BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24856_g1_i2 len=800 path=[7125:0-196 3200:197-799]

Length=800
                                                                      Score     E

ref|XP_009619969.1|  PREDICTED: cyclin-dependent kinase F-4             158   3e-41   
gb|AFP20225.1|  MAP kinase                                              157   5e-41   
ref|XP_009794518.1|  PREDICTED: cyclin-dependent kinase F-4-like        151   8e-39   
ref|XP_010324488.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...    148   1e-37   
ref|XP_010324487.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...    147   3e-37   
ref|XP_006361242.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    145   1e-36   
ref|XP_006361243.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    144   3e-36   
ref|XP_009760645.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    144   4e-36   
ref|XP_009599753.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    144   5e-36   
ref|XP_009760646.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    137   6e-34   
ref|XP_009760644.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    138   6e-34   
ref|XP_009599761.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    137   8e-34   
ref|XP_009599747.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    137   9e-34   
ref|XP_006361244.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    137   1e-33   
ref|XP_006361245.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    136   2e-33   
ref|XP_010325610.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    135   5e-33   
ref|XP_010325611.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    132   7e-32   
ref|XP_006364472.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    132   8e-32   
ref|XP_011092619.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    131   1e-31   
ref|XP_011092618.1|  PREDICTED: cyclin-dependent kinase F-4-like ...    129   1e-30   
ref|XP_010278819.1|  PREDICTED: cyclin-dependent kinase F-4-like        124   3e-29   
emb|CDP14933.1|  unnamed protein product                                122   2e-28   
ref|XP_011075034.1|  PREDICTED: cyclin-dependent kinase F-4-like        120   1e-27   
ref|XP_010665218.1|  PREDICTED: cyclin-dependent kinase F-4             119   2e-27   
gb|EYU37514.1|  hypothetical protein MIMGU_mgv1a006119mg                117   7e-27   
gb|EYU37513.1|  hypothetical protein MIMGU_mgv1a006119mg                114   6e-26   
gb|EYU37515.1|  hypothetical protein MIMGU_mgv1a006119mg                114   1e-25   
ref|XP_010675667.1|  PREDICTED: cyclin-dependent kinase F-4             111   1e-24   
gb|EYU37516.1|  hypothetical protein MIMGU_mgv1a006119mg                111   1e-24   
ref|XP_006432566.1|  hypothetical protein CICLE_v10003654mg             103   8e-22   
ref|XP_007209990.1|  hypothetical protein PRUPE_ppa005252mg             100   9e-21   
ref|XP_007040811.1|  Kinase superfamily protein isoform 1             99.8    1e-20   
ref|XP_010278820.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  99.8    2e-20   
ref|XP_004300144.1|  PREDICTED: cyclin-dependent kinase F-4-like      98.6    5e-20   
gb|EYU29089.1|  hypothetical protein MIMGU_mgv1a0075472mg             97.1    5e-20   
ref|XP_008238099.1|  PREDICTED: cyclin-dependent kinase F-4           98.6    5e-20   
ref|XP_010278823.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  97.8    6e-20   
ref|XP_002519870.1|  mak, putative                                    97.4    1e-19   Ricinus communis
ref|XP_007040813.1|  Kinase superfamily protein isoform 3             97.4    1e-19   
ref|XP_011028055.1|  PREDICTED: cyclin-dependent kinase F-4           93.2    3e-18   
ref|XP_009365744.1|  PREDICTED: cyclin-dependent kinase F-4           93.6    3e-18   
ref|XP_008448596.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  92.4    6e-18   
ref|XP_008448597.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  91.7    1e-17   
gb|KHN47645.1|  Cyclin-dependent kinase F-4                           89.4    7e-17   
ref|XP_006599209.1|  PREDICTED: cyclin-dependent kinase F-4-like      89.4    7e-17   
ref|XP_008373453.1|  PREDICTED: cyclin-dependent kinase F-4           89.0    1e-16   
ref|XP_007158186.1|  hypothetical protein PHAVU_002G131400g           88.2    2e-16   
ref|XP_006414009.1|  hypothetical protein EUTSA_v10027028mg           87.8    2e-16   
ref|XP_004509543.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  87.4    3e-16   
ref|XP_003547727.1|  PREDICTED: cyclin-dependent kinase F-4-like      87.0    4e-16   
ref|XP_004146120.1|  PREDICTED: cyclin-dependent kinase F-4-like      87.0    4e-16   
gb|KGN55695.1|  hypothetical protein Csa_3G005580                     87.0    6e-16   
dbj|BAF02222.1|  putative serine/threonine protein kinase             84.3    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35422.1|  hypothetical protein JCGZ_10805                       86.3    8e-16   
ref|NP_001078408.1|  conserved peptide upstream open reading fram...  85.5    9e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02199.1|  putative serine/threonine protein kinase             85.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567574.1|  conserved peptide upstream open reading frame 25    85.5    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849407.1|  conserved peptide upstream open reading frame 25    85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002304373.2|  hypothetical protein POPTR_0003s10090g           84.3    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009108409.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  81.6    3e-14   
emb|CDY09272.1|  BnaC03g63020D                                        81.3    5e-14   
gb|KEH20316.1|  cyclin-dependent kinase                               80.9    5e-14   
ref|XP_004512408.1|  PREDICTED: cyclin-dependent kinase F-4-like      80.5    7e-14   
gb|KHF97733.1|  Cyclin-dependent kinase F-4                           79.3    1e-13   
gb|KHG16595.1|  Cyclin-dependent kinase F-4                           79.3    2e-13   
ref|XP_006285874.1|  hypothetical protein CARUB_v10007369mg           79.3    2e-13   
ref|XP_002867954.1|  hypothetical protein ARALYDRAFT_492943           79.3    2e-13   
ref|XP_010278825.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  78.6    2e-13   
gb|KHG16596.1|  Cyclin-dependent kinase F-4                           79.0    2e-13   
ref|XP_010535831.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  79.0    3e-13   
ref|XP_010110440.1|  Cyclin-dependent kinase F-4                      78.6    3e-13   
ref|XP_010278824.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  78.2    3e-13   
ref|XP_009108408.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  78.2    4e-13   
emb|CDX76497.1|  BnaA08g09030D                                        78.2    4e-13   
ref|XP_003612616.1|  Serine/threonine protein kinase ICK              77.4    7e-13   
ref|XP_009108410.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  77.0    1e-12   
ref|XP_007156359.1|  hypothetical protein PHAVU_003G279600g           77.0    1e-12   
ref|XP_010434456.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  76.6    1e-12   
ref|XP_010918078.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  76.6    2e-12   
ref|XP_010535821.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  76.3    2e-12   
gb|KHN41734.1|  Cyclin-dependent kinase F-4                           73.9    3e-12   
ref|XP_010434453.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  75.5    4e-12   
ref|XP_008799996.1|  PREDICTED: cyclin-dependent kinase F-4           75.5    4e-12   
ref|XP_009136989.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  75.1    5e-12   
ref|XP_009136988.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  74.7    7e-12   
gb|KHF97734.1|  Cyclin-dependent kinase F-4                           74.3    7e-12   
gb|KHF97732.1|  Cyclin-dependent kinase F-4                           73.9    1e-11   
ref|XP_003517078.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  73.6    1e-11   
emb|CDX98605.1|  BnaA03g43900D                                        73.6    2e-11   
ref|XP_008779080.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  73.2    2e-11   
ref|XP_006573477.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  73.2    2e-11   
emb|CDY01580.1|  BnaC07g35700D                                        73.2    2e-11   
ref|XP_009136990.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  72.8    3e-11   
ref|XP_008802975.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.4    4e-11   
ref|XP_010439765.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.4    4e-11   
ref|XP_010449400.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.4    4e-11   
ref|XP_008779081.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.0    4e-11   
ref|XP_010449399.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.0    5e-11   
ref|XP_010439764.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  72.0    5e-11   
ref|XP_010054057.1|  PREDICTED: cyclin-dependent kinase F-4           71.6    7e-11   
ref|XP_010449398.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  71.2    8e-11   
ref|XP_010439763.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  71.2    1e-10   
ref|XP_010906697.1|  PREDICTED: cyclin-dependent kinase F-4-like      70.1    2e-10   
ref|XP_008802973.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  68.9    6e-10   
ref|XP_006854198.1|  hypothetical protein AMTR_s00048p00208600        66.6    3e-09   
ref|XP_006587633.1|  PREDICTED: cyclin-dependent kinase F-4-like      66.6    3e-09   
ref|XP_010940815.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  66.2    4e-09   
ref|XP_010940813.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  65.9    5e-09   
ref|XP_010918077.1|  PREDICTED: cyclin-dependent kinase F-4 isofo...  65.9    6e-09   
ref|XP_010056182.1|  PREDICTED: cyclin-dependent kinase F-4-like      65.5    7e-09   
ref|XP_010940816.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  65.5    8e-09   
ref|XP_010940814.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  65.1    1e-08   
ref|XP_009382627.1|  PREDICTED: cyclin-dependent kinase F-4           64.3    2e-08   
ref|XP_010530391.1|  PREDICTED: cyclin-dependent kinase F-4-like      63.2    4e-08   
ref|XP_008779078.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  62.4    7e-08   
ref|XP_009388431.1|  PREDICTED: cyclin-dependent kinase F-4-like      61.2    2e-07   
gb|KCW72791.1|  hypothetical protein EUGRSUZ_E01241                   60.5    4e-07   
ref|XP_007040814.1|  Kinase superfamily protein isoform 4             58.9    1e-06   
ref|XP_009408087.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  58.5    2e-06   
ref|XP_009408091.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  58.5    2e-06   
gb|KHN11838.1|  Cyclin-dependent kinase F-4                           58.2    2e-06   
ref|XP_010228082.1|  PREDICTED: cyclin-dependent kinase F-4-like      57.4    4e-06   
ref|XP_009613848.1|  PREDICTED: cyclin-dependent kinase F-4-like      57.4    4e-06   
ref|XP_004964362.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  57.0    6e-06   
emb|CDY23116.1|  BnaC09g18700D                                        54.7    3e-05   
ref|XP_004964361.1|  PREDICTED: cyclin-dependent kinase F-4-like ...  53.9    7e-05   
ref|XP_002436374.1|  hypothetical protein SORBIDRAFT_10g001310        53.5    7e-05   Sorghum bicolor [broomcorn]
gb|AFK44618.1|  unknown                                               50.4    9e-05   
ref|XP_009400730.1|  PREDICTED: cyclin-dependent kinase F-4-like      52.8    1e-04   
ref|XP_006655724.1|  PREDICTED: cyclin-dependent kinase F-4-like      52.0    3e-04   
ref|XP_006398217.1|  hypothetical protein EUTSA_v10000881mg           50.8    5e-04   
ref|NP_001056617.1|  Os06g0116100                                     51.2    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMT27774.1|  Cyclin-dependent kinase F-4                           50.8    6e-04   
gb|AAO25540.1|  GAMYB-binding protein                                 50.8    6e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS62127.1|  Cyclin-dependent kinase F-4                           50.4    0.001   



>ref|XP_009619969.1| PREDICTED: cyclin-dependent kinase F-4 [Nicotiana tomentosiformis]
Length=449

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 115/184 (63%), Gaps = 19/184 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + ALEQK NRWS  TI+N 
Sbjct  278  LQHRFFQSCFYVPPSLRSKAAVARTPPSAG----------MKGALEQKTNRWSSSTITNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S  S  K  +  + G+ RK + N QDA  N K LKGS+KQ +KY+PPAR +P+ G  
Sbjct  328  KPRSNFSPVK--SQFSPGVQRKLQTNYQDATKNDKSLKGSVKQPAKYRPPARNVPVVGSA  385

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRASTK  280
            VK   VS+ A+KL N+ IGSGR P+KQ LPQPMK G       V  GRS+DI PGR+ ++
Sbjct  386  VKTRAVSDAAEKLANMTIGSGRAPIKQPLPQPMKAGGLHGPRDVFLGRSQDIMPGRSYSR  445

Query  279  KLAG  268
            K+AG
Sbjct  446  KVAG  449



>gb|AFP20225.1| MAP kinase [Nicotiana tabacum]
Length=470

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 115/184 (63%), Gaps = 19/184 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + ALEQK NRWS  TI+N 
Sbjct  299  LQHRFFQSCFYVPPSLRSKAAVARTPPSAG----------MKGALEQKTNRWSSSTITNS  348

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S  S  K  +  + G+ RK + N QDA  N K LKGS+KQ +KY+PPAR +P+ G  
Sbjct  349  KPRSNFSPVK--SQFSPGVQRKLQTNYQDATKNDKSLKGSVKQPAKYRPPARNVPVVGSA  406

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRASTK  280
            VK   VS+ A+KL N+ IGSGR P+KQ LPQPMK G       V  GRS+DI PGR+ ++
Sbjct  407  VKTRAVSDAAEKLANMTIGSGRAPIKQPLPQPMKAGGLHGPRDVFLGRSQDIMPGRSYSR  466

Query  279  KLAG  268
            K+AG
Sbjct  467  KVAG  470



>ref|XP_009794518.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana sylvestris]
Length=461

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 115/196 (59%), Gaps = 31/196 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C Y+PPSLRS   + RT  S G           + A+EQK NRWS GTI+N 
Sbjct  278  LQHRFFQSCFYIPPSLRSKAAVARTPPSAG----------MKGAMEQKTNRWSSGTITNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S  S  K  +  + G+ RK ++N QDA  N K LKGS+KQ +KY+PPAR  P+ G  
Sbjct  328  KPRSNFSPVK--SQFSPGVQRKLQLNYQDATKNDKSLKGSIKQPAKYRPPARNAPVVGSA  385

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------------------VVSHGR  316
            VK   VS+ A+KL N++IGS R P+K  LPQPMK G                   V  GR
Sbjct  386  VKTRAVSDAAEKLANMSIGSARAPIKHPLPQPMKAGGLHPLPQPMKAGGLHGPRDVFLGR  445

Query  315  SRDITPGRASTKKLAG  268
            S+DI PGR+ ++K+AG
Sbjct  446  SQDIMPGRSYSRKIAG  461



>ref|XP_010324488.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Solanum lycopersicum]
Length=450

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 24/187 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   +++T  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVSKTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKP-RASLNAGIPRKSEINSQDAISN-KPLKGS-LKQK-SKYQPPARKLPMP  451
            K+   +SSF P ++  + G+ RK ++N QDA  N KPLKGS +KQ+ +KY+PPAR +P+ 
Sbjct  328  KA---SSSFSPVKSQFSPGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNIPLV  384

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRA  289
            G TVK ++VS+ A+KL N++IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+
Sbjct  385  GSTVK-TRVSDAAEKLGNMSIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRS  443

Query  288  STKKLAG  268
             ++K+AG
Sbjct  444  FSRKVAG  450



>ref|XP_010324487.1| PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Solanum lycopersicum]
Length=451

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 124/186 (67%), Gaps = 21/186 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   +++T  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVSKTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGS-LKQK-SKYQPPARKLPMPG  448
            K+ S  S  K + S  AG+ RK ++N QDA  N KPLKGS +KQ+ +KY+PPAR +P+ G
Sbjct  328  KASSSFSPVKSQFS-PAGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNIPLVG  386

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRAS  286
             TVK ++VS+ A+KL N++IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+ 
Sbjct  387  STVK-TRVSDAAEKLGNMSIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRSF  445

Query  285  TKKLAG  268
            ++K+AG
Sbjct  446  SRKVAG  451



>ref|XP_006361242.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Solanum 
tuberosum]
Length=451

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 120/186 (65%), Gaps = 21/186 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVARTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKG-SLKQK-SKYQPPARKLPMPG  448
            K  S  S  K + S  AG+ RK ++N QDA  N KPLKG S+KQ+ +KY+PPAR +P+ G
Sbjct  328  KPSSNFSPIKSQFS-PAGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNVPLVG  386

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRAS  286
             T K S+VS+ ++KL N+ IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+ 
Sbjct  387  STAK-SRVSDASEKLANMTIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRSY  445

Query  285  TKKLAG  268
            ++K+AG
Sbjct  446  SRKVAG  451



>ref|XP_006361243.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Solanum 
tuberosum]
Length=450

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 122/187 (65%), Gaps = 24/187 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVARTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKP-RASLNAGIPRKSEINSQDAISN-KPLKG-SLKQK-SKYQPPARKLPMP  451
            K    +S+F P ++  + G+ RK ++N QDA  N KPLKG S+KQ+ +KY+PPAR +P+ 
Sbjct  328  KP---SSNFSPIKSQFSPGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNVPLV  384

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRA  289
            G T K S+VS+ ++KL N+ IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+
Sbjct  385  GSTAK-SRVSDASEKLANMTIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRS  443

Query  288  STKKLAG  268
             ++K+AG
Sbjct  444  YSRKVAG  450



>ref|XP_009760645.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Nicotiana 
sylvestris]
Length=450

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 114/184 (62%), Gaps = 18/184 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G+  NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKYDKWSFGSSPNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S  S+ K +  +N G+ R+ ++N Q+ + N K LK S+ Q+ KY+PP R +PM G  
Sbjct  327  KPSSNFSTVKSQVPVNTGVQRRLDMNYQEPMRNDKSLKDSVNQQPKYRPPVRNVPMVGSG  386

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRASTK  280
            V    +S+ A+KL N++IGSGR P KQ + +PMK G       + HGRS++  PGR+ ++
Sbjct  387  VTTRAISDAAEKLANVSIGSGRGPTKQPVFKPMKAGGWHGHQDLFHGRSQEFLPGRSYSR  446

Query  279  KLAG  268
            K+AG
Sbjct  447  KVAG  450



>ref|XP_009599753.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 117/185 (63%), Gaps = 19/185 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G++ NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKCDKWSFGSLPNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S  S+   +  +N G+ R+ ++N Q+ + S+K LKGS+ Q+ KY+PP R +PM G  
Sbjct  327  KPSSNFSTVTSKVPINTGVQRRLDMNYQEPMGSDKSLKGSVNQQPKYRPPVRNVPMVGSG  386

Query  441  VKPSQVSNTAKKLTNLNIGSGRP-PVKQLLPQPMKGG------VVSHGRSRDITPGRAST  283
            V    +S+ A+KL N++IGSGR  P KQ + +PMK G       + HGRS+++ PGR+ +
Sbjct  387  VTTRAISDAAEKLANVSIGSGRGRPTKQPVFKPMKAGGWHGQHDLFHGRSQELLPGRSYS  446

Query  282  KKLAG  268
            +K+AG
Sbjct  447  RKVAG  451



>ref|XP_009760646.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Nicotiana 
sylvestris]
 gb|AFP20224.1| MAP kinase [Nicotiana tabacum]
Length=425

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 114/189 (60%), Gaps = 23/189 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G+  NP
Sbjct  248  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKYDKWSFGSSPNP  296

Query  618  KSMSKTSSFKPRASLNA-----GIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP  457
            K  S  S+ K +  +N      G+ R+ ++N Q+ + N K LK S+ Q+ KY+PP R +P
Sbjct  297  KPSSNFSTVKSQVPVNTVTHVTGVQRRLDMNYQEPMRNDKSLKDSVNQQPKYRPPVRNVP  356

Query  456  MPGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPG  295
            M G  V    +S+ A+KL N++IGSGR P KQ + +PMK G       + HGRS++  PG
Sbjct  357  MVGSGVTTRAISDAAEKLANVSIGSGRGPTKQPVFKPMKAGGWHGHQDLFHGRSQEFLPG  416

Query  294  RASTKKLAG  268
            R+ ++K+AG
Sbjct  417  RSYSRKVAG  425



>ref|XP_009760644.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Nicotiana 
sylvestris]
Length=455

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 114/189 (60%), Gaps = 23/189 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G+  NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKYDKWSFGSSPNP  326

Query  618  KSMSKTSSFKPRASLNA-----GIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP  457
            K  S  S+ K +  +N      G+ R+ ++N Q+ + N K LK S+ Q+ KY+PP R +P
Sbjct  327  KPSSNFSTVKSQVPVNTVTHVTGVQRRLDMNYQEPMRNDKSLKDSVNQQPKYRPPVRNVP  386

Query  456  MPGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPG  295
            M G  V    +S+ A+KL N++IGSGR P KQ + +PMK G       + HGRS++  PG
Sbjct  387  MVGSGVTTRAISDAAEKLANVSIGSGRGPTKQPVFKPMKAGGWHGHQDLFHGRSQEFLPG  446

Query  294  RASTKKLAG  268
            R+ ++K+AG
Sbjct  447  RSYSRKVAG  455



>ref|XP_009599761.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Nicotiana 
tomentosiformis]
Length=426

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 117/190 (62%), Gaps = 24/190 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G++ NP
Sbjct  248  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKCDKWSFGSLPNP  296

Query  618  KSMSKTSSFKPRASLNA-----GIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLP  457
            K  S  S+   +  +N      G+ R+ ++N Q+ + S+K LKGS+ Q+ KY+PP R +P
Sbjct  297  KPSSNFSTVTSKVPINTVTRVTGVQRRLDMNYQEPMGSDKSLKGSVNQQPKYRPPVRNVP  356

Query  456  MPGPTVKPSQVSNTAKKLTNLNIGSGRP-PVKQLLPQPMKGG------VVSHGRSRDITP  298
            M G  V    +S+ A+KL N++IGSGR  P KQ + +PMK G       + HGRS+++ P
Sbjct  357  MVGSGVTTRAISDAAEKLANVSIGSGRGRPTKQPVFKPMKAGGWHGQHDLFHGRSQELLP  416

Query  297  GRASTKKLAG  268
            GR+ ++K+AG
Sbjct  417  GRSYSRKVAG  426



>ref|XP_009599747.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=456

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 117/190 (62%), Gaps = 24/190 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  +V            R ALEQK ++WS G++ NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKTAVAKTPPAV-----------MRGALEQKCDKWSFGSLPNP  326

Query  618  KSMSKTSSFKPRASLNA-----GIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLP  457
            K  S  S+   +  +N      G+ R+ ++N Q+ + S+K LKGS+ Q+ KY+PP R +P
Sbjct  327  KPSSNFSTVTSKVPINTVTRVTGVQRRLDMNYQEPMGSDKSLKGSVNQQPKYRPPVRNVP  386

Query  456  MPGPTVKPSQVSNTAKKLTNLNIGSGRP-PVKQLLPQPMKGG------VVSHGRSRDITP  298
            M G  V    +S+ A+KL N++IGSGR  P KQ + +PMK G       + HGRS+++ P
Sbjct  387  MVGSGVTTRAISDAAEKLANVSIGSGRGRPTKQPVFKPMKAGGWHGQHDLFHGRSQELLP  446

Query  297  GRASTKKLAG  268
            GR+ ++K+AG
Sbjct  447  GRSYSRKVAG  456



>ref|XP_006361244.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Solanum 
tuberosum]
Length=446

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 116/186 (62%), Gaps = 26/186 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVARTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGS-LKQK-SKYQPPARKLPMPG  448
            K  S  S  K + S  AG+ RK ++N QDA  N KPLKGS +KQ+ +KY+PPAR +P   
Sbjct  328  KPSSNFSPIKSQFS-PAGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNVP---  383

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRAS  286
                 S+VS+ ++KL N+ IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+ 
Sbjct  384  ---SKSRVSDASEKLANMTIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRSY  440

Query  285  TKKLAG  268
            ++K+AG
Sbjct  441  SRKVAG  446



>ref|XP_006361245.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X4 [Solanum 
tuberosum]
Length=445

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 118/187 (63%), Gaps = 29/187 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQH FFQ+C YVPPSLRS   + RT  S G           + + EQK NRWS  T++NP
Sbjct  278  LQHRFFQSCFYVPPSLRSKTAVARTPPSAG----------MKGSSEQKTNRWSSSTLTNP  327

Query  618  KSMSKTSSFKP-RASLNAGIPRKSEINSQDAISN-KPLKGS-LKQK-SKYQPPARKLPMP  451
            K    +S+F P ++  + G+ RK ++N QDA  N KPLKGS +KQ+ +KY+PPAR +P  
Sbjct  328  KP---SSNFSPIKSQFSPGVQRKLQMNYQDATRNDKPLKGSSIKQQPAKYRPPARNVP--  382

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS--H----GRSRDITPGRA  289
                  S+VS+ ++KL N+ IGSGR  +KQ  PQPMK G +   H    GRS+DI PGR+
Sbjct  383  ----SKSRVSDASEKLANMTIGSGRASIKQPFPQPMKAGGLHGQHDLFLGRSQDILPGRS  438

Query  288  STKKLAG  268
             ++K+AG
Sbjct  439  YSRKVAG  445



>ref|XP_010325610.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Solanum 
lycopersicum]
Length=453

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 110/187 (59%), Gaps = 21/187 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  S             R A+EQK  +WS G   NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKAAVAKTPPS----------AVVRGAVEQK-YKWSSGLSHNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP---MP  451
            K  S  S+ K +   NAG+ RK ++N QD   N K L+GS+ Q+ KY+PP R +P   M 
Sbjct  327  KPSSNFSTVKSQLPFNAGVQRKLDMNYQDPTRNDKFLQGSVNQQPKYRPPGRNIPSDPMV  386

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRA  289
            G  V+   VS+ A KL N+NIGSGR P  Q + +PMK G       + HGRS++  PGR+
Sbjct  387  GSRVQNFAVSDAADKLGNMNIGSGRVPTMQPVVKPMKAGGWHGQHDLFHGRSKEFLPGRS  446

Query  288  STKKLAG  268
             ++K+AG
Sbjct  447  FSRKVAG  453



>ref|XP_010325611.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Solanum 
lycopersicum]
Length=447

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 108/187 (58%), Gaps = 27/187 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T  SV                EQK  +WS G   NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKAAVAKTPPSV----------------EQK-YKWSSGLSHNP  320

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKL---PMP  451
            K  S  S+ K +   NAG+ RK ++N QD   N K L+GS+ Q+ KY+PP R +   PM 
Sbjct  321  KPSSNFSTVKSQLPFNAGVQRKLDMNYQDPTRNDKFLQGSVNQQPKYRPPGRNIPSDPMV  380

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRA  289
            G  V+   VS+ A KL N+NIGSGR P  Q + +PMK G       + HGRS++  PGR+
Sbjct  381  GSRVQNFAVSDAADKLGNMNIGSGRVPTMQPVVKPMKAGGWHGQHDLFHGRSKEFLPGRS  440

Query  288  STKKLAG  268
             ++K+AG
Sbjct  441  FSRKVAG  447



>ref|XP_006364472.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006364473.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Solanum 
tuberosum]
Length=453

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 110/187 (59%), Gaps = 21/187 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   + +T            S   R A+EQK  +WS G   NP
Sbjct  278  LQHPFFQSCFYVPPSLRTKAAVAKTPP----------SAVVRGAVEQK-YKWSSGLSHNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKL---PMP  451
            K  +  S+ K +   NAG+ RK ++N QD   N K L+GS+ Q+ KY+PP R +   PM 
Sbjct  327  KPSNNFSTVKSQLPFNAGVQRKLDMNYQDPTRNDKFLQGSVNQQPKYRPPGRNIPSDPMV  386

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRA  289
            G  V+   VS+ A KL ++NIGSGR P  Q + +PMK G       + HGRS++  PGR+
Sbjct  387  GSRVQNFAVSDAADKLGSMNIGSGRGPTMQPIVKPMKAGGWHGQHDLFHGRSKEFLPGRS  446

Query  288  STKKLAG  268
             ++K+AG
Sbjct  447  FSRKVAG  453



>ref|XP_011092619.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Sesamum 
indicum]
Length=450

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 112/184 (61%), Gaps = 18/184 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    ++RT  S G          TR  LEQ   R   G++SN 
Sbjct  278  LQHPFFQSCFYVPPSLRPKAAISRTPPSAG----------TRGVLEQNCGRRYPGSLSNL  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  ++ SS KP+ASL+AG+ RK ++N+QD   N K LK  +KQ+ +Y+PP    P PG  
Sbjct  328  KPTNRFSSAKPQASLSAGVQRKLDMNNQDLTKNDKNLKNYVKQQPRYRPPGMNGP-PGNM  386

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRASTK  280
             K   VS+ A+KL+N+ +GS RP  +  +P PMK G       +  GRS+++ PGRA T+
Sbjct  387  GKTRGVSDAAEKLSNMTVGSVRPLARPSVPPPMKAGGWHGQSDLFLGRSQEVVPGRAYTR  446

Query  279  KLAG  268
            K+AG
Sbjct  447  KVAG  450



>ref|XP_011092618.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Sesamum 
indicum]
Length=451

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 113/185 (61%), Gaps = 19/185 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    ++RT  S G          TR  LEQ   R   G++SN 
Sbjct  278  LQHPFFQSCFYVPPSLRPKAAISRTPPSAG----------TRGVLEQNCGRRYPGSLSNL  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAIS--NKPLKGSLKQKSKYQPPARKLPMPGP  445
            K  ++ SS KP+ASL+AG+ RK ++N+Q  ++  +K LK  +KQ+ +Y+PP    P PG 
Sbjct  328  KPTNRFSSAKPQASLSAGVQRKLDMNNQQDLTKNDKNLKNYVKQQPRYRPPGMNGP-PGN  386

Query  444  TVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRAST  283
              K   VS+ A+KL+N+ +GS RP  +  +P PMK G       +  GRS+++ PGRA T
Sbjct  387  MGKTRGVSDAAEKLSNMTVGSVRPLARPSVPPPMKAGGWHGQSDLFLGRSQEVVPGRAYT  446

Query  282  KKLAG  268
            +K+AG
Sbjct  447  RKVAG  451



>ref|XP_010278819.1| PREDICTED: cyclin-dependent kinase F-4-like [Nelumbo nucifera]
Length=416

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 107/183 (58%), Gaps = 16/183 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+ V   RT  SVG           R ALEQK  R   GT+SN 
Sbjct  244  LQHPFFQSCFYIPPSLRARVAAPRTPPSVG----------LRGALEQKSARKYYGTLSNT  293

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K  +  SS K  ASL+ G+ RK E+N+ +A  N     S  ++ +Y+PPAR  P    T 
Sbjct  294  KPPTNFSSAKLHASLSTGVQRKLEMNNLEANKNDKSVKSCAKQPRYRPPARNSPTSIYTG  353

Query  438  KPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMK-GGVVSH----GRSRDITPGRASTKK  277
            K  + VS+TA+KL  + IGSGR PVKQ    PMK GG   H    GRS +I  GR+ ++K
Sbjct  354  KTGRGVSDTAEKLAQMTIGSGRQPVKQPQTLPMKAGGWHGHTEFLGRSHEIPSGRSYSRK  413

Query  276  LAG  268
            +AG
Sbjct  414  VAG  416



>emb|CDP14933.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 103/183 (56%), Gaps = 16/183 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            +QHPFFQ+C YVPPSLR+   L +T  S G          TR  +EQK  R   G++ N 
Sbjct  278  IQHPFFQSCFYVPPSLRTKAALAKTPPSAG----------TRVPVEQKTGRRYSGSLPNV  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            KS +  SS K  AS  AG+ RK E+N Q     K  K +LKQ  +Y+PP +  P      
Sbjct  328  KSANNFSSVKSNASSYAGVQRKLEMNFQFQDEQKYSKSTLKQPPRYRPPVKNGPASTFMG  387

Query  438  KPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRASTKK  277
            K   VS+TA+K +N+ IGSG+P +K   P PMK G       +  GRS+++ PGR  T+K
Sbjct  388  KTRGVSDTAEKFSNMTIGSGKPSLKSQQPPPMKAGGWHGQSDLFLGRSQEMLPGRTFTRK  447

Query  276  LAG  268
            +AG
Sbjct  448  VAG  450



>ref|XP_011075034.1| PREDICTED: cyclin-dependent kinase F-4-like [Sesamum indicum]
Length=455

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 107/189 (57%), Gaps = 23/189 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLRS   + RT  SVG          TR  +EQK  R     +SNP
Sbjct  278  LQHPFFQSCFYIPPSLRSKAAVARTPPSVG----------TRGVMEQKCGRRYPANLSNP  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGS-LKQKSKYQPPARKLPMPGPT  442
            K ++  +  K +ASL  G+ RK ++N+QDA  N   +   +KQ+SKY+PP    P  G  
Sbjct  328  KPINSFAYAKSQASLT-GVQRKLDLNNQDATKNGTNQNYYVKQQSKYRPPGMNGPSAGNM  386

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMK-GGVVSH-----GRS-----RDITPG  295
             K   VS+ A KL N+ +GSGRP  K  +P PMK GG   H     GR      +++ PG
Sbjct  387  GKSRGVSDVADKLANMTVGSGRPFAKPSVPPPMKAGGWHEHSDMFVGRQSQELLQELLPG  446

Query  294  RASTKKLAG  268
            R+ T+K+AG
Sbjct  447  RSYTRKVAG  455



>ref|XP_010665218.1| PREDICTED: cyclin-dependent kinase F-4 [Vitis vinifera]
 emb|CBI37450.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 110/187 (59%), Gaps = 22/187 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    +TRT  S            T+ AL+QK G R+S  T SN
Sbjct  278  LQHPFFQSCFYVPPSLRPRTAVTRTPPS----------GETKGALDQKSGRRYSRAT-SN  326

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  S  SS KP A+   G+ RK E+N+QD   N K LK S KQ  +Y+PPAR  P    
Sbjct  327  SKPTSNYSSAKPHAAFVTGVQRKLEMNNQDVYKNDKSLKSSPKQ-PRYRPPARNSPTSIY  385

Query  444  TVKPS-QVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVS------HGRSRDITPGRAS  286
              +   +VS+ A+KL N+ +GSGR  ++Q LP PMK G          GRS+++ PGRA+
Sbjct  386  ADRTKREVSDAAEKLANMTVGSGRNGMRQSLPAPMKAGGWHGQSDSFLGRSQELRPGRAA  445

Query  285  -TKKLAG  268
             T+K+AG
Sbjct  446  YTRKVAG  452



>gb|EYU37514.1| hypothetical protein MIMGU_mgv1a006119mg [Erythranthe guttata]
Length=398

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 109/187 (58%), Gaps = 20/187 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSG-VGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLRS    +TRT  S G          TR   EQ   R   G++SN
Sbjct  222  LQHPFFQSCFYVPPSLRSNKAAITRTPPSAG----------TRGLAEQNCARRYPGSLSN  271

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
            PK  +K S  KP+ S+NAG  RK E+N+QD   N K LK ++K + +Y+PP    P  G 
Sbjct  272  PKPTNKFSPAKPQVSVNAGAQRKLEMNNQDVTKNDKNLKSNVKPQPRYRPPGLDGPPAGN  331

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVK-QLLPQPMKGG------VVSHGRSRDITPGRA  289
             +  ++ VS+ A+KL N+ +G  RP  K  +LP PMK G          GRS+++ PGR+
Sbjct  332  NLGRNRGVSDAAEKLANMRMGPARPFAKPTVLPPPMKAGGWHGQSQALIGRSQEVIPGRS  391

Query  288  STKKLAG  268
             ++K+AG
Sbjct  392  YSRKVAG  398



>gb|EYU37513.1| hypothetical protein MIMGU_mgv1a006119mg [Erythranthe guttata]
Length=399

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 108/192 (56%), Gaps = 29/192 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSG-VGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLRS    +TRT  S G          TR   EQ   R   G++SN
Sbjct  222  LQHPFFQSCFYVPPSLRSNKAAITRTPPSAG----------TRGLAEQNCARRYPGSLSN  271

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
            PK  +K S  KP+ S+NAG  RK E+N+QD   N K LK ++K + +Y+PP     + GP
Sbjct  272  PKPTNKFSPAKPQVSVNAGAQRKLEMNNQDVTKNDKNLKSNVKPQPRYRPPG----LDGP  327

Query  444  TVKPSQ------VSNTAKKLTNLNIGSGRPPVK-QLLPQPMKGG------VVSHGRSRDI  304
                +       VS+ A+KL N+ +G  RP  K  +LP PMK G          GRS+++
Sbjct  328  PAAGNNLGRNRGVSDAAEKLANMRMGPARPFAKPTVLPPPMKAGGWHGQSQALIGRSQEV  387

Query  303  TPGRASTKKLAG  268
             PGR+ ++K+AG
Sbjct  388  IPGRSYSRKVAG  399



>gb|EYU37515.1| hypothetical protein MIMGU_mgv1a006119mg [Erythranthe guttata]
Length=455

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 110/188 (59%), Gaps = 21/188 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSG-VGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLRS    +TRT  S G          TR   EQ   R   G++SN
Sbjct  278  LQHPFFQSCFYVPPSLRSNKAAITRTPPSAG----------TRGLAEQNCARRYPGSLSN  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAIS--NKPLKGSLKQKSKYQPPARKLPMPG  448
            PK  +K S  KP+ S+NAG  RK E+N+Q  ++  +K LK ++K + +Y+PP    P  G
Sbjct  328  PKPTNKFSPAKPQVSVNAGAQRKLEMNNQQDVTKNDKNLKSNVKPQPRYRPPGLDGPPAG  387

Query  447  PTVKPSQ-VSNTAKKLTNLNIGSGRPPVK-QLLPQPMKGG------VVSHGRSRDITPGR  292
              +  ++ VS+ A+KL N+ +G  RP  K  +LP PMK G          GRS+++ PGR
Sbjct  388  NNLGRNRGVSDAAEKLANMRMGPARPFAKPTVLPPPMKAGGWHGQSQALIGRSQEVIPGR  447

Query  291  ASTKKLAG  268
            + ++K+AG
Sbjct  448  SYSRKVAG  455



>ref|XP_010675667.1| PREDICTED: cyclin-dependent kinase F-4 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 107/187 (57%), Gaps = 25/187 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQNC YVPPSLR+   + RT  S+G          +R  ++QK  R S G  + P
Sbjct  278  LQHPFFQNCYYVPPSLRTRATVNRTPPSLG----------SRGYVDQKSARKSSGPGTVP  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP---MP  451
               SKT+S KP  +  AG+ RK E++ +D   N K +K S+KQ  KY+PP R  P    P
Sbjct  328  --FSKTTSLKPHVAFGAGVQRKLEMDGKDLNKNDKSIKSSVKQ-PKYRPPVRNSPSSIYP  384

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGG------VVSHGRSRDITPGRA  289
            G T +   VS  A++L+ +++GSGR   +  +P PMK G       +  GRS++I P R 
Sbjct  385  GRTTR--GVSEAAERLSKISLGSGRQTTRSSVPPPMKAGGWHGQSNMFMGRSQEIQPSRT  442

Query  288  STKKLAG  268
             T+K+AG
Sbjct  443  FTRKVAG  449



>gb|EYU37516.1| hypothetical protein MIMGU_mgv1a006119mg [Erythranthe guttata]
Length=456

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 109/193 (56%), Gaps = 30/193 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSG-VGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLRS    +TRT  S G          TR   EQ   R   G++SN
Sbjct  278  LQHPFFQSCFYVPPSLRSNKAAITRTPPSAG----------TRGLAEQNCARRYPGSLSN  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAIS--NKPLKGSLKQKSKYQPPARKLPMPG  448
            PK  +K S  KP+ S+NAG  RK E+N+Q  ++  +K LK ++K + +Y+PP     + G
Sbjct  328  PKPTNKFSPAKPQVSVNAGAQRKLEMNNQQDVTKNDKNLKSNVKPQPRYRPPG----LDG  383

Query  447  PTVKPSQ------VSNTAKKLTNLNIGSGRPPVK-QLLPQPMKGG------VVSHGRSRD  307
            P    +       VS+ A+KL N+ +G  RP  K  +LP PMK G          GRS++
Sbjct  384  PPAAGNNLGRNRGVSDAAEKLANMRMGPARPFAKPTVLPPPMKAGGWHGQSQALIGRSQE  443

Query  306  ITPGRASTKKLAG  268
            + PGR+ ++K+AG
Sbjct  444  VIPGRSYSRKVAG  456



>ref|XP_006432566.1| hypothetical protein CICLE_v10003654mg [Citrus clementina]
 ref|XP_006471340.1| PREDICTED: cyclin-dependent kinase F-4-like [Citrus sinensis]
 gb|ESR45806.1| hypothetical protein CICLE_v10003654mg [Citrus clementina]
Length=455

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 102/191 (53%), Gaps = 27/191 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    +TRT  S G          T+ ALEQ+G +   G  SN 
Sbjct  278  LQHPFFQSCFYVPPSLRPRAAVTRTPPSAG----------TKGALEQQGAKRFSGAFSNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN---KPLKGSLKQKSKYQPPARKLPM--  454
            K +S   S K  A +N G+ RK E+ +Q+  +N   K L  S KQ  +Y+P  RK P   
Sbjct  328  KPVSSFPSPKLNAHINTGVQRKLEMANQNQDANKNDKSLNNSAKQ-PRYRPAGRKSPTIF  386

Query  453  -PGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI--------T  301
              G T +   VS+TA+KL N++I S R  V+ L P  MK GV   G S D+         
Sbjct  387  NKGRTAR--GVSDTAEKLANMSIASRRQSVEHLKPPAMKTGVHWSGDSGDLFLRPTQQMQ  444

Query  300  PGRASTKKLAG  268
            PGR  ++K+ G
Sbjct  445  PGRTYSRKVVG  455



>ref|XP_007209990.1| hypothetical protein PRUPE_ppa005252mg [Prunus persica]
 gb|EMJ11189.1| hypothetical protein PRUPE_ppa005252mg [Prunus persica]
Length=470

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 103/188 (55%), Gaps = 22/188 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLRS   + RT    G           R A EQ+  R   GT+SN 
Sbjct  294  LQHPFFQSCYYVPPSLRSRSTVARTPPFAG----------ARGASEQQCARKLSGTLSNS  343

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S   S K  AS+  G+ RK ++ +QDA  N K LK S KQ+ KY+PP +  P     
Sbjct  344  KISSNFPSPKLHASMGTGVQRKLDMVNQDAKKNDKYLKSSAKQQ-KYRPPGKSSPTTVNK  402

Query  441  VKPSQ-VSNTAKKLTNLNIGSGRPPV-KQLLPQPMKGGVVSHGRS--------RDITPGR  292
             + +  VS+T++KL N+ IG  +  V +Q+ P PMK GV   G S        ++I PGR
Sbjct  403  GRITHGVSDTSEKLANMTIGYRKQTVGQQMRPPPMKAGVQWIGESGNLYLRPVQEIQPGR  462

Query  291  ASTKKLAG  268
              ++K+AG
Sbjct  463  TYSRKVAG  470



>ref|XP_007040811.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007040812.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25313.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=453

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 97/187 (52%), Gaps = 21/187 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    ++RT  SVG           R  LEQ+  R   G + N 
Sbjct  278  LQHPFFQSCFYVPPSLRPRSAISRTPPSVG----------VRGTLEQQSARRYPGVLPNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K     +S K  AS   G+ RK E+ ++D   N K LK   KQ  KY+PP RK P+    
Sbjct  328  KLTGNLNSAKINASFGTGVQRKLEMVNRDPTKNDKSLKNPAKQ-PKYRPPGRKSPVSFNK  386

Query  441  VKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD--------ITPGRA  289
             + ++  S+ A+KL N+ IG+ R  V QL P PMK GV     S D        +  GR 
Sbjct  387  DRTARGASDVAEKLANVTIGNRRQSVGQLRPPPMKAGVQWTAESNDMFLRPTQQLQSGRT  446

Query  288  STKKLAG  268
             ++K+AG
Sbjct  447  FSRKVAG  453



>ref|XP_010278820.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278821.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278822.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Nelumbo 
nucifera]
Length=446

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 97/176 (55%), Gaps = 17/176 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            L+HPFFQ+C YVPPSLR  V   RT  SVG           R +LEQK  R   GT+SN 
Sbjct  278  LRHPFFQSCFYVPPSLRPRVATPRTPPSVG----------LRGSLEQKSARRYSGTLSNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K ++  SS K  ASL+ G+ RK E+ + DA  N     S  ++ +Y+PP R       T 
Sbjct  328  KPITNFSSAKMHASLSTGVQRKLEMGNLDANKNDNSAKSGAKQPRYRPPVRNSTTSIYTG  387

Query  438  KP-SQVSNTAKKLTNLNIGSGRPPVKQLLPQ-PMK-GGVVSH----GRSRDITPGR  292
            K    VS++A+KL  + IGSGR  V++  PQ PMK GG  SH    GR  +I  GR
Sbjct  388  KTGGGVSDSAEKLAQMTIGSGRQIVREPPPQLPMKAGGWHSHSEFLGRPHEIPSGR  443



>ref|XP_004300144.1| PREDICTED: cyclin-dependent kinase F-4-like [Fragaria vesca subsp. 
vesca]
Length=470

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 103/193 (53%), Gaps = 32/193 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR      RT    G          TR ALEQ+  R   GT+SN 
Sbjct  294  LQHPFFQSCYYVPPSLRPKTT-ARTPPFAG----------TRGALEQQSARKVSGTLSNS  342

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S   S K  AS+  G+ RK ++ +QDA  N K LK S  Q+ KY+PP +      PT
Sbjct  343  KLTSSFPSPKLHASIGTGVHRKLDMANQDAKKNDKYLKSSTNQQ-KYRPPGKS----SPT  397

Query  441  VKPSQ------VSNTAKKLTNLNIGSGRPPVKQ-LLPQPMKGGVVSHGRS--------RD  307
               ++      VS+ ++KLTN+ IGS R  V Q L P PMK G    G +        ++
Sbjct  398  ASVNKGRVARGVSDASEKLTNMTIGSRRQSVGQPLRPPPMKAGAQWIGETGNLYLRPVQE  457

Query  306  ITPGRASTKKLAG  268
            I PGRA ++K+AG
Sbjct  458  IQPGRAYSRKVAG  470



>gb|EYU29089.1| hypothetical protein MIMGU_mgv1a0075472mg, partial [Erythranthe 
guttata]
Length=322

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 87/160 (54%), Gaps = 15/160 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRT--TQSVGRNNIEFISTRTRDALEQKGNRWSVGTIS  625
            LQHPFFQ+C YVPPSLRS   +T+T     VG           R  LEQK +R   G +S
Sbjct  149  LQHPFFQSCFYVPPSLRSKAAVTKTPPGYEVG----------ARGVLEQKCDRIYPGNLS  198

Query  624  NPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGP  445
            NP  M++  S K    +N+G+ RK ++N+QD   N   +  +KQ+ KY+PP      PG 
Sbjct  199  NPNPMNRFPSAKSLLPVNSGVQRKLDMNNQDLTKNDRNQNYVKQQQKYRPPGILNGPPGY  258

Query  444  TVKPSQVSNTAKKLTNLNIGSGRPPVKQLLP--QP-MKGG  334
              K   VS  A+KL N+ + + RP   ++L   QP MK G
Sbjct  259  VGKARGVSEAAEKLANMTLAADRPLYAKVLATVQPSMKAG  298



>ref|XP_008238099.1| PREDICTED: cyclin-dependent kinase F-4 [Prunus mume]
Length=470

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 103/188 (55%), Gaps = 22/188 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLRS   + RT    G           R A EQ+  R   GT+SN 
Sbjct  294  LQHPFFQSCYYVPPSLRSRSTVARTPPFAG----------ARVASEQQCARKLSGTLSNS  343

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  S   S K   S+  G+ RK ++ +QDA  N K LK S KQ+ KY+PP +  P     
Sbjct  344  KISSNFPSPKLHVSMGTGVQRKLDMVNQDAKKNDKYLKSSAKQQ-KYRPPGKSSPTSVNK  402

Query  441  VKPSQ-VSNTAKKLTNLNIGSGRPPV-KQLLPQPMKGGVVSHGRS--------RDITPGR  292
             + ++ VS+T++KL N+ IG  +  V +Q+ P PMK GV   G S        ++I PGR
Sbjct  403  GRITRGVSDTSEKLANMTIGYRKQTVGQQMRPPPMKAGVQWIGESGNLYLRPVQEIQPGR  462

Query  291  ASTKKLAG  268
              ++K+AG
Sbjct  463  TYSRKVAG  470



>ref|XP_010278823.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Nelumbo 
nucifera]
Length=441

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 97/176 (55%), Gaps = 22/176 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            L+HPFFQ+C YVPPSLR  V   RT  SVG           R +LEQK  R   GT+SN 
Sbjct  278  LRHPFFQSCFYVPPSLRPRVATPRTPPSVG----------LRGSLEQKSARRYSGTLSNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K ++  SS K  ASL+ G+ RK E+ + DA  N     S  ++ +Y+PP R       T 
Sbjct  328  KPITNFSSAKMHASLSTGVQRKLEMGNLDANKNDNSAKSGAKQPRYRPPVR-----NSTR  382

Query  438  KP-SQVSNTAKKLTNLNIGSGRPPVKQLLPQ-PMK-GGVVSH----GRSRDITPGR  292
            K    VS++A+KL  + IGSGR  V++  PQ PMK GG  SH    GR  +I  GR
Sbjct  383  KTGGGVSDSAEKLAQMTIGSGRQIVREPPPQLPMKAGGWHSHSEFLGRPHEIPSGR  438



>ref|XP_002519870.1| mak, putative [Ricinus communis]
 gb|EEF42474.1| mak, putative [Ricinus communis]
Length=455

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 99/190 (52%), Gaps = 25/190 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPP+LRS   +TRT  S G           +  LEQ+  R   G +SN 
Sbjct  278  LQHPFFQSCFYVPPTLRSRAPVTRTPPSAG----------AKCTLEQQYARRPTGPLSNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K      S K  ASL+ G+ RK ++ +QDA  N K  + S KQ+ KY+PP RK P P   
Sbjct  328  KVSPAYMSPKLNASLSTGVQRKLDLVNQDASRNDKSFRSSTKQQ-KYRPPGRKSP-PTNI  385

Query  441  VKPSQ----VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI--------TP  298
            +  S+    VS+TA K  ++ +GS R    Q  P PMK GV     S D+          
Sbjct  386  INKSRAARGVSDTADKFASMAVGSNRHSGLQQRPPPMKAGVQWAAESGDMFLRPSHQFQA  445

Query  297  GRASTKKLAG  268
            GR+ T+K+ G
Sbjct  446  GRSCTRKVVG  455



>ref|XP_007040813.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY25314.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
Length=454

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 98/188 (52%), Gaps = 22/188 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    ++RT  SVG           R  LEQ+  R   G + N 
Sbjct  278  LQHPFFQSCFYVPPSLRPRSAISRTPPSVG----------VRGTLEQQSARRYPGVLPNA  327

Query  618  KSMSKTSSFKPRASL-NAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
            K     +S K  AS   AG+ RK E+ ++D   N K LK   KQ  KY+PP RK P+   
Sbjct  328  KLTGNLNSAKINASFGTAGVQRKLEMVNRDPTKNDKSLKNPAKQ-PKYRPPGRKSPVSFN  386

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD--------ITPGR  292
              + ++  S+ A+KL N+ IG+ R  V QL P PMK GV     S D        +  GR
Sbjct  387  KDRTARGASDVAEKLANVTIGNRRQSVGQLRPPPMKAGVQWTAESNDMFLRPTQQLQSGR  446

Query  291  ASTKKLAG  268
              ++K+AG
Sbjct  447  TFSRKVAG  454



>ref|XP_011028055.1| PREDICTED: cyclin-dependent kinase F-4 [Populus euphratica]
Length=452

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 90/165 (55%), Gaps = 16/165 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    +TRT  S G          T+  LEQ+  R   G +SN 
Sbjct  278  LQHPFFQSCFYVPPSLRPRAAITRTPTSAG----------TKGGLEQQCARSLPGALSNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSK--YQPPARKLPMPGP  445
            K  +   S K  ASL+ G+ RK ++ +QD  S KP K SLK  +K  YQPP RK P    
Sbjct  328  KLTNSFPSPKLHASLSTGVQRKLDMVNQD--SRKPDK-SLKSSTKPRYQPPGRKSPTFMS  384

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRS  313
              + ++ VS TA KL ++ I S R  + Q  P PMK GV   G S
Sbjct  385  KGRVARGVSETADKLASMTIASRRQSLGQPKPPPMKAGVQWTGES  429



>ref|XP_009365744.1| PREDICTED: cyclin-dependent kinase F-4 [Pyrus x bretschneideri]
Length=472

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 102/190 (54%), Gaps = 24/190 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLRS   + RT    G           R A +Q   R S GT+S+ 
Sbjct  294  LQHPFFQSCYYVPPSLRSRSNVARTPPIAG----------ARGAEQQSARRLS-GTVSHS  342

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLK-QKSKYQPPARKLPMPGP  445
            K  +   S K  AS+  G+ RK ++ +QD   N K LK S K Q+ KY+PP +  P    
Sbjct  343  KLANSFPSPKLHASVGTGVQRKLDMANQDVKKNDKYLKSSPKQQQQKYRPPGKSSPTSVN  402

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVK--QLLPQPMKGGVVSHGRS--------RDITP  298
              + ++ VS+T++KL N+ IG  R  V   Q+ P PMK GV   G S        ++I P
Sbjct  403  KGRVARGVSDTSEKLANMTIGHRRQTVGQPQMRPPPMKAGVQWIGESGNLYLRPVQEIQP  462

Query  297  GRASTKKLAG  268
            GR  ++K+AG
Sbjct  463  GRTYSRKVAG  472



>ref|XP_008448596.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Cucumis 
melo]
Length=453

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 95/170 (56%), Gaps = 19/170 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   +TRT  S G          T+D LEQ+  +     +S+ 
Sbjct  278  LQHPFFQSCYYVPPSLRARAPITRTPPSAG----------TKDLLEQQTAKKYPVALSDS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP----M  454
            +     SS K  A L+ G+ RK ++ +QD   N K +K +++Q+ KY+PP R  P     
Sbjct  328  RIAGNFSSPKLPAMLSTGVQRKLDLMNQDLNKNDKTMKSTVRQQ-KYRPPVRNSPTNSIY  386

Query  453  PGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI  304
             G  V+   VS+T +KL N+ I   +P + Q LP+PMK GV   G S D+
Sbjct  387  KGNNVR--GVSDTGEKLANMTIAPRKPTIGQ-LPRPMKAGVRWSGSSSDL  433



>ref|XP_008448597.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Cucumis 
melo]
Length=440

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 91/166 (55%), Gaps = 24/166 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   +TRT  S G          T+D LEQ+  +     +S+ 
Sbjct  278  LQHPFFQSCYYVPPSLRARAPITRTPPSAG----------TKDLLEQQTAKKYPVALSDS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            +     SS K  A L+ G+ RK ++ +QD   N K +K +++Q+ KY+PP R  P     
Sbjct  328  RIAGNFSSPKLPAMLSTGVQRKLDLMNQDLNKNDKTMKSTVRQQ-KYRPPVRNSP-----  381

Query  441  VKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI  304
                  +NT +KL N+ I   +P + Q LP+PMK GV   G S D+
Sbjct  382  ------TNTGEKLANMTIAPRKPTIGQ-LPRPMKAGVRWSGSSSDL  420



>gb|KHN47645.1| Cyclin-dependent kinase F-4, partial [Glycine soja]
Length=449

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (56%), Gaps = 27/189 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   +TRT  S G          TR +L+++G +   G + N 
Sbjct  276  LQHPFFQSCFYIPPSLRTR-AVTRTPPSAG----------TRGSLDRQGLKRYSGALPNT  324

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  SS K +AS+ +G+ RK ++ ++D I S K LK +  Q+SKY+ P +  P     
Sbjct  325  KITNNFSSPKLQASIASGVQRKLDMANEDGIKSKKSLKTT--QQSKYRLPGKGSPTSINK  382

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRS--------RDITPG  295
            G T +   VS TA+KL N++IG+ R  + Q  P PMK GV     S        + I   
Sbjct  383  GRTARG--VSETAEKLANMSIGTRRQSLGQTRPPPMKAGVNWISESGNFMLRSGQQIPSE  440

Query  294  RASTKKLAG  268
            R+ T+K+AG
Sbjct  441  RSLTRKVAG  449



>ref|XP_006599209.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max]
Length=451

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (56%), Gaps = 27/189 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   +TRT  S G          TR +L+++G +   G + N 
Sbjct  278  LQHPFFQSCFYIPPSLRTR-AVTRTPPSAG----------TRGSLDRQGLKRYSGALPNT  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  SS K +AS+ +G+ RK ++ ++D I S K LK +  Q+SKY+ P +  P     
Sbjct  327  KITNNFSSPKLQASIASGVQRKLDMANEDGIKSKKSLKTT--QQSKYRLPGKGSPTSINK  384

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRS--------RDITPG  295
            G T +   VS TA+KL N++IG+ R  + Q  P PMK GV     S        + I   
Sbjct  385  GRTARG--VSETAEKLANMSIGTRRQSLGQTRPPPMKAGVNWISESGNFMLRSGQQIPSE  442

Query  294  RASTKKLAG  268
            R+ T+K+AG
Sbjct  443  RSLTRKVAG  451



>ref|XP_008373453.1| PREDICTED: cyclin-dependent kinase F-4 [Malus domestica]
 ref|XP_008364481.1| PREDICTED: cyclin-dependent kinase F-4-like [Malus domestica]
Length=476

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 101/194 (52%), Gaps = 28/194 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLRS   + RT    G           R A +Q   R S GT+S+ 
Sbjct  294  LQHPFFQSCYYVPPSLRSRSTVGRTPPIAG----------ARGAEQQSARRLS-GTVSHS  342

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLK-----QKSKYQPPARKLP  457
            K  +   S K  AS+   + RK ++ +QDA  N K LK S K     Q+ KY+PP +  P
Sbjct  343  KLANSFXSPKLHASVGTAVQRKLDMANQDAKKNDKYLKSSPKQQQQQQQQKYRPPGKSSP  402

Query  456  MPGPTVKPSQ-VSNTAKKLTNLNIGSGRPPVKQLL--PQPMKGGVVSHGRS--------R  310
                  + +  VS+T++KL N+ IG  R  V QL   P PMK GV   G S        +
Sbjct  403  TAVNKGRVAXGVSDTSEKLANMTIGHRRQTVGQLQMRPPPMKAGVQWIGESGNLYLRPVQ  462

Query  309  DITPGRASTKKLAG  268
            +I PGR  ++K+AG
Sbjct  463  EIQPGRTYSRKVAG  476



>ref|XP_007158186.1| hypothetical protein PHAVU_002G131400g [Phaseolus vulgaris]
 gb|ESW30180.1| hypothetical protein PHAVU_002G131400g [Phaseolus vulgaris]
Length=451

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 98/188 (52%), Gaps = 25/188 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLRS   + RT  S G          TR AL+Q+G +   G +S  
Sbjct  278  LQHPFFQSCFYIPPSLRSR-AVARTPPSAG----------TRGALDQQGVKRYPGALSYS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  +  SS K    L +G+ RK ++ +QD I N KP++ +   K KY+ P R  P     
Sbjct  327  KITNHFSSQKLHPPLASGVQRKLDMVNQDGIRNEKPMRST---KPKYRQPGRDSPTSMNK  383

Query  441  VKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGV---------VSHGRSRDITPGR  292
             + ++ +S TA+KL NL++   R  + Q  P PMK GV         +     + I  GR
Sbjct  384  GRSARGISETAEKLGNLSVSGRRQSMGQTRPPPMKAGVNWISESGNFILGSAQQQIQAGR  443

Query  291  ASTKKLAG  268
              T+K+AG
Sbjct  444  TFTRKVAG  451



>ref|XP_006414009.1| hypothetical protein EUTSA_v10027028mg [Eutrema salsugineum]
 gb|ESQ55462.1| hypothetical protein EUTSA_v10027028mg [Eutrema salsugineum]
Length=462

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 102/196 (52%), Gaps = 30/196 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    + RT   VG           R + E +  +    +++N 
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPPVG----------PRGSFEHQSVKRHTVSLANA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM--PG  448
            K  +   + K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP RK P    G
Sbjct  328  KPFNSHVTPKSNAAFGSGVQRKLDLANQDGTRNTKPVRSSVRD-SKYRPPGRKSPHNGAG  386

Query  447  PTVKPSQ----VSNTAKKLTNLNIGSG---RPPV-----KQLLPQPMKGGVVSHGRSRDI  304
             +   S+    VS TA KL+N++IG G   R  V     +QL P PMK G V   R   +
Sbjct  387  SSFNKSRVARGVSETADKLSNVSIGGGVSRRHSVSVMQQQQLKPPPMKAGCVGETRDMFL  446

Query  303  TPGR----ASTKKLAG  268
             P +    A ++K+AG
Sbjct  447  RPTQPTTNAYSRKVAG  462



>ref|XP_004509543.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004509544.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Cicer 
arietinum]
 ref|XP_004509545.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Cicer 
arietinum]
Length=451

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 96/186 (52%), Gaps = 21/186 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   +TRT  SVG +           A++++  +   G + N 
Sbjct  278  LQHPFFQSCFYIPPSLRTR-PVTRTPPSVGISG----------AVDRQTVKRYSGALPNS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K  +  SS K   SL   + RK ++  +D I NK       Q+SKYQPP +  P     V
Sbjct  327  KLTNNFSSMKLHPSLAPAVQRKLDMAKEDGIKNKK-STKTTQQSKYQPPGKASPTSVNKV  385

Query  438  KPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGV--------VSHGRSRDITPGRAS  286
            + ++ VS TA KL N++I + R    Q  P PMK GV        +    S+ I  GR  
Sbjct  386  RTARGVSETADKLANMSIPTRRHSFGQTRPPPMKAGVNWVSEPGNILLRSSQQIPTGRPF  445

Query  285  TKKLAG  268
            TKK+AG
Sbjct  446  TKKVAG  451



>ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max]
 gb|KHN27523.1| Cyclin-dependent kinase F-4 [Glycine soja]
Length=450

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 103/188 (55%), Gaps = 26/188 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   +TRT  S G          TR +L++ G +   G + N 
Sbjct  278  LQHPFFQSCFYIPPSLRTR-AVTRTPPSAG----------TRGSLDRLGLKRYSGALPNT  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  +S K +AS+ +G+ RK ++ ++D I S K LK +  Q+SKY+ P +  P     
Sbjct  327  KITNNFTSPKVQASIASGVQRKLDMANEDGIKSKKSLKTT--QQSKYRLPGKGSPTSINK  384

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRS-------RDITPGR  292
            G T +   VS TA+KL N++IG+ R  + Q  P PMK GV     S       + I   R
Sbjct  385  GRTARG--VSETAEKLVNMSIGTRRLSLGQTRPPPMKAGVNWISESGNLLRSGQQIPTER  442

Query  291  ASTKKLAG  268
              T+K+AG
Sbjct  443  TLTRKVAG  450



>ref|XP_004146120.1| PREDICTED: cyclin-dependent kinase F-4-like [Cucumis sativus]
 ref|XP_004167251.1| PREDICTED: cyclin-dependent kinase F-4-like [Cucumis sativus]
Length=449

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 19/170 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   +TRT  S G          T+D LEQ+  +     +S+ 
Sbjct  274  LQHPFFQSCYYVPPSLRARPPITRTPPSAG----------TKDVLEQQTAKKYPVALSDS  323

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP----M  454
            +     SS K  A L+ G+ RK ++ +QD   N K +K +++Q+ KY+PP R  P     
Sbjct  324  RIGGNFSSPKLPALLSTGVQRKLDLMNQDLNKNDKTMKSTVRQQ-KYRPPVRNSPTNSIY  382

Query  453  PGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI  304
             G  V+   VS+T +KL N+ I   +P + Q LP+PMK GV     S D+
Sbjct  383  KGNNVR--GVSDTGEKLANMTIAPRKPTIGQ-LPRPMKAGVRWSSSSSDL  429



>gb|KGN55695.1| hypothetical protein Csa_3G005580 [Cucumis sativus]
Length=520

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 19/170 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR+   +TRT  S G          T+D LEQ+  +     +S+ 
Sbjct  345  LQHPFFQSCYYVPPSLRARPPITRTPPSAG----------TKDVLEQQTAKKYPVALSDS  394

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP----M  454
            +     SS K  A L+ G+ RK ++ +QD   N K +K +++Q+ KY+PP R  P     
Sbjct  395  RIGGNFSSPKLPALLSTGVQRKLDLMNQDLNKNDKTMKSTVRQQ-KYRPPVRNSPTNSIY  453

Query  453  PGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI  304
             G  V+   VS+T +KL N+ I   +P + Q LP+PMK GV     S D+
Sbjct  454  KGNNVR--GVSDTGEKLANMTIAPRKPTIGQ-LPRPMKAGVRWSSSSSDL  500



>dbj|BAF02222.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=272

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 100/199 (50%), Gaps = 34/199 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E           Q   R+ V +++N
Sbjct  86   LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFE----------HQSVKRYPV-SLAN  134

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +   S K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP +K P    
Sbjct  135  AKPFNSYVSPKSNAAFGSGVQRKLDMVNQDGTRNTKPVRSSVRD-SKYRPPGKKSPHNAA  193

Query  444  T-------VKPSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRS  313
                    V  S VS TA KL N+ I   GS R  V      +QL P PMK G V   R 
Sbjct  194  AASLNKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPPMKAGWVGETRD  253

Query  312  RDITPGR----ASTKKLAG  268
              + P +    A ++K+AG
Sbjct  254  MFLRPTQPTTNAYSRKVAG  272



>gb|KDP35422.1| hypothetical protein JCGZ_10805 [Jatropha curcas]
Length=459

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 95/200 (48%), Gaps = 41/200 (21%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPP+LRS +  TRT  SVG          ++  LEQ+G R   G +SN 
Sbjct  278  LQHPFFQSCFYVPPTLRSRLPSTRTPPSVG----------SKGTLEQQGPRRHSGVLSNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K      S K   SL+ G+ RK ++ +QDA  N K  K +  ++ KY+PP RK       
Sbjct  328  KVSHSFLSPKLNTSLSTGVQRKLDLVNQDANRNEKSFKNAAAKQQKYRPPGRK-------  380

Query  441  VKPSQVSN----------TAKKLTNLNIGSGRPPVKQL----LPQPMKGGVVSHGRSRDI  304
              PS VSN          T  K  ++ +GS R    Q      P PMK GV     S D+
Sbjct  381  -SPSIVSNRGRASRGVLETTDKFASMTMGSHRQTGVQTGVQPRPPPMKAGVQWTSESGDM  439

Query  303  --------TPGRASTKKLAG  268
                      GR  T+K+ G
Sbjct  440  FLRPTHQFQTGRTYTRKVVG  459



>ref|NP_001078408.1| conserved peptide upstream open reading frame 25 [Arabidopsis 
thaliana]
 gb|AEE84143.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=404

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 101/195 (52%), Gaps = 30/195 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E           Q   R+ V +++N
Sbjct  222  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFE----------HQSVKRYPV-SLAN  270

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP---M  454
             K  +   S K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP +K P   +
Sbjct  271  AKPFNSYVSPKSNAAFGSGVQRKLDMVNQDGTRNTKPVRSSVRD-SKYRPPGKKSPPASL  329

Query  453  PGPTVKPSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDIT  301
                V  S VS TA KL N+ I   GS R  V      +QL P PMK G V   R   + 
Sbjct  330  NKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPPMKAGWVGETRDMFLR  389

Query  300  PGR----ASTKKLAG  268
            P +    A ++K+AG
Sbjct  390  PTQPTTNAYSRKVAG  404



>dbj|BAF02199.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=404

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 101/195 (52%), Gaps = 30/195 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E           Q   R+ V +++N
Sbjct  222  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFE----------HQSVKRYPV-SLAN  270

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP---M  454
             K  +   S K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP +K P   +
Sbjct  271  AKPFNSYVSPKSNAAFGSGVQRKLDMVNQDGTRNTKPVRSSVRD-SKYRPPGKKSPPASL  329

Query  453  PGPTVKPSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDIT  301
                V  S VS TA KL N+ I   GS R  V      +QL P PMK G V   R   + 
Sbjct  330  NKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPPMKAGWVGETRDMFLR  389

Query  300  PGR----ASTKKLAG  268
            P +    A ++K+AG
Sbjct  390  PTQPTTNAYSRKVAG  404



>ref|NP_567574.1| conserved peptide upstream open reading frame 25 [Arabidopsis 
thaliana]
 gb|AAK25900.1|AF360190_1 putative kinase [Arabidopsis thaliana]
 gb|AAK64081.1| putative kinase [Arabidopsis thaliana]
 gb|AEE84141.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=461

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 102/197 (52%), Gaps = 33/197 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E           Q   R+ V +++N
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFE----------HQSVKRYPV-SLAN  326

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +   S K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP +K P P  
Sbjct  327  AKPFNSYVSPKSNAAFGSGVQRKLDMVNQDGTRNTKPVRSSVRD-SKYRPPGKKSP-PAA  384

Query  444  T-----VKPSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRD  307
            +     V  S VS TA KL N+ I   GS R  V      +QL P PMK G V   R   
Sbjct  385  SLNKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPPMKAGWVGETRDMF  444

Query  306  ITPGR----ASTKKLAG  268
            + P +    A ++K+AG
Sbjct  445  LRPTQPTTNAYSRKVAG  461



>ref|NP_849407.1| conserved peptide upstream open reading frame 25 [Arabidopsis 
thaliana]
 gb|AEE84142.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=464

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 100/199 (50%), Gaps = 34/199 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E           Q   R+ V +++N
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFE----------HQSVKRYPV-SLAN  326

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +   S K  A+  +G+ RK ++ +QD   N KP++ S++  SKY+PP +K P    
Sbjct  327  AKPFNSYVSPKSNAAFGSGVQRKLDMVNQDGTRNTKPVRSSVRD-SKYRPPGKKSPHNAA  385

Query  444  T-------VKPSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRS  313
                    V  S VS TA KL N+ I   GS R  V      +QL P PMK G V   R 
Sbjct  386  AASLNKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPPMKAGWVGETRD  445

Query  312  RDITPGR----ASTKKLAG  268
              + P +    A ++K+AG
Sbjct  446  MFLRPTQPTTNAYSRKVAG  464



>ref|XP_002304373.2| hypothetical protein POPTR_0003s10090g [Populus trichocarpa]
 gb|EEE79352.2| hypothetical protein POPTR_0003s10090g [Populus trichocarpa]
Length=457

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 89/167 (53%), Gaps = 19/167 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    +TRT  S G          T+  LEQ+  R   G +SN 
Sbjct  282  LQHPFFQSCFYVPPSLRPRAAITRTPASAG----------TKGGLEQQCGRNLPGALSNS  331

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSK--YQPPARKLPMPGP  445
            K  +   S K  ASL+ G+ RK ++ +QD  S KP K SLK  +K  YQPP RK P    
Sbjct  332  KLTNSFPSPKLHASLSTGVQRKLDMVNQD--SRKPDK-SLKSSTKPRYQPPGRKSPTFMS  388

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLPQP--MKGGVVSHGRS  313
              + ++  S TA K  ++ I S R  + Q  P+P  MK GV   G S
Sbjct  389  KGRVARGASETADKFASMTIASRRQSLGQ-QPKPPTMKAGVQWTGES  434



>ref|XP_009108409.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Brassica 
rapa]
Length=456

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 103/195 (53%), Gaps = 34/195 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFF++C YVPPSLR    + RT   VG R + E  S + +             T+S 
Sbjct  278  LQHPFFKSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQSAKRQ-------------TVSL  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +  S  KP A+  +G+ RK ++  Q+   N KP++ S+K  SKY+PP RK P PG 
Sbjct  325  AKPFNNVSP-KPSAAFGSGVQRKLDMAKQEGTRNTKPVRSSVKD-SKYRPPGRKSP-PGS  381

Query  444  TVKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDIT  301
            ++  ++    VS TA KL+N+++    S R  V     +QL P PMK G V   R   + 
Sbjct  382  SLSKNRVARGVSETADKLSNMSVRGTVSRRHSVSVMQQQQLKPPPMKAGCVGEKRDMFLR  441

Query  300  PGR----ASTKKLAG  268
            P +    A ++K+AG
Sbjct  442  PTQPATSAYSRKVAG  456



>emb|CDY09272.1| BnaC03g63020D [Brassica napus]
Length=461

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 100/200 (50%), Gaps = 39/200 (20%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E  + + +             T+S 
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQTVKRQ-------------TVSL  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +  S  KP A+  +G+ RK ++  QD   N KP++ S+K  SKY+PP RK P PG 
Sbjct  325  AKPFNNVSP-KPSAAFGSGVQRKLDMAKQDGTRNTKPVRSSVKD-SKYRPPGRKSP-PGG  381

Query  444  TVKPSQ---------VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGR  316
                S          VS TA KL+N+++    S R  V     +QL P PMK G V   R
Sbjct  382  NAAGSSLSKNRVARGVSETADKLSNMSVRGTVSRRHSVSVMQQQQLKPPPMKAGCVGEKR  441

Query  315  SRDITPGR----ASTKKLAG  268
               + P +    A ++K+AG
Sbjct  442  DMFLRPTQPATSAYSRKVAG  461



>gb|KEH20316.1| cyclin-dependent kinase [Medicago truncatula]
Length=451

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 95/188 (51%), Gaps = 25/188 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFF++C Y+PPSLR+  G+TRT  S G           R +++++G +   G + N 
Sbjct  278  LQHPFFKSCFYIPPSLRTK-GVTRTPPSAG----------IRGSVDRQGVKRYSGGLLNS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP---G  448
            K  +  SS K   +L  G+ RK ++ ++D  +         Q SKY+PP +  P     G
Sbjct  327  KLTTNFSSNKLHPALAPGVQRKLDMANEDG-TKNKKTVKTTQPSKYRPPGKDSPTSINKG  385

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDIT--------PGR  292
             T +   VS TA KL N++I + R  + Q  P PMK GV     S +I          GR
Sbjct  386  RTAR--GVSETANKLANMSIATRRQSLGQTRPPPMKAGVNWTSESGNILLRSSHPIPTGR  443

Query  291  ASTKKLAG  268
              TKK+AG
Sbjct  444  TFTKKVAG  451



>ref|XP_004512408.1| PREDICTED: cyclin-dependent kinase F-4-like [Cicer arietinum]
Length=449

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 97/187 (52%), Gaps = 25/187 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLRS   + RT    G          TR +L+Q+G +   G + N 
Sbjct  278  LQHPFFQSCFYIPPSLRSR-AVARTPPPAG----------TRGSLDQQGIKRYPGALPNS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMP-GP  445
            K  +  SS  P+    +G+ RK ++ +QD I N KP+K +   +SKY+ P +  P     
Sbjct  327  KLTNYFSS--PKVQPYSGVQRKLDMINQDGIKNEKPMKTT--TQSKYRQPGKDSPTSINK  382

Query  444  TVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD--------ITPGRA  289
                  VS TA++L N+++G+ R  + Q  P PMK GV     S +        I  GR 
Sbjct  383  GGVACGVSETAERLANISVGTRRQSMGQTRPPPMKAGVNWSSDSPNFMLRPAPQIPTGRT  442

Query  288  STKKLAG  268
             T+K+AG
Sbjct  443  FTRKVAG  449



>gb|KHF97733.1| Cyclin-dependent kinase F-4 [Gossypium arboreum]
Length=432

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 78/164 (48%), Gaps = 14/164 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            L HPFFQ+C YVPPSLR    ++ T  SVG           +   EQ+  R   G + N 
Sbjct  278  LGHPFFQSCYYVPPSLRPKAAVSGTPPSVG----------VKGTWEQQSPRRFSGFLPNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K     S+ K  ASL  G+ RK E+ +QD   N     S  ++ +Y+PP RK P      
Sbjct  328  KLAGNHSTLKANASLGTGVQRKLEMVNQDLNKNDKSLKSFAKQPRYRPPGRKSPFATSIN  387

Query  438  KPSQ---VSNTAKKLTNLNIGSGRPPVKQLLPQPMKG-GVVSHG  319
            K       S+ A+KL N+ IG+ R  V Q+     KG G V  G
Sbjct  388  KDRNAIGASDVAEKLANVTIGNRRLNVGQIRHSEYKGWGSVDCG  431



>gb|KHG16595.1| Cyclin-dependent kinase F-4 [Gossypium arboreum]
Length=428

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 89/194 (46%), Gaps = 28/194 (14%)
 Frame = -3

Query  798  LQHPFFQ-NCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ  C YVPPSLR  + ++RT  S G           R  LEQ+  R   G   N
Sbjct  246  LQHPFFQVGCFYVPPSLRPRIAVSRTPPSAG----------VRGTLEQQSVRRYSGAQPN  295

Query  621  PKSMSKTSSFKPRASLNAGIP---RKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM  454
             K     SS K  AS + G     RK E+ +QD   N KPLK   KQ ++Y PP R+   
Sbjct  296  GKFTGSFSSLKTNASFSTGADCAQRKPELLNQDLRKNDKPLKNYSKQ-TRYWPPGRRTTT  354

Query  453  PGPTV----KPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD-------  307
                     + +  S   +KL N+ IGS R    Q+   PMK GV     S D       
Sbjct  355  ISMNKDRNGRGAGASEVVEKLGNVTIGSRRQYGGQIGAPPMKAGVQWTAESNDMFLRPTQ  414

Query  306  -ITPGRASTKKLAG  268
             I  GR  T+K+AG
Sbjct  415  QIPSGRTFTRKVAG  428



>ref|XP_006285874.1| hypothetical protein CARUB_v10007369mg [Capsella rubella]
 gb|EOA18772.1| hypothetical protein CARUB_v10007369mg [Capsella rubella]
Length=458

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 91/191 (48%), Gaps = 24/191 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y PPSLR    + RT   VG           R + E +  + +  +++N 
Sbjct  278  LQHPFFQSCFYAPPSLRPKQSVARTPPPVG----------PRGSFEHQSVKRNPVSLANA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K  +   S K  A+  +G+ RK ++ +QD   N     S  + SKY+PP +K P P    
Sbjct  328  KPFNSYVSPKSNAAFGSGVQRKLDMPNQDGTRNTKTVRSFVRDSKYRPPGKKSPTPALNK  387

Query  438  K--PSQVSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDITPGR-  292
                  VS TA KL N+ +   GS R  V     +QL P  MK G V   R   + P + 
Sbjct  388  NRFTRSVSETADKLANMTVGGTGSRRHSVSVVGHQQLKPPSMKAGWVGETRDMFLRPTQP  447

Query  291  ---ASTKKLAG  268
               A ++K+AG
Sbjct  448  TTNAYSRKVAG  458



>ref|XP_002867954.1| hypothetical protein ARALYDRAFT_492943 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44213.1| hypothetical protein ARALYDRAFT_492943 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 96/197 (49%), Gaps = 34/197 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    + RT  + G             + E +  +    +++N 
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPAWG-------------SFEHQSVKRHPVSLANT  324

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K  +   S K  A+  +G+ RK E+ +QD   N KP++ S++  SKY+PP +K P     
Sbjct  325  KPFNSYVSPKSNAAFGSGVQRKLEMANQDGTRNTKPVRSSVRD-SKYRPPGKKSPQKAAA  383

Query  441  VKPSQ------VSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRD  307
               ++      VS TA KL N+ I   GS R  V      +QL P  MK G V   R   
Sbjct  384  ASLNKNRVTRSVSETADKLANMTIGATGSRRHSVSVVGQHQQLKPPAMKAGWVGQTRDMF  443

Query  306  ITPGR----ASTKKLAG  268
            + P +    A ++K+AG
Sbjct  444  LRPTQPTTNAYSRKVAG  460



>ref|XP_010278825.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X4 [Nelumbo 
nucifera]
Length=384

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 64/115 (56%), Gaps = 10/115 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            L+HPFFQ+C YVPPSLR  V   RT  SVG           R +LEQK  R   GT+SN 
Sbjct  278  LRHPFFQSCFYVPPSLRPRVATPRTPPSVG----------LRGSLEQKSARRYSGTLSNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPM  454
            K ++  SS K  ASL+ G+ RK E+ + DA  N     S  ++ +Y+PP R   M
Sbjct  328  KPITNFSSAKMHASLSTGVQRKLEMGNLDANKNDNSAKSGAKQPRYRPPVRNSTM  382



>gb|KHG16596.1| Cyclin-dependent kinase F-4 [Gossypium arboreum]
Length=446

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 89/194 (46%), Gaps = 28/194 (14%)
 Frame = -3

Query  798  LQHPFFQ-NCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ  C YVPPSLR  + ++RT  S G           R  LEQ+  R   G   N
Sbjct  264  LQHPFFQVGCFYVPPSLRPRIAVSRTPPSAG----------VRGTLEQQSVRRYSGAQPN  313

Query  621  PKSMSKTSSFKPRASLNAGIP---RKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM  454
             K     SS K  AS + G     RK E+ +QD   N KPLK   KQ ++Y PP R+   
Sbjct  314  GKFTGSFSSLKTNASFSTGADCAQRKPELLNQDLRKNDKPLKNYSKQ-TRYWPPGRRTTT  372

Query  453  PGPTV----KPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD-------  307
                     + +  S   +KL N+ IGS R    Q+   PMK GV     S D       
Sbjct  373  ISMNKDRNGRGAGASEVVEKLGNVTIGSRRQYGGQIGAPPMKAGVQWTAESNDMFLRPTQ  432

Query  306  -ITPGRASTKKLAG  268
             I  GR  T+K+AG
Sbjct  433  QIPSGRTFTRKVAG  446



>ref|XP_010535831.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Tarenaya hassleriana]
Length=458

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 101/196 (52%), Gaps = 34/196 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+CLYVPPSLR      RT     R + E  ST+          R+ V  ++NP
Sbjct  278  LQHPFFQSCLYVPPSLRLKPSAARTPPVGPRGSFEQSSTK----------RFPVA-LTNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQ---DAIS--NKPLKGSLKQKSKYQPPARKLPM  454
            K ++   + K  A  + GI RK ++ +Q   DA +  NKP+K S  + +KY+PP RK P 
Sbjct  327  KPVNSYVTPKVNAPFSTGIQRKLDMANQFSKDATTKNNKPMKSSSARDAKYRPPGRKTP-  385

Query  453  PGPTVKPSQ----VSNTAKKLTNLNIGSG----RPPVKQLLPQPMKGGVVSHGRSRDIT-  301
              P++  S+    VS TA KL +  IG+     R  +  +   PMK G +    ++D+  
Sbjct  386  --PSLNKSRGTRGVSETADKLASTTIGAAASARRHTITTVRAPPMKAGWMGES-TKDMFL  442

Query  300  -----PGRASTKKLAG  268
                 P  A T+K+AG
Sbjct  443  RPNQPPSNAYTRKVAG  458



>ref|XP_010110440.1| Cyclin-dependent kinase F-4 [Morus notabilis]
 gb|EXC26272.1| Cyclin-dependent kinase F-4 [Morus notabilis]
Length=455

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 100/189 (53%), Gaps = 23/189 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLRS   + RT            S RTR   +Q+  +    T+ N 
Sbjct  278  LQHPFFQSCYYVPPSLRSRPAVARTPP----------SARTRVPDQQQCAKKHTATLHNS  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAI--SNKPLKGSLKQKSKYQPPARKLPMPGP  445
            KS S  SS K  AS ++G+ RK ++ +QDA    NK +K S  Q+ KY+PP +   +   
Sbjct  328  KSSSNFSSPKLHASADSGVQRKLDMLNQDARKNDNKSIKSSGNQQ-KYRPPGKSNSISTN  386

Query  444  TVKPSQ-VSNTAKKLTNLNIGSGRPPVKQLLP-QPMKGGVVSHGRSRD--------ITPG  295
             V+ ++ VS+ ++KL N+ +G  R P   L P  PMK GV   G S +        I  G
Sbjct  387  RVRATRVVSDASEKLANMTLGPPRKPTVGLRPTAPMKSGVQWIGESGNVYLRHAQPIQSG  446

Query  294  RASTKKLAG  268
            R  T+K+ G
Sbjct  447  RVYTRKVVG  455



>ref|XP_010278824.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Nelumbo 
nucifera]
Length=393

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 63/111 (57%), Gaps = 10/111 (9%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            L+HPFFQ+C YVPPSLR  V   RT  SVG           R +LEQK  R   GT+SN 
Sbjct  278  LRHPFFQSCFYVPPSLRPRVATPRTPPSVG----------LRGSLEQKSARRYSGTLSNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPAR  466
            K ++  SS K  ASL+ G+ RK E+ + DA  N     S  ++ +Y+PP R
Sbjct  328  KPITNFSSAKMHASLSTGVQRKLEMGNLDANKNDNSAKSGAKQPRYRPPVR  378



>ref|XP_009108408.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Brassica 
rapa]
Length=461

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 100/200 (50%), Gaps = 39/200 (20%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFF++C YVPPSLR    + RT   VG R + E  S + +             T+S 
Sbjct  278  LQHPFFKSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQSAKRQ-------------TVSL  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +  S  KP A+  +G+ RK ++  Q+   N KP++ S+K  SKY+PP RK P PG 
Sbjct  325  AKPFNNVSP-KPSAAFGSGVQRKLDMAKQEGTRNTKPVRSSVKD-SKYRPPGRKSP-PGG  381

Query  444  TVKPSQ---------VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGR  316
                S          VS TA KL+N+++    S R  V     +QL P PMK G V   R
Sbjct  382  NAAGSSLSKNRVARGVSETADKLSNMSVRGTVSRRHSVSVMQQQQLKPPPMKAGCVGEKR  441

Query  315  SRDITPGR----ASTKKLAG  268
               + P +    A ++K+AG
Sbjct  442  DMFLRPTQPATSAYSRKVAG  461



>emb|CDX76497.1| BnaA08g09030D [Brassica napus]
Length=461

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 99/200 (50%), Gaps = 39/200 (20%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR    + RT   VG R + E  S + +             T+S 
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQSAKRQ-------------TVSL  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +  S  KP A+  +G+ RK ++  Q+   N KP++ S+K  SKY+PP RK P PG 
Sbjct  325  AKPFNNVSP-KPSAAFGSGVQRKLDMAKQEGTRNTKPVRSSVKD-SKYRPPGRKSP-PGG  381

Query  444  TVKPSQ---------VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGR  316
                S          VS TA KL+N+++    S R  V     +QL P PMK G V   R
Sbjct  382  NAAGSSLSKNRVARGVSETADKLSNMSVRGTVSRRHSVSVMQQQQLKPPPMKAGCVGEKR  441

Query  315  S---RDITPG-RASTKKLAG  268
                R   P   A ++K+AG
Sbjct  442  DMFLRSTQPATSAYSRKVAG  461



>ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicago truncatula]
 gb|AES95574.1| cyclin-dependent kinase [Medicago truncatula]
Length=449

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 99/188 (53%), Gaps = 27/188 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLRS   + RT    G          TR AL+Q+G +   G + + 
Sbjct  278  LQHPFFQSCFYIPPSLRSR-AVARTPPPAG----------TRGALDQQGVKRYPGALHSS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP---MPG  448
            K  +  SS  P+   ++G+ RK ++ +Q+ I N+    +  Q SKY+ P ++ P   + G
Sbjct  327  KPTNYFSS--PKVQPSSGVQRKLDMVNQEGIKNEKSMKTTTQ-SKYRHPGKESPTSVIKG  383

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRD--------ITPGR  292
             T+    +S TA++L N++IG+ R  + Q  P PMK GV     S +        I  GR
Sbjct  384  RTIH--GISETAERLANMSIGNRRQSMGQPRPPPMKAGVNWSSESPNFMLRPAPQIPTGR  441

Query  291  ASTKKLAG  268
               +K+AG
Sbjct  442  TYPRKVAG  449



>ref|XP_009108410.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Brassica 
rapa]
Length=455

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 98/193 (51%), Gaps = 31/193 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFF++C YVPPSLR    + RT   VG R + E  S + +             T+S 
Sbjct  278  LQHPFFKSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQSAKRQ-------------TVSL  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             K  +  S  KP A+  +G+ RK ++  Q+   N KP++ S+K  SKY+PP RK P    
Sbjct  325  AKPFNNVSP-KPSAAFGSGVQRKLDMAKQEGTRNTKPVRSSVKD-SKYRPPGRKSPRSSL  382

Query  444  TVK--PSQVSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDITPG  295
            +       VS TA KL+N+++    S R  V     +QL P PMK G V   R   + P 
Sbjct  383  SKNRVARGVSETADKLSNMSVRGTVSRRHSVSVMQQQQLKPPPMKAGCVGEKRDMFLRPT  442

Query  294  R----ASTKKLAG  268
            +    A ++K+AG
Sbjct  443  QPATSAYSRKVAG  455



>ref|XP_007156359.1| hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris]
 gb|ESW28353.1| hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris]
Length=448

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 22/185 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   +TRT  S G          TR +L+++G +     + N 
Sbjct  278  LQHPFFQSCFYIPPSLRTR-AVTRTPPSAG----------TRGSLDRQGLKRYSSALPNT  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM---P  451
            K  +  SS K  AS+ +G+ RK ++ ++D I N KPLK +  Q SKY+   +  P     
Sbjct  327  KITNNFSSQKLHASVTSGVQRKLDLATKDGIKNKKPLKTTTPQ-SKYRFTGKDSPTGMNK  385

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLL-PQPMKGG--VVSHGRSRDITP-GRAST  283
            G +V+   VS +A+KL N++IG+ R  + Q   P PMK    +    RS    P  R+ T
Sbjct  386  GRSVRG--VSESAEKLANMSIGTRRQSMGQSRPPPPMKTANWISESLRSGQQNPTERSLT  443

Query  282  KKLAG  268
            +K+AG
Sbjct  444  RKVAG  448



>ref|XP_010434456.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Camelina 
sativa]
Length=459

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 91/193 (47%), Gaps = 27/193 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y PPSLR    + RT   VG           R + E +  +    +++N 
Sbjct  278  LQHPFFQSCFYAPPSLRPKPSVARTPPPVG----------PRGSFEHQSVKRQPVSLANA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K  +  +S K  A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P P    
Sbjct  328  KPFNSYASPKSHAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSP-PAALN  386

Query  438  K---PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDITPG  295
            K      VS  A KL N+ I   GS R  V      +QL P  MK G V   R   + P 
Sbjct  387  KNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWVGETRDMYLRPT  446

Query  294  R----ASTKKLAG  268
            +    A ++K+AG
Sbjct  447  QPTTNAYSRKVAG  459



>ref|XP_010918078.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Elaeis guineensis]
Length=456

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 78/158 (49%), Gaps = 29/158 (18%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTISN  622
            LQH FFQ+C Y+ PS+R  V    +T S G           R A EQK   R+S GT+S 
Sbjct  298  LQHSFFQSCFYIAPSVRPKVAGKLSTPSAG----------VRGASEQKSARRYSTGTLST  347

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP----  457
             K  S    FK  ASL  G  R  E+    +  N K +K  LKQ S+Y+PPAR  P    
Sbjct  348  TKPASNILPFKSNASLRTGAQRTLELEHHGSEKNEKSMKIDLKQ-SRYRPPARNNPGVLG  406

Query  456  --------MPGPT----VKPSQVSNTAKKLTNLNIGSG  379
                    MPG T    V  ++VSN A+KL  +++ SG
Sbjct  407  RNSHRVADMPGKTALGAVTSTRVSNVAEKLGKVSLSSG  444



>ref|XP_010535821.1| PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Tarenaya hassleriana]
Length=459

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 98/195 (50%), Gaps = 31/195 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+CLYVPPSLR      RT     R + E  ST+          R+ V  ++NP
Sbjct  278  LQHPFFQSCLYVPPSLRLKPSAARTPPVGPRGSFEQSSTK----------RFPVA-LTNP  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQ---DAIS--NKPLKGSLKQKSKYQPPARKLPM  454
            K ++   + K  A  + GI RK ++ +Q   DA +  NKP+K S  + +KY+PP RK P 
Sbjct  327  KPVNSYVTPKVNAPFSTGIQRKLDMANQFSKDATTKNNKPMKSSSARDAKYRPPGRKTP-  385

Query  453  PGPTVKP---SQVSNTAKKLTNLNIGSG----RPPVKQLLPQPMKGGVVSHGRSRDIT--  301
            P    K      VS TA KL +  IG+     R  +  +   PMK G +    ++D+   
Sbjct  386  PASLNKSRGTRGVSETADKLASTTIGAAASARRHTITTVRAPPMKAGWMGES-TKDMFLR  444

Query  300  ----PGRASTKKLAG  268
                P  A T+K+AG
Sbjct  445  PNQPPSNAYTRKVAG  459



>gb|KHN41734.1| Cyclin-dependent kinase F-4 [Glycine soja]
Length=269

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 98/189 (52%), Gaps = 29/189 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   + RT    G          TR AL+Q+G +   G +   
Sbjct  97   LQHPFFQSCFYIPPSLRN-RAVARTPPPAG----------TRGALDQQGVKRYSGALPTS  145

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  SS K    L +G+ RK ++ +QD I N KP++ +   K KY+ P +  P     
Sbjct  146  KLSNNFSSMKLHPPLASGVQRKLDMVNQDGIKNEKPMRTT---KPKYRQPGKDSPTSMNK  202

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQ-LLPQPMKGG--VVSH------GRSRDITP  298
            G +V+   VS TA+KL NL++ S R  + Q   P PMK G   +S       G ++ I  
Sbjct  203  GRSVR--GVSETAEKLGNLSVSSRRQSMGQPRPPPPMKAGGNWISESGNFILGPAQQIPT  260

Query  297  GRASTKKLA  271
            GR   +K+A
Sbjct  261  GRTFARKVA  269



>ref|XP_010434453.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Camelina 
sativa]
 ref|XP_010434455.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Camelina 
sativa]
Length=462

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 89/195 (46%), Gaps = 28/195 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y PPSLR    + RT   VG           R + E +  +    +++N 
Sbjct  278  LQHPFFQSCFYAPPSLRPKPSVARTPPPVG----------PRGSFEHQSVKRQPVSLANA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPTV  439
            K  +  +S K  A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P      
Sbjct  328  KPFNSYASPKSHAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSPHNSAAA  387

Query  438  K-----PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDIT  301
                     VS  A KL N+ I   GS R  V      +QL P  MK G V   R   + 
Sbjct  388  LNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWVGETRDMYLR  447

Query  300  PGR----ASTKKLAG  268
            P +    A ++K+AG
Sbjct  448  PTQPTTNAYSRKVAG  462



>ref|XP_008799996.1| PREDICTED: cyclin-dependent kinase F-4 [Phoenix dactylifera]
Length=437

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 82/168 (49%), Gaps = 36/168 (21%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGV-GLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQH FFQ+C YV PSLR  V G   T  S G           R A EQK   R+S G +S
Sbjct  278  LQHSFFQSCFYVAPSLRPKVAGKLNTPPSAG----------ARGASEQKSARRYSTGALS  327

Query  624  NPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP---  457
              K  +   S K  ASL  G+ RK E+  Q+   N K +K +LKQ S+Y+PPAR  P   
Sbjct  328  TTKPANNILSVKSNASLRTGVQRKLEMEHQEHEKNEKSMKNNLKQ-SRYRPPARNNPGVL  386

Query  456  ---------MPGPT----VKPSQVSNTAKKLTNLNIGSG------RPP  370
                     M G T       ++VSN A+KL  +++ SG      RPP
Sbjct  387  GRNSHRVADMAGKTALGVATSTRVSNVAEKLEKVSLSSGLWHNGKRPP  434



>ref|XP_009136989.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Brassica rapa]
Length=458

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 101/194 (52%), Gaps = 30/194 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YV PSLR    + RT   VG           R + EQ+  +    +++  
Sbjct  278  LQHPFFQSCFYVQPSLRPKPSVARTP-PVG----------PRGSFEQQPVKRQPVSLAKA  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K+ +  SS K  A+  +G+ RK ++  QDA  N KP++ S+K  + Y+PP RK P  G +
Sbjct  327  KTFNSHSSPKSNAAFGSGVHRKLDLAKQDATRNTKPVRSSVKD-TIYRPPGRKSP-SGSS  384

Query  441  VKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDITP  298
            V  ++    VS T  KL+N++I    S R  V     +QL P  MK G V   R   I P
Sbjct  385  VNKNRVARGVSETGDKLSNMSIRGTVSRRHSVSVMQQQQLKPLQMKAGCVGETRDMFIRP  444

Query  297  GRAST----KKLAG  268
             +++T    +K+AG
Sbjct  445  TQSTTNAYSRKVAG  458



>ref|XP_009136988.1| PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Brassica rapa]
Length=461

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 101/196 (52%), Gaps = 31/196 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YV PSLR    + RT   VG           R + EQ+  +    +++  
Sbjct  278  LQHPFFQSCFYVQPSLRPKPSVARTP-PVG----------PRGSFEQQPVKRQPVSLAKA  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM--PG  448
            K+ +  SS K  A+  +G+ RK ++  QDA  N KP++ S+K  + Y+PP RK P    G
Sbjct  327  KTFNSHSSPKSNAAFGSGVHRKLDLAKQDATRNTKPVRSSVKD-TIYRPPGRKSPCNAAG  385

Query  447  PTVKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDI  304
             +V  ++    VS T  KL+N++I    S R  V     +QL P  MK G V   R   I
Sbjct  386  SSVNKNRVARGVSETGDKLSNMSIRGTVSRRHSVSVMQQQQLKPLQMKAGCVGETRDMFI  445

Query  303  TPGRAST----KKLAG  268
             P +++T    +K+AG
Sbjct  446  RPTQSTTNAYSRKVAG  461



>gb|KHF97734.1| Cyclin-dependent kinase F-4 [Gossypium arboreum]
Length=461

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 75/158 (47%), Gaps = 14/158 (9%)
 Frame = -3

Query  798  LQHPFFQ-NCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            L HPFFQ +C YVPPSLR    ++ T  SVG           +   EQ+  R   G + N
Sbjct  306  LGHPFFQVSCYYVPPSLRPKAAVSGTPPSVG----------VKGTWEQQSPRRFSGFLPN  355

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPT  442
             K     S+ K  ASL  G+ RK E+ +QD   N     S  ++ +Y+PP RK P     
Sbjct  356  AKLAGNHSTLKANASLGTGVQRKLEMVNQDLNKNDKSLKSFAKQPRYRPPGRKSPFATSI  415

Query  441  VKPSQ---VSNTAKKLTNLNIGSGRPPVKQLLPQPMKG  337
             K       S+ A+KL N+ IG+ R  V Q+     KG
Sbjct  416  NKDRNAIGASDVAEKLANVTIGNRRLNVGQIRHSEYKG  453



>gb|KHF97732.1| Cyclin-dependent kinase F-4 [Gossypium arboreum]
Length=595

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 75/158 (47%), Gaps = 14/158 (9%)
 Frame = -3

Query  798  LQHPFFQ-NCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            L HPFFQ +C YVPPSLR    ++ T  SVG           +   EQ+  R   G + N
Sbjct  440  LGHPFFQVSCYYVPPSLRPKAAVSGTPPSVG----------VKGTWEQQSPRRFSGFLPN  489

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPT  442
             K     S+ K  ASL  G+ RK E+ +QD   N     S  ++ +Y+PP RK P     
Sbjct  490  AKLAGNHSTLKANASLGTGVQRKLEMVNQDLNKNDKSLKSFAKQPRYRPPGRKSPFATSI  549

Query  441  VKPSQ---VSNTAKKLTNLNIGSGRPPVKQLLPQPMKG  337
             K       S+ A+KL N+ IG+ R  V Q+     KG
Sbjct  550  NKDRNAIGASDVAEKLANVTIGNRRLNVGQIRHSEYKG  587



>ref|XP_003517078.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Glycine 
max]
 ref|XP_006573479.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X4 [Glycine 
max]
Length=450

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 98/189 (52%), Gaps = 29/189 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   + RT    G          TR AL+Q+G +   G +   
Sbjct  278  LQHPFFQSCFYIPPSLRNR-AVARTPPPAG----------TRGALDQQGVKRYSGALPTS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  SS K    L +G+ RK ++ +QD I N KP++ +   K KY+ P +  P     
Sbjct  327  KLSNNFSSMKLHPPLASGVQRKLDMVNQDGIKNEKPMRTT---KPKYRQPGKDSPTSMNK  383

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQ-LLPQPMKGG--VVSH------GRSRDITP  298
            G +V+   VS TA+KL NL++ S R  + Q   P PMK G   +S       G ++ I  
Sbjct  384  GRSVR--GVSETAEKLGNLSVSSRRQSMGQPRPPPPMKAGGNWISESGNFILGPAQQIPT  441

Query  297  GRASTKKLA  271
            GR   +K+A
Sbjct  442  GRTFARKVA  450



>emb|CDX98605.1| BnaA03g43900D [Brassica napus]
Length=461

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 100/196 (51%), Gaps = 31/196 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YV PSLR    + RT   VG           R + EQ+  +    +++  
Sbjct  278  LQHPFFQSCFYVQPSLRPKPSVARTP-PVG----------PRGSFEQQPVKRQPVSLAKA  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM--PG  448
            K+ +  SS K  A+  +G+ RK ++  QDA  N KP++ S+K  + Y+PP RK P    G
Sbjct  327  KTFNSHSSPKSNAAFGSGVHRKLDLAKQDATRNTKPVRSSVKD-TIYRPPGRKSPCNAAG  385

Query  447  PTVKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDI  304
             +V  ++    VS T  KL+N++I    S R  V     +QL P  MK G V   R   I
Sbjct  386  SSVNKNRVARGVSETGDKLSNMSIRGTVSRRHSVSVMQQQQLKPPQMKAGCVGETRDMFI  445

Query  303  TPGR----ASTKKLAG  268
             P +    A ++K+AG
Sbjct  446  RPTQPTTNAYSRKVAG  461



>ref|XP_008779080.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Phoenix 
dactylifera]
Length=364

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 87/179 (49%), Gaps = 32/179 (18%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNR-WSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK  R +S+G +
Sbjct  175  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNTRRYSIGAL  223

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            SN K  S  SS    A +  G+ RK E+ N Q++ + K  K   KQ S+Y+PPAR  P  
Sbjct  224  SNTKPASNLSSANVNAYMRTGVQRKLEMENHQESKNEKSTKIGPKQ-SRYRPPARNNPAG  282

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGR--------PPVKQLLPQPMK--------GGVVSH  322
                   +VS+  +KL  L + S +        PP+K   PQP++        GG  SH
Sbjct  283  YLGRDSRRVSDVTEKLACLKVSSNKVSDASEKLPPLKAADPQPVRQQPPRMKAGGWHSH  341



>ref|XP_006573477.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Glycine 
max]
 ref|XP_006573478.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Glycine 
max]
Length=476

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 98/189 (52%), Gaps = 29/189 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   + RT    G          TR AL+Q+G +   G +   
Sbjct  304  LQHPFFQSCFYIPPSLRNR-AVARTPPPAG----------TRGALDQQGVKRYSGALPTS  352

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMP---  451
            K  +  SS K    L +G+ RK ++ +QD I N KP++ +   K KY+ P +  P     
Sbjct  353  KLSNNFSSMKLHPPLASGVQRKLDMVNQDGIKNEKPMRTT---KPKYRQPGKDSPTSMNK  409

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQ-LLPQPMKGG--VVSH------GRSRDITP  298
            G +V+   VS TA+KL NL++ S R  + Q   P PMK G   +S       G ++ I  
Sbjct  410  GRSVR--GVSETAEKLGNLSVSSRRQSMGQPRPPPPMKAGGNWISESGNFILGPAQQIPT  467

Query  297  GRASTKKLA  271
            GR   +K+A
Sbjct  468  GRTFARKVA  476



>emb|CDY01580.1| BnaC07g35700D [Brassica napus]
Length=461

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 98/196 (50%), Gaps = 31/196 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    + RT   VG           R + EQ+  +    +++  
Sbjct  278  LQHPFFQSCFYVPPSLRPKPSVARTP-PVG----------PRGSFEQQPAKRQPVSLAKA  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPM--PG  448
            K+ +  +S K   +  +G+ RK ++  QD   N KP + S K  S Y+PP RK P    G
Sbjct  327  KTFNSHASPKSNTAFGSGVQRKLDLAKQDGTRNTKPARSSAKD-SIYRPPGRKSPCNAAG  385

Query  447  PTVKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDI  304
             +V  ++    VS TA KL+N++I    S R  V     +QL P  MK G V   R   I
Sbjct  386  SSVNKNRVARGVSETADKLSNMSIRGTVSRRHSVSVMQQQQLKPPQMKAGCVGETRDMFI  445

Query  303  TPGR----ASTKKLAG  268
             P +    A ++K+AG
Sbjct  446  RPTQPTTNAYSRKVAG  461



>ref|XP_009136990.1| PREDICTED: cyclin-dependent kinase F-4 isoform X3 [Brassica rapa]
Length=457

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 100/194 (52%), Gaps = 31/194 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YV PSLR    + RT   VG           R + EQ+  +    +++  
Sbjct  278  LQHPFFQSCFYVQPSLRPKPSVARTP-PVG----------PRGSFEQQPVKRQPVSLAKA  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGPT  442
            K+ +  SS K  A+  +G+ RK ++  QDA  N KP++ S+K  + Y+PP RK   P  +
Sbjct  327  KTFNSHSSPKSNAAFGSGVHRKLDLAKQDATRNTKPVRSSVKD-TIYRPPGRK--SPCSS  383

Query  441  VKPSQ----VSNTAKKLTNLNI---GSGRPPV-----KQLLPQPMKGGVVSHGRSRDITP  298
            V  ++    VS T  KL+N++I    S R  V     +QL P  MK G V   R   I P
Sbjct  384  VNKNRVARGVSETGDKLSNMSIRGTVSRRHSVSVMQQQQLKPLQMKAGCVGETRDMFIRP  443

Query  297  GRAST----KKLAG  268
             +++T    +K+AG
Sbjct  444  TQSTTNAYSRKVAG  457



>ref|XP_008802975.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Phoenix 
dactylifera]
Length=467

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 97/201 (48%), Gaps = 36/201 (18%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLT-RTTQSVGRNNIEFISTRTRDALEQKG-NRWSVGTIS  625
            LQH FFQ+C+YV PSLR  V     T  SVG           R A EQKG  R+S GT+S
Sbjct  279  LQHSFFQSCVYVAPSLRPKVAAKPNTPPSVG----------VRGASEQKGARRYSTGTLS  328

Query  624  NPKSMSKTSSFKPRASLNAGIPRKSEINSQD-AISNKPLKGSLKQKSKYQPPARKLP---  457
              K+ +   S K  ASL  G  RK E+  Q    + K +K S KQ S Y+PPAR  P   
Sbjct  329  TTKAANNVLSVKSNASLRTGAQRKLEMAHQAPEKTEKSMKNSFKQ-SPYRPPARNNPGAF  387

Query  456  ---------MPGPT----VKPSQVSNTAKKLTNLNIGSG-RPPVKQLLPQPMKGGVVSH-  322
                     +P  T       ++VSN A+KL  +++ SG +   KQ  P    GG  S  
Sbjct  388  GRSSRRMADIPEKTSNRAATSAKVSNVAEKLGKMSLNSGPQHAGKQPPPWMKAGGWHSQT  447

Query  321  ---GRSRDITPGRASTKKLAG  268
                RS ++ P R  T+K+ G
Sbjct  448  DLLARSHELPP-RRFTRKVVG  467



>ref|XP_010439765.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Camelina 
sativa]
Length=459

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 93/195 (48%), Gaps = 31/195 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQS-VGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C Y PPSLR    + RT    VG           R + E +  +    +++N
Sbjct  278  LQHPFFQSCFYAPPSLRPKPSVARTPPPPVG----------PRGSFEHQSVKRQPVSLAN  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPT  442
             K  +  +S K  A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P   P 
Sbjct  328  AKPFNSYASPKSHAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSP---PA  384

Query  441  VKPSQ----VSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDIT  301
            +  ++    VS  A KL N+ I   GS R  V      +QL P  MK G V   R   + 
Sbjct  385  LNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWVGETRDMYLR  444

Query  300  PGR----ASTKKLAG  268
            P +    A ++K+AG
Sbjct  445  PTQPTTNAYSRKVAG  459



>ref|XP_010449400.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Camelina 
sativa]
Length=463

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 98/200 (49%), Gaps = 37/200 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRD---ALEQKGNRWSVGT  631
            LQHPFF++C Y PPSLR    + RT   VG R + E  S + +    A  +  N ++  +
Sbjct  278  LQHPFFKSCFYAPPSLRPKPSVVRTPPPVGPRVSFEHQSVKRQPVSLANAKPFNSYAFNS  337

Query  630  ISNPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
             ++PKS          A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P  
Sbjct  338  YASPKS---------HAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSP--  386

Query  450  GPTVKPSQ----VSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSR  310
             P +  ++    VS  A KL N+ I   GS R  V      +QL P  MK G V  G +R
Sbjct  387  -PALNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWV--GETR  443

Query  309  DI------TPGRASTKKLAG  268
            D+      T   A ++K+AG
Sbjct  444  DMFLRPTQTTTNAYSRKVAG  463



>ref|XP_008779081.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Phoenix 
dactylifera]
Length=363

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 90/180 (50%), Gaps = 35/180 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNR-WSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK  R +S+G +
Sbjct  175  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNTRRYSIGAL  223

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            SN K  S  SS    A +  G+ RK E+ N Q++ + K  K   KQ S+Y+PPAR    P
Sbjct  224  SNTKPASNLSSANVNAYMRTGVQRKLEMENHQESKNEKSTKIGPKQ-SRYRPPARN--NP  280

Query  450  GPTVKPS-QVSNTAKKLTNLNIGSGR--------PPVKQLLPQPMK--------GGVVSH  322
            G   + S +VS+  +KL  L + S +        PP+K   PQP++        GG  SH
Sbjct  281  GYLGRDSRRVSDVTEKLACLKVSSNKVSDASEKLPPLKAADPQPVRQQPPRMKAGGWHSH  340



>ref|XP_010449399.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Camelina 
sativa]
Length=464

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 96/199 (48%), Gaps = 34/199 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRD---ALEQKGNRWSVGT  631
            LQHPFF++C Y PPSLR    + RT   VG R + E  S + +    A  +  N ++  +
Sbjct  278  LQHPFFKSCFYAPPSLRPKPSVVRTPPPVGPRVSFEHQSVKRQPVSLANAKPFNSYAFNS  337

Query  630  ISNPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
             ++PKS          A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P P
Sbjct  338  YASPKS---------HAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSP-P  387

Query  450  GPTVK---PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRD  307
                K      VS  A KL N+ I   GS R  V      +QL P  MK G V  G +RD
Sbjct  388  AALNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWV--GETRD  445

Query  306  I------TPGRASTKKLAG  268
            +      T   A ++K+AG
Sbjct  446  MFLRPTQTTTNAYSRKVAG  464



>ref|XP_010439764.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Camelina 
sativa]
Length=460

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 91/194 (47%), Gaps = 28/194 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQS-VGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C Y PPSLR    + RT    VG           R + E +  +    +++N
Sbjct  278  LQHPFFQSCFYAPPSLRPKPSVARTPPPPVG----------PRGSFEHQSVKRQPVSLAN  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPT  442
             K  +  +S K  A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P P   
Sbjct  328  AKPFNSYASPKSHAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSP-PAAL  386

Query  441  VK---PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDITP  298
             K      VS  A KL N+ I   GS R  V      +QL P  MK G V   R   + P
Sbjct  387  NKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWVGETRDMYLRP  446

Query  297  GR----ASTKKLAG  268
             +    A ++K+AG
Sbjct  447  TQPTTNAYSRKVAG  460



>ref|XP_010054057.1| PREDICTED: cyclin-dependent kinase F-4 [Eucalyptus grandis]
 gb|KCW78440.1| hypothetical protein EUGRSUZ_D02596 [Eucalyptus grandis]
 gb|KCW78441.1| hypothetical protein EUGRSUZ_D02596 [Eucalyptus grandis]
Length=449

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 92/187 (49%), Gaps = 25/187 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR      RT  SVG           R  L+Q+  R     ++N 
Sbjct  278  LQHPFFQSCYYVPPSLRVRAAAPRTPPSVG----------ARAPLQQQNAR-RTAVVANT  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP---G  448
            K     SS K +  +N G+ RK  + S+   ++K    S+KQ  KY+PP +  P     G
Sbjct  327  KLSGNLSSPK-QQPVNRGVERKLNMGSEKDANHKLSSTSIKQ-PKYRPPGKNSPSSINKG  384

Query  447  PTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKG-------GVVSHGRSRDITPGRA  289
             T   S V+  A+K+ NL++ S +      +P PMK        G +   +  +I PGRA
Sbjct  385  GTA--SAVTGAAQKMGNLSLSSRKDCAIPRVPHPMKAGGWRGEPGDMLRRKPNEIPPGRA  442

Query  288  STKKLAG  268
             ++K+ G
Sbjct  443  FSRKVTG  449



>ref|XP_010449398.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Camelina 
sativa]
Length=467

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 94/201 (47%), Gaps = 35/201 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRD---ALEQKGNRWSVGT  631
            LQHPFF++C Y PPSLR    + RT   VG R + E  S + +    A  +  N ++  +
Sbjct  278  LQHPFFKSCFYAPPSLRPKPSVVRTPPPVGPRVSFEHQSVKRQPVSLANAKPFNSYAFNS  337

Query  630  ISNPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
             ++PKS          A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P  
Sbjct  338  YASPKS---------HAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSPHN  388

Query  450  GPTVK-----PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRS  313
                         VS  A KL N+ I   GS R  V      +QL P  MK G V  G +
Sbjct  389  AAAALNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWV--GET  446

Query  312  RDI------TPGRASTKKLAG  268
            RD+      T   A ++K+AG
Sbjct  447  RDMFLRPTQTTTNAYSRKVAG  467



>ref|XP_010439763.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Camelina 
sativa]
Length=463

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 89/196 (45%), Gaps = 29/196 (15%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQS-VGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C Y PPSLR    + RT    VG           R + E +  +    +++N
Sbjct  278  LQHPFFQSCFYAPPSLRPKPSVARTPPPPVG----------PRGSFEHQSVKRQPVSLAN  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMPGPT  442
             K  +  +S K  A+  +G+ RK E+ +QD   N     S  + SKY+PP +K P     
Sbjct  328  AKPFNSYASPKSHAAFGSGVQRKLEMANQDGTRNTKAVRSSVRDSKYRPPGKKSPHNAAA  387

Query  441  VK-----PSQVSNTAKKLTNLNI---GSGRPPV------KQLLPQPMKGGVVSHGRSRDI  304
                      VS  A KL N+ I   GS R  V      +QL P  MK G V   R   +
Sbjct  388  ALNKNRFTRSVSEAADKLANMTIGGTGSRRHSVSVVGQHQQLKPPSMKAGWVGETRDMYL  447

Query  303  TPGR----ASTKKLAG  268
             P +    A ++K+AG
Sbjct  448  RPTQPTTNAYSRKVAG  463



>ref|XP_010906697.1| PREDICTED: cyclin-dependent kinase F-4-like [Elaeis guineensis]
Length=466

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 95/200 (48%), Gaps = 34/200 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTISN  622
            LQHPFFQ C+YV PSL   VG    T           S   R A EQK   R+S GT+S 
Sbjct  278  LQHPFFQTCVYVAPSLHPKVGAKPNTPP---------SAGVRGASEQKSARRYSTGTLST  328

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQD-AISNKPLKGSLKQKSKYQPPARKLP----  457
             K  +   S K  ASL  G  RK E++ +    + K ++ S KQ S+Y+PPAR  P    
Sbjct  329  TKPANNVLSVKSNASLRTGAQRKLELDHRGPGKTEKSMRNSFKQ-SQYRPPARNNPGVLG  387

Query  456  --------MPGPTVK----PSQVSNTAKKLTNLNIGSG-RPPVKQLLPQPMKGGVVSH--  322
                    +P  T       ++VSN A+KL  +++ SG +   KQ  P    GG  S   
Sbjct  388  RSSRSAADIPEKTASGAATSAKVSNVAEKLGKMSLSSGPQHSGKQPPPWMKAGGWHSQTD  447

Query  321  --GRSRDITPGRASTKKLAG  268
               RS ++ P R  T+K+ G
Sbjct  448  LLSRSHELPP-RRYTRKVVG  466



>ref|XP_008802973.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802974.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Phoenix 
dactylifera]
Length=470

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 98/204 (48%), Gaps = 39/204 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLT-RTTQSVGRNNIEFISTRTRDALEQKG-NRWSVGTIS  625
            LQH FFQ+C+YV PSLR  V     T  SVG           R A EQKG  R+S GT+S
Sbjct  279  LQHSFFQSCVYVAPSLRPKVAAKPNTPPSVG----------VRGASEQKGARRYSTGTLS  328

Query  624  NPKSMSKTSSFKPRASLN---AGIPRKSEINSQD-AISNKPLKGSLKQKSKYQPPARKLP  457
              K+ +   S K  ASL    AG  RK E+  Q    + K +K S KQ S Y+PPAR  P
Sbjct  329  TTKAANNVLSVKSNASLRTVAAGAQRKLEMAHQAPEKTEKSMKNSFKQ-SPYRPPARNNP  387

Query  456  ------------MPGPT----VKPSQVSNTAKKLTNLNIGSG-RPPVKQLLPQPMKGGVV  328
                        +P  T       ++VSN A+KL  +++ SG +   KQ  P    GG  
Sbjct  388  GAFGRSSRRMADIPEKTSNRAATSAKVSNVAEKLGKMSLNSGPQHAGKQPPPWMKAGGWH  447

Query  327  SH----GRSRDITPGRASTKKLAG  268
            S      RS ++ P R  T+K+ G
Sbjct  448  SQTDLLARSHELPP-RRFTRKVVG  470



>ref|XP_006854198.1| hypothetical protein AMTR_s00048p00208600 [Amborella trichopoda]
 gb|ERN15665.1| hypothetical protein AMTR_s00048p00208600 [Amborella trichopoda]
Length=470

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 13/114 (11%)
 Frame = -3

Query  798  LQHPFFQNCL-YVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ C  YVPPSLR+   L   T   G           + A E KG R S+GT+S+
Sbjct  278  LQHPFFQPCFFYVPPSLRAKGMLAPRTPPSGS---------VKGASEHKGVRRSLGTLSS  328

Query  621  --PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPAR  466
              P + S  SS K  ASLN G+ R+ E+++Q+ + N  L  S  ++ +Y+PPAR
Sbjct  329  VKPVAASHFSSAKLSASLNTGVQRRLEMDNQE-VKNDKLAKSGARQPRYRPPAR  381



>ref|XP_006587633.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max]
Length=455

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 99/199 (50%), Gaps = 43/199 (22%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   + RT    G          TR AL+Q+  +   G +   
Sbjct  278  LQHPFFQSCFYIPPSLRNR-AVARTPPPAG----------TRGALDQQEVKRYSGALPTS  326

Query  618  KSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLP----M  454
            K  +  SS K    L +G+ RK ++ +QD I N KP++ +   K KY+ P +        
Sbjct  327  KLSNNFSSMKLHPPLASGVQRKLDMVNQDGIKNEKPVRTT---KPKYRQPGKDSSPTSMS  383

Query  453  PGPTVKPSQVSNTAKKLTNL--------NIGSGRP-PVKQLLPQPMKGG--VVSH-----  322
             G +V+   VS TA+KL NL        +IG G+P P     P PMK G   +S      
Sbjct  384  KGRSVR--GVSETAEKLRNLSVTNRRQSSIGIGQPRP-----PPPMKAGGNWISESGNFI  436

Query  321  -GRSRDITPGRASTKKLAG  268
             G ++ I+ GR   +K+AG
Sbjct  437  LGPAQQISTGRTFARKVAG  455



>ref|XP_010940815.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Elaeis 
guineensis]
Length=465

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 16/145 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK   R+S+G +
Sbjct  278  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNARRYSMGAL  326

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            S  K  +  SS    AS+  G+ RK  + N Q++ + K  K  LKQ S+Y+PPAR  P  
Sbjct  327  SGTKPATNLSSANGDASMRTGVQRKLAMENHQESENEKSTKIGLKQ-SRYRPPARNNPAG  385

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGR  376
                    VS+   KL +L + S +
Sbjct  386  YLGRDSRSVSDVTDKLAHLKVSSNK  410



>ref|XP_010940813.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Elaeis 
guineensis]
Length=491

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 16/145 (11%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK   R+S+G +
Sbjct  304  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNARRYSMGAL  352

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            S  K  +  SS    AS+  G+ RK  + N Q++ + K  K  LKQ S+Y+PPAR  P  
Sbjct  353  SGTKPATNLSSANGDASMRTGVQRKLAMENHQESENEKSTKIGLKQ-SRYRPPARNNPAG  411

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGR  376
                    VS+   KL +L + S +
Sbjct  412  YLGRDSRSVSDVTDKLAHLKVSSNK  436



>ref|XP_010918077.1| PREDICTED: cyclin-dependent kinase F-4 isoform X1 [Elaeis guineensis]
Length=481

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 79/183 (43%), Gaps = 54/183 (30%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTISN  622
            LQH FFQ+C Y+ PS+R  V    +T S G           R A EQK   R+S GT+S 
Sbjct  298  LQHSFFQSCFYIAPSVRPKVAGKLSTPSAG----------VRGASEQKSARRYSTGTLST  347

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQ--------DAIS------------------N  520
             K  S    FK  ASL  G  R  E+           D+ +                   
Sbjct  348  TKPASNILPFKSNASLRTGAQRTLELEHHVLGSQFIVDSYTITWFFYSKFFKLQGSEKNE  407

Query  519  KPLKGSLKQKSKYQPPARKLP------------MPGPT----VKPSQVSNTAKKLTNLNI  388
            K +K  LKQ S+Y+PPAR  P            MPG T    V  ++VSN A+KL  +++
Sbjct  408  KSMKIDLKQ-SRYRPPARNNPGVLGRNSHRVADMPGKTALGAVTSTRVSNVAEKLGKVSL  466

Query  387  GSG  379
             SG
Sbjct  467  SSG  469



>ref|XP_010056182.1| PREDICTED: cyclin-dependent kinase F-4-like [Eucalyptus grandis]
Length=452

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 91/189 (48%), Gaps = 26/189 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PP+LRS +   RT   VG          TR +L+ +  R   G   N 
Sbjct  278  LQHPFFQSCYYIPPALRSRLTANRTPPPVG----------TRVSLQVQNGRRYPGMSDNR  327

Query  618  KSMSKTSSFKPRA-SLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP---MP  451
            K     SS  PRA +L  G  RK  + +QD+    P   S  ++ +++P     P   + 
Sbjct  328  KLGVNNSS--PRAVALKPGAQRKLNMVNQDSNKVAPYSNSSVKQPRFRPSGNNSPTSVIK  385

Query  450  GPTVKPSQVSNTAKKLTNLNIGSGR-PPVKQLLPQPMKG-------GVVSHGRSRDITPG  295
            GP  +  +V++ ++KL +++ G  + P ++QLLP    G               + I PG
Sbjct  386  GPMSR--EVADISEKLADMSFGPRKGPEMQQLLPLKAGGWRDEPVHAYYGQRHGQWIQPG  443

Query  294  RASTKKLAG  268
            R   +K+AG
Sbjct  444  RGYNRKVAG  452



>ref|XP_010940816.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X4 [Elaeis 
guineensis]
Length=464

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 77/146 (53%), Gaps = 19/146 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK   R+S+G +
Sbjct  278  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNARRYSMGAL  326

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            S  K  +  SS    AS+  G+ RK  + N Q++ + K  K  LKQ S+Y+PPAR    P
Sbjct  327  SGTKPATNLSSANGDASMRTGVQRKLAMENHQESENEKSTKIGLKQ-SRYRPPARN--NP  383

Query  450  GPTVKPSQ-VSNTAKKLTNLNIGSGR  376
            G   + S+ VS+   KL +L + S +
Sbjct  384  GYLGRDSRSVSDVTDKLAHLKVSSNK  409



>ref|XP_010940814.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Elaeis 
guineensis]
Length=490

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 77/146 (53%), Gaps = 19/146 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK   R+S+G +
Sbjct  304  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNARRYSMGAL  352

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI-NSQDAISNKPLKGSLKQKSKYQPPARKLPMP  451
            S  K  +  SS    AS+  G+ RK  + N Q++ + K  K  LKQ S+Y+PPAR    P
Sbjct  353  SGTKPATNLSSANGDASMRTGVQRKLAMENHQESENEKSTKIGLKQ-SRYRPPARN--NP  409

Query  450  GPTVKPSQ-VSNTAKKLTNLNIGSGR  376
            G   + S+ VS+   KL +L + S +
Sbjct  410  GYLGRDSRSVSDVTDKLAHLKVSSNK  435



>ref|XP_009382627.1| PREDICTED: cyclin-dependent kinase F-4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009382628.1| PREDICTED: cyclin-dependent kinase F-4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009382629.1| PREDICTED: cyclin-dependent kinase F-4 [Musa acuminata subsp. 
malaccensis]
Length=445

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 16/113 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNR-WSVGTISN  622
            LQHPFFQ+C YVPP LR  V    +   VG           + A EQ   R +S G +S 
Sbjct  278  LQHPFFQSCFYVPPFLRPRVA---SHTPVG----------IKGAPEQSSTRRYSTGALSV  324

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPAR  466
             KS + + + K  ASL AG+ RK E+++Q+   N K  K +LK+ S+Y+PPAR
Sbjct  325  TKSANSSVTAKANASLRAGVQRKLEMDNQEFEKNGKSPKNNLKE-SRYKPPAR  376



>ref|XP_010530391.1| PREDICTED: cyclin-dependent kinase F-4-like [Tarenaya hassleriana]
Length=437

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 15/119 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR      RT   V       +    R + EQ+  R     ++N 
Sbjct  278  LQHPFFQSCFYVPPSLRLKPTAARTPPPV-------LVGPMRGSFEQQSTRRFPVAVANH  330

Query  618  KSMSKTSSFKPRAS----LNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARKLP  457
            K +   S   P+A+     N G+ RK ++ +QD   +NKP+KG+ K  +KY+PP RK P
Sbjct  331  KPVD--SYVTPKANNGQYFNTGVQRKLDMVNQDVTKNNKPVKGTAKD-AKYRPPGRKSP  386



>ref|XP_008779078.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Phoenix 
dactylifera]
Length=389

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 87/204 (43%), Gaps = 57/204 (28%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNR-WSVGTI  628
            LQH FFQ C Y+PPS  LR   G+  T  SVG           + A EQK  R +S+G +
Sbjct  175  LQHSFFQPCFYIPPSVCLRPA-GMPATPPSVG----------MKGAFEQKNTRRYSIGAL  223

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEI--------------------------NSQDAI  526
            SN K  S  SS    A +  G+ RK E+                          N Q++ 
Sbjct  224  SNTKPASNLSSANVNAYMRTGVQRKLEMENHQVSSPMLILNCLCVCCECLREIYNLQESK  283

Query  525  SNKPLKGSLKQKSKYQPPARKLPMPGPTVKPSQVSNTAKKLTNLNIGSGR--------PP  370
            + K  K   KQ S+Y+PPAR  P         +VS+  +KL  L + S +        PP
Sbjct  284  NEKSTKIGPKQ-SRYRPPARNNPAGYLGRDSRRVSDVTEKLACLKVSSNKVSDASEKLPP  342

Query  369  VKQLLPQPMK--------GGVVSH  322
            +K   PQP++        GG  SH
Sbjct  343  LKAADPQPVRQQPPRMKAGGWHSH  366



>ref|XP_009388431.1| PREDICTED: cyclin-dependent kinase F-4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388432.1| PREDICTED: cyclin-dependent kinase F-4-like [Musa acuminata subsp. 
malaccensis]
Length=438

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 88/186 (47%), Gaps = 36/186 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNR-WSVGTISN  622
            LQHPFF+ CL + PS  S +     T  VG           + AL Q G R +S G +S 
Sbjct  278  LQHPFFKACLRIHPSFHSRLAGLSHTPPVG----------NKGALGQNGTRRYSTGPLSV  327

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQPPARKLPMPGP  445
             +S +   S K   SL AG+ RK E+N ++   N + L  +L+Q S+Y+PPAR       
Sbjct  328  TRSANNFISTKANGSLRAGVQRKLEMNDKELEKNGRSLGNNLRQ-SRYKPPARNNTAGYL  386

Query  444  TVKPSQVSNT---------AKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDITPGR  292
             VK  ++ +          A+KL+++++ SG     +  P P +            TPGR
Sbjct  387  AVKSQKIVDVPGKMPCTKIAEKLSHMSLDSGIQKASK--PPPHE------------TPGR  432

Query  291  ASTKKL  274
              +KKL
Sbjct  433  RYSKKL  438



>gb|KCW72791.1| hypothetical protein EUGRSUZ_E01241 [Eucalyptus grandis]
Length=453

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 91/190 (48%), Gaps = 27/190 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRT-TQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C Y+PP+LRS +   RT    +G          TR +L+ +  R   G   N
Sbjct  278  LQHPFFQSCYYIPPALRSRLTANRTPPPGLG----------TRVSLQVQNGRRYPGMSDN  327

Query  621  PKSMSKTSSFKPRA-SLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP---M  454
             K     SS  PRA +L  G  RK  + +QD+    P   S  ++ +++P     P   +
Sbjct  328  RKLGVNNSS--PRAVALKPGAQRKLNMVNQDSNKVAPYSNSSVKQPRFRPSGNNSPTSVI  385

Query  453  PGPTVKPSQVSNTAKKLTNLNIGSGR-PPVKQLLPQPMKG-------GVVSHGRSRDITP  298
             GP  +  +V++ ++KL +++ G  + P ++QLLP    G               + I P
Sbjct  386  KGPMSR--EVADISEKLADMSFGPRKGPEMQQLLPLKAGGWRDEPVHAYYGQRHGQWIQP  443

Query  297  GRASTKKLAG  268
            GR   +K+AG
Sbjct  444  GRGYNRKVAG  453



>ref|XP_007040814.1| Kinase superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY25315.1| Kinase superfamily protein isoform 4 [Theobroma cacao]
Length=359

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 44/85 (52%), Gaps = 10/85 (12%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C YVPPSLR    ++RT  SVG           R  LEQ+  R   G + N 
Sbjct  278  LQHPFFQSCFYVPPSLRPRSAISRTPPSVG----------VRGTLEQQSARRYPGVLPNA  327

Query  618  KSMSKTSSFKPRASLNAGIPRKSEI  544
            K     +S K  AS   G+ RK E+
Sbjct  328  KLTGNLNSAKINASFGTGVQRKLEM  352



>ref|XP_009408087.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408088.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408089.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408090.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=465

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (46%), Gaps = 37/201 (18%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALE-QKGNRWSVGTI  628
            LQH FFQ C Y+PPS  +R  VG  +T+ SV    +          LE +   R+S+  +
Sbjct  278  LQHSFFQPCFYIPPSPRVRLSVGAPKTSPSVIMKGV----------LESEAARRYSLDFL  327

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP---  457
            SN +  S  S      S   G+ R  +++ Q+   N+    +  +  ++QP AR  P   
Sbjct  328  SNARMSSNLSFTNVNESSRTGVQRNIKMSHQEN-KNERFDTNDIKPYRHQPAARNTPGYS  386

Query  456  ---------MPGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQP--MKGGVVSHGRS-  313
                     +   TV P++ S+ A K  NLN+   R P  QL+ QP  +K G + HGR+ 
Sbjct  387  RMTCNVVEKLAHLTVSPNRDSHIAGKAPNLNLRPAREP-SQLVTQPPALKSG-IWHGRTA  444

Query  312  -----RDITPGRA-STKKLAG  268
                  DI   R    +K+AG
Sbjct  445  LLGRPNDIPAARCYHARKVAG  465



>ref|XP_009408091.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (46%), Gaps = 37/201 (18%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDALE-QKGNRWSVGTI  628
            LQH FFQ C Y+PPS  +R  VG  +T+ SV    +          LE +   R+S+  +
Sbjct  244  LQHSFFQPCFYIPPSPRVRLSVGAPKTSPSVIMKGV----------LESEAARRYSLDFL  293

Query  627  SNPKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP---  457
            SN +  S  S      S   G+ R  +++ Q+   N+    +  +  ++QP AR  P   
Sbjct  294  SNARMSSNLSFTNVNESSRTGVQRNIKMSHQEN-KNERFDTNDIKPYRHQPAARNTPGYS  352

Query  456  ---------MPGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQP--MKGGVVSHGRS-  313
                     +   TV P++ S+ A K  NLN+   R P  QL+ QP  +K G + HGR+ 
Sbjct  353  RMTCNVVEKLAHLTVSPNRDSHIAGKAPNLNLRPAREP-SQLVTQPPALKSG-IWHGRTA  410

Query  312  -----RDITPGRA-STKKLAG  268
                  DI   R    +K+AG
Sbjct  411  LLGRPNDIPAARCYHARKVAG  431



>gb|KHN11838.1| Cyclin-dependent kinase F-4 [Glycine soja]
Length=467

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 100/211 (47%), Gaps = 55/211 (26%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISNP  619
            LQHPFFQ+C Y+PPSLR+   + RT    G          TR AL+Q+  +   G +   
Sbjct  278  LQHPFFQSCFYIPPSLRNR-AVARTPPPAG----------TRGALDQQEVKRYSGALPTS  326

Query  618  KSMSKTSSFK---PRAS---------LNAGIPRKSEINSQDAISN-KPLKGSLKQKSKYQ  478
            K  +  SS K   P AS         +  G+ RK ++ +QD I N KP++ +   K KY+
Sbjct  327  KLSNNFSSMKLHPPLASEQGSHPIEIVATGVQRKLDMVNQDGIKNEKPVRTT---KPKYR  383

Query  477  PPARKLP----MPGPTVKPSQVSNTAKKLTNL--------NIGSGRP-PVKQLLPQPMKG  337
             P +         G +V+   VS TA+KL NL        +IG G+P P     P PMK 
Sbjct  384  QPGKDSSPTSMSKGRSVR--GVSETAEKLRNLSVTSRRQSSIGIGQPRP-----PPPMKA  436

Query  336  G--VVSH------GRSRDITPGRASTKKLAG  268
            G   +S       G  + I+ GR   +K+AG
Sbjct  437  GGNWISESGNFILGPPQQISTGRTFARKVAG  467



>ref|XP_010228082.1| PREDICTED: cyclin-dependent kinase F-4-like [Brachypodium distachyon]
Length=475

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 77/162 (48%), Gaps = 37/162 (23%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQKGN-RWSVGTIS  625
            LQHPFFQ C Y+PPSLR    G   T  S G           R AL+ K   R+  GT+S
Sbjct  278  LQHPFFQPCFYIPPSLRFRSTGYATTPPSAG----------ARGALDLKNTRRYPAGTLS  327

Query  624  NPK-----SMSKTSSFKPRASLNAGIPRKSEINSQDAI-SNKPLKGSLKQKSKYQPPARK  463
            N K     S   T++   RA   AG+ RK E++ Q  + SN  L   +K+ +  QP +R 
Sbjct  328  NEKPTVNYSYMSTTNTPARA---AGVQRKLELDHQVKVESNHKL---MKENAMNQPWSRP  381

Query  462  LPMPGPTVKPS----------QVSNTAKKLTNLNIGSGRPPV  367
               P P V+ +          +  + A+KL+ L + S R PV
Sbjct  382  ---PPPAVRSNGNYLTKDQSPRAPDIAEKLSQLTMASNRTPV  420



>ref|XP_009613848.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana tomentosiformis]
Length=382

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 52/105 (50%), Gaps = 14/105 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN-  622
            LQH FFQ+C Y PPSL S   + RT    G             ALEQK NRWS  T++N 
Sbjct  280  LQHRFFQSCFYRPPSLCSKAAVARTPPYAG----------MLGALEQKTNRWSSSTLTNV  329

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISN-KPLKGSLKQK  490
            PK  S  S  K + S       K ++N QD   N K LKGS  Q+
Sbjct  330  PKPSSNFSHVKSQYS--PSFRAKLQMNYQDETKNDKSLKGSNSQQ  372



>ref|XP_004964362.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Setaria 
italica]
Length=471

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 70/146 (48%), Gaps = 15/146 (10%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQHPFFQ C YVPPSLR    G   T  SVG           + A++QK G R+S+GT+ 
Sbjct  278  LQHPFFQPCFYVPPSLRFKSTGYASTPPSVG----------AKGAVDQKNGRRYSMGTVP  327

Query  624  NPKSMSKTSSFKPRASLN-AGIPRKSEINSQDAISNKPL--KGSLKQKSKYQPPARKLPM  454
            N +     S     A +  AG+ RK E++ Q   +N  +    ++ Q        R    
Sbjct  328  NGRPTVNYSYLSNNAPVRAAGVQRKLELDHQPQEANHKVTKANAMNQSWSRSAAVRSNGN  387

Query  453  PGPTVKPSQVSNTAKKLTNLNIGSGR  376
                 + S+ S+ A+KL+ L++G  R
Sbjct  388  YLAKDQSSRASDLAEKLSQLSMGPNR  413



>emb|CDY23116.1| BnaC09g18700D [Brassica napus]
Length=563

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 82/178 (46%), Gaps = 30/178 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRS--GVG----LTRTTQSVGRNNIEFISTRTRDALEQKGNRWSV  637
            LQHPFFQ+C YVPPSLR+   VG    L    QSV R      +T T  A   K    + 
Sbjct  386  LQHPFFQSCYYVPPSLRAKPSVGQRGSLEHQQQSVKR----LPATLTCTANNNK----AF  437

Query  636  GTISNPKSMSKTSSFKPRASLNAGIPRKSE----INSQDAISNKPLKGSLKQKSKYQ-PP  472
             + + PK+ +      P  +      RK E    IN + + ++KP+     + +KY  PP
Sbjct  438  NSYATPKANA-----LPYGACQTQ--RKQEMSNKINQETSWNSKPVGSYNVRDAKYIPPP  490

Query  471  ARKLP--MPGPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQPMKGGVVSHGRSRDI  304
             RK P  M    V P + S  A KL N  +G GR   +Q     MK G V  G S D+
Sbjct  491  GRKSPPSMNKKWVFPREPSENANKLANAAVGGGRWSQRQTQQPAMKAGWV--GDSGDM  546



>ref|XP_004964361.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Setaria 
italica]
Length=478

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 48/91 (53%), Gaps = 13/91 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQHPFFQ C YVPPSLR    G   T  SVG           + A++QK G R+S+GT+ 
Sbjct  278  LQHPFFQPCFYVPPSLRFKSTGYASTPPSVG----------AKGAVDQKNGRRYSMGTVP  327

Query  624  NPKSMSKTSSFKPRASLN-AGIPRKSEINSQ  535
            N +     S     A +  AG+ RK E++ Q
Sbjct  328  NGRPTVNYSYLSNNAPVRAAGVQRKLELDHQ  358



>ref|XP_002436374.1| hypothetical protein SORBIDRAFT_10g001310 [Sorghum bicolor]
 gb|EER87741.1| hypothetical protein SORBIDRAFT_10g001310 [Sorghum bicolor]
Length=473

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 73/149 (49%), Gaps = 20/149 (13%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQKG-NRWSVGTIS  625
            LQHPFFQ C YVPPSLR    G   T  S G           + A++QK   R+S+GT+ 
Sbjct  278  LQHPFFQQCFYVPPSLRFKSTGYASTPPSAG----------AKGAVDQKNIRRYSMGTVP  327

Query  624  NPKSMSKTSSFKPRA-SLNAGIPRKSEINSQ--DAISNKPLKGSLKQKSKYQPPARKLPM  454
            N +     S     A +  AG+ RK E++ Q  +  ++K  K ++  +S  +P A +   
Sbjct  328  NARPTVNYSYLSNNAPARAAGVQRKLELDHQLPETNNHKVTKANMMNQSWSRPAAVR--S  385

Query  453  PGPTVKPSQ---VSNTAKKLTNLNIGSGR  376
             G  +   Q     + A+KL+ L++G  R
Sbjct  386  NGNYLAKDQNPRAPDLAEKLSQLSMGPNR  414



>gb|AFK44618.1| unknown [Lotus japonicus]
Length=100

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 57/104 (55%), Gaps = 16/104 (15%)
 Frame = -3

Query  546  INSQDAISNK-PLKGSLKQKSKYQPPARKLPMP---GPTVKPSQVSNTAKKLTNLNIGSG  379
            + S+D I NK PLK +  Q+SKYQPP ++ P     G T +   VS TA+KL N++IG+ 
Sbjct  1    MASEDGIKNKKPLKTT--QQSKYQPPGKESPTSIKKGRTAR--GVSETAEKLANMSIGTR  56

Query  378  RPPVKQLLPQPMKGGVVSHGRSRD--------ITPGRASTKKLA  271
            R  + Q  P PMK GV     S D        I  GR  T+K+A
Sbjct  57   RQSLGQTRPPPMKAGVNWSSGSGDFLLKPAQQIPTGRTLTRKVA  100



>ref|XP_009400730.1| PREDICTED: cyclin-dependent kinase F-4-like [Musa acuminata subsp. 
malaccensis]
Length=463

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 92/202 (46%), Gaps = 41/202 (20%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPS--LRSGVGLTRTTQSVGRNNIEFISTRTRDAL-EQKGNRWSVGTI  628
            LQH FFQ C Y+PPS  LRS  G+ +T  SVG          TR AL      R SVG +
Sbjct  278  LQHSFFQPCFYIPPSPRLRSE-GVQKTPSSVG----------TRGALASDTARRNSVGVL  326

Query  627  SNPKSMSKTSSFKPRASLN-AGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLP-M  454
            SN + +   SS     S    GI R+ E+  Q+    +  +  +K   + QP  R    +
Sbjct  327  SNTRPVYNFSSTSVNESFRMTGIQRRLELGHQEYQKERLARNEVKPYVR-QPTTRDFTGL  385

Query  453  PGPTVKPSQ-VSNTAKKLTNLNIGSGR--------PPVK-QLLPQP---MKGGVVS-H--  322
            PG   + SQ   N  +KL +L + S R        P +K QL  QP   MK G    H  
Sbjct  386  PG---RDSQRTCNVVEKLGHLTLSSNRGSDICGKLPQLKPQLGRQPPPAMKAGAWHGHSA  442

Query  321  --GRSRDI--TPGRASTKKLAG  268
              GR  DI   PG   T+K+AG
Sbjct  443  FPGRPHDIPSAPG-YYTRKVAG  463



>ref|XP_006655724.1| PREDICTED: cyclin-dependent kinase F-4-like [Oryza brachyantha]
Length=480

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 73/156 (47%), Gaps = 27/156 (17%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQH FFQ C Y+PPSLR    G   T  SVG           + A++QK  R +VG +SN
Sbjct  278  LQHSFFQPCFYIPPSLRFRSSGYAATPPSVG----------AKGAVDQKNARSTVGLLSN  327

Query  621  PK---SMSKTSSFKPRASLNAGIPRKSEINSQDA--------ISNKPLKGSLKQKSKYQP  475
             +   + S  SS  P  +  AG+ RK +++ Q +        +++K  K     +   +P
Sbjct  328  GRPAVNYSYWSSNTPARA--AGVQRKLDLDHQGSMNPYQVPEVNHKLTKEEAMNQPWSRP  385

Query  474  PARKLPMPGPTVKPSQ---VSNTAKKLTNLNIGSGR  376
            PA  +   G      Q     + A+KL+ L +GS R
Sbjct  386  PAAAVRNNGNYFTKDQSPRAPDIAEKLSQLAVGSNR  421



>ref|XP_006398217.1| hypothetical protein EUTSA_v10000881mg [Eutrema salsugineum]
 gb|ESQ39670.1| hypothetical protein EUTSA_v10000881mg [Eutrema salsugineum]
Length=455

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 77/177 (44%), Gaps = 28/177 (16%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRSGVGLTRTTQSVG-RNNIEFISTRTRDALEQKGNRWSVGTISN  622
            LQHPFFQ+C YVPPSLR          SVG R ++E    ++   L       +      
Sbjct  278  LQHPFFQSCYYVPPSLRP-------KPSVGQRGSLEHQQQQSGKRLPATLTNNTATNNKP  330

Query  621  PKSMSKTSSFKPRASLNAGIPRKSEINSQDAISNKPLKGSLKQKSKYQPPARKLPMP---  451
              S +   ++ P  S    +  K  IN   A +NKP+     + +KY PP RK P     
Sbjct  331  FNSYTTPKAYAPFGSQKLDMANK--INQDTAWNNKPVGNCHVRDAKYIPPGRKSPQASTN  388

Query  450  -------GPTVKPSQVSNTAKKLTNLNIGSGRPPVKQLLPQP-MKGGVVSHGRSRDI  304
                   GP+   ++V+N A       +G GR    Q   QP MK G +  G+S D+
Sbjct  389  KNWVFARGPSETTNKVANAATV-----VGGGRWGESQRQQQPAMKAGWM--GQSGDV  438



>ref|NP_001056617.1| Os06g0116100 [Oryza sativa Japonica Group]
 dbj|BAD67913.1| putative GAMYB-binding protein [Oryza sativa Japonica Group]
 dbj|BAF18531.1| Os06g0116100 [Oryza sativa Japonica Group]
 gb|ACF60471.1| myb-binding protein [Oryza sativa Japonica Group]
 dbj|BAG91473.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64986.1| hypothetical protein OsJ_19906 [Oryza sativa Japonica Group]
Length=484

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 76/162 (47%), Gaps = 31/162 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSL--RSGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTI  628
            LQHPFFQ C Y+PPSL  RS  G   T  SVG           + A++QK   R+SVG +
Sbjct  278  LQHPFFQPCFYIPPSLRFRSTNGYAATPPSVG----------AKGAVDQKNARRYSVGPL  327

Query  627  SNPKSMSKTSSFKPRA-SLNAGIPRKSEINSQDAI-SNKPLKGS---LKQKSKYQPPARK  463
            SN +     S       +  AG+ RK E++ Q  + S +  +G+    K ++  QP +R 
Sbjct  328  SNGRPAVNYSYLSANTPARAAGVQRKLELDHQVNMNSCQAPEGNHKLTKAEAMNQPWSR-  386

Query  462  LPMPGPTVKPS-----------QVSNTAKKLTNLNIGSGRPP  370
             P P      S           +  + A+KL+ L +GS R P
Sbjct  387  -PPPAAAAVRSNGNYFTKDQGPRAPDIAEKLSQLTVGSNRVP  427



>gb|EMT27774.1| Cyclin-dependent kinase F-4 [Aegilops tauschii]
Length=553

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 24/124 (19%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQHPFFQ C YVPPSLR    G   T  SVG           + A++QK   R+ VG++S
Sbjct  346  LQHPFFQPCFYVPPSLRFRSTGYATTPPSVG----------AKGAMDQKNARRYPVGSLS  395

Query  624  NPK-----SMSKTSSFKPRASLNAGIPRKSEINSQ-DAISNKPLKGSLKQKSKYQPPARK  463
            N +     S   T++   RA   AG+ RK E++ Q    SN  L    K+ +  QP +R 
Sbjct  396  NGRPAVNNSYLSTNNVPARA---AGVQRKLELDHQVKPESNHKLT---KENAMNQPWSRL  449

Query  462  LPMP  451
             P P
Sbjct  450  PPAP  453



>gb|AAO25540.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 46/91 (51%), Gaps = 13/91 (14%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLRS-GVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQHPFFQ C YVPPSLR    G      SVG           + A++QK   R+ VGT+S
Sbjct  278  LQHPFFQPCFYVPPSLRYRSTGYATPPPSVG----------AKGAMDQKNARRYPVGTLS  327

Query  624  NPKSMSKTSSFKPRA-SLNAGIPRKSEINSQ  535
            N +     S     A +  AG+ RK E++ Q
Sbjct  328  NGRPAVNNSYLSTNAPARAAGVQRKLELDHQ  358



>gb|EMS62127.1| Cyclin-dependent kinase F-4 [Triticum urartu]
Length=553

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 20/95 (21%)
 Frame = -3

Query  798  LQHPFFQNCLYVPPSLR-SGVGLTRTTQSVGRNNIEFISTRTRDALEQK-GNRWSVGTIS  625
            LQHPFFQ C Y+PPSLR    G   T  SVG           + A++QK   R+ VGT++
Sbjct  347  LQHPFFQPCFYIPPSLRFRSTGYATTPPSVG----------AKGAMDQKNARRYPVGTLT  396

Query  624  NPK-----SMSKTSSFKPRASLNAGIPRKSEINSQ  535
            N +     S   T++   RA   AG+ RK E++ Q
Sbjct  397  NGRPAVNNSYLGTNNVPARA---AGVQRKLELDHQ  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1475250502080