKNPSGTSLLVPSVQELAKEKISTVPPRYIQSQHDELVINEANSILEIPVIDMKKLL  60

Query  237  S--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S    S EL KLHLACKDWGFF L+NH V+ SLVE+VK E QDFFNLP+ EK+++ Q   
Sbjct  61   SLEYGSLELSKLHLACKDWGFFQLVNHDVSSSLVEKVKLETQDFFNLPMSEKKKFWQTPH  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPE-----------------  539
              +GFGQ FVVS+EQKLDWAD+F++ TLP + R P+LFP+LP                  
Sbjct  121  HMEGFGQAFVVSDEQKLDWADIFFMTTLPKHSRMPHLFPQLPLPICVDSYTVFVFESCLL  180

Query  540  -----AFRNTIETYSVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCP  704
                 + R+T E YS E+ KLSM ++ ++ K L +  +EM M FE+ +QSMRMNYYPPCP
Sbjct  181  NLCSLSCRDTFELYSTELKKLSMVIVDYMGKALKMDEKEMSMFFEDDVQSMRMNYYPPCP  240

Query  705  ESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVE----  872
            + E V+GL+PHSD   LTILLQ+N+  GL+++KDG W P+ P+PNAF+VN+GD +E    
Sbjct  241  QPEKVIGLTPHSDGSALTILLQLNDVEGLQVRKDGMWVPVKPLPNAFIVNIGDMLEVKNI  300

Query  873  -------------------------------IFSNGIYRSIEHRALVS  923
                                           I +NGIYRSIEHRA V+
Sbjct  301  YSFIKHFVVSYDSRNPIAFTIYLETLSLSHCIMTNGIYRSIEHRATVN  348



>ref|XP_002270078.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=362

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 200/279 (72%), Gaps = 2/279 (1%)
 Frame = +3

Query  93   PVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-QSENS-EELQKL  266
            P+ S+Q+L+K+    VP  +I D  + P  + +     +P IDM+ L  SE +  EL+KL
Sbjct  13   PIQSIQELIKEPIPAVPQPFILDDPQPPILSANTPLPLLPTIDMKHLIMSETAGSELEKL  72

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
            H  CK+WGFF L+NHGVN SLVE++K EI +F+ LPLEE+ +Y    GD +G+G L + S
Sbjct  73   HSTCKEWGFFQLVNHGVNSSLVEKLKSEIGEFYKLPLEERMKYKMRPGDVEGYGHLPIRS  132

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            E+QKLDWAD FY+ T P + R P L P+LP + R+++E Y  E+ KL+M +L F+AK L 
Sbjct  133  EDQKLDWADRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLAMMLLGFMAKALK  192

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            ++  EM  LFE+GMQS+RM+YYPPCP+ E VMGL+PHSDA G+TILLQ+N   GL+IKKD
Sbjct  193  LEKGEMEELFEDGMQSVRMSYYPPCPQPELVMGLTPHSDATGITILLQINGVDGLQIKKD  252

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  253  GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  291



>emb|CBI30782.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 200/279 (72%), Gaps = 2/279 (1%)
 Frame = +3

Query  93   PVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL-QSENS-EELQKL  266
            P+ S+Q+L+K+    VP  +I D  + P  + +     +P IDM+ L  SE +  EL+KL
Sbjct  13   PIQSIQELIKEPIPAVPQPFILDDPQPPILSANTPLPLLPTIDMKHLIMSETAGSELEKL  72

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
            H  CK+WGFF L+NHGVN SLVE++K EI +F+ LPLEE+ +Y    GD +G+G L + S
Sbjct  73   HSTCKEWGFFQLVNHGVNSSLVEKLKSEIGEFYKLPLEERMKYKMRPGDVEGYGHLPIRS  132

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            E+QKLDWAD FY+ T P + R P L P+LP + R+++E Y  E+ KL+M +L F+AK L 
Sbjct  133  EDQKLDWADRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLAMMLLGFMAKALK  192

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            ++  EM  LFE+GMQS+RM+YYPPCP+ E VMGL+PHSDA G+TILLQ+N   GL+IKKD
Sbjct  193  LEKGEMEELFEDGMQSVRMSYYPPCPQPELVMGLTPHSDATGITILLQINGVDGLQIKKD  252

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  253  GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  291



>ref|XP_009149139.1| PREDICTED: protein SRG1-like [Brassica rapa]
Length=360

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 210/296 (71%), Gaps = 7/296 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            MEA  ++   S+ VPSVQ+LV++     VP RY+  D  +S  +  S    ++PVIDM++
Sbjct  1    MEAKGETQWSSIIVPSVQELVEEKVITTVPLRYVQSDQDKSGVTDDSGLIPDIPVIDMKR  60

Query  231  LQS----ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYG  398
            L S    ++  E+QKL LACK++GFF L+NHG++ + +++ K E  D F+LP+EEK+R+ 
Sbjct  61   LCSSAAKDSDSEVQKLDLACKEFGFFQLVNHGIDQTFLDKTKLETHDLFSLPMEEKKRFW  120

Query  399  QAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEM  578
            Q   + +GFGQ FV+SE+QKLDWAD+F+    PT +R P+LFPKLP  FR+T+E YS ++
Sbjct  121  QQPDEMEGFGQAFVLSEDQKLDWADIFFFTMQPTQLRKPHLFPKLPLPFRDTLEMYSAQV  180

Query  579  HKLSMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGL  755
              ++  ++  +   L IK EE+   F + M QSMRMNYYPPCPE   V+GL+PHSDAG L
Sbjct  181  KSIAKTLIAKMGDALQIKPEEIEERFRDDMFQSMRMNYYPPCPEPNQVIGLTPHSDAGAL  240

Query  756  TILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            TILLQVNE  GL+IKKDG W  + P+PNAF+VNVGD +EI +NGIY+SIEHR +V+
Sbjct  241  TILLQVNEVEGLQIKKDGKWVFVKPLPNAFIVNVGDVLEIITNGIYKSIEHRVVVN  296



>ref|XP_010448451.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=354

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/287 (55%), Positives = 203/287 (71%), Gaps = 13/287 (5%)
 Frame = +3

Query  87   SLPVPSVQQLVK-DNPNVVPSRYIHDGVESPASAKSIAAVN------VPVIDMQKLQSEN  245
            S+ VPSVQ+LVK D    VP RY    V S    K+  AV+      +P+IDM  L S +
Sbjct  10   SIIVPSVQELVKEDMITAVPPRY----VRSSQVDKAEVAVDSDLRNQIPIIDMSLLSSLD  65

Query  246  SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGF  425
            SE + KL  ACK+WGFF L+NHG++ S +E+ K EIQDFFNLP+EEK++  Q   + +GF
Sbjct  66   SE-IDKLDFACKEWGFFQLVNHGMDSSFLEKFKSEIQDFFNLPMEEKKKLWQKPDEIEGF  124

Query  426  GQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLC  605
            GQLFVVSEEQKLDWAD+F L   P  +R  +LFPKLP  FR+T++ YS E+  ++  +L 
Sbjct  125  GQLFVVSEEQKLDWADMFLLTMQPVRLREAHLFPKLPLPFRDTLDKYSAEVKSITKFLLA  184

Query  606  FLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNET  782
             +A  L IK EEM  LF++ + Q MRMNYYPPCPE + V+GL+PHSD+ GLTILLQVN+ 
Sbjct  185  KIAVALKIKPEEMEELFDDELGQRMRMNYYPPCPEPDKVIGLTPHSDSTGLTILLQVNDV  244

Query  783  TGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             GL+IKKDG W  + P+PNA VVN+GD +EI +NG YRSIEHR +V+
Sbjct  245  DGLQIKKDGKWVTVKPLPNALVVNIGDILEIVTNGTYRSIEHRGVVN  291



>ref|XP_008373604.1| PREDICTED: S-norcoclaurine synthase 1-like [Malus domestica]
Length=357

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 204/285 (72%), Gaps = 3/285 (1%)
 Frame = +3

Query  72   QSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVE-SPASAKSIAAVNVPVIDMQKLQSENS  248
            + LG SLPV +VQ L       +P RYI   ++  PAS +   ++ +PV+D  KL  ++ 
Sbjct  11   KDLGGSLPVENVQALASSTLKEIPPRYIRPEIQHEPASVED--SLQIPVVDTNKLNDDDD  68

Query  249  EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFG  428
            +EL KLHLACK+WGFF LINH V   +++++K + ++FF LPLE K+ Y Q     +G+G
Sbjct  69   DELAKLHLACKEWGFFQLINHDVPEEVIKKMKSDTEEFFQLPLEVKKAYAQLPNHIEGYG  128

Query  429  QLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCF  608
            Q FVVSE+QKLDW D+ +L + P ++R+   +P LP +FR T++ YS E+ ++++ +   
Sbjct  129  QAFVVSEDQKLDWGDMLFLLSQPLSLRNLTFWPTLPTSFRETLDKYSEELQQVTLYIWKL  188

Query  609  LAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTG  788
            + KNLG+ SEEM  +FE+G Q +RMNYYPPC ++  VMGL+PHSDA GLT+L+QVNE  G
Sbjct  189  ICKNLGLNSEEMESMFEDGTQGLRMNYYPPCQQASRVMGLTPHSDAVGLTLLVQVNEVQG  248

Query  789  LEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            L+IKK+G W P+ P+P+AF+VN+GD +EI SNG Y+SIEHRA+V+
Sbjct  249  LQIKKNGRWVPVKPVPSAFIVNIGDIIEIMSNGEYKSIEHRAVVN  293



>ref|XP_003632981.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=362

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 199/279 (71%), Gaps = 2/279 (1%)
 Frame = +3

Query  93   PVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQK-LQSENS-EELQKL  266
            P+ SVQ+L+K+    VP  +I D  + P  + S     +P IDM+  + SE +  EL+KL
Sbjct  13   PIQSVQELIKEPIPAVPQPFILDNPQPPILSASTPLPLLPTIDMKHVIMSETAGSELEKL  72

Query  267  HLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFVVS  446
            +  CK+WGFF L+NHGVN SLVE++K EI +F+ LPLEE+ +Y    GD +G+G L + S
Sbjct  73   NSTCKEWGFFQLVNHGVNSSLVEKLKSEIGEFYKLPLEERMKYKMRPGDVEGYGHLPIRS  132

Query  447  EEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKNLG  626
            EEQKLDWAD FY+ T P + R P L P+LP + R+++E Y  E+ KL+M +L F+AK L 
Sbjct  133  EEQKLDWADRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLAMMLLGFMAKALK  192

Query  627  IKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIKKD  806
            ++  EM  LF++GMQS+RM YYPPCP+ E VMGL+PHSDA G+TILLQ+N   GL+IKKD
Sbjct  193  LEKREMEELFDDGMQSVRMTYYPPCPQPELVMGLTPHSDATGITILLQINGVDGLQIKKD  252

Query  807  GTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            G W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  253  GVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  291



>ref|XP_008238358.1| PREDICTED: S-norcoclaurine synthase 1-like [Prunus mume]
Length=369

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 208/299 (70%), Gaps = 7/299 (2%)
 Frame = +3

Query  45   LYIAMEADAQS---LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPV  215
            L + ME +  S   LG SLPV +VQ L  +N   +P RYI   +E    +    ++ +PV
Sbjct  8    LGVRMETEVLSRKDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSME-DSLQIPV  66

Query  216  IDMQKLQSE---NSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEK  386
            +DM KL  +   + +EL KLHLACKDWGFF LINHGV+  ++E++K + ++FF LPLEEK
Sbjct  67   VDMSKLMGDPLGHGDELAKLHLACKDWGFFQLINHGVSEEVIEKIKSDTKEFFQLPLEEK  126

Query  387  QRYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETY  566
            + Y Q     +G+GQ FVVSEEQKLDW D+ +L + P + R+   +P LP +FR T++ Y
Sbjct  127  KAYAQLPNHIEGYGQAFVVSEEQKLDWGDMLFLLSQPVSQRNLTFWPTLPASFRETLDKY  186

Query  567  SVEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDA  746
            SVE+ +++  +   + +NL + SE++  +FE+G Q +RMNYYPPCP++  VMGL+PHSDA
Sbjct  187  SVELQEVTKYLWKLICENLRLNSEKLASMFEDGTQGLRMNYYPPCPQASRVMGLTPHSDA  246

Query  747  GGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
             GLT+L+QVN+  GL+IK +G W PI P+P A +VN+GD +EI SNG Y+SIEHRA+V+
Sbjct  247  VGLTLLIQVNDVQGLQIKNNGKWVPITPVPGALIVNIGDIIEILSNGEYKSIEHRAVVN  305



>ref|XP_010498040.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 204/295 (69%), Gaps = 6/295 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            MEA       S+ VPSVQ++VK+     VPSRY+  D  ++  +  S   + +P+IDM +
Sbjct  1    MEAKGAVQWSSILVPSVQEMVKEKMITNVPSRYVRSDEDKTEVADDSGLNIEIPIIDMNR  60

Query  231  LQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S      E+ KL  ACK+WGFF L+NHG++ S +++ K EIQDFFNLP+E K+++ Q 
Sbjct  61   LCSPTIMDSEIAKLDFACKEWGFFQLVNHGIDSSFLDKTKLEIQDFFNLPMEAKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
              + +GFGQ FVVSE+QKLDWAD+FY    P  +R P+LFPKLP  FR+T+E YS E+  
Sbjct  121  PNEIEGFGQAFVVSEDQKLDWADLFYHTVKPVELRKPHLFPKLPLPFRDTLEKYSAEVQN  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLT  758
            ++  +   +A+ L IK EEM   F   + +Q+MRMNYYPPCP+ + V+GL+PHSD+ GLT
Sbjct  181  IANILTVKMARALEIKPEEMEFFFNNVDSIQAMRMNYYPPCPQPDQVIGLTPHSDSVGLT  240

Query  759  ILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            IL+ VNE  GL+IK DG W P+ P+PNAF+VN+GD +EI +NG YRSIEHR + +
Sbjct  241  ILMPVNEVEGLQIKNDGKWIPVKPLPNAFIVNIGDILEIITNGTYRSIEHRGVAN  295



>ref|XP_002279610.1| PREDICTED: S-norcoclaurine synthase 1-like [Vitis vinifera]
Length=355

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 205/284 (72%), Gaps = 2/284 (1%)
 Frame = +3

Query  72   QSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE  251
            +  G SLPV +VQ L  +N + +P +Y+   ++S        ++++P IDM+KL  ++ +
Sbjct  10   KEFGGSLPVANVQALASNNSSDIPIQYLMLELQSEEVLVD-ESLHIPTIDMRKLMVDD-D  67

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            E++KLH ACKDWGFF LINHGV   ++ ++  ++QDFF L LEEK  Y Q   D +G+GQ
Sbjct  68   EMEKLHFACKDWGFFQLINHGVEEEVIVKMMMDVQDFFKLSLEEKNAYAQLPNDIEGYGQ  127

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVS +QKLDW D+ +L  LP + R+  L+PK P +FR T+E YS E+H++S+ +L  +
Sbjct  128  AFVVSRDQKLDWGDMLFLLPLPASQRNMRLWPKKPTSFRETLEKYSSELHRVSINLLRSM  187

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            AKNLGI  +++  +FE+  Q +RMNYYPPC  ++ VMGL+PHSDA GLT+L+QVNE  GL
Sbjct  188  AKNLGINPDKLATMFEDATQGVRMNYYPPCVNADKVMGLTPHSDATGLTLLVQVNEVQGL  247

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKK+G W PI P+P+AF+VN+GD +EI SNG Y+SIEHRA+V+
Sbjct  248  QIKKNGKWVPIRPVPDAFIVNIGDIIEIMSNGEYKSIEHRAVVN  291



>gb|KEH38520.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=278

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 200/278 (72%), Gaps = 2/278 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQ  236
            ME      G SL VPSVQ+L K+  + VP+RYI    E     ++ + + +PVIDM+KL 
Sbjct  1    MEEIKNPSGTSLLVPSVQELAKEKISTVPARYIQSQHEELVINEANSILEIPVIDMKKLL  60

Query  237  S--ENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            S    S EL KLHLACKDWGFF L+NH V+ SL+E+VK EI DFFNLP+ EK+++ Q   
Sbjct  61   SLEYGSLELSKLHLACKDWGFFQLVNHDVSSSLLEKVKMEIMDFFNLPMSEKKKFWQTPQ  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
              +GFGQ FV+SEEQKLDWAD+F++ TLP ++R P+LFP+LP   R+T+E YS E+  L+
Sbjct  121  HMEGFGQAFVLSEEQKLDWADLFFMTTLPKHLRMPHLFPQLPLPLRDTLELYSQEIKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L  + K+L ++  E+R LFE+G+Q MR NYYPPCP+ E V+GL+ HSD  GLTILLQ
Sbjct  181  MVILGHIEKSLKMEEMEIRELFEDGIQMMRTNYYPPCPQPEKVIGLTNHSDPVGLTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSN  884
            +NE  GL+I+K+  W P+ P+PNAF+VN+GD +E+  N
Sbjct  241  LNEVEGLQIRKNCMWVPVKPLPNAFIVNIGDMLEVKLN  278



>sp|D4N501.1|DIOX2_PAPSO RecName: Full=Probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Papaver somniferum]
 gb|ADD85330.1| scoulerine O-demethylase [Papaver somniferum]
Length=364

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/297 (52%), Positives = 206/297 (69%), Gaps = 10/297 (3%)
 Frame = +3

Query  63   ADAQSLGLSLPVPSVQQLVKDNPNVVPSRYIH--DGVESPASAKSIAA-VNVPVIDMQKL  233
            A    LG  + +PSVQ+L K     +PSRYI   + ++ P  A  I     VPVID++ L
Sbjct  4    AKLMKLGNGMSIPSVQELAKLTLAEIPSRYICTVENLQLPVGASVIDDHETVPVIDIENL  63

Query  234  QSEN----SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             S        EL +LH ACK+WGFF ++NHGV+ SLV+ VK +IQ FFNL + EK +YGQ
Sbjct  64   ISSEPVTEKLELDRLHSACKEWGFFQVVNHGVDTSLVDNVKSDIQGFFNLSMNEKIKYGQ  123

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
             +GD +GFGQ FV SE+Q LDWAD+F + TLP ++R P+LF KLP   R TIE+YS EM 
Sbjct  124  KDGDVEGFGQAFVASEDQTLDWADIFMILTLPLHLRKPHLFSKLPLPLRETIESYSSEMK  183

Query  582  KLSMKVLCFLAKNLGIKSEEMRML---FEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGG  752
            KLSM +   + K L +++ E++ +   F++  Q MRMNYYPPCP+ E  +GL+PHSD GG
Sbjct  184  KLSMVLFEKMEKALQVQAVEIKEISEVFKDMTQVMRMNYYPPCPQPELAIGLTPHSDFGG  243

Query  753  LTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LTILLQ+NE  GL+IK +G W  + P+PNAFVVNVGD +EI +NG+YRS++HRA+V+
Sbjct  244  LTILLQLNEVEGLQIKNEGRWISVKPLPNAFVVNVGDVLEIMTNGMYRSVDHRAVVN  300



>ref|XP_004490336.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=352

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 197/281 (70%), Gaps = 0/281 (0%)
 Frame = +3

Query  81   GLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEELQ  260
            G  +  PSVQ+L K     VP +Y+    +    + + +   +P+ID  KL  E+  EL+
Sbjct  3    GTPVLAPSVQELAKQGITEVPEQYLQPNQDPILVSNTTSLPQLPIIDFDKLLCEDVTELE  62

Query  261  KLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLFV  440
            KLH A K+WGFF LINHGVN SL+E VK  +++FFNLP+EEK+++ Q   +  GFGQ++V
Sbjct  63   KLHHASKEWGFFQLINHGVNSSLIENVKIGVEEFFNLPMEEKKKFWQTREELQGFGQVYV  122

Query  441  VSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAKN  620
              EE+KL W D+F++KT P ++R PNL P +P+ FR+ +++YS+++ KL  K++ F+ K 
Sbjct  123  ALEEEKLRWGDMFFVKTFPLDMRHPNLIPCIPQPFRDELDSYSLQLKKLCFKIIEFMTKA  182

Query  621  LGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEIK  800
            L  K  E+  LFE G QS+R+NYYPPCP+ E V+GL+ HSD   LTILLQVNE  GL+I+
Sbjct  183  LKTKPNELLNLFENGDQSIRINYYPPCPKPEQVIGLNSHSDGTALTILLQVNEIQGLQIR  242

Query  801  KDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            KDG W PI PI +AFVVNVGD  EI SNGIYRSIEHRA V+
Sbjct  243  KDGNWIPINPISDAFVVNVGDMFEIMSNGIYRSIEHRATVN  283



>ref|XP_006389976.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
 gb|ESQ27262.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
Length=356

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/293 (51%), Positives = 208/293 (71%), Gaps = 4/293 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKD-NPNVVPSRYIHDGVESPASAK-SIAAVNVPVIDMQK  230
            MEA+ +    SL VP V ++VK+ N   VP RY+    E+  +   S  +  +PVIDM++
Sbjct  1    MEAEGERQWSSLIVPCVLEMVKEQNLTTVPPRYVRSDQETSENLDDSSMSSEIPVIDMKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S ++   EL+KL  AC+DWGFF L+NHG++ S +++++ E+QDFFNLP+EEKQ++ Q 
Sbjct  61   LYSVSTMDSELEKLDFACQDWGFFQLVNHGIDSSFLDKLETEVQDFFNLPMEEKQKFWQR  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHK  584
             G+ +GFGQ+ VVSE+QKLDW D+F L T P   R  +LF KLP +FR T+ETYS E+  
Sbjct  121  SGEFEGFGQVNVVSEDQKLDWGDMFILTTEPIRSRKSHLFSKLPPSFRETVETYSSEVKS  180

Query  585  LSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            ++  +   +A  L IK EEM  LFE+  QS+++NYYPPCP+ + V+GL+PHSDA GLTIL
Sbjct  181  IAKILFAKMASVLEIKREEMEDLFEDVWQSIKINYYPPCPQPDQVVGLTPHSDAAGLTIL  240

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVN+  GL+IKKDG W  + P+ NA VVNVG+ +EI +NG YRSIEHR +V+
Sbjct  241  LQVNQVEGLQIKKDGKWVVVKPLRNALVVNVGEILEIITNGRYRSIEHRVVVN  293



>ref|XP_006494099.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=359

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 204/291 (70%), Gaps = 2/291 (1%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESP-ASAKSIAAVNVPVIDMQK  230
            MEA A  +  SL  PS+ +L  + P   VP RY+   ++ P       +A  +PVIDM K
Sbjct  1    MEAKATVIASSLVEPSILELANNKPLTTVPPRYVRPDIDHPLIRNDESSAEQLPVIDMHK  60

Query  231  LQSENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
            L S +  EL+KL  ACKDWGFF LINHGV CSLVE+VK E  DFF+LP++EK+++ Q  G
Sbjct  61   LVSGDDSELEKLDRACKDWGFFQLINHGVRCSLVEKVKAETLDFFDLPIDEKRKFWQQPG  120

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +GFGQLF+ SEEQKLDW   F L TLP  +R  +L PKLP  FR+ +E Y  E+  L+
Sbjct  121  DIEGFGQLFIASEEQKLDWGYGFTLFTLPNYLRKLHLLPKLPLPFRDDLEVYLSELKNLA  180

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            +K+L  +AK L +   +M+ LFE G+QS+RMNYYPPCP+ E V+G++ H DA  LTILLQ
Sbjct  181  LKILDQMAKALRMDPNDMKELFENGVQSLRMNYYPPCPQPEQVIGINSHCDASALTILLQ  240

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +N+  GL+IKKDG W  + P+P+AF+VN+GD +E+F+NG YRSIEHRA ++
Sbjct  241  INQMDGLQIKKDGKWVAVRPLPDAFIVNIGDILEVFTNGTYRSIEHRATMN  291



>emb|CDY21769.1| BnaA09g45200D [Brassica napus]
Length=364

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 210/301 (70%), Gaps = 12/301 (4%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDN-PNVVPSRYIH-DGVESPASAKSIAAVNVPVIDMQK  230
            ME+   +   S+ VPSVQ++VK+     VP RY+  D  ++  +  S     +P+IDM++
Sbjct  1    MESKGAAQWSSIIVPSVQEMVKEKMVTTVPPRYVRPDQDKTEITDGSGLNTEIPIIDMKR  60

Query  231  LQSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQA  404
            L S  +   E++KL  ACK+WGFF L+ HG++ S ++++K EIQ FFNLP+EEK+++ Q 
Sbjct  61   LCSSTTMHSEVEKLDFACKEWGFFQLVKHGIDPSFLDKIKLEIQGFFNLPMEEKKKFWQQ  120

Query  405  EGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH-  581
              + +GFGQ FVVSE+QKLDWAD+FY    P   R P+LFPKLP  FR+T+ETYS E+  
Sbjct  121  PNEIEGFGQAFVVSEDQKLDWADMFYHIVQPIEERKPHLFPKLPLPFRDTLETYSTEVRS  180

Query  582  -----KLSMKVLCFLAKNLGIKSEEMRMLFE--EGMQSMRMNYYPPCPESEHVMGLSPHS  740
                 +L   ++  +A+ L +K EEM  LF+  + +Q MRMNYYPPCP+ + V+GLSPHS
Sbjct  181  IAKILELDWPLIAKMARVLDVKPEEMLKLFDDVDSVQMMRMNYYPPCPQPDKVIGLSPHS  240

Query  741  DAGGLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALV  920
            D  GLTILLQVNE  GL+IKKDG W P+ P+PN+F+VN+GD +EI +NG YRSIEHR +V
Sbjct  241  DPNGLTILLQVNEVEGLQIKKDGKWVPVKPLPNSFIVNIGDVIEIITNGTYRSIEHRGVV  300

Query  921  S  923
            +
Sbjct  301  N  301



>gb|KDO43333.1| hypothetical protein CISIN_1g022160mg [Citrus sinensis]
Length=301

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 186/238 (78%), Gaps = 4/238 (2%)
 Frame = +3

Query  222  MQKLQSENSE----ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQ  389
            M KL S++ +    EL+ LH+AC+DWGFF LINHGV+ SL+E++K+EI +FF LP+EEK+
Sbjct  1    MDKLLSDSGDSTHSELENLHMACRDWGFFQLINHGVSSSLIEKLKQEIPEFFKLPMEEKK  60

Query  390  RYGQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYS  569
            +Y Q  GD +G+GQ FV+SEE KLDW+D+F + TLPT +R P+LFPKLP   R+T+E +S
Sbjct  61   KYWQQPGDVEGYGQAFVMSEETKLDWSDMFLMSTLPTYLRKPHLFPKLPLPLRDTLEAHS  120

Query  570  VEMHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAG  749
             EM+ L+ KVL  +AK L +   +M+ LFE GMQSMRMNY PPCP+ E V+GL+ HSDA 
Sbjct  121  KEMNNLAQKVLNQMAKTLRMDPNDMKELFEGGMQSMRMNYCPPCPQPELVIGLNSHSDAA  180

Query  750  GLTILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            GL+ILLQ+NE  GL+IKKDG W PI P+P+AF++N+GD +EI +NGIYRSIEHR  V+
Sbjct  181  GLSILLQINEVDGLQIKKDGMWVPIKPLPDAFIINIGDVLEIITNGIYRSIEHRGTVN  238



>ref|XP_009139110.1| PREDICTED: protein SRG1-like isoform X2 [Brassica rapa]
Length=354

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 204/293 (70%), Gaps = 6/293 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDN-PNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL  233
            MEA       S+ VPSVQ++V++N    VP RY+   ++  A   S     +P+IDM  L
Sbjct  1    MEAKRGIQWSSIIVPSVQEMVEENLITTVPPRYLRSDLDK-AEIDSDLRTEIPIIDMNLL  59

Query  234  QSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             S  S   E+ KL  ACK+WGFF LINHG++ S +++VK E+QDFFNLP+EEK++  Q  
Sbjct  60   CSSTSMDSEINKLDFACKEWGFFQLINHGMDSSFLDKVKSEVQDFFNLPMEEKRKLRQRP  119

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GD +GFGQ FVVSEEQKLDW D+F L   P ++R P+LFPKLP  FR+ +E YS E+   
Sbjct  120  GDIEGFGQAFVVSEEQKLDWGDMFLLTMQPFHLRKPHLFPKLPPPFRDALEKYSSEVKST  179

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            +  +L  +A+ L IK +EM  LF + + Q +RMNYYPPCPE + V GL+PHSDA GLTIL
Sbjct  180  AKILLANMARALKIKPDEMEYLFGDDLGQKLRMNYYPPCPEPDQVYGLTPHSDATGLTIL  239

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            LQVNE  GL+IKK+G W  + P+PNAFVVN+GD +EI +NG Y+SIEHR +V+
Sbjct  240  LQVNEVEGLQIKKNGKWVSVKPLPNAFVVNIGDMLEI-TNGTYKSIEHRGVVN  291



>ref|XP_006420284.1| hypothetical protein CICLE_v10005497mg [Citrus clementina]
 gb|ESR33524.1| hypothetical protein CICLE_v10005497mg [Citrus clementina]
Length=307

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = +3

Query  222  MQKLQSEN--SEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRY  395
            MQKL S +    EL KL  AC++WGFF L+NHGV+ SLVE+VK EIQ+FFNLP++EK+++
Sbjct  1    MQKLLSGDFMDSELGKLDHACREWGFFQLVNHGVSSSLVEKVKVEIQEFFNLPMKEKEKF  60

Query  396  GQAEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVE  575
                G+T+GFGQ FVVSEEQ+LDWA  F + TLP  +R P+LFPKLP   R+T+E +S E
Sbjct  61   WMRPGETEGFGQNFVVSEEQRLDWAYGFTMFTLPAYLRKPHLFPKLPFPLRDTLEAWSAE  120

Query  576  MHKLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGL  755
            +  LS K+L  +AK LGI + +++ LFEE MQ+MRMNYYPPCP+ E V+G + HSDA  +
Sbjct  121  LGNLSQKLLRQMAKALGIDANDVKALFEEAMQTMRMNYYPPCPKPEQVIGFNSHSDASSI  180

Query  756  TILLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            TILLQ+NET GL+IKKDG W P++P+P+AF++NVGD +E+F+NGIYRSIEHRA V+
Sbjct  181  TILLQLNETAGLQIKKDGMWVPVIPLPDAFIINVGDILEVFTNGIYRSIEHRATVN  236



>ref|XP_003632980.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=363

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 203/291 (70%), Gaps = 4/291 (1%)
 Frame = +3

Query  63   ADAQSLGL-SLPVPSVQQLVKDNPNVVPSRYIHDGVESPA-SAKSIAAVNVPVIDMQKL-  233
            A  QS  L + PV SVQ+L+K+    VP  +I D  + P  SA S     +P IDM+ L 
Sbjct  2    ASTQSYSLRAAPVQSVQELIKEPIPAVPQPFILDDPQPPILSASSTPLPLLPTIDMKHLI  61

Query  234  QSENS-EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEG  410
             SE +  EL+KLH  CK+WGFF L+NHGV+ SLVE++K EI +F+ LPLEE+ +Y    G
Sbjct  62   MSETAGSELEKLHSTCKEWGFFQLVNHGVSSSLVEKLKSEIGEFYKLPLEERMKYKMRPG  121

Query  411  DTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLS  590
            D +G+G L + SE+QK DW D FY+ T P + R P L P+LP + R+++E Y  E+ KL+
Sbjct  122  DVEGYGHLPIRSEDQKHDWGDRFYMITNPIHTRKPYLLPELPSSLRDSLECYLAELQKLA  181

Query  591  MKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQ  770
            M +L F+AK L ++  EM  LFE+GMQS+RM YYPPCP+ E VMGL+PHSDA G+TILLQ
Sbjct  182  MMLLGFMAKALQLEKGEMEELFEDGMQSVRMTYYPPCPQPELVMGLTPHSDATGITILLQ  241

Query  771  VNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +N   GL+IKKDG W P+  +P+A VVNVGD +EI SNG+Y SIEHRA V+
Sbjct  242  INGVDGLQIKKDGVWIPVSFLPDALVVNVGDVLEILSNGVYTSIEHRATVN  292



>gb|KEH17519.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 200/282 (71%), Gaps = 0/282 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G SL VPSVQ+L K     VP +Y++   +    + + +   VPVID+ KL  E++ EL
Sbjct  4    FGTSLLVPSVQELAKKPIIEVPEQYLYPNQDPIVLSNTSSLQQVPVIDLSKLLCEDASEL  63

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            QKL  ACK WGFF LINHGV+ SLVE +K  +Q+F + P+EEK++  Q   D +GFGQLF
Sbjct  64   QKLDQACKQWGFFQLINHGVSPSLVENLKIGVQEFMSRPVEEKKKLWQTPEDIEGFGQLF  123

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE QKL+WAD+F+  TLP+  R+P LFP +P+ FR+ +ETY +E+ K+ + ++  + K
Sbjct  124  VVSENQKLEWADLFFTTTLPSYARNPRLFPNIPQPFRDNLETYCLELKKVCITIITHMTK  183

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++ +EM   F++  Q+ RMNYYPPCP+ E+V+GL+PHSDA  LTILLQ N+  GL+I
Sbjct  184  ALKVEPKEMLEFFDDLTQATRMNYYPPCPQPENVIGLNPHSDADCLTILLQANDIEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W  + P+  AFVVN+GD +EI +NGIYRSIEHRA V+
Sbjct  244  RKDGQWISVKPLAGAFVVNIGDMLEILTNGIYRSIEHRATVN  285



>gb|KEH17521.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=359

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 200/282 (71%), Gaps = 0/282 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G SL VPSVQ+L K     VP +Y++   +    + + +   VPVID+ KL  E++ EL
Sbjct  4    FGTSLLVPSVQELAKKPIIEVPEQYLYPNQDPIVLSNTSSLQQVPVIDLSKLLCEDASEL  63

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            QKL  ACK WGFF LINHGV+ SLVE +K  +Q+F + P+EEK++  Q   D +GFGQLF
Sbjct  64   QKLDQACKQWGFFQLINHGVSPSLVENLKIGVQEFMSRPVEEKKKLWQTPEDIEGFGQLF  123

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE QKL+WAD+F+  TLP+  R+P LFP +P+ FR+ +ETY +E+ K+ + ++  + K
Sbjct  124  VVSENQKLEWADLFFTTTLPSYARNPRLFPNIPQPFRDNLETYCLELKKVCITIITHMTK  183

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L ++ +EM   F++  Q+ RMNYYPPCP+ E+V+GL+PHSDA  LTILLQ N+  GL+I
Sbjct  184  ALKVEPKEMLEFFDDLTQATRMNYYPPCPQPENVIGLNPHSDADCLTILLQANDIEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W  + P+  AFVVN+GD +EI +NGIYRSIEHRA V+
Sbjct  244  RKDGQWISVKPLAGAFVVNIGDMLEILTNGIYRSIEHRATVN  285



>gb|KEH27886.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 201/282 (71%), Gaps = 0/282 (0%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G S  VPSV +L K +   VP +++    ++     + +   VPVID+ KL  E++ EL
Sbjct  4    FGTSRLVPSVHELAKQSIVEVPEQFLRPNQDATHVINTDSLPQVPVIDLGKLLGEDATEL  63

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
            +KL LACK+WGFF +INHGVN SL+E+VK  I++F +LP+EEK+++ Q   D +GFGQ+F
Sbjct  64   EKLDLACKEWGFFQIINHGVNTSLIEKVKIGIKEFLSLPVEEKKKFWQTPNDMEGFGQMF  123

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVS++QKL+WAD+F + TLP + R+P LFP + + FR+ +E Y  E+ KL   ++  + K
Sbjct  124  VVSDDQKLEWADLFLITTLPLDERNPRLFPSIFQPFRDNLEIYCSEVQKLCFTIISQMEK  183

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L I+S E+  LF    Q+MR N YPPCP+ E+V+GL+PHSD G LTILLQ NE  GL+I
Sbjct  184  ALKIESNEVTELFNHITQAMRWNLYPPCPQPENVIGLNPHSDVGALTILLQANEIEGLQI  243

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KDG W P+ P+PNAFV+N+GD +EI +NGIYRSIEHRA V+
Sbjct  244  RKDGQWIPVQPLPNAFVINIGDMLEIVTNGIYRSIEHRATVN  285



>ref|XP_006355628.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=353

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/282 (53%), Positives = 199/282 (71%), Gaps = 8/282 (3%)
 Frame = +3

Query  78   LGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSEEL  257
             G SL VPSVQ+L K     +P+RY+H   E+P  +      +VPV+D+QKL S +S + 
Sbjct  10   FGKSLLVPSVQELAKQ----IPARYVHPEQETPVIS---TGASVPVLDLQKLISGDSMD-  61

Query  258  QKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQLF  437
             +LH AC+ WGF  +INHGV  SL+E+ KRE+ + F+LP+EEK++  Q E   +GFG  F
Sbjct  62   SELHSACQQWGFLQVINHGVTPSLLEDFKREVIELFSLPMEEKKKLWQQEDSLEGFGNAF  121

Query  438  VVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFLAK  617
            VVSE+QKLDW+D+F + TLP  IR  +LF  LP   R+ +E Y  E+  ++M ++C LAK
Sbjct  122  VVSEDQKLDWSDMFGIMTLPPRIRKVDLFQNLPSNLRDILEAYCKEIKSVAMIIVCQLAK  181

Query  618  NLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGLEI  797
             L +  +E R LF +GMQSMRMNYYPPCPE +  +GLS HSD G LTIL Q+NET GL++
Sbjct  182  ALRMAEKETRDLFSDGMQSMRMNYYPPCPEPDRAIGLSSHSDPGVLTILFQLNETEGLQV  241

Query  798  KKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +KD  W PI P+PNA +VNVGD +EI SNG+YRSIEHRA+V+
Sbjct  242  QKDDIWVPIKPLPNALIVNVGDMMEILSNGVYRSIEHRAIVN  283



>ref|XP_002279625.1| PREDICTED: S-norcoclaurine synthase 1 [Vitis vinifera]
 emb|CBI33969.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 207/284 (73%), Gaps = 3/284 (1%)
 Frame = +3

Query  72   QSLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKLQSENSE  251
            +  G SLPV +VQ L  DN   +P R +   ++S        + ++P+IDM+KL  ++ +
Sbjct  5    KDFGGSLPVANVQALASDNSGDIPIRDLRAELQSEEVLVD-ESPHIPIIDMRKLMVDD-D  62

Query  252  ELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAEGDTDGFGQ  431
            E++KLH ACKDWGFF LINHGV   ++E++K ++Q+FF LPLEEK  Y Q   + +G+GQ
Sbjct  63   EMEKLHFACKDWGFFQLINHGVE-EVIEKMKMDVQEFFKLPLEEKNAYAQPPNNIEGYGQ  121

Query  432  LFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKLSMKVLCFL  611
             FVVS++QKLDW D+ +L  LP ++R+  L+P+ P +FR T++ YS E+H++S+ +L  +
Sbjct  122  AFVVSQDQKLDWGDMLFLFPLPASLRNMRLWPENPTSFRETLDNYSSELHRVSINLLRSM  181

Query  612  AKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTILLQVNETTGL  791
            AKNLG+  +++  +FE+G Q +RMNYYPPC  ++ VMGL+PHSDA GLT+L+QVNE  GL
Sbjct  182  AKNLGVNPDKLASMFEDGTQGVRMNYYPPCVHADKVMGLTPHSDATGLTLLVQVNEVQGL  241

Query  792  EIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALVS  923
            +IKK+G W PI P+P+  VVN+GD +EI SNG Y+SIEHRA+V+
Sbjct  242  QIKKNGKWVPIKPVPDGLVVNIGDIIEIMSNGEYKSIEHRAVVN  285



>ref|XP_008439690.1| PREDICTED: protein SRG1-like [Cucumis melo]
Length=377

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/290 (52%), Positives = 199/290 (69%), Gaps = 4/290 (1%)
 Frame = +3

Query  54   AMEADAQ--SLGLSLPVPSVQQLVKDNPNVVPSRYIHDGVESPASAKSIAAVNVPVIDMQ  227
            +ME++ Q    G S+ VPSV +L K     +P RY     + P      +  +VPV+D+ 
Sbjct  13   SMESNTQMVDFGTSIIVPSVLELTKRAIPKIPLRYERLDQDPPIDPGRESGPSVPVVDIH  72

Query  228  KLQ--SENSEELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQ  401
             L      S E+ KLH ACK+WGFF +INHGV+ +L+EE + E++ FFNLP +EK+   Q
Sbjct  73   GLAVGGSASPEIDKLHSACKEWGFFQIINHGVSTTLLEEFRMEVESFFNLPYDEKKLLWQ  132

Query  402  AEGDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMH  581
               + +GFGQLFVVSEEQKLDW+D+FY+ TLP N+R P+LF +LP   R T+E YS E+ 
Sbjct  133  DSKNQEGFGQLFVVSEEQKLDWSDMFYITTLPLNLRKPHLFQRLPPKLRETLEAYSTEVK  192

Query  582  KLSMKVLCFLAKNLGIKSEEMRMLFEEGMQSMRMNYYPPCPESEHVMGLSPHSDAGGLTI  761
            KL+M +L  LA  L +  EEMR LF +G+QS+RMNYYPPCP  +  +G S HSDA  LTI
Sbjct  193  KLAMVILDHLAGALKMDVEEMRELFGDGVQSVRMNYYPPCPVPDKAIGFSAHSDADALTI  252

Query  762  LLQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHR  911
            L Q+NE  GL+I+KDG W  + P+PNAFVVN+GD +EI SNG+Y+SIEHR
Sbjct  253  LYQLNEVEGLQIRKDGRWIAVKPLPNAFVVNIGDIMEIVSNGVYKSIEHR  302



>ref|XP_010537691.1| PREDICTED: protein SRG1-like isoform X1 [Tarenaya hassleriana]
Length=355

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/292 (51%), Positives = 204/292 (70%), Gaps = 5/292 (2%)
 Frame = +3

Query  57   MEADAQSLGLSLPVPSVQQLVKDNP-NVVPSRYIHDGVESPASAKSIAAVNVPVIDMQKL  233
            ME        SL VPSVQ+LVKDN    VP RY+    +   +        +PVID+ +L
Sbjct  1    MEGKGARQWSSLTVPSVQELVKDNNITTVPPRYVRSDKDGVLAGDEFGN-GLPVIDLDRL  59

Query  234  QSENS--EELQKLHLACKDWGFFHLINHGVNCSLVEEVKREIQDFFNLPLEEKQRYGQAE  407
             S  +   EL+KL  AC+ WGFF L+NHGV+  L+E+ K  ++D FNLP+EEK++  Q  
Sbjct  60   CSATTMDAELEKLDSACRQWGFFQLVNHGVDTCLLEKAKEGVRDLFNLPMEEKKKLWQRS  119

Query  408  GDTDGFGQLFVVSEEQKLDWADVFYLKTLPTNIRSPNLFPKLPEAFRNTIETYSVEMHKL  587
            GD +GFGQ FV+SE+Q LDWAD+F+L + P  +R P+LFPKLP  FR+ ++ +S ++   
Sbjct  120  GDLEGFGQAFVLSEDQNLDWADMFFLTSQPVPLRRPHLFPKLPLPFRDALDAFSTQVMSK  179

Query  588  SMKVLCFLAKNLGIKSEEMRMLFEEGM-QSMRMNYYPPCPESEHVMGLSPHSDAGGLTIL  764
            +  ++  +A+ L +K EEM  LF++G+ Q+MR+NYYPPCPE + V+GL+PHSDA GLTIL
Sbjct  180  ARILISKMARALEVKPEEMEGLFDDGLWQTMRLNYYPPCPEPDKVVGLTPHSDAVGLTIL  239

Query  765  LQVNETTGLEIKKDGTWFPILPIPNAFVVNVGDCVEIFSNGIYRSIEHRALV  920
            L VNE  GL+IKKDG W P+ P+P+AFVVNVGD +EI +NG Y+S+EHRA+V
Sbjct  240  LHVNEVEGLQIKKDGGWVPVKPLPDAFVVNVGDIIEIVNNGEYQSVEHRAMV  291



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1982002837986