BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24849_g5_i9 len=3857 path=[19937:0-627 18326:628-671 16973:672-684
16986:685-719 18416:720-779 22940:780-860 18556:861-909
24341:910-912 13654:913-1102 @13944@!:1103-2101 5446:2102-3856]

Length=3857
                                                                      Score     E

ref|XP_009802698.1|  PREDICTED: UDP-glycosyltransferase 86A1            594   0.0      
emb|CDP18343.1|  unnamed protein product                                592   0.0      
ref|XP_006354353.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       593   0.0      
ref|XP_009610181.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       592   0.0      
ref|XP_004166167.1|  PREDICTED: phosphoglycerate kinase, chloropl...    430   0.0      
ref|XP_004137833.1|  PREDICTED: phosphoglycerate kinase, chloropl...    430   0.0      
ref|XP_004246641.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       590   0.0      
ref|XP_007027384.1|  UDP-Glycosyltransferase superfamily protein        575   0.0      
gb|KHG05148.1|  Phosphoglycerate kinase 1, chloroplastic -like pr...    421   0.0      
gb|EYU34478.1|  hypothetical protein MIMGU_mgv1a020724mg                568   0.0      
ref|XP_007151656.1|  hypothetical protein PHAVU_004G065300g             417   0.0      
ref|XP_009616388.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       565   0.0      
ref|XP_002276858.1|  PREDICTED: UDP-glycosyltransferase 86A1            565   0.0      Vitis vinifera
ref|XP_011094625.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       563   0.0      
ref|XP_011040925.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       560   0.0      
ref|XP_006428406.1|  hypothetical protein CICLE_v10011571mg             557   0.0      
ref|XP_009785232.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       557   0.0      
ref|XP_011094626.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       556   0.0      
ref|XP_004246642.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       551   1e-179   
ref|XP_010050978.1|  PREDICTED: UDP-glycosyltransferase 86A1            550   2e-179   
gb|KDP29154.1|  hypothetical protein JCGZ_16543                         550   3e-179   
ref|XP_007016838.1|  UDP-Glycosyltransferase superfamily protein        550   8e-179   
gb|EYU38553.1|  hypothetical protein MIMGU_mgv1a005283mg                548   3e-178   
ref|XP_006384937.1|  hypothetical protein POPTR_0004s22400g             547   5e-178   
ref|XP_004304452.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       546   2e-177   
ref|XP_003632262.1|  PREDICTED: UDP-glycosyltransferase 86A1            545   3e-177   
ref|XP_002523692.1|  UDP-glucosyltransferase, putative                  545   5e-177   Ricinus communis
ref|XP_010043797.1|  PREDICTED: UDP-glycosyltransferase 86A2            543   2e-176   
ref|XP_010253969.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       543   3e-176   
gb|EYU34479.1|  hypothetical protein MIMGU_mgv1a005298mg                542   5e-176   
ref|XP_002314296.1|  glycosyltransferase family protein                 542   5e-176   Populus trichocarpa [western balsam poplar]
ref|XP_010107482.1|  UDP-glycosyltransferase 86A1                       541   1e-175   
ref|XP_006354352.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       540   3e-175   
ref|XP_007205117.1|  hypothetical protein PRUPE_ppa004829mg             539   7e-175   
ref|XP_008226277.1|  PREDICTED: UDP-glycosyltransferase 86A2            538   1e-174   
ref|XP_007206260.1|  hypothetical protein PRUPE_ppa015843mg             538   2e-174   
ref|XP_007151658.1|  hypothetical protein PHAVU_004G065300g             418   3e-174   
ref|XP_007206586.1|  hypothetical protein PRUPE_ppa020358mg             536   6e-174   
emb|CDP07057.1|  unnamed protein product                                534   6e-173   
ref|XP_008243982.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       533   7e-173   
dbj|BAG80551.1|  UDP-glucose:glucosyltransferase                        533   9e-173   Lycium barbarum [goji berry]
ref|XP_006367686.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       533   1e-172   
ref|XP_011077327.1|  PREDICTED: UDP-glycosyltransferase 86A1            533   2e-172   
emb|CDP12501.1|  unnamed protein product                                531   7e-172   
ref|XP_010263435.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       531   9e-172   
ref|XP_009784463.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       531   2e-171   
ref|XP_010516934.1|  PREDICTED: UDP-glycosyltransferase 86A1            529   8e-171   
ref|XP_010509409.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       528   1e-170   
ref|XP_008355190.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       526   6e-170   
ref|XP_008243981.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       526   6e-170   
ref|XP_008363514.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       525   9e-170   
gb|KDO49335.1|  hypothetical protein CISIN_1g011724mg                   525   1e-169   
ref|XP_009376817.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       525   1e-169   
ref|XP_007207842.1|  hypothetical protein PRUPE_ppa023014mg             525   2e-169   
ref|XP_007206708.1|  hypothetical protein PRUPE_ppa024090mg             525   2e-169   
ref|XP_009623615.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       523   5e-169   
ref|XP_004249621.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       524   5e-169   
ref|XP_007205115.1|  hypothetical protein PRUPE_ppa004816mg             524   6e-169   
ref|XP_008465359.1|  PREDICTED: UDP-glycosyltransferase 86A2            521   7e-168   
ref|XP_010505248.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       521   8e-168   
ref|XP_008243980.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       520   2e-167   
ref|XP_002879636.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    520   2e-167   
ref|NP_181234.1|  UDP-glycosyltransferase 86A1                          520   2e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295617.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       519   3e-167   
ref|XP_009376097.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       518   6e-167   
ref|XP_008350360.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       518   7e-167   
ref|XP_004145815.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       518   9e-167   
ref|XP_011089946.1|  PREDICTED: UDP-glycosyltransferase 86A2            517   1e-166   
gb|KDP43993.1|  hypothetical protein JCGZ_05460                         517   2e-166   
emb|CDX74999.1|  BnaA05g07450D                                          516   2e-166   
ref|XP_009334655.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       515   6e-166   
ref|XP_009143540.1|  PREDICTED: UDP-glycosyltransferase 86A1            514   3e-165   
ref|XP_006345817.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       513   4e-165   
ref|XP_008359642.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       514   6e-165   
ref|XP_010107481.1|  UDP-glycosyltransferase 86A1                       513   9e-165   
gb|KFK36574.1|  hypothetical protein AALP_AA4G141300                    512   2e-164   
ref|XP_004239693.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       511   5e-164   
ref|XP_009143541.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       509   9e-164   
ref|XP_006410874.1|  hypothetical protein EUTSA_v10016577mg             510   9e-164   
ref|XP_009376819.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       509   1e-163   
ref|XP_006350954.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       509   1e-163   
ref|XP_009376816.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       509   2e-163   
ref|XP_010557349.1|  PREDICTED: UDP-glycosyltransferase 86A2            509   2e-163   
emb|CDX75000.1|  BnaA05g07460D                                          509   2e-163   
ref|XP_004249916.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       508   3e-163   
ref|XP_004304453.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       507   1e-162   
ref|XP_011091584.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       506   2e-162   
emb|CDY33212.1|  BnaC04g08270D                                          506   3e-162   
gb|KFK32346.1|  udp-glycosyltransferase-like protein                    505   6e-162   
ref|XP_011091585.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       504   1e-161   
ref|XP_009413144.1|  PREDICTED: UDP-glycosyltransferase 86A1            503   4e-161   
dbj|BAF75888.1|  glucosyltransferase                                    502   8e-161   Dianthus caryophyllus [carnation]
ref|XP_006350953.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       501   2e-160   
gb|EPS66574.1|  hypothetical protein M569_08200                         500   3e-160   
emb|CDY33211.1|  BnaC04g08280D                                          499   5e-160   
ref|XP_006424499.1|  hypothetical protein CICLE_v10029902mg             499   7e-160   
emb|CDY30510.1|  BnaA04g16230D                                          499   8e-160   
ref|XP_011074004.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       499   8e-160   
ref|XP_010907029.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    499   9e-160   
ref|XP_009140842.1|  PREDICTED: UDP-glycosyltransferase 86A2            499   9e-160   
emb|CDP07058.1|  unnamed protein product                                499   1e-159   
ref|XP_010907030.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    499   1e-159   
gb|KDO60213.1|  hypothetical protein CISIN_1g011789mg                   498   4e-159   
ref|XP_006488636.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       497   4e-159   
emb|CDX77151.1|  BnaC04g39460D                                          497   5e-159   
ref|XP_009401822.1|  PREDICTED: UDP-glycosyltransferase 86A1            496   5e-158   
ref|XP_011094627.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       494   7e-158   
gb|AFJ53012.1|  UDP-glycosyltransferase 1                               494   8e-158   
ref|XP_011094737.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       492   5e-157   
gb|AFJ53014.1|  UDP-glycosyltransferase 1                               491   2e-156   
ref|XP_011074246.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       490   2e-156   
ref|XP_004983013.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    491   3e-156   
gb|AFJ53011.1|  UDP-glycosyltransferase 1                               489   1e-155   
ref|XP_010907028.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       488   1e-155   
emb|CBI32766.3|  unnamed protein product                                487   2e-155   
ref|XP_002464565.1|  hypothetical protein SORBIDRAFT_01g020920          486   9e-155   Sorghum bicolor [broomcorn]
ref|XP_010414605.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       486   1e-154   
ref|XP_011094740.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       486   1e-154   
ref|XP_003573977.1|  PREDICTED: UDP-glycosyltransferase 86A1 isof...    483   2e-153   
ref|XP_002879117.1|  glycosyltransferase family protein                 482   3e-153   
ref|XP_003573976.1|  PREDICTED: UDP-glycosyltransferase 86A1 isof...    482   4e-153   
ref|XP_006409826.1|  hypothetical protein EUTSA_v10016590mg             481   1e-152   
ref|NP_180375.1|  UDP-glycosyltransferase 86A2                          478   8e-152   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61749.1|  putative glucosyltransferase                            478   1e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645070.1|  PREDICTED: uncharacterized protein LOC100383...    478   2e-151   
gb|AFJ53013.1|  UDP-glycosyltransferase 1                               477   4e-151   
ref|XP_011094621.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       476   4e-151   
dbj|BAJ86664.1|  predicted protein                                      476   6e-151   
dbj|BAJ89423.1|  predicted protein                                      476   7e-151   
ref|XP_011094624.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       476   7e-151   
ref|XP_006294108.1|  hypothetical protein CARUB_v10023101mg             476   8e-151   
gb|EYU34477.1|  hypothetical protein MIMGU_mgv1a005487mg                475   1e-150   
ref|XP_010470154.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       475   1e-150   
gb|AFJ53015.1|  UDP-glycosyltransferase 1                               474   3e-150   
dbj|BAJ89293.1|  predicted protein                                      474   3e-150   
ref|XP_010510698.1|  PREDICTED: UDP-glycosyltransferase 86A2            471   6e-149   
ref|NP_001169578.1|  uncharacterized protein LOC100383459               471   8e-149   Zea mays [maize]
ref|XP_010107479.1|  UDP-glycosyltransferase 86A1                       469   2e-148   
ref|XP_011094622.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       469   2e-148   
ref|XP_004983012.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    469   3e-148   
ref|XP_008778580.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       467   8e-148   
ref|XP_010107499.1|  UDP-glycosyltransferase 86A1                       482   3e-147   
ref|XP_011094623.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       466   5e-147   
ref|XP_009400676.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       468   5e-147   
ref|XP_008809704.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       462   6e-147   
gb|EYU34489.1|  hypothetical protein MIMGU_mgv1a005852mg                464   8e-147   
ref|XP_008809703.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       466   2e-146   
gb|EYU34484.1|  hypothetical protein MIMGU_mgv1a005271mg                464   3e-146   
ref|XP_011094738.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       464   5e-146   
ref|XP_006662391.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       461   1e-145   
ref|XP_010669654.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       461   5e-145   
ref|XP_008644820.1|  PREDICTED: UDP-glycosyltransferase 86A1            460   9e-145   
ref|XP_010686252.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    459   2e-144   
dbj|BAG80548.1|  UDP-glucose:glucosyltransferase                        457   5e-144   Lycium barbarum [goji berry]
ref|XP_009792555.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    461   9e-144   
ref|XP_010678487.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       456   3e-143   
ref|XP_010686253.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    456   6e-143   
emb|CBI17168.3|  unnamed protein product                                451   2e-142   
ref|XP_009792521.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    460   4e-142   
gb|EYU36650.1|  hypothetical protein MIMGU_mgv1a004868mg                452   2e-141   
ref|XP_009616940.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    454   5e-141   
ref|XP_009616939.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    454   6e-141   
ref|XP_009616937.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    453   2e-140   
gb|EYU34488.1|  hypothetical protein MIMGU_mgv1a005552mg                447   3e-140   
gb|EAY78678.1|  hypothetical protein OsI_33780                          448   4e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_006354360.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    451   5e-140   
ref|XP_009616934.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    454   8e-140   
gb|AAP53972.1|  UDP-glucoronosyl and UDP-glucosyl transferase fam...    447   8e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006833161.1|  hypothetical protein AMTR_s00072p00130550          451   1e-139   
ref|XP_009616931.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    454   1e-139   
emb|CBI32769.3|  unnamed protein product                                450   1e-139   
gb|EYU34486.1|  hypothetical protein MIMGU_mgv1a023861mg                446   1e-139   
dbj|BAJ85107.1|  predicted protein                                      443   2e-138   
gb|EYU34487.1|  hypothetical protein MIMGU_mgv1a005354mg                441   1e-137   
ref|XP_008243986.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    447   1e-137   
gb|AGA84057.1|  UDP-glucosyltransferase isoform 1                       439   5e-137   
ref|XP_004306252.1|  PREDICTED: phosphoglycerate kinase-like            443   3e-136   
gb|KEH25354.1|  phosphoglycerate kinase                                 442   1e-135   
ref|XP_009398946.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       434   5e-135   
ref|XP_002519506.1|  phosphoglycerate kinase, putative                  440   9e-135   Ricinus communis
ref|XP_010107484.1|  Phosphoglycerate kinase 1                          440   1e-134   
ref|XP_010107480.1|  UDP-glycosyltransferase 86A1                       431   3e-134   
ref|XP_010325972.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    435   4e-134   
ref|XP_007027389.1|  Phosphoglycerate kinase isoform 2                  435   5e-134   
ref|XP_007208305.1|  hypothetical protein PRUPE_ppa003108mg             434   2e-133   
emb|CDP06766.1|  unnamed protein product                                436   3e-133   
gb|EYU34480.1|  hypothetical protein MIMGU_mgv1a004928mg                430   4e-133   
ref|XP_010253975.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    435   5e-133   
ref|XP_009405745.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       428   5e-133   
gb|KCW89397.1|  hypothetical protein EUGRSUZ_A01689                     432   6e-133   
ref|XP_002323474.2|  hypothetical protein POPTR_0016s09300g             436   6e-133   Populus trichocarpa [western balsam poplar]
ref|XP_004246636.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    434   1e-132   
ref|XP_006593736.1|  PREDICTED: phosphoglycerate kinase, chloropl...    430   5e-132   
ref|XP_006593735.1|  PREDICTED: phosphoglycerate kinase, chloropl...    429   7e-132   
ref|XP_011030204.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    432   1e-131   
ref|XP_010050967.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    431   2e-131   
ref|XP_004516663.1|  PREDICTED: phosphoglycerate kinase, chloropl...    431   2e-131   
ref|XP_006352303.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    421   2e-130   
ref|XP_006593734.1|  PREDICTED: phosphoglycerate kinase, chloropl...    428   2e-130   
gb|KHN47674.1|  Phosphoglycerate kinase                                 428   2e-130   
ref|XP_011030211.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    425   4e-130   
ref|XP_010050961.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    427   1e-129   
ref|XP_011030209.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    425   1e-129   
ref|XP_011030207.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    425   1e-129   
ref|XP_011030210.1|  PREDICTED: phosphoglycerate kinase-like isof...    424   2e-129   
ref|XP_010050957.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    426   3e-129   
ref|XP_011030206.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    424   4e-129   
ref|XP_011030203.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    425   5e-129   
ref|XP_006493017.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    423   3e-128   
gb|EYU34483.1|  hypothetical protein MIMGU_mgv1a005954mg                415   4e-128   
ref|XP_006428397.1|  hypothetical protein CICLE_v10011216mg             422   4e-128   
ref|XP_011094620.1|  PREDICTED: uncharacterized protein LOC105174...    412   4e-127   
ref|XP_010684063.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    413   4e-127   
ref|XP_010684062.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    416   1e-126   
gb|EMS64309.1|  UDP-glycosyltransferase 86A1                            407   2e-126   
gb|ABR17327.1|  unknown                                                 411   3e-126   Picea sitchensis
ref|XP_010684058.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    415   4e-126   
ref|XP_010684061.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    415   5e-126   
ref|XP_010684057.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    415   8e-126   
ref|XP_006493018.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    416   9e-126   
ref|XP_010684055.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    416   1e-125   
ref|XP_008350374.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       405   1e-125   
ref|XP_011094615.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    414   8e-125   
ref|XP_006493015.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    411   1e-123   
ref|XP_006493011.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    410   1e-123   
ref|XP_010653609.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    407   5e-123   
gb|EPS73117.1|  hypothetical protein M569_01639                         400   9e-123   
ref|XP_007027388.1|  Phosphoglycerate kinase, putative isoform 1        405   1e-121   
ref|XP_006493016.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    400   6e-120   
ref|XP_008443576.1|  PREDICTED: uncharacterized protein LOC103487132    401   3e-119   
ref|XP_011094616.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    397   7e-119   
gb|EPS68563.1|  hypothetical protein M569_06205                         389   1e-118   
gb|EPS66197.1|  hypothetical protein M569_08579                         394   2e-118   
ref|XP_011091588.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    389   3e-118   
gb|EYU34490.1|  hypothetical protein MIMGU_mgv1a002752mg                392   2e-117   
ref|XP_011091587.1|  PREDICTED: UDP-glycosyltransferase 86A1-like...    389   2e-117   
ref|XP_010907027.1|  PREDICTED: phosphoglycerate kinase, chloropl...    388   6e-117   
gb|EYU36656.1|  hypothetical protein MIMGU_mgv11b024665mg               382   6e-116   
ref|XP_010907026.1|  PREDICTED: phosphoglycerate kinase, chloropl...    389   1e-115   
gb|EMT03715.1|  Cytokinin-O-glucosyltransferase 2                       378   7e-115   
ref|XP_009616936.1|  PREDICTED: phosphoglycerate kinase 2, chloro...    381   2e-113   
ref|XP_009616935.1|  PREDICTED: phosphoglycerate kinase 2, chloro...    381   2e-113   
ref|XP_010107502.1|  UDP-glycosyltransferase 86A1                       377   5e-113   
ref|XP_006833177.1|  hypothetical protein AMTR_s00072p00151180          375   6e-110   
ref|XP_009334676.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       364   3e-108   
ref|XP_010234765.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    358   6e-105   
ref|XP_010234764.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    358   2e-104   
gb|ABB47707.1|  methyltransferase family protein, expressed             355   2e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EPS60356.1|  hypothetical protein M569_14447                         345   3e-103   
ref|XP_006296293.1|  hypothetical protein CARUB_v10025463mg             341   4e-103   
ref|XP_004173864.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       339   2e-102   
ref|XP_011094739.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       338   2e-101   
ref|NP_001169647.1|  uncharacterized protein LOC100383528               343   5e-101   Zea mays [maize]
gb|EEC67040.1|  hypothetical protein OsI_33779                          349   6e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_002464567.1|  hypothetical protein SORBIDRAFT_01g020930          347   1e-100   Sorghum bicolor [broomcorn]
ref|XP_006661798.1|  PREDICTED: phosphoglycerate kinase, chloropl...    346   2e-100   
gb|EEE51029.1|  hypothetical protein OsJ_31675                          355   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645175.1|  PREDICTED: uncharacterized protein LOC100383...    342   1e-99    
ref|XP_008645148.1|  PREDICTED: uncharacterized protein LOC100383...    343   2e-99    
ref|XP_004983016.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    343   4e-99    
ref|XP_009794965.1|  PREDICTED: UDP-glycosyltransferase 86A2-like       331   6e-99    
gb|ACN39829.1|  unknown                                                 335   2e-98    Picea sitchensis
gb|ABK24777.1|  unknown                                                 334   2e-98    Picea sitchensis
gb|ADE76691.1|  unknown                                                 330   8e-97    
gb|ABR17061.1|  unknown                                                 326   1e-95    Picea sitchensis
ref|XP_011091739.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       318   3e-95    
gb|ADE76226.1|  unknown                                                 325   4e-95    
gb|ACN39827.1|  unknown                                                 317   6e-92    Picea sitchensis
ref|XP_011094619.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    318   9e-92    
gb|EPS66198.1|  hypothetical protein M569_08580                         310   2e-91    
ref|XP_009616938.1|  PREDICTED: phosphoglycerate kinase 2, chloro...    314   1e-89    
ref|NP_001064696.2|  Os10g0442300                                       303   2e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006410873.1|  hypothetical protein EUTSA_v10017663mg             300   8e-89    
gb|EMT21756.1|  Para-aminobenzoate synthase                             323   2e-88    
ref|XP_008809687.1|  PREDICTED: phosphoglycerate kinase, chloropl...    304   8e-86    
ref|XP_008645169.1|  PREDICTED: uncharacterized protein LOC100383...    301   1e-84    
ref|XP_011030214.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    297   3e-84    
ref|XP_011030215.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    297   3e-84    
ref|XP_011030213.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    297   4e-84    
ref|XP_008809688.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    297   7e-84    
ref|XP_008809686.1|  PREDICTED: phosphoglycerate kinase, chloropl...    298   1e-83    
gb|EYU34482.1|  hypothetical protein MIMGU_mgv1a026087mg                286   5e-83    
ref|XP_007151659.1|  hypothetical protein PHAVU_004G065300g             291   6e-83    
ref|XP_006428396.1|  hypothetical protein CICLE_v10011216mg             289   1e-81    
ref|XP_007151655.1|  hypothetical protein PHAVU_004G065300g             290   2e-81    
ref|XP_006493019.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    288   4e-81    
ref|XP_010325974.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    286   2e-80    
gb|ABR16264.1|  unknown                                                 281   2e-79    
ref|XP_002966076.1|  hypothetical protein SELMODRAFT_407312             278   7e-79    
ref|XP_002971410.1|  hypothetical protein SELMODRAFT_441496             278   1e-78    
ref|XP_009376835.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       269   2e-78    
gb|ABR16342.1|  unknown                                                 273   1e-76    
gb|KDO49320.1|  hypothetical protein CISIN_1g0147082mg                  265   7e-76    
ref|XP_006838757.1|  hypothetical protein AMTR_s00002p00256140          269   1e-75    
ref|XP_006593737.1|  PREDICTED: phosphoglycerate kinase, chloropl...    271   4e-75    
ref|XP_006429745.1|  hypothetical protein CICLE_v10011540mg             266   4e-74    
gb|KDO64318.1|  hypothetical protein CISIN_1g010684mg                   265   8e-74    
ref|XP_002263989.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    265   1e-73    
gb|KEH35117.1|  UDP-glucosyltransferase family protein                  264   1e-73    
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    263   3e-73    
gb|AIS39476.1|  flavonoid UDP-glucosyltransferase 10                    263   5e-73    
gb|KDO64319.1|  hypothetical protein CISIN_1g010684mg                   263   6e-73    
gb|ABK24277.1|  unknown                                                 262   8e-73    
gb|ABR18044.1|  unknown                                                 261   1e-72    
ref|XP_003618643.1|  Cytokinin-O-glucosyltransferase                    261   2e-72    
gb|KDO49322.1|  hypothetical protein CISIN_1g0147082mg                  254   3e-72    
ref|XP_003618657.1|  Cytokinin-O-glucosyltransferase                    260   4e-72    
ref|XP_010063153.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    260   5e-72    
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    259   7e-72    
gb|AIE12476.1|  UGT7                                                    259   1e-71    
gb|AFJ52999.1|  UDP-glycosyltransferase 1                               259   1e-71    
gb|KEH19454.1|  UDP-glucosyltransferase family protein                  258   2e-71    
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       257   3e-71    
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       256   8e-71    
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          256   9e-71    
ref|XP_008384734.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       255   1e-70    
ref|XP_011069428.1|  PREDICTED: UDP-glycosyltransferase 86A1-like       249   1e-70    
ref|XP_003618661.1|  Cytokinin-O-glucosyltransferase                    256   1e-70    
dbj|BAF49299.1|  putative glycosyltransferase                           256   1e-70    
ref|XP_006429747.1|  hypothetical protein CICLE_v10013430mg             256   1e-70    
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       256   2e-70    
ref|XP_010063159.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    255   2e-70    
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       255   2e-70    
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       254   3e-70    
gb|KDO64321.1|  hypothetical protein CISIN_1g010825mg                   255   3e-70    
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       254   4e-70    
ref|XP_004303931.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       254   4e-70    
gb|EYU45043.1|  hypothetical protein MIMGU_mgv1a020141mg                249   4e-70    
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    253   6e-70    
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    253   8e-70    
gb|KEH25028.1|  UDP-glucosyltransferase family protein                  253   1e-69    
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                  253   1e-69    
ref|XP_009782481.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       252   1e-69    
dbj|BAG80542.1|  glycosyltransferase                                    253   1e-69    
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         253   2e-69    
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             252   2e-69    
dbj|BAK02647.1|  predicted protein                                      253   2e-69    
ref|XP_010030030.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   2e-69    
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       251   2e-69    
ref|XP_003618634.1|  Cytokinin-O-glucosyltransferase                    252   3e-69    
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             252   3e-69    
gb|KEH21629.1|  UDP-glucosyltransferase family protein                  251   3e-69    
gb|EMT24598.1|  Cytokinin-O-glucosyltransferase 2                       251   3e-69    
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          252   3e-69    
gb|KEH35119.1|  UDP-glucosyltransferase family protein                  252   3e-69    
ref|XP_010063157.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   5e-69    
ref|XP_010063162.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    252   5e-69    
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             251   6e-69    
ref|XP_003618658.1|  Cytokinin-O-glucosyltransferase                    251   6e-69    
ref|XP_009593947.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       250   6e-69    
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             251   6e-69    
ref|XP_002990617.1|  hypothetical protein SELMODRAFT_448116             250   7e-69    
gb|KDO64316.1|  hypothetical protein CISIN_1g010684mg                   250   8e-69    
ref|XP_010922029.1|  PREDICTED: UDP-glycosyltransferase 87A2-like       250   8e-69    
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       250   8e-69    
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       250   9e-69    
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    249   9e-69    
gb|ABR16170.1|  unknown                                                 251   1e-68    
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    250   1e-68    
gb|KCW48703.1|  hypothetical protein EUGRSUZ_K02355                     249   1e-68    
ref|XP_008237171.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       250   1e-68    
ref|XP_002971412.1|  hypothetical protein SELMODRAFT_267489             249   1e-68    
ref|XP_003618640.1|  Cytokinin-O-glucosyltransferase                    250   1e-68    
ref|XP_003618637.1|  Cytokinin-O-glucosyltransferase                    250   1e-68    
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       249   2e-68    
ref|XP_006858828.1|  hypothetical protein AMTR_s00066p00177320          249   2e-68    
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       250   2e-68    
ref|XP_010247543.1|  PREDICTED: UDP-glycosyltransferase 84B2-like       250   2e-68    
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             249   2e-68    
ref|XP_003618665.1|  Cytokinin-O-glucosyltransferase                    249   2e-68    
emb|CDP01076.1|  unnamed protein product                                249   2e-68    
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       249   3e-68    
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       249   3e-68    
ref|XP_003618632.1|  Cytokinin-O-glucosyltransferase                    249   3e-68    
ref|XP_009377938.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   3e-68    
ref|XP_004958356.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       249   3e-68    
ref|XP_007201501.1|  hypothetical protein PRUPE_ppa016883mg             248   3e-68    
ref|XP_006838761.1|  hypothetical protein AMTR_s00002p00256270          248   4e-68    
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       248   4e-68    
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            249   4e-68    
gb|ABR16243.1|  unknown                                                 249   4e-68    
gb|AFK38894.1|  unknown                                                 249   4e-68    
gb|EMS52500.1|  UDP-glycosyltransferase 85A3                            249   4e-68    
ref|XP_002966072.1|  hypothetical protein SELMODRAFT_167957             249   4e-68    
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       249   5e-68    
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      249   5e-68    
ref|XP_009369550.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       248   5e-68    
ref|XP_007215295.1|  hypothetical protein PRUPE_ppa004989mg             248   5e-68    
pdb|2PQ6|A  Chain A, Crystal Structure Of Medicago Truncatula Ugt...    248   5e-68    
ref|XP_004303933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   5e-68    
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   6e-68    
gb|KDO64317.1|  hypothetical protein CISIN_1g010684mg                   248   6e-68    
ref|XP_007199429.1|  hypothetical protein PRUPE_ppa026557mg             248   7e-68    
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       248   7e-68    
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   7e-68    
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              248   8e-68    
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    248   8e-68    
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       249   9e-68    
ref|XP_004305884.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   1e-67    
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     247   1e-67    
ref|XP_008679293.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       248   1e-67    
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase      247   1e-67    
ref|XP_002965705.1|  hypothetical protein SELMODRAFT_84049              247   1e-67    
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       247   1e-67    
ref|XP_008358180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       247   1e-67    
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    247   1e-67    
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    247   1e-67    
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       246   2e-67    
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            246   2e-67    
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg             246   2e-67    
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   3e-67    
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       247   3e-67    
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         246   3e-67    
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       246   4e-67    
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             246   4e-67    
emb|CDY41486.1|  BnaA08g20880D                                          246   4e-67    
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-67    
gb|AFW64428.1|  hypothetical protein ZEAMMB73_964153                    246   4e-67    
ref|XP_010063158.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    246   4e-67    
ref|XP_008679294.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       246   5e-67    
gb|AES74860.2|  UDP-glucosyltransferase family protein                  246   6e-67    
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       246   6e-67    
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       244   6e-67    
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       245   6e-67    
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       245   6e-67    
dbj|BAK01910.1|  predicted protein                                      245   7e-67    
ref|XP_007151398.1|  hypothetical protein PHAVU_004G043200g             245   7e-67    
ref|XP_009377935.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-67    
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   7e-67    
ref|XP_003618655.1|  UDP-glucuronosyltransferase                        245   8e-67    
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   8e-67    
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   8e-67    
gb|KCW70350.1|  hypothetical protein EUGRSUZ_F03595                     245   9e-67    
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   9e-67    
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   1e-66    
dbj|BAG80534.1|  putative glycosyltransferase                           244   1e-66    
ref|XP_003608449.1|  Cytokinin-O-glucosyltransferase                    244   1e-66    
ref|XP_003598165.1|  Cytokinin-O-glucosyltransferase                    244   1e-66    
gb|AFK36738.1|  unknown                                                 244   1e-66    
ref|XP_010037079.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       244   1e-66    
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         244   1e-66    
ref|XP_002278087.2|  PREDICTED: UDP-glycosyltransferase 87A1-like       243   2e-66    
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       244   2e-66    
gb|ACN40261.1|  unknown                                                 240   2e-66    
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             244   2e-66    
ref|XP_004485548.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       244   2e-66    
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       243   2e-66    
ref|XP_006603934.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       244   2e-66    
gb|AES96307.2|  UDP-glucosyltransferase family protein                  244   2e-66    
ref|XP_007151400.1|  hypothetical protein PHAVU_004G043400g             244   2e-66    
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       243   2e-66    
ref|XP_002966074.1|  hypothetical protein SELMODRAFT_84376              243   2e-66    
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             243   3e-66    
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       243   3e-66    
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      243   3e-66    
ref|XP_004489449.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    243   3e-66    
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       242   4e-66    
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       242   4e-66    
ref|XP_004489448.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    243   4e-66    
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    243   4e-66    
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             243   4e-66    
ref|XP_004296051.1|  PREDICTED: UDP-glycosyltransferase 87A2-like       242   4e-66    
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   4e-66    
ref|XP_009369551.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       242   4e-66    
gb|ABK95289.1|  unknown                                                 243   4e-66    
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             243   5e-66    
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       243   5e-66    
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             243   5e-66    
ref|XP_009790488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    243   6e-66    
ref|XP_010112357.1|  UDP-glycosyltransferase 85A7                       243   6e-66    
gb|KEH25029.1|  UDP-glucosyltransferase family protein                  243   6e-66    
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             243   7e-66    
ref|XP_003618656.1|  UDP-glucuronosyltransferase                        243   7e-66    
ref|XP_003618642.1|  Cytokinin-O-glucosyltransferase                    244   7e-66    
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   7e-66    
ref|XP_003618649.1|  Cytokinin-O-glucosyltransferase                    242   7e-66    
ref|XP_006350869.1|  PREDICTED: UDP-glycosyltransferase 87A2-like       241   7e-66    
ref|XP_006858837.1|  hypothetical protein AMTR_s00066p00179570          241   8e-66    
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       242   8e-66    
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      242   8e-66    
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             242   8e-66    
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like     242   9e-66    
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    242   9e-66    
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   9e-66    
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    242   9e-66    
ref|XP_010257044.1|  PREDICTED: UDP-glycosyltransferase 87A1-like       241   9e-66    
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       242   1e-65    
gb|KCW70354.1|  hypothetical protein EUGRSUZ_F03599                     242   1e-65    
ref|XP_010039151.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       241   1e-65    
ref|XP_010099459.1|  UDP-glycosyltransferase 87A1                       241   1e-65    
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg             241   1e-65    
gb|AGU14127.1|  UDP-glycosyltransferase                                 242   1e-65    
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       242   1e-65    
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       242   1e-65    
ref|XP_002971625.1|  hypothetical protein SELMODRAFT_96089              241   1e-65    
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         241   1e-65    
ref|XP_003618651.1|  UDP-glucuronosyltransferase 2A3                    241   1e-65    
ref|XP_003593141.1|  Cytokinin-O-glucosyltransferase                    241   1e-65    
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                       241   1e-65    
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  241   1e-65    



>ref|XP_009802698.1| PREDICTED: UDP-glycosyltransferase 86A1 [Nicotiana sylvestris]
Length=496

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/481 (60%), Positives = 358/481 (74%), Gaps = 4/481 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M  + QK HAI++P PYQGHI P ++L+I LAS GFT+TFVNT  I S I  ++     +
Sbjct  1     MASHYQKPHAILIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQT-QRHS  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               DD+F +AR +GLDIRY T++DGFPLGFDR+ +   F+ G+++VFSAH DE+V  L   
Sbjct  60    NKDDLFAKARENGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDEVVGNLVKS  119

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +PP TCLIAD+FY WP +IA KYNLV VSF+TEPALV  +  H++LLK+NGHF  +D RK
Sbjct  120   DPPVTCLIADTFYVWPLMIAEKYNLVYVSFWTEPALVLTLYYHMELLKKNGHFASQDNRK  179

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGVEAIEPRDL  YLQ  +  T  V+  +YK F D KKADI+ICNTVQELE  T
Sbjct  180   DTIDYIPGVEAIEPRDLMSYLQATDIWT-VVHRVIYKAFTDIKKADIIICNTVQELEFDT  238

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL +KQP YAIGP+FP   T+     SL  ESDC +WL++KP  SVLY SFGS AH +
Sbjct  239   LSALNKKQPTYAIGPIFPSGLTKAPFSISLWSESDCSQWLNNKPNTSVLYVSFGSYAHTS  298

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             KE I+E+  GL LS VNFIWVLRP +  +DE DF   GF+EC++DRGLIVPWC Q  VIS
Sbjct  299   KEDILEIAHGLQLSGVNFIWVLRPDIVSSDETDFLPVGFEECIKDRGLIVPWCKQIEVIS  358

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNS LESIWC +P+IC+PL+ DQ TNRKLVV++WKIGINLC  D K +
Sbjct  359   HPAIGGFLTHCGWNSTLESIWCGIPLICFPLLTDQFTNRKLVVNDWKIGINLC--DKKRV  416

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             + EEVA KV   M  +S+ ELRKA+K+VRK LENALG +GSS KN  +F+E IK    + 
Sbjct  417   THEEVAEKVSNFMCGDSTQELRKAMKEVRKTLENALGQDGSSEKNFHQFMEDIKVNIRKR  476

Query  3597  S  3599
             +
Sbjct  477   A  477



>emb|CDP18343.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 361/481 (75%), Gaps = 8/481 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M    +K HAI++P PYQGHINP +HL+I LAS+GF +TFVNT+ +   I KA+ G+   
Sbjct  1     MAGTYRKPHAIMIPYPYQGHINPFVHLAIKLASKGFIITFVNTQSVQHQISKAQTGSRR-  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG-  2513
               DDIF +AR SGLDIRY T+SDGFPL FDR+ +   F+ G+++VFSAH+DELV  L   
Sbjct  60    --DDIFAKARQSGLDIRYATVSDGFPLSFDRSLNEDQFVEGLIHVFSAHIDELVGNLVNS  117

Query  2514  -LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               EPP TCLI+D+F+ W S+IA K+NLV+VSF+TEPALV  +  HLDLL++NGHF     
Sbjct  118   ETEPPATCLISDTFFVWGSVIARKHNLVHVSFWTEPALVLTLYYHLDLLRQNGHFASPVN  177

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D+IDYIPGV+AIEP DL  YLQ  +  T AV+  +YK F+D K+ADI+ICNTVQELEP
Sbjct  178   RRDNIDYIPGVKAIEPGDLMSYLQATDIWT-AVHQVIYKAFDDVKRADIIICNTVQELEP  236

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL  KQP YAIGP+FP  FT+     SL  ESDC +WL+ KP GSVLY SFGS AH
Sbjct  237   ETISALNRKQPTYAIGPVFPAGFTKSNVATSLWSESDCTQWLNDKPDGSVLYVSFGSYAH  296

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +K+ I+E+  GL  S V+FIWV+RP +  +DE DF   GF++ ++DRGLIVPWC Q AV
Sbjct  297   TSKQDILEMAHGLSSSGVSFIWVVRPDIVSSDETDFLPVGFEDQIKDRGLIVPWCCQIAV  356

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             ISHPA+GGF+THCGWNSILESIWCSVP++CYPL+ DQ TNRKLV+++WKIGINLC  D +
Sbjct  357   ISHPAIGGFLTHCGWNSILESIWCSVPLVCYPLVTDQFTNRKLVINDWKIGINLC--DKQ  414

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             +I+++EV  K+  LM  +   ELR AIK+VRK LE AL +NGSS  N  +FVEKIK +  
Sbjct  415   AITRDEVVEKISLLMNGQVLDELRAAIKEVRKKLELALSTNGSSEGNFHQFVEKIKTQMR  474

Query  3591  Q  3593
             +
Sbjct  475   E  475



>ref|XP_006354353.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=500

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/479 (60%), Positives = 358/479 (75%), Gaps = 6/479 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLII--KARRGTT  2330
             M  ++QK HAI++P PYQGHI P ++L+I LAS GFT+TFVNT  I S I   ++R  + 
Sbjct  1     MANHHQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQSRENSQ  60

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DD+F +AR SGLDIRY T++DGFPLGFDR+ +   F+ G+++VFSAH DELV  L 
Sbjct  61    IKNKDDLFARARESGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDELVGDLV  120

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +PP TCLIAD+FY WP++IA KYNLV VSF+TEPALVF +  H++LLK+NGHF  +D 
Sbjct  121   KSDPPVTCLIADTFYVWPAMIADKYNLVYVSFWTEPALVFNLYYHMELLKKNGHFASQDN  180

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             RKD+IDYIPGV+AIEPRDL  YLQ  +  T  V+  +YK F D KKADI+ICNTVQELE 
Sbjct  181   RKDTIDYIPGVKAIEPRDLMSYLQATDIWT-VVHRVIYKAFTDIKKADIIICNTVQELEF  239

Query  2871  QTISALEEKQPFYAIGPLFPQ-SFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
              T+SAL + QP YAIGP+FP  +FT+     SL  ESDC +WL++KP  SVLY SFGS A
Sbjct  240   DTLSALNKNQPTYAIGPIFPSGNFTKAPFSISLWSESDCSQWLNNKPNSSVLYVSFGSYA  299

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
             H +KE ++E+  GL LS VNFIWVLRP +  +DE DF   GF+E ++DRGLIVPWC Q  
Sbjct  300   HTSKEDLLEIAHGLQLSGVNFIWVLRPDIVSSDETDFLPVGFEESIKDRGLIVPWCRQIE  359

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             VISHPA GGF+THCGWNS LESIWC +P+IC+PL+ DQ TNRKLVV++WKIGINLC  D 
Sbjct  360   VISHPATGGFLTHCGWNSTLESIWCGIPLICFPLLTDQFTNRKLVVNDWKIGINLC--DK  417

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             + ++ EEVA KV   M   S+ ELRKA+K+VRK LENALG +GSS KN  +F+E IK  
Sbjct  418   ERVTHEEVAEKVSHFMCGNSTQELRKAVKEVRKTLENALGQDGSSEKNFHQFMENIKVN  476



>ref|XP_009610181.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=498

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/482 (59%), Positives = 358/482 (74%), Gaps = 4/482 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKAR-RGTTT  2333
             M  + QK HAI++P PYQGHI P ++L+I LAS GFT+TFVNT  I S I  ++ +    
Sbjct  1     MASHYQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQTQQNYQ  60

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                DD+F +AR +GLDIRY T++DGFPLGFDR+ +   F+ G+++VFSAH DE+V  L  
Sbjct  61    HNKDDLFAKARENGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDEVVGNLVK  120

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
              +PP TCLIAD+FY WP +IA KYNLV VSF+TEPALV  +  H++LLK+NGHF C+D R
Sbjct  121   SDPPVTCLIADTFYVWPLMIAEKYNLVYVSFWTEPALVLTLYYHMELLKKNGHFACQDNR  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             KDSIDYIPGVEAIEPRDL  YLQ   +  + V+  +YK F D KKAD++ICNTVQELE  
Sbjct  181   KDSIDYIPGVEAIEPRDLMSYLQ-ATDIWTVVHRVIYKAFTDIKKADMIICNTVQELEFD  239

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             T+SAL +KQP YAIGP+FP   T+     SL  ESDC +WL++KP  SVLY SFGS AH 
Sbjct  240   TLSALNKKQPTYAIGPIFPSGLTKAPFSISLWSESDCSQWLNNKPNTSVLYVSFGSYAHT  299

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +KE I+E+  GL LS VNFIWVLRP +  +DE DF   GF+E ++DRGLIVPWC Q  VI
Sbjct  300   SKEDILEIAHGLQLSGVNFIWVLRPDIVSSDETDFLPVGFEESIKDRGLIVPWCRQIEVI  359

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF+THCGWNS LESIWC +P+IC+PL+ DQ TNRKLVV++WKIGINLC  D+  
Sbjct  360   SHPAIGGFLTHCGWNSTLESIWCGIPLICFPLLTDQFTNRKLVVNDWKIGINLC--DNAR  417

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             ++ EEVA KV   M  +++ ELRKA+K+VRK LENALG +GSS KN  +F+E IK    +
Sbjct  418   VTHEEVAEKVSNFMCGDTTQELRKAMKEVRKTLENALGQDGSSQKNFQQFMEDIKVNIRK  477

Query  3594  SS  3599
              +
Sbjct  478   RA  479



>ref|XP_004166167.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
Length=675

 Score =   430 bits (1106),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 248/314 (79%), Gaps = 9/314 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP++L+EI++ L   KKIIWIGPVKFS S+ +A GAS+LA  +  LSQR+CD+
Sbjct  365   GWLPVDLGPTSLDEINALLMNSKKIIWIGPVKFSDSSQSARGASRLARKLYDLSQRDCDI  424

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC A    SS+  A N+ +NASVVW+F KG+ LPG+LALDRAYP+E++W  ++ 
Sbjct  425   TVVGTTACKAIMQESSTLCAYNVFENASVVWDFFKGKQLPGVLALDRAYPYEINWDAVFC  484

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             D   PLVVDIGSGNG+FL  MARR KD NFLGLEIN KLVKRCL  V Q  MKN HF+AT
Sbjct  485   DTALPLVVDIGSGNGMFLLEMARRRKDHNFLGLEINEKLVKRCLHSVHQLEMKNGHFIAT  544

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+ +YPG LVLVSIQCPNPDFNKP HRWRMLQ+SLVEA+ADLLAS GKVFLQ
Sbjct  545   NATSTFRSIVCNYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLVEAVADLLASNGKVFLQ  604

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGG--WLKENPFGIRSDWEQHVLDRGD  1994
             SD+E VA+RM+E F  YGKGKL V         Q G  WL ENPFG+RSDWE+HVLDRGD
Sbjct  605   SDVEAVALRMREAFLLYGKGKLGVLQ------EQVGEEWLSENPFGVRSDWERHVLDRGD  658

Query  1995  PMYRLCLSKSESSE  2036
             PM+RL LSKS +++
Sbjct  659   PMFRLMLSKSTTTK  672


 Score =   282 bits (721),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 201/295 (68%), Gaps = 14/295 (5%)
 Frame = +1

Query  247   KIKKFQRLQFSSPVKSQ--------LTALDKAEACYESELRLFPHVQTLGQFPKEELFGK  402
             K  ++  +  S+P +S         + + D A + +   L   PHVQTLG+FP+EEL GK
Sbjct  36    KYDRYHAVLMSTPARSWGAVYCKNLVNSEDHASSWWN--LEAVPHVQTLGEFPREELAGK  93

Query  403   VVMVRFDSTILPVDKKKLDPHSAS----TVKYLCEARAKVILVGSWSSTINSKPLALEAV  570
             VVMVRFDST+L +++  L  +S      T+KYL ++ AKVIL  +W++   ++ L +++V
Sbjct  94    VVMVRFDSTLLLLEEMDLKTNSMKNAVFTIKYLHKSGAKVILASNWNTNSAARYLDIKSV  153

Query  571   AEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFG  750
              +YLSSVLQLKV P K  S  MM   E   + DILLLEN+S  K++V+NC KF++ LS G
Sbjct  154   VDYLSSVLQLKVCPVKCSSYSMMLTEEGFEKADILLLENLSVFKEEVANCSKFSKMLSLG  213

Query  751   VDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGG  930
             VDIFVNDSFS+ H+ILASTVGI  FCS C+AGF+FQ GL QL+K  +T ++PYVAIIGGG
Sbjct  214   VDIFVNDSFSQSHRILASTVGITRFCSTCLAGFNFQEGLCQLKKAAQTKRQPYVAIIGGG  273

Query  931   NLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVE  1095
             NL++K AALH LAS C  LVFVG M+FQIM A GL V  +L+     K+A  +++
Sbjct  274   NLLNKLAALHVLASTCSVLVFVGMMSFQIMQALGLSVSYRLMNHGVCKEAAELIQ  328



>ref|XP_004137833.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58973.1| hypothetical protein Csa_3G740160 [Cucumis sativus]
Length=674

 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 246/312 (79%), Gaps = 9/312 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP++L+EI++ L   KKIIWIGPVKFS S+ +A GAS+LA  +  LSQR+CD+
Sbjct  365   GWLPVDLGPTSLDEINALLMNSKKIIWIGPVKFSDSSQSARGASRLARKLYDLSQRDCDI  424

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC A    SS+  A N+ +NASVVW+F KG+ LPG+LALDRAYP+E++W  ++ 
Sbjct  425   TVVGTTACKAIMQESSTLCAYNVFENASVVWDFFKGKQLPGVLALDRAYPYEINWDAVFC  484

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             D   PLVVDIGSGNG+FL  MARR KD NFLGLEIN KLVKRCL  V Q  MKN HF+AT
Sbjct  485   DTTLPLVVDIGSGNGMFLLEMARRRKDHNFLGLEINEKLVKRCLHSVHQLEMKNGHFIAT  544

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+ +YPG LVLVSIQCPNPDFNKP HRWRMLQ+SLVEA+ADLLAS GKVFLQ
Sbjct  545   NATSTFRSIVCNYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLVEAVADLLASNGKVFLQ  604

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGG--WLKENPFGIRSDWEQHVLDRGD  1994
             SD+E VA+RM+E F  YGKGKL V         Q G  WL ENPFG+RSDWE+HVLDRGD
Sbjct  605   SDVEAVALRMREAFLLYGKGKLGVLQ------EQVGEEWLSENPFGVRSDWERHVLDRGD  658

Query  1995  PMYRLCLSKSES  2030
             PM+RL LSKS +
Sbjct  659   PMFRLMLSKSTT  670


 Score =   282 bits (721),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/295 (51%), Positives = 201/295 (68%), Gaps = 14/295 (5%)
 Frame = +1

Query  247   KIKKFQRLQFSSPVKSQ--------LTALDKAEACYESELRLFPHVQTLGQFPKEELFGK  402
             K  ++  +  S+P +S         + + D A + +   L   PHVQTLG+FP+EEL GK
Sbjct  36    KYDRYHAVLMSTPARSWGAVYCKNLVNSEDHASSWWN--LEAVPHVQTLGEFPREELAGK  93

Query  403   VVMVRFDSTILPVDKKKLDPHSAS----TVKYLCEARAKVILVGSWSSTINSKPLALEAV  570
             VVMVRFDST+L +++  L  +S      T+KYL ++ AKVIL  +W++   ++ L +++V
Sbjct  94    VVMVRFDSTLLLLEEMDLKTNSMKNAVFTIKYLHKSGAKVILASNWNTNSAARYLDIKSV  153

Query  571   AEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFG  750
              +YLSSVLQLKV P K  S  MM   E   + DILLLEN+S  K++V+NC KF++ LS G
Sbjct  154   VDYLSSVLQLKVCPVKCSSYSMMLTEEGFEKADILLLENLSVFKEEVANCSKFSKMLSLG  213

Query  751   VDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGG  930
             VDIFVNDSFS+ H+ILASTVGI  FCS C+AGF+FQ GL QL+K  +T ++PYVAIIGGG
Sbjct  214   VDIFVNDSFSQSHRILASTVGITRFCSTCLAGFNFQEGLCQLKKAAQTKRQPYVAIIGGG  273

Query  931   NLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVE  1095
             NL++K AALH LAS C  LVFVG M+FQIM A GL V  +L+     K+A  +++
Sbjct  274   NLLNKLAALHVLASTCSVLVFVGMMSFQIMQALGLSVSYRLMNHGVCKEAAELIQ  328



>ref|XP_004246641.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=500

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 357/479 (75%), Gaps = 6/479 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLII--KARRGTT  2330
             M  ++QK HAI++P PYQGHI P ++L+I LAS GFT+TFVNT  I S I   ++R  + 
Sbjct  1     MANHHQKPHAIMIPYPYQGHITPFVYLAIKLASHGFTITFVNTHYIHSKISNSQSRENSQ  60

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DD+F +AR SGLDIRY T++DGFPLGFDR+ +   F+ G+++VFSAH DELV  L 
Sbjct  61    IKNKDDLFARARESGLDIRYATVNDGFPLGFDRSLNHDQFVEGLLHVFSAHFDELVGDLV  120

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +PP TCLIAD+FY WP++IA KYNLV VSF+TEPALVF +  H++LLK+NGHF  +D 
Sbjct  121   KSDPPVTCLIADTFYVWPAMIAEKYNLVYVSFWTEPALVFNLYYHMELLKKNGHFASQDN  180

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             RKD+IDYIPGV+AIEPRDL  YLQ      + V+  +YK F D KKADI+ICNTVQELE 
Sbjct  181   RKDTIDYIPGVKAIEPRDLMSYLQA-TEIWTVVHRVIYKAFTDIKKADIIICNTVQELEF  239

Query  2871  QTISALEEKQPFYAIGPLFPQ-SFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
              T+SAL + QP YAIGP+FP  +FT+     SL  ESDC +WL++KP  SVLY SFGS A
Sbjct  240   DTLSALNKNQPTYAIGPIFPSGNFTKAPFSISLWSESDCSQWLNNKPNSSVLYVSFGSYA  299

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
             H +KE ++E+  GL LS VNFIWVLRP +  +DE DF   GF+E ++DRGLIVPWC Q  
Sbjct  300   HTSKEDLLEIAHGLQLSGVNFIWVLRPDIVSSDETDFLPVGFEESIKDRGLIVPWCRQIE  359

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             VISHPA GGF+THCGWNS LESIWC +P+IC+PL+ DQ TNRKLVV++WKIGINLC  D 
Sbjct  360   VISHPATGGFLTHCGWNSTLESIWCGIPLICFPLLTDQFTNRKLVVNDWKIGINLC--DK  417

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             + ++ EEV+ KV   M   S+ ELRKA+K+VRK LENALG +GSS +N  +F+E IK  
Sbjct  418   ERVTHEEVSEKVSHFMCGSSAQELRKAVKEVRKTLENALGQDGSSERNFHQFMENIKVN  476



>ref|XP_007027384.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY07886.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=484

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/476 (58%), Positives = 354/476 (74%), Gaps = 3/476 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +N+QK HAI++  P QGH+ P++ L++ LAS+GFT+TFVNT+ I   I K+   TTT+
Sbjct  1     MEKNHQKPHAIMIAYPLQGHVIPSVQLAMKLASKGFTITFVNTQSIHHQITKSHPNTTTS  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               +DIFT+AR SGLDIRY  +SDGFPLGFDR+ +   F+ G+++V SAH+DELV      
Sbjct  61    DAEDIFTEARKSGLDIRYNVVSDGFPLGFDRSLNHDQFLEGVLHVMSAHIDELVANTIKT  120

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PPPTCLIAD+F+ W S+I++KYNLVNVSF+TEPALVF +  HLDLL+ NGHF   D R 
Sbjct  121   NPPPTCLIADTFFVWSSMISNKYNLVNVSFWTEPALVFTLYYHLDLLRSNGHFASIDNRD  180

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D IDYIPGV A+EP+DL  YLQ  + +T  V+  ++K FED KKAD +ICNTVQELE +T
Sbjct  181   DVIDYIPGVRAVEPKDLMSYLQASDIST-VVHRIIFKAFEDVKKADFIICNTVQELEHET  239

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL +KQP YAIGP+F   FT+     SL  ESDC +WLD+K  GSVLY SFGS AH +
Sbjct  240   ISALNKKQPTYAIGPIFRTGFTKSVVATSLWSESDCTQWLDTKRNGSVLYISFGSYAHAS  299

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  I E+  GL+LS V+FIWVLRP +  + E DF   GF+E ++  G+IVPWC Q AVIS
Sbjct  300   KNDIAEIAHGLLLSGVSFIWVLRPDIVCSGETDFLPVGFEENIKGTGMIVPWCCQIAVIS  359

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPAVGGF+THCGWNSILES+WC+VP+IC+PL+ DQ TNRKL VD+WKIG+NL   D K I
Sbjct  360   HPAVGGFLTHCGWNSILESVWCTVPLICFPLLTDQFTNRKLAVDDWKIGLNL--SDKKQI  417

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +++EV  K+  L+  +S  +LRK IK+V+K LENAL + GSS +N ++F+  ++ K
Sbjct  418   NRDEVVEKIHRLISRKSGDDLRKNIKEVKKKLENALSTVGSSEENFNQFICDVQIK  473



>gb|KHG05148.1| Phosphoglycerate kinase 1, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG13352.1| Phosphoglycerate kinase 1, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG21913.1| Phosphoglycerate kinase 1, chloroplastic -like protein [Gossypium 
arboreum]
Length=675

 Score =   421 bits (1082),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 247/312 (79%), Gaps = 4/312 (1%)
 Frame = +3

Query  1107  WKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDVS  1286
             W PVDLGP +LEEI S ++  KKIIWIGPVKFSSS     G SKLA M+   SQ  C+++
Sbjct  365   WLPVDLGPRSLEEIYSLVTNSKKIIWIGPVKFSSSKPCTVGTSKLAQMLCKQSQCECEIT  424

Query  1287  IVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYND  1466
             IVG  AC+     S+S ++ N+++NASVVWEFLK + LPG+++LDRAYPFE+DW   Y+D
Sbjct  425   IVGSTACEVIKNESNSLSSFNVLENASVVWEFLKEQKLPGVMSLDRAYPFEIDWSVAYHD  484

Query  1467  PDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATN  1643
               +PLVVDIGSGNGLF+ GMA+ RKD NFLGLEIN KLV+RCLD V QS ++N +F+ +N
Sbjct  485   ASQPLVVDIGSGNGLFIMGMAQNRKDLNFLGLEINGKLVRRCLDSVHQSGIRNAYFIGSN  544

Query  1644  ATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQS  1823
             AT+TFRSI+ SYPG LVLVS+QCPNPDFNKP +RW MLQ+SL+EA+ADLLAS GKVFLQS
Sbjct  545   ATTTFRSIVFSYPGELVLVSVQCPNPDFNKPENRWSMLQRSLIEAVADLLASKGKVFLQS  604

Query  1824  DIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGG--WLKENPFGIRSDWEQHVLDRGDP  1997
             D+E VA+RMKE+F +YGKGKL + + D+  I   G  WL+ENPFGI SDWEQHV+DRG P
Sbjct  605   DVEAVAMRMKEQFLQYGKGKLHLSH-DQYNIRINGNAWLEENPFGIHSDWEQHVIDRGAP  663

Query  1998  MYRLCLSKSESS  2033
             MYRL LSKS  S
Sbjct  664   MYRLMLSKSTGS  675


 Score =   269 bits (688),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 194/288 (67%), Gaps = 6/288 (2%)
 Frame = +1

Query  286   VKSQLTALDKAEACY--ESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLD  459
             V S + +  K + C   E EL   PHVQTL +FP+EEL  KVVMVRFDSTIL  +K  L 
Sbjct  52    VVSNVNSSHKEKTCLYDEGELEALPHVQTLREFPREELVAKVVMVRFDSTILLGEKLDLS  111

Query  460   PHSAS----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS  627
               SAS    T+KYL E  AKVIL+  WS  IN K L  +AVA+ LSSVLQLKVI  +  S
Sbjct  112   SQSASKALYTIKYLHECGAKVILMSEWSRKINPKLLDAQAVADILSSVLQLKVIALRCIS  171

Query  628   SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAST  807
              +     E   + DI LLEN+S+ K++V+NC KFA+ LS  VDI VNDSF + HK+LAST
Sbjct  172   CKSPLRREDLQKADIFLLENLSEYKEEVANCSKFAELLSSEVDILVNDSFCQSHKVLAST  231

Query  808   VGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDAL  987
             VG+A FC A +AGF F+  L QL+KI +T KKPYVA+IGGGNL   AAAL FLAS CDAL
Sbjct  232   VGVARFCYASMAGFSFEENLHQLKKIAKTKKKPYVAVIGGGNLKRNAAALQFLASRCDAL  291

Query  988   VFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             VFVG+M+FQIM A G  +P  LVER A K A  IV+ A   N+L+  P
Sbjct  292   VFVGQMSFQIMRALGHSIPTNLVERDAHKAALDIVQFAHDKNVLMSYP  339



>gb|EYU34478.1| hypothetical protein MIMGU_mgv1a020724mg [Erythranthe guttata]
Length=490

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/474 (57%), Positives = 358/474 (76%), Gaps = 8/474 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +  +K HAI++P PYQGHINP + L++ LAS+GFT+TFVNT+ + S I +A+ GT  A
Sbjct  1     MADTARKPHAIMIPYPYQGHINPFVSLAMKLASQGFTITFVNTQSVHSRISRAQSGTDAA  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF  ARNSGLDIRY T+SDGFPLGFDR+ +   F+ G+++VFSAHVDELV  L+  
Sbjct  61    ---DIFAGARNSGLDIRYATVSDGFPLGFDRSANHDQFVEGLIHVFSAHVDELVATLSAS  117

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +PP TCLIAD+FY W S IA+K+NLV+VSF+TEPALV ++  HLDLLK+N HFG K+ RK
Sbjct  118   DPPVTCLIADTFYVWSSAIAAKHNLVSVSFWTEPALVLSLYYHLDLLKKNSHFGSKEKRK  177

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGVE + P DLP YLQ + +T++ V+  +Y+ F D KKADI+ICN VQELE +T
Sbjct  178   DTIDYIPGVETVNPTDLPSYLQSD-DTSTVVHRVIYRAFTDVKKADIIICNAVQELESKT  236

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL  KQP YAIGP+    FT QT   SL  E+DC  WL++KP GSVLY SFGS AH T
Sbjct  237   LSALHTKQPTYAIGPIV-SCFTNQTIATSLWSETDCTPWLNNKPDGSVLYVSFGSHAHTT  295

Query  3057  -KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I E+  GL+ S  +FIWV+RP +  +DE +F   GF+  ++ RG+IV WC Q  VI
Sbjct  296   SKQDIWEIAHGLLSSGSDFIWVVRPDIVSSDEANFLPPGFENSIKGRGVIVRWCSQMKVI  355

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF++HCGWNS+LESIWC VP+IC+PL  DQ TNRKLVV++W+IGINLC+ D  S
Sbjct  356   SHPAIGGFLSHCGWNSVLESIWCKVPLICFPLFTDQFTNRKLVVNDWRIGINLCDRD--S  413

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
             I++ EV  K+++LM  ++S +LR A+K+V + LE+AL S+G+S KN+  F+E +
Sbjct  414   ITRGEVREKIEYLMSGKTSEKLRNAVKEVSRTLESALTSDGASEKNLSLFIEDL  467



>ref|XP_007151656.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
 ref|XP_007151660.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
 gb|ESW23650.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
 gb|ESW23654.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
Length=674

 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 242/307 (79%), Gaps = 7/307 (2%)
 Frame = +3

Query  1107  WKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDVS  1286
             W PVDLGP++L+EI S L+ CKKI+WIGPVKF +S+    GASKL  ++D L Q NC+++
Sbjct  368   WVPVDLGPASLDEIGSTLTNCKKIVWIGPVKFVNSSEYTNGASKLTRILDKLGQNNCEIT  427

Query  1287  IVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYND  1466
             +VG MA        SS +  N+I+NASVVWEFLKGR LPG++A+DR YP E++W  IY+D
Sbjct  428   VVGAMASKLVRQEKSSLSFINIIENASVVWEFLKGRKLPGVMAVDRGYPSEINWNSIYSD  487

Query  1467  PDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATN  1643
             P + LVVDIGSGNGLFL  MARR+ D NFLGLEIN KLV RCLD ++Q  +KN +FVATN
Sbjct  488   PAQSLVVDIGSGNGLFLLEMARRRQDLNFLGLEINEKLVLRCLDSINQYDIKNGYFVATN  547

Query  1644  ATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQS  1823
             ATSTFRSI+S+YPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EAI DLLA  GK++LQS
Sbjct  548   ATSTFRSIVSTYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAIVDLLAPNGKIYLQS  607

Query  1824  DIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPMY  2003
             D+E V IRMKE+F +YGKGKL++E        Q  WL+ENPFG+RS+WE+HVL+R  PMY
Sbjct  608   DVEAVTIRMKEQFLRYGKGKLDLE------YGQSEWLEENPFGVRSNWEKHVLERQAPMY  661

Query  2004  RLCLSKS  2024
             R+  SKS
Sbjct  662   RMMFSKS  668


 Score =   262 bits (669),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 184/270 (68%), Gaps = 6/270 (2%)
 Frame = +1

Query  334   SELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILP---VDKKKLDPHSA-STVKYLCEAR  501
              EL   PH+QTL +FP+EELFGKVVMVRFDS IL     DKK     +A  T+KYL +A 
Sbjct  75    GELNGIPHIQTLREFPREELFGKVVMVRFDSNILVKKVCDKKNQSVSNAVYTIKYLHKAG  134

Query  502   AKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLL  681
             AK+ILV  W+  +N+     ++V ++LS VLQ++++P      +  A +    + +I LL
Sbjct  135   AKIILVSDWN--MNTPEHHTDSVTDFLSEVLQIQIVPLHTIYFKKQAKMNSLEKENIHLL  192

Query  682   ENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQL  861
              N+S  K++V+NC +FA+ LS GVDIFVNDSFS  HK+LASTVG+  FC ACIAGFHF+ 
Sbjct  193   GNLSNFKEEVANCLEFARILSSGVDIFVNDSFSNCHKVLASTVGVTRFCYACIAGFHFEE  252

Query  862   GLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPV  1041
              L+ L+ +    +KPYVAIIGGGNL DKAA+  FLAS C   VFVG M+FQ+MHA G+ +
Sbjct  253   RLNLLKNLAEASRKPYVAIIGGGNLYDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSI  312

Query  1042  PIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             P  LV+RKA+ +A  IV  A+  N+ IL P
Sbjct  313   PCDLVDRKAINEALDIVRLAQDRNVQILYP  342



>ref|XP_009616388.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=491

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 354/482 (73%), Gaps = 3/482 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M + +QK HAI+ P P QGH+ P ++L+I LAS GFT+TFVNT+ +   I KAR      
Sbjct  1     MNQIDQKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFVNTQSVHYQISKARL-ENGV  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               DD+F+ AR  GLDIR  TI DGFP+ FDR+ +   +   ++  F +HVDELV+ L   
Sbjct  60    EGDDLFSSARKLGLDIRDVTIYDGFPIDFDRSLNHDKYFEAILNDFGSHVDELVENLVLS  119

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PPP  L+AD+FY WPS IA KYNLVNVS++TEPALV ++  HLDLL++NGH+ C D R+
Sbjct  120   NPPPNILVADTFYIWPSTIAKKYNLVNVSYWTEPALVLSVYYHLDLLRQNGHYDCIDKRQ  179

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D IDYIPGV+AI+P DL  YLQ  +    A  +     F D KKA+ +ICNTVQ+LE +T
Sbjct  180   DVIDYIPGVKAIKPTDLASYLQSNDTKMVANRIIHRAIFTDVKKAEYIICNTVQQLESET  239

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             I+AL+EKQP YAIGPLF   FT+ +   SL  ESDC  WLD+KP GSV+Y SFGS AH T
Sbjct  240   IAALQEKQPVYAIGPLFSPGFTKSSVKTSLWSESDCTNWLDAKPCGSVIYVSFGSYAHTT  299

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K++IME+ RGL++SEVNF+WVLRP +  ++E D+   G++E ++DRGLIVPWC Q AVIS
Sbjct  300   KQNIMEIARGLVVSEVNFLWVLRPDIVSSEETDYLPIGYEEFIKDRGLIVPWCCQTAVIS  359

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPAVGGF+THCGWNSILESIWCSVP IC+PL+ DQ TNRK+VVD+WKIGINLC  D +SI
Sbjct  360   HPAVGGFLTHCGWNSILESIWCSVPFICFPLLTDQFTNRKIVVDDWKIGINLC--DKESI  417

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             +++EV+ KVK L++ + + E+++ IK VRK LE+A+  NGSS  N  KF++ +K+K  + 
Sbjct  418   TRDEVSEKVKLLLRGKVAEEMKQQIKKVRKTLEDAVAINGSSQVNFTKFIDDLKSKIPKK  477

Query  3597  SV  3602
             +V
Sbjct  478   NV  479



>ref|XP_002276858.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vitis vinifera]
Length=481

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/480 (56%), Positives = 358/480 (75%), Gaps = 7/480 (1%)
 Frame = +3

Query  2157  MVENNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT  2333
             MV+NN  + HAI++P P QGH+ P +HL+I LAS GFT+TFVNT+ +   I +A+   + 
Sbjct  1     MVDNNPPNPHAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSP  60

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                +DIF  ARNSGLDIRY T+SDGFP+GFDR+ +   FM G+++V+SAHVDELV  +  
Sbjct  61    ---EDIFAGARNSGLDIRYATVSDGFPVGFDRSLNHDQFMEGILHVYSAHVDELVGSIVH  117

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
              +PP TCLIAD+FY WPS I++KYNLVNVSF+TEPALV ++  H+ LL+ +GHF   D R
Sbjct  118   SDPPATCLIADTFYVWPSKISNKYNLVNVSFWTEPALVLSLYYHMHLLRSHGHFASFDNR  177

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDYIPGV  I+P DL  YLQ  + TT  V+  +YK F+D K+AD +ICNTV+ELE  
Sbjct  178   EDAIDYIPGVPEIKPTDLTSYLQATDITT-VVHRIIYKAFDDVKRADFIICNTVEELESN  236

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISA+ +KQP+YAIGPLFP  FT+     ++  ESDC  WL ++P GSVLY SFGS AH 
Sbjct  237   TISAIHQKQPYYAIGPLFPTGFTKSPVPMNMWSESDCAHWLTARPNGSVLYLSFGSYAHT  296

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K +I+E+  GL+LS VNFIWV+RP +  +DE      GF++ ++DRGLIVPWC Q  VI
Sbjct  297   SKHNIVEIAHGLLLSGVNFIWVIRPDIVSSDEPQPLPVGFEDQIKDRGLIVPWCSQIEVI  356

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF+THCGWNSILES+WC+VP++CYPL+ DQ TNRKLVVD+WKIGINLC  D + 
Sbjct  357   SHPAIGGFVTHCGWNSILESVWCTVPLLCYPLLTDQFTNRKLVVDDWKIGINLC--DGRR  414

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +++EEV+ K+  +M  +++ +LRK IKDVRK LENA+   GSS +N  +FV++   K  +
Sbjct  415   MTREEVSEKISRVMFGKTADDLRKRIKDVRKTLENAVSPVGSSERNFSQFVKEAGDKIQE  474



>ref|XP_011094625.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=487

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/475 (57%), Positives = 349/475 (73%), Gaps = 4/475 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD-  2348
             ++ H I++P P+QGHINP++ L++ LASRGFTVTFVNTE     I K+R+  +    DD 
Sbjct  11    KRPHFIIIPPPFQGHINPSVQLTLKLASRGFTVTFVNTEFSHDQIKKSRKHLSNGEDDDD  70

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             IF  +R SGLDIRY T+SDGFPL FDR+     F+ G ++V  AHVD+LV KL   +PPP
Sbjct  71    IFAGSRESGLDIRYRTVSDGFPLSFDRSLHRDQFVEGRIHVSPAHVDDLVGKLMASDPPP  130

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
             TCL+ADSF  W S IA KY LVNVSF+T+PA+VF +  HLDLLK+NGH+G K  RKD++D
Sbjct  131   TCLVADSFSTWGSSIAWKYGLVNVSFWTQPAVVFMLYYHLDLLKKNGHYGSKVLRKDTVD  190

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             YIPGV +IEPRDL  +LQ E +T++ ++  + K F+DAK AD++I NT +ELEP  ISAL
Sbjct  191   YIPGVASIEPRDLTSFLQ-ETDTSTVMHRLIEKAFQDAKNADLIIINTAEELEPGPISAL  249

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
             +EK P YAIGP+FP  FT +    +L  ESDC +WLD KPPGSVLYASFGS AH  KE I
Sbjct  250   KEKHPTYAIGPIFPSHFTNRAVEMNLWSESDCTRWLDGKPPGSVLYASFGSFAHSNKEDI  309

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
               +  GL+LS V+FIWVLRP +  ++  DF  +GFQE V ++GL+VPWC Q  V++H AV
Sbjct  310   ETIANGLLLSGVSFIWVLRPDIVSSEVKDFLPNGFQENVGNKGLVVPWCKQNVVLAHSAV  369

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             GGF+THCGWNS LESIW  +P+IC+PL+ DQ TNRKLVVD+WKIGI+LC    K +S +E
Sbjct  370   GGFLTHCGWNSTLESIWVGLPLICFPLVGDQTTNRKLVVDDWKIGIDLCK--GKLVSSDE  427

Query  3429  VASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             VA ++K LM  E+S ELRK +  +RK LE+ALG NG+S  N DKFV+ +K +  +
Sbjct  428   VAERIKLLMCGETSNELRKNVTKLRKKLESALGRNGASQMNFDKFVDDVKDRIER  482



>ref|XP_011040925.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Populus euphratica]
Length=485

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 351/479 (73%), Gaps = 7/479 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             MVE  +K H I +P P QGH+ PA+HL+I LASRGFT+TF+NT+ I   I  A+  +   
Sbjct  1     MVETLKKPHVIFIPFPLQGHVIPAVHLAIKLASRGFTITFINTQAIHHQISNAQPSSEP-  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF + R SGLDIRYTT+SDG P+GFDR+ +   F   +++V SAHVDE+V ++   
Sbjct  60    ---DIFAKVRESGLDIRYTTVSDGLPIGFDRSLNHDQFTAALLHVLSAHVDEVVGQIVKS  116

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +    CLIAD+F+ WPS IA K+ L+ VSF+TEPALVF++  H+DLL  NGHF C+DCR+
Sbjct  117   DDSIRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLMRNGHFACQDCRE  176

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGV+AIEP+D+  YLQ E +TTS ++  ++K F DA+ AD ++CNTVQELE +T
Sbjct  177   DTIDYIPGVKAIEPKDMVSYLQ-ETDTTSTIHQLIFKAFNDARNADFLLCNTVQELEVET  235

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL+ K P YAIGP+FP  FTE +   SL  ESDC +WLD KP GSVLY SFGS AH+ 
Sbjct  236   LSALQAKMPCYAIGPIFPNGFTESSVATSLWSESDCTQWLDKKPHGSVLYVSFGSFAHVA  295

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+ +GL LS+V+F+WVLRP +  +D+ D    GF+E V DR +I+PWC Q AV++
Sbjct  296   KRDLVEIAKGLSLSKVSFVWVLRPDIVSSDDADPLPGGFEEEVADRAMIIPWCSQRAVLA  355

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNS+LESIWC VP++  PL  DQ TNRKLVVD+WKIGINL   D K +
Sbjct  356   HPAIGGFLTHCGWNSVLESIWCQVPLLSLPLQTDQFTNRKLVVDDWKIGINL--SDGKFV  413

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +KEEV+ KVK LM  +S    R  IK+++K LENAL  NGSS K++ +FV+ ++ K ++
Sbjct  414   TKEEVSYKVKRLMSGKSEDGFRNTIKEMKKTLENALSCNGSSEKSMARFVKDLRTKISE  472



>ref|XP_006428406.1| hypothetical protein CICLE_v10011571mg [Citrus clementina]
 ref|XP_006493026.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Citrus sinensis]
 gb|ESR41646.1| hypothetical protein CICLE_v10011571mg [Citrus clementina]
Length=492

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/478 (56%), Positives = 347/478 (73%), Gaps = 9/478 (2%)
 Frame = +3

Query  2160  VENNQKH---HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             +ENN K    HAI +  P QGH+ P ++L++ LAS GFT+TFVNT  I   I KA+   +
Sbjct  1     MENNHKKPKPHAIAICYPLQGHVIPFVNLALKLASSGFTITFVNTHSIHHQITKAQ---S  57

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DDIF  AR +GLDIRY T+SDG PL FDR+ +   FM  +++VFSAHVDELV  L 
Sbjct  58    NGDEDDIFAGARKAGLDIRYATVSDGLPLNFDRSLNHDQFMECLLHVFSAHVDELVGNLI  117

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
              L P   CL+ D+F+ W S+IA KYNLVN+SF+TEPALV  +  H+DLL+ +GHF   D 
Sbjct  118   QLNPEMNCLVTDTFFVWSSMIAKKYNLVNISFWTEPALVITLYYHMDLLRSHGHFASTDN  177

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D+IDYIPGV AIE +DL  YLQ   +T++ V+  + K FED K+ D ++CNTV ELE 
Sbjct  178   REDTIDYIPGVRAIERKDLMSYLQA-TDTSTVVHRIIQKAFEDVKRVDFILCNTVHELES  236

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL +KQP YAIGP+FP  FT+     SL  ES+C +WL++KP GSVLY SFGS AH
Sbjct  237   ETISALHQKQPTYAIGPIFPAGFTKSLVPTSLWSESECTQWLNTKPRGSVLYVSFGSYAH  296

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVR--DRGLIVPWCHQP  3224
              +K  I+E+  GL+LSEV+F+WVLRP +  +DE DF   GF+E ++   RGLIVPWC Q 
Sbjct  297   ASKNDIVEIALGLLLSEVSFVWVLRPDIVSSDETDFLPVGFEEKIKISGRGLIVPWCSQI  356

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              VISH A+GGF+THCGWNSI ESIWCSVP++C+PL+ DQ TNRKLVVD+WKIG+NLC+  
Sbjct  357   DVISHSAIGGFLTHCGWNSIQESIWCSVPLLCFPLLTDQFTNRKLVVDDWKIGLNLCDQK  416

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
               SI+KEEV+ K+  LM  +SS ELRK IK+VRK LENAL ++GSS KN ++F+  ++
Sbjct  417   KSSITKEEVSEKINSLMSGKSSAELRKNIKEVRKKLENALSADGSSQKNFNQFINDVQ  474



>ref|XP_009785232.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
 ref|XP_009785233.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
Length=487

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/481 (56%), Positives = 353/481 (73%), Gaps = 7/481 (1%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E N K HAI++P P QGHI P  HL+INLAS+G T+TFVNT+     ++KA+  + ++  
Sbjct  4     EENIKPHAIMIPAPLQGHIVPFTHLAINLASKGLTITFVNTQSTHQRLMKAQSVSGSSLD  63

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGL  2516
              DIFT+AR SGLDIRYTTI DGFPL FDR  +   FM G+++VFSAHVD+LV  L  +  
Sbjct  64    YDIFTEARKSGLDIRYTTICDGFPLNFDRARNHNQFMEGLLHVFSAHVDDLVGNLVDSNH  123

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP +CLIADSFY WPS IA KYNLVN+SF+TEPAL F    H+DLL+ NGHFG +D R+
Sbjct  124   NPPVSCLIADSFYVWPSEIAKKYNLVNISFWTEPALAFTSYYHMDLLRSNGHFGSQDNRE  183

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D I YIPGV+AIEPRDLP Y+Q +    S ++  ++K  EDAKKAD++ICNTVQELE  T
Sbjct  184   DMIHYIPGVQAIEPRDLPSYIQ-DPEPWSIMHRYIFKSLEDAKKADMIICNTVQELESST  242

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL+EK+PFYAIGP+FP  FT+  A  +L  ESDC +WL++KP GSV+Y SFGSLA+++
Sbjct  243   ISALQEKKPFYAIGPIFPNGFTKSVAPTNLWVESDCIEWLNTKPKGSVMYISFGSLANIS  302

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             ++ ++E+  GL+LS V+FIWV+RP +  + E D    GF++ V+DRGL+VPWC Q  VIS
Sbjct  303   RQDVLEIAHGLLLSSVSFIWVVRPDITWSKETDLLPSGFEDDVKDRGLVVPWCSQIDVIS  362

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+ GF+THCGWNS+LESIWC VPM+C+P+  DQ TNRKLVV EWK+G +LC+   + +
Sbjct  363   HPAIRGFLTHCGWNSVLESIWCKVPMLCFPIFTDQFTNRKLVVSEWKVGFDLCS--GRIL  420

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
              ++E+A K+       +  ELR  +++ RK LE+AL  NGSS +N  + V  +K+K  Q 
Sbjct  421   RRQEIAQKINCFTSEAN--ELRINLEETRKQLEDALSENGSSGRNYKQLVCDLKSKILQK  478

Query  3597  S  3599
             S
Sbjct  479   S  479



>ref|XP_011094626.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=502

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 351/480 (73%), Gaps = 8/480 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M    +K HAI++P PYQGHINP + L++ LA++GFT+TFVNT+ +   I +A++    +
Sbjct  1     MAGTPRKPHAIMIPYPYQGHINPFVSLAMKLAAQGFTITFVNTQSVHCRISRAQKWIDGS  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF  AR+SGLDIRY T+SDGFPLGFDR+ +   F+ G+++VFSAHVDELV  LA  
Sbjct  61    ---DIFAGARDSGLDIRYATVSDGFPLGFDRSLNHDQFVEGLIHVFSAHVDELVANLADS  117

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +PP TCLIAD+FY W S IA K+NLV+VSF+TEPALV ++  HLDLLKENGHFG ++ R+
Sbjct  118   DPPVTCLIADTFYVWASAIAEKHNLVSVSFWTEPALVLSLYYHLDLLKENGHFGSQEKRQ  177

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D IDYIPGV  I+P DL  YLQ +   T  V+  +Y+ FED KKADI+ICNTV+ELE  T
Sbjct  178   DIIDYIPGVGTIKPTDLTSYLQADEIWT-VVHRVIYRAFEDVKKADIIICNTVRELEYNT  236

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ++AL  KQP YAIGP+    FT QT   SL  E+DC  WL+ KP GSVLY SFGS AH T
Sbjct  237   LAALHRKQPTYAIGPIV-SDFTNQTVATSLWSETDCTPWLNEKPNGSVLYVSFGSHAHTT  295

Query  3057  -KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              KE I E+  GL LS VNF+WV+RP +  +++  F   GF+  ++ RGLIV WC Q  V+
Sbjct  296   SKEDIWEIAHGLALSGVNFVWVVRPDIVNSNDAKFLPVGFENSIKGRGLIVRWCSQMKVM  355

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF++HCGWNS+LESIWC VP+IC+PL  DQ TNRKLVV++WKIGINLC  D  S
Sbjct  356   SHPAIGGFMSHCGWNSVLESIWCKVPLICFPLFTDQFTNRKLVVNDWKIGINLC--DRPS  413

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             I++EEV  KVK+LM  ++S ELR  IK V   ++NAL S+GSS +N   F+E +KA+ N+
Sbjct  414   ITREEVKDKVKYLMSGQTSEELRNTIKKVSSTMKNALMSSGSSEENFHLFIENVKAQMNK  473



>ref|XP_004246642.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=476

 Score =   551 bits (1420),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 270/474 (57%), Positives = 350/474 (74%), Gaps = 11/474 (2%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT--DDIF  2354
             HA+V+P PYQGHINP IHL++ LAS+GF +TF+NT+ I S I KA   +++ P+  ++IF
Sbjct  8     HALVIPCPYQGHINPTIHLALKLASKGFIITFINTQFIHSQITKAHSPSSSEPSGLENIF  67

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE--PPP  2528
             ++   SGLDIRY TISDGFPL FDR  ++  F+ G++  FS +VD+LV  LA  +   P 
Sbjct  68    SKPCESGLDIRYLTISDGFPLEFDRNMNSLPFLEGLINGFSNYVDKLVGDLAKEDCVDPI  127

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
              CLIAD+F+ WPSIIA KY +V+VSFFTEPALVFA+  HLDLL+ENGH G  + RKD +D
Sbjct  128   NCLIADTFFVWPSIIAKKYEIVHVSFFTEPALVFALYYHLDLLEENGHSGSHENRKDIVD  187

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             YIPGV++I+  DLP   Q      S V+  +YK F+D +KADI+I NTVQELEP+TI+++
Sbjct  188   YIPGVKSIKSSDLPSLYQN-----SVVHQLIYKAFQDVRKADIIIANTVQELEPETITSI  242

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
             +EK  FYAIGP+   +FTE T   SL  E DC +WLD+KP GSVLY SFGS+A + KE I
Sbjct  243   QEKHKFYAIGPIVSANFTELTISSSLWSEHDCTQWLDAKPRGSVLYVSFGSVALVNKEDI  302

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
             +EL  GLMLSEVNFIWVLR  +   DE D    G++E V+DRGLIVPWC+QP VISH AV
Sbjct  303   LELAHGLMLSEVNFIWVLRFNVLGQDENDILPVGYKEKVKDRGLIVPWCNQPRVISHSAV  362

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             GGF++HCGWNS++ESIWC VP+IC PL+ DQ  NRKLVV +WK+GINL   D++SI++EE
Sbjct  363   GGFLSHCGWNSVVESIWCGVPLICSPLVTDQLANRKLVVYDWKVGINL--RDEESITREE  420

Query  3429  VASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             V SK+K+LM  E+S  LRK +  V++   N L +NGSS    +KFVE++K K +
Sbjct  421   VRSKIKYLMNEETSNNLRKNVAQVKETFHNTLATNGSSNVYFNKFVEELKIKIS  474



>ref|XP_010050978.1| PREDICTED: UDP-glycosyltransferase 86A1 [Eucalyptus grandis]
 gb|KCW89399.1| hypothetical protein EUGRSUZ_A01691 [Eucalyptus grandis]
Length=480

 Score =   550 bits (1418),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 263/478 (55%), Positives = 351/478 (73%), Gaps = 4/478 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARR-GTTT  2333
             M  ++QK HA+++  P QGH+ P++HL++ LAS GFT+TFVNT+ I   + K+       
Sbjct  1     MENSHQKLHALMIAYPLQGHVIPSVHLAMKLASMGFTITFVNTQSIHHQLTKSHHHNDGP  60

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                +DIF  AR SGLDIRY T+SDGFPLGFDR+     FM G+++V SAHVDE V KLA 
Sbjct  61    EAAEDIFAGARKSGLDIRYATVSDGFPLGFDRSLHHDQFMEGLLHVMSAHVDEFVGKLAA  120

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
              EPP  CLI D+FY W S+I  KY+LVN+SF+TEPALV  +  HLDLL+ NGHFG  D R
Sbjct  121   SEPPVNCLIVDTFYVWSSMICEKYHLVNISFWTEPALVLTVYYHLDLLRINGHFGAIDNR  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDY+PGV +I+ +DL  YLQ +N T + V+  + + FE+ KKAD++ICNTVQELEP 
Sbjct  181   EDAIDYVPGVRSIQRKDLASYLQADN-TGTVVHRIINEAFENVKKADVIICNTVQELEPD  239

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             T+ AL++KQP YAIGP+FP  F +     SL  ESDC +WL ++P GSVLY SFGS AH 
Sbjct  240   TLLALQKKQPVYAIGPVFPIGFAKSPVATSLWSESDCTEWLSARPSGSVLYISFGSYAHA  299

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K+ I E+  GL+LSEV+FIWVLRP +  +DE +    GF++ ++  GLIVPWC Q  V+
Sbjct  300   SKQDIWEIAFGLLLSEVSFIWVLRPDIVSSDESEPLPPGFRDQIKGIGLIVPWCCQIEVL  359

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SH ++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+W IGINL   D+KS
Sbjct  360   SHSSIGGFLTHCGWNSILESIWCCVPIMCFPLLTDQYTNRKLVVDDWGIGINL--RDEKS  417

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             +++EEV+ K++ LM    + ELRK +++VRK L++ALG NGSS KN++ F++ +K K 
Sbjct  418   VTREEVSRKIRRLMIGGLADELRKKVREVRKALDSALGPNGSSEKNLNDFIDDVKVKI  475



>gb|KDP29154.1| hypothetical protein JCGZ_16543 [Jatropha curcas]
Length=482

 Score =   550 bits (1418),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 271/485 (56%), Positives = 356/485 (73%), Gaps = 8/485 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +N +K HAI++P P QGHI P +HL+INLAS+GFT+TF+NTE     I KA       
Sbjct  1     MEDNQEKPHAILMPCPLQGHIIPFVHLAINLASKGFTITFINTEFTHYRITKATTSANNQ  60

Query  2337  PTDDIFTQARNS-GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-A  2510
                DIFT+AR   G DIRY  +SDGFPL FDR  +   F+ GM+Y+FSAHVD+LV KL  
Sbjct  61    EYYDIFTEARTQFGFDIRYRIVSDGFPLVFDRAVNREQFLKGMLYIFSAHVDDLVGKLEQ  120

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +P  TCL+AD+FY WPS++A KYNLVN+SF+TEPAL F++  H DLLK NGHFG  D 
Sbjct  121   NTKPKITCLLADTFYVWPSMVAKKYNLVNISFWTEPALDFSLYYHWDLLKINGHFGYYDN  180

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D+  YIPGVEAIEP+DLP YLQ    TT  +   +YKG+E+ K+AD +ICNT+QELEP
Sbjct  181   REDTRKYIPGVEAIEPKDLPSYLQDTQTTT--MNKMIYKGYENVKEADFIICNTIQELEP  238

Query  2871  QTISALEEKQPFYAIGPLFP-QSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
             + ISAL EKQPFY+IGP+F    FT  +   SL  ESDC +WL  KP GSVLY SFGS+A
Sbjct  239   KPISALNEKQPFYSIGPIFLLNGFTNISIPTSLWSESDCTQWLQPKPHGSVLYVSFGSVA  298

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMD-GFQECVRDRGLIVPWCHQP  3224
             H +K+ I+E+  GL+LS+V+FIWVLR  +  +D+ D  +  GF++ +RD+GLIVPWC Q 
Sbjct  299   HCSKKDIIEIAHGLLLSKVSFIWVLRNDIVSSDDDDDILPVGFEDEIRDKGLIVPWCCQI  358

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
             +VIS+P VGGF+THCGWNS+LESIW SVPM+CYP+  DQ TNRKLVVD+WK+G+N C  D
Sbjct  359   SVISNPTVGGFLTHCGWNSVLESIWYSVPMLCYPIFTDQITNRKLVVDDWKVGLNFC--D  416

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              K I ++EV+ K+  LM  +S+ +LR  IK V+K L++A+ + GSS +N +KF+  +KAK
Sbjct  417   KKEIRRDEVSEKINRLMSGKSATDLRNNIKQVKKTLQDAVSTIGSSERNFNKFIGDVKAK  476

Query  3585  FNQSS  3599
              ++++
Sbjct  477   ISEAA  481



>ref|XP_007016838.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY34457.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=497

 Score =   550 bits (1416),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 341/476 (72%), Gaps = 7/476 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +  QK HAI +P P QGH+ P++HL+I LAS+GFT+TF+NT  I     +A  G    
Sbjct  20    MADTAQKPHAIFIPYPLQGHVIPSVHLAIKLASKGFTITFINTHSIHHQTSEAEPGKGP-  78

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF   R SGLDIRYTT+SDG PLGFDR+ +   FM  +++VFSAHV+E+V ++   
Sbjct  79    ---DIFASVRESGLDIRYTTVSDGLPLGFDRSLNHDQFMAALLHVFSAHVEEVVSQIVKS  135

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
                  CLIAD+F+ WPS IA K+ L+ +S++TEPALVF +  HLDLL+ NGHFG +DCR+
Sbjct  136   GDRVHCLIADTFFVWPSKIAKKFGLLYISYWTEPALVFTLYYHLDLLRMNGHFGLQDCRE  195

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             DSIDYIPGV+AIEPRDL  YLQ E + T+  +  ++  FEDAK AD V+CNTVQELEP T
Sbjct  196   DSIDYIPGVQAIEPRDLMSYLQ-ETDVTTVCHQIIFNAFEDAKNADFVLCNTVQELEPVT  254

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL    PFYAIGP+FP  FT+     SL  ESDC +WLD +P GSVLY SFGS AH+ 
Sbjct  255   ISALRATVPFYAIGPIFPSGFTKSIVATSLWSESDCTQWLDKQPHGSVLYVSFGSYAHVR  314

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  +  +  GL+LS+VNF+WVLRP +  +D+ D    GF+E V DR +I+PWC Q AV++
Sbjct  315   KTDLTVIADGLLLSKVNFLWVLRPDIVSSDDADPLPVGFKEEVGDRAMIIPWCCQIAVLA  374

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPAVGGF+THCGWNSILES WC VP++ YPL+ DQ TNRKLVV +WK GINL N +   I
Sbjct  375   HPAVGGFLTHCGWNSILESAWCGVPLLSYPLLTDQFTNRKLVVHDWKAGINLSNKN--PI  432

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             ++EEV+  +  LM  +S  + R  +K+V++ LENAL  NGSS KN+D+F++ +KAK
Sbjct  433   TREEVSDNINRLMSGKSGDQYRSKVKEVKETLENALTPNGSSEKNMDQFIKALKAK  488



>gb|EYU38553.1| hypothetical protein MIMGU_mgv1a005283mg [Erythranthe guttata]
Length=490

 Score =   548 bits (1411),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 266/472 (56%), Positives = 341/472 (72%), Gaps = 3/472 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
              K HAI+ P P QGH+ P ++L++ LAS GF +TF+NTE I   I KA+ G      DDI
Sbjct  10    HKPHAILFPYPLQGHVIPFVNLAVKLASNGFKITFINTESIHHQITKAKDGPALG-QDDI  68

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F QAR SGL+I+Y T+SDGFPLGFDR+ +   F  G+++VF AHVDELV KL   +P   
Sbjct  69    FAQARKSGLEIQYATVSDGFPLGFDRSMNHDQFFEGILHVFPAHVDELVGKLVEADPTIN  128

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
              LI D+FY WPS IA KYNLVN+SFFTEPALVF +  HL+LL++NGHF  K+ R+D+IDY
Sbjct  129   ALIVDTFYVWPSFIAEKYNLVNISFFTEPALVFTLYYHLELLRKNGHFASKENRRDAIDY  188

Query  2712  IPGVEAIEPRDLPLYLQ-QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             IPGV++I P DL  YLQ  E+ +T+ V+  +YK F D KK+D +ICNT+QELE +TISAL
Sbjct  189   IPGVKSIMPTDLMSYLQANEDASTTTVHGIIYKAFVDVKKSDFIICNTIQELEEETISAL  248

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
               +QPFY+IGP+FP  F +     SL  ESDC +WL SKP GSVLY SFGS AH +K  +
Sbjct  249   NREQPFYSIGPIFPPGFAKSCISTSLWSESDCNQWLRSKPRGSVLYVSFGSYAHTSKHVL  308

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
              E+  GL+LS V+FIWVLRP +  +DE D    GF E V  RGLIV WC Q  VISHP+V
Sbjct  309   EEIANGLLLSGVHFIWVLRPDIVSSDETDILPVGFAERVAGRGLIVTWCCQVDVISHPSV  368

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             GGF+THCGWNSILES+WC VP+ICYPL+ DQ TNRKLVVD+ K+GINLC D+   +++E 
Sbjct  369   GGFMTHCGWNSILESVWCGVPLICYPLLTDQFTNRKLVVDDLKVGINLC-DEKLIVTREG  427

Query  3429  VASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             V  K+ +LM A+ S E+R+ ++ V+  L +A+ ++GSSV+N   FVE +K K
Sbjct  428   VLEKINYLMDAKKSEEIREQVEKVKTMLVDAMANDGSSVRNFTCFVEDLKGK  479



>ref|XP_006384937.1| hypothetical protein POPTR_0004s22400g [Populus trichocarpa]
 gb|ERP62734.1| hypothetical protein POPTR_0004s22400g [Populus trichocarpa]
Length=488

 Score =   547 bits (1410),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 346/479 (72%), Gaps = 7/479 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E ++K H I +P P QGH+ PA+HL+I LAS+GFT+TF+NT+ I      A+  +   
Sbjct  1     MAETHKKPHVIFIPFPLQGHVIPAVHLAIKLASQGFTITFINTQAIHHQTSNAQPSSEP-  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF + R SGLDIRYTT+SDG P+GFDR+ +   F   +++VFSAHVDE+V ++   
Sbjct  60    ---DIFAKVRESGLDIRYTTVSDGLPIGFDRSLNFDQFTAALLHVFSAHVDEVVGQIVKS  116

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +    CLIAD+F+ WPS IA K+ L+ VSF+TEPALVF++  H+DLL  NGHF C+DCR+
Sbjct  117   DDSIRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLMINGHFACQDCRE  176

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGV+AIEP+D+  YLQ E +TTS  +  ++K F DA+ AD ++CNTVQELE +T
Sbjct  177   DTIDYIPGVKAIEPKDMVSYLQ-ETDTTSISHQLIFKAFNDARNADFLLCNTVQELEVET  235

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL+ K P YAIGP+FP  FT+     SL  ESDC +WLD KP GSVLY SFGS AH+ 
Sbjct  236   LSALQAKMPCYAIGPIFPNGFTKSFVATSLWSESDCTQWLDKKPHGSVLYVSFGSFAHVA  295

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+ +GL LS+V+F+WVLRP +  +D+ D    GF+E V DR +I+PWC Q AV++
Sbjct  296   KRDLVEIAKGLSLSKVSFVWVLRPDIVSSDDADPLPGGFEEEVADRAMIIPWCSQRAVLA  355

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNS+LESIWC VP++  PL  DQ TNRKLVVD+WKIG NL   D K +
Sbjct  356   HPAIGGFLTHCGWNSVLESIWCQVPLLSLPLQTDQFTNRKLVVDDWKIGFNL--SDGKFV  413

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +KEEV+  VK LM  +S    R  IK+++K LENAL  NGSS  N+ +FV+ ++ K ++
Sbjct  414   TKEEVSYNVKRLMSGKSEDGFRNTIKEMKKTLENALSCNGSSEINMARFVKDLRTKISE  472



>ref|XP_004304452.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=490

 Score =   546 bits (1406),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 264/480 (55%), Positives = 347/480 (72%), Gaps = 4/480 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M  N+ K HA++   P QGH+ PA+HL+I LAS GFTVTFVNT  +   IIK++   T +
Sbjct  1     MENNHSKPHAVLFSYPLQGHVIPAVHLAIKLASNGFTVTFVNTRAVHHQIIKSQSLDTPS  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                +IF     S LDIRY TISDGFP+GFDR+ +   F  G+++ F AHVDELV +L   
Sbjct  61    EDVNIFDGVCKSSLDIRYVTISDGFPIGFDRSLNHDQFWEGVLHDFPAHVDELVAELVRS  120

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCR  2693
             +PP TCLIAD+F+ WP++IA+KYNLVNVSF+TEP LV  +  H+ LL+ENGHF    + R
Sbjct  121   DPPVTCLIADTFFVWPTMIAAKYNLVNVSFWTEPVLVLTLYYHIYLLRENGHFASPGNHR  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDYIPGV+AIEP+DL  YLQ   + TS V+  ++K FE+ K+AD ++CNT+QELE  
Sbjct  181   QDTIDYIPGVKAIEPKDLMSYLQA-TDVTSVVHRIIFKAFEEVKRADFILCNTIQELESG  239

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISA +EKQP YAIGP+FP  FT+ T   SL  E DC +WL++KP GS+LY SFGS AH 
Sbjct  240   TISAFQEKQPTYAIGPIFPNGFTKSTVATSLWSEFDCIEWLNTKPDGSILYVSFGSYAHA  299

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K  I E+  GL+LS+V FIWVLRP +  ++E      GF++ +++RGLIV WC Q  VI
Sbjct  300   SKRDIEEIANGLLLSKVGFIWVLRPDIVSSNETQILPVGFEDEIKNRGLIVSWCSQIEVI  359

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF+THCGWNSILES+W  +P++CYPL+ DQ TNRKLVVD+WK+GINLC  D KS
Sbjct  360   SHPAIGGFLTHCGWNSILESMWRGLPLLCYPLLTDQFTNRKLVVDDWKVGINLC--DRKS  417

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             I++EEV  KV  LM  +SS ELR+  + V+  LE+AL  +GSS  N  +F++ +KAK  +
Sbjct  418   ITEEEVKEKVNSLMSGKSSEELRRNARKVKNTLESALDKDGSSNGNFVRFIDDVKAKIQE  477



>ref|XP_003632262.1| PREDICTED: UDP-glycosyltransferase 86A1 [Vitis vinifera]
Length=474

 Score =   545 bits (1403),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 257/480 (54%), Positives = 351/480 (73%), Gaps = 8/480 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M   +Q  HAI++  P QGH+ PA+HL+INLASRGFT+TFVNT  I     +A+     A
Sbjct  1     MASTHQNPHAILVAYPLQGHVIPAVHLAINLASRGFTITFVNTLSIHQQTSRAQ----GA  56

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-AG  2513
              +DDIF+ +R +GLDIRYTT+SDG P+GFDR+ +   FM  +++V SAHV+ELV+++ A 
Sbjct  57    GSDDIFSGSREAGLDIRYTTVSDGLPVGFDRSLNHDQFMAALLHVLSAHVEELVERVVAE  116

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
               PP +CLIAD+F+ WPS +A K+ L+ VSF+TEPALVF +  H+DLL+++GHF C + R
Sbjct  117   AAPPVSCLIADTFFVWPSALAKKFGLLYVSFWTEPALVFTLYYHMDLLRKHGHFDCSETR  176

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             KD IDYIPGVEAI PRD+  YLQ   +T++  +  +   F+DAK AD V+CNTV+ELE  
Sbjct  177   KDVIDYIPGVEAIHPRDMTSYLQA-TDTSTVCHQIISTAFQDAKGADFVLCNTVEELELH  235

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISAL+ K+  YA+GP+FP  FT+     SL  ESDC  WLD+KP GSVLY SFGS AH+
Sbjct  236   TISALQAKKKLYAVGPIFPPGFTKSIVATSLWAESDCTHWLDAKPKGSVLYVSFGSYAHI  295

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K  +ME+  GLMLS++NF+WVLRP +  +D+ D   +  +E VR R +I+PWC Q AV+
Sbjct  296   SKRDLMEIANGLMLSKINFVWVLRPDIVSSDDPDLLPNELKEEVRGRSIIIPWCCQIAVL  355

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             +HPAVGGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+WK+GIN+   D +S
Sbjct  356   AHPAVGGFLTHCGWNSILESIWCKVPLLCFPLLTDQFTNRKLVVDDWKVGINI--SDGES  413

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             I++ EV+ K+  LM  +S  EL + +  V++ LENAL  +GSS KN+++F + +K +  +
Sbjct  414   IARGEVSEKINHLMGGKSGDELWERMDAVKQTLENALKPDGSSEKNMNRFKDDLKVRIQE  473



>ref|XP_002523692.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF38632.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=487

 Score =   545 bits (1403),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 259/481 (54%), Positives = 345/481 (72%), Gaps = 4/481 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +  +K HAI +P P QGH+ P++HL+I LAS+GFT+TF+NT  I     KA   T T 
Sbjct  1     MADKPKKPHAIFIPYPLQGHLIPSVHLAIKLASQGFTITFINTYSIHHQTSKAAL-TKTG  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                D+FT AR SGLDIRYTT+SDG P+GFDR+ +   FM  +++VFSAHV+E V ++   
Sbjct  60    AGPDMFTTARESGLDIRYTTVSDGLPIGFDRSLNHDQFMAALLHVFSAHVEEAVAEIVSS  119

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
                  CLIAD+F+ WPS IASK+ LV+VSF+TEPALVF +  H+DLL+ +GHF C+DCR+
Sbjct  120   GEDVHCLIADTFFVWPSKIASKFGLVHVSFWTEPALVFTLYYHMDLLRIHGHFACQDCRE  179

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGVE IEP+D   YLQ E +TTS  +  ++  F D K AD VICN+VQELE   
Sbjct  180   DTIDYIPGVEGIEPKDTTSYLQ-ETDTTSVCHQIIFNCFNDTKNADFVICNSVQELESDV  238

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SA+  K PFYAIGP+ P  F +     SL  ESDC +WLD KP GSVLY +FGS AH++
Sbjct  239   LSAIHAKIPFYAIGPILPNDFGKSILSTSLWSESDCIQWLDQKPNGSVLYVAFGSYAHVS  298

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+  GL LS+V+F+WVLRP +  +DE D   DGF+E V DR +I+PWC+Q +V++
Sbjct  299   KNDLIEIANGLALSKVSFVWVLRPDIVSSDETDLLPDGFKEEVLDRSIIIPWCNQHSVLT  358

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNSILESIWC VP++C+PL  DQ TNRKL VD+WK+GIN+ N   K I
Sbjct  359   HPAIGGFLTHCGWNSILESIWCEVPLLCFPLYTDQFTNRKLAVDDWKVGINMSN--MKLI  416

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             SKE+VA+ +  LM   S  ELR  IK+V+K LENA+   GSS +N+ +F++ ++ +  + 
Sbjct  417   SKEDVANNINRLMCGNSKDELRNKIKEVKKTLENAVSPGGSSEQNMAQFMKDLEDRIEKK  476

Query  3597  S  3599
             +
Sbjct  477   A  477



>ref|XP_010043797.1| PREDICTED: UDP-glycosyltransferase 86A2 [Eucalyptus grandis]
 gb|KCW85785.1| hypothetical protein EUGRSUZ_B02537 [Eucalyptus grandis]
Length=490

 Score =   543 bits (1400),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 352/485 (73%), Gaps = 9/485 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +N++K HAI++P P QGH+NP++HL+I LASRGF VTF+NT+ I    +KA       
Sbjct  1     MADNHRKPHAIIIPYPLQGHVNPSVHLAIKLASRGFAVTFINTQSIHHHTVKALDQKPDG  60

Query  2337  PTD-----DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVK  2501
               D     DIF   R SG DIRYTT+SDG P+GFDR+ +   FM  +++VFSAHV+E+V 
Sbjct  61    DGDGNGSYDIFANVRRSGHDIRYTTVSDGLPVGFDRSLNHDQFMASLLHVFSAHVEEIVG  120

Query  2502  KL-AGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
              + A        LIAD+F+ WPS +A K+ L+ VSF+TEPALVF +  H+DLL+ NGHF 
Sbjct  121   NIVATPGEGADFLIADTFFVWPSKVAEKFGLLYVSFWTEPALVFTLYYHMDLLRINGHFA  180

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
             C+DCR+D IDYIPGV  ++P+D+  YLQ E++T+S  +  ++ GF+D K AD ++CNTVQ
Sbjct  181   CQDCREDPIDYIPGVPPLQPKDMTSYLQ-ESDTSSTCHQIIFNGFQDVKAADFILCNTVQ  239

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFG  3038
             ELEP T++AL+E++PFY+IGP+FP+ FT      SL PESDC +WLD+KPPGSVLY SFG
Sbjct  240   ELEPGTVAALQEQKPFYSIGPVFPEGFTRSDVATSLWPESDCSQWLDTKPPGSVLYVSFG  299

Query  3039  SLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCH  3218
             S AHL++  + E+  GL+LS+V+F+WVLR  +  +++ D   DGF++ + DR +I+PWC 
Sbjct  300   SYAHLSRPDLEEIAHGLLLSKVDFVWVLRTDIVSSEDTDPLPDGFKQELGDRAIIIPWCS  359

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q AV+SHPA+GGF+THCGWNSILESIW  VPM+C+PL+ DQ TNRKLVV +WKIG+NL  
Sbjct  360   QNAVLSHPAIGGFLTHCGWNSILESIWSGVPMLCFPLLTDQFTNRKLVVSDWKIGLNLS-  418

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D    ++EEVA+K+  LM  +S  + + A++ ++  LE AL  +GSS K++D+F+  IK
Sbjct  419   -DRNKTTREEVANKISQLMSQDSGSKFKNAVEALKTKLEEALMPDGSSTKDLDQFIVDIK  477

Query  3579  AKFNQ  3593
              + +Q
Sbjct  478   DRIHQ  482



>ref|XP_010253969.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Nelumbo nucifera]
Length=492

 Score =   543 bits (1398),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 349/480 (73%), Gaps = 11/480 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             MV ++QK HAI++  P QGH+ PA+HL++NLAS+GFT+TF+NT+ I     KA+  +   
Sbjct  1     MVGSDQKPHAILIAFPLQGHVIPAVHLAMNLASKGFTITFINTQSIHHQTTKAQPDSG--  58

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKK--LA  2510
                DIF  AR SGLDIRY T+SDG P+GFDR+ +   FM  +++V SAH +EL++   ++
Sbjct  59    --GDIFAGARKSGLDIRYKTVSDGLPIGFDRSLNHDQFMYSLLHVSSAHAEELIRDIVMS  116

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
              L PP TCLIAD+F+ WPS+IA K  L  VSF+TEPALVF +  H++LL+ NGHF C   
Sbjct  117   DLPPPATCLIADTFFVWPSMIAKKLGLAYVSFWTEPALVFTLYYHMNLLRMNGHFDCNSK  176

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R D+I+YIPGV AIEP DL  YLQ E +T+S V+  ++K FED K AD V+CNT+QELEP
Sbjct  177   RDDTINYIPGVPAIEPTDLMSYLQ-ETDTSSVVHQVIFKAFEDVKNADFVVCNTIQELEP  235

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL+ ++PFYAIGP+F   FT+ T   SL  ESDC  WLD+KP GSVLY SFGS AH
Sbjct  236   ETISALQVEKPFYAIGPIFVSGFTKSTVATSLWSESDCAHWLDTKPHGSVLYVSFGSYAH  295

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVR--DRGLIVPWCHQP  3224
             + ++ I E+  GL+LS+VNF+WVLRP +  +D  D   DGF E +   +RG +V WC+Q 
Sbjct  296   VGRQDIEEIAYGLLLSKVNFVWVLRPDIISSDVTDPLPDGFGEQMEMGNRGKVVQWCNQI  355

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
             AV+ HPAVGGF+THCGWNSILESIWC VPM+C+PL+ DQ TNRKLVVD+W+IG+N+   D
Sbjct  356   AVLKHPAVGGFLTHCGWNSILESIWCQVPMLCFPLLTDQFTNRKLVVDDWRIGMNI--KD  413

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
               SI ++EV+ K+  L+  +   E    IK+VRK +ENAL  +GSS KN+D+F+E + A+
Sbjct  414   KMSIGRKEVSQKIDALVNGKLGDECMNKIKEVRKAMENALMPDGSSQKNLDQFIEDLTAR  473



>gb|EYU34479.1| hypothetical protein MIMGU_mgv1a005298mg [Erythranthe guttata]
Length=490

 Score =   542 bits (1397),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 344/479 (72%), Gaps = 6/479 (1%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
             N   HH I++P P+QGHINP+I L++ LAS+GFT+TFVNT      I K+R   +    D
Sbjct  9     NPNHHHVIIIPPPFQGHINPSIQLALKLASKGFTITFVNTHSTHDQITKSRPKIS----D  64

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF  AR+SG DIRY TISDGFPL FDR+ +   FM G M+V+ AHVDELV +LAG +P 
Sbjct  65    DIFGPARDSGRDIRYITISDGFPLSFDRSLNREQFMEGRMHVYPAHVDELVGQLAGSDPR  124

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
             P CL++D+   W   IA+KY LV VSF+T+PALVF++ SH  LLK NGH+G  D RKD+I
Sbjct  125   PDCLVSDTISTWGYGIAAKYGLVYVSFWTQPALVFSMYSHTHLLKINGHYGSIDNRKDTI  184

Query  2706  DYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
             DYIPGVEAIEP+DL  +L  E +T+ A++  + K F +AKKAD +I N ++ELEP+ IS 
Sbjct  185   DYIPGVEAIEPKDLSSFLH-ETDTSKAIHRVIPKAFAEAKKADFIIFNAMEELEPEPIST  243

Query  2886  LEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
             L++  P Y +GPLFP  F   +   +L  ESDC KWL++KP GSVLYASFGS AH +K  
Sbjct  244   LKKTLPVYPVGPLFPHHFANPSIQMNLWSESDCSKWLETKPSGSVLYASFGSYAHSSKRD  303

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPA  3245
             I  + +GLMLS V FIWVLRP +  ++  D   DGFQE V DRG++V WC Q +V+S+  
Sbjct  304   IETIAKGLMLSGVYFIWVLRPDVVSSEVKDVLPDGFQENVGDRGIVVNWCKQNSVLSNCG  363

Query  3246  VGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKE  3425
             VGGF+THCGWNSILES+W   PM+C+PL+ DQ +NRKLVVD+W++GINLC ++ + +S +
Sbjct  364   VGGFLTHCGWNSILESLWAGKPMVCFPLLGDQTSNRKLVVDDWRVGINLC-EEGRLVSCD  422

Query  3426  EVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSSV  3602
             +VA +VKFLM  ESS ELRK ++ +RK +ENAL  NGSS  N DKFVE +K +   + V
Sbjct  423   DVAERVKFLMSGESSFELRKNVELIRKKMENALSENGSSEVNFDKFVEDMKVRIEDTKV  481



>ref|XP_002314296.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE88251.1| glycosyltransferase family protein [Populus trichocarpa]
Length=486

 Score =   542 bits (1396),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 257/476 (54%), Positives = 345/476 (72%), Gaps = 7/476 (1%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             + ++K HAI++P P QGH+ P++HL+I LAS+GFT+TF+NT      I KA+  +     
Sbjct  4     QTSKKPHAILVPYPLQGHVIPSVHLAIKLASQGFTITFINTHAFHHQISKAQPNSEP---  60

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
              DIFT+ R SGLDIRY TISDG P+GFDR+ +   +M  +++VFSAHVDE+V ++   + 
Sbjct  61    -DIFTKVRESGLDIRYATISDGLPVGFDRSLNHDQYMAALLHVFSAHVDEVVGQIVKSDD  119

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
                CLIAD+F+ WPS IA K+ L+ VSF+TEPALVF++  H+DLL+ NGHFGC+DCR+D 
Sbjct  120   SVRCLIADTFFVWPSKIAKKFGLLYVSFWTEPALVFSLYYHMDLLRINGHFGCQDCREDI  179

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV+AIEP+D+  YLQ E  TTS  +  ++  F D + AD V+CN+VQELE +T+S
Sbjct  180   IDYIPGVKAIEPKDMTSYLQ-EAETTSVCHQIIFNAFNDTRSADFVVCNSVQELEVETLS  238

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL+ + P+YAIGPLFP  FT+     SL  ESDC +WLD KP GSVLY SFGS AH+TK+
Sbjct  239   ALQAEMPYYAIGPLFPNGFTKSFVATSLWSESDCTQWLDEKPRGSVLYVSFGSYAHVTKK  298

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              + ++  GL LS+V+F+WVLR  +  +D+     DGF+E V DR +I+PWC Q  V+ H 
Sbjct  299   DLAQIANGLSLSKVSFVWVLRADIVSSDDAHPLPDGFEEEVADRAMIIPWCCQREVLPHH  358

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             A+GGF+THCGWNSILESIWC VP++C PL+ DQ TNRKLVVD+WK+GINL   D K ++K
Sbjct  359   AIGGFLTHCGWNSILESIWCQVPLLCLPLLTDQFTNRKLVVDDWKVGINL--SDRKFVTK  416

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             EEV+S +  L   +   ELR  IK+V+K LENAL   GSS KN+ +F++ +K K +
Sbjct  417   EEVSSNINSLFSGKLGDELRTKIKEVKKTLENALSPGGSSEKNMAQFIKDLKNKIS  472



>ref|XP_010107482.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16164.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=489

 Score =   541 bits (1394),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 263/479 (55%), Positives = 339/479 (71%), Gaps = 6/479 (1%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD---  2345
             K HAI++P  +QGHI P ++L+I LAS GFT+TFVNTE+I   I K++   TT   +   
Sbjct  8     KPHAIMIPFYFQGHITPFVNLAIKLASEGFTLTFVNTEIIHHQITKSKDSNTTELEENDH  67

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF  AR SGLDIRY T+SDGFPL F+R  +   F  G ++VF AHVDELV  L   +P 
Sbjct  68    DIFAGARKSGLDIRYKTVSDGFPLSFNRLLNIDQFCEGGLHVFPAHVDELVGNLVREDPS  127

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
              +CLIAD+F++W S IA KY L+NVSF+TEPALVF ++ H DLL +NGHF   D R+D+I
Sbjct  128   VSCLIADTFFSWTSWIAKKYKLINVSFWTEPALVFTLNYHWDLLVKNGHFASNDNREDTI  187

Query  2706  DYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
             DYIPGV+AIEP+DL  +LQ   NT +  + ++YK FEDAK AD ++CNTVQELE  TI A
Sbjct  188   DYIPGVKAIEPKDLTSFLQS-TNTNTIQHRSIYKSFEDAKNADFILCNTVQELESDTILA  246

Query  2886  LEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
             ++EKQP YAIGP+FP  FTE     SL    DC +WLD+KP GSVLY SFGS        
Sbjct  247   IQEKQPMYAIGPVFPSEFTESIVPTSLKAGFDCSQWLDTKPRGSVLYISFGSFVVSETSD  306

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPA  3245
             I E+  G++LS VNFIWVLR   A  +E      G ++ ++DRGLIVPWC Q  VIS+PA
Sbjct  307   IEEIAHGIVLSGVNFIWVLRRDAASYEESYILPIGIEDEIKDRGLIVPWCSQVEVISNPA  366

Query  3246  VGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKE  3425
             +GGF+THCGWNSILES+WC VP++CYPL  DQPTN+KLVVD+W++GINLC  D K + + 
Sbjct  367   IGGFLTHCGWNSILESVWCGVPLLCYPLYADQPTNKKLVVDDWRVGINLC--DRKPLGRS  424

Query  3426  EVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSSV  3602
             EVA K+  LM  +S+ ELR+   ++R  LENAL ++GSS KN+ +F+  +KAK +   +
Sbjct  425   EVAQKINRLMSGKSAEELREETMNLRTTLENALATDGSSEKNLSQFITDVKAKIDNRKI  483



>ref|XP_006354352.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=473

 Score =   540 bits (1390),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 265/473 (56%), Positives = 345/473 (73%), Gaps = 10/473 (2%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAP-TDDIFT  2357
             HA+V+P PYQGHINPAIHLS+ LAS+GF +TF+NT+ I S I KA   +++ P  ++IF+
Sbjct  8     HALVIPCPYQGHINPAIHLSLKLASKGFIITFINTQFIHSQITKAHSPSSSEPGLENIFS  67

Query  2358  QARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE--PPPT  2531
             +A  SGLDIRY TISDGFPL FDR  ++  F+ G++  FS HVD+LV +L   +   P  
Sbjct  68    KACESGLDIRYLTISDGFPLEFDRNMNSLPFLEGLINGFSNHVDKLVGELVKEDCIDPIN  127

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
             CLIAD+F  WPSIIA KY +V+VSFFTEPALVFA+  H DLL+ENGH G  + R+D +DY
Sbjct  128   CLIADTFLVWPSIIAKKYEIVHVSFFTEPALVFALYYHFDLLEENGHSGSHENRQDIVDY  187

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPGV++I+  DLP   Q      S V+  + K F+D +KADI+I NTVQELE +TI++++
Sbjct  188   IPGVKSIKSSDLPSLFQN-----SVVHQLINKAFQDVRKADIIIANTVQELELETITSIQ  242

Query  2892  EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
             E   FYAIGP+   +FT+ T   SL  E DC +WLD+KP GSVLY SFGS+A + KE I+
Sbjct  243   ENHKFYAIGPIVSANFTKLTISSSLWFEHDCTQWLDAKPSGSVLYVSFGSVALVNKEDIL  302

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             EL  GLMLSEVNFIWVLR  +   DE D    G++E V+DRGLIVPWC+Q  VISH AVG
Sbjct  303   ELAHGLMLSEVNFIWVLRFNVLGQDENDILPVGYKEKVKDRGLIVPWCNQTRVISHSAVG  362

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF++HCGWNS++ESIWC VP+IC PL+ DQ  NRKLVV +WK+GINL   D +SI++EEV
Sbjct  363   GFLSHCGWNSVVESIWCGVPLICSPLVTDQLANRKLVVYDWKVGINL--RDKESITREEV  420

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             + K+K+LM  E+S  LRK +  V++   + L +NGSS  N +KFVE++K K +
Sbjct  421   SDKIKYLMNEETSSNLRKNVAQVKETFHDTLATNGSSNVNFNKFVEELKMKIS  473



>ref|XP_007205117.1| hypothetical protein PRUPE_ppa004829mg [Prunus persica]
 gb|EMJ06316.1| hypothetical protein PRUPE_ppa004829mg [Prunus persica]
Length=490

 Score =   539 bits (1389),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 263/487 (54%), Positives = 348/487 (71%), Gaps = 13/487 (3%)
 Frame = +3

Query  2157  MVENNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT  2333
             M  N  KH HA++ P P QGH+ PA+HL+I LAS+G TVTFVNT+ +   I+K+      
Sbjct  1     MENNTSKHPHAVIFPYPLQGHVIPAVHLAIKLASKGITVTFVNTQAVHHQIVKSH----A  56

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                D+IF   R SGLDI Y TI+DGFP+ FDR+ +   F   +++ F AHVDEL+ KL  
Sbjct  57    MEDDNIFNGVRQSGLDIHYVTINDGFPVDFDRSLNHDQFWESVLHDFPAHVDELLAKLVL  116

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH---FGCK  2684
               PP  CLI+D+F+ WP+IIA KYNLV VSF+TEPAL+F +  H+DLL +NGH       
Sbjct  117   SNPPVNCLISDTFFVWPTIIAKKYNLVTVSFWTEPALIFNLYYHVDLLNKNGHGHFTSHA  176

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             + R+D+IDYIPGV AIEP+DL  YLQ  ++ TS V+  + K FE  K AD ++CNTVQEL
Sbjct  177   NPRQDTIDYIPGVRAIEPKDLSSYLQ-PSDYTSPVHRIIVKAFEKIKTADFILCNTVQEL  235

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             E +T+SAL+EKQ  Y+IGP+FP  FT+     SL  ESDC +WL ++  GSVLY SFGS 
Sbjct  236   ESETVSALQEKQQIYSIGPIFPTGFTKSRVATSLWSESDCIQWLSTRSRGSVLYVSFGSY  295

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRD--RGLIVPWCH  3218
             AH +K  I E+  GL+LS+V FIWVLRP +  +DE +    GF++ ++D  +GLIVPWC 
Sbjct  296   AHASKREIEEIANGLLLSKVGFIWVLRPDIVSSDEPEILPFGFEDEIKDQEQGLIVPWCS  355

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q  VISHPA+GGFITHCGWNSILESIWC++P++C+PL+ DQ TNRKLVVD+W++G+NLC 
Sbjct  356   QIEVISHPAIGGFITHCGWNSILESIWCNLPLLCFPLLTDQFTNRKLVVDDWRVGLNLC-  414

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D K I+KEEVA K+  LM  +S+ ELR+ +K+VRK LE AL   GSS +N+D+F++ +K
Sbjct  415   -DQKPITKEEVAEKISHLMSGKSADELRRNVKEVRKALEGALAIGGSSHRNLDQFIDGVK  473

Query  3579  AKFNQSS  3599
             AK  + +
Sbjct  474   AKVQEKT  480



>ref|XP_008226277.1| PREDICTED: UDP-glycosyltransferase 86A2 [Prunus mume]
Length=480

 Score =   538 bits (1387),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 252/478 (53%), Positives = 348/478 (73%), Gaps = 11/478 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
              + ++ HAI +  P QGH+ P++HL+I LASRGF +TF+NT  I     KA+  + + P 
Sbjct  9     HHQKRPHAIFIAYPLQGHVIPSVHLAIKLASRGFKITFINTHSIHHQTSKAQPDSGSDP-  67

Query  2343  DDIFTQAR-NSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
                F   R +SGLDI Y T+SDG PL FDR+ +   FM  +++VFSAH +E+V ++    
Sbjct  68    ---FAYVRESSGLDIDYATVSDGLPLEFDRSLNHDQFMASLLHVFSAHAEEVVGRVVKFS  124

Query  2520  P---PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
                 P TC+IAD+F+ WPS IA K+ L+ VSF+TEPALVF +  HLDLL++NGHF C+D 
Sbjct  125   ADTTPVTCIIADTFFVWPSKIAKKFGLLYVSFWTEPALVFTLYYHLDLLRKNGHFACQDV  184

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D+IDY+PGV AIEP+D+  +LQ E +TTS  +  ++  F+DA+ A   +CNTVQE+E 
Sbjct  185   REDTIDYVPGVRAIEPKDMTSFLQ-ETDTTSVCHHIIFNAFKDARGAHFHLCNTVQEIEA  243

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL+ K PFYAIGP+FP  F +     SL  ESDC +WL+++P GSVLY SFGS AH
Sbjct  244   ETISALQSKTPFYAIGPIFPSKFNKNIVATSLWSESDCTQWLNTRPQGSVLYVSFGSYAH  303

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             ++K+ ++E+  GL+LS+VNF+WVLRP +  +++ +    GF+E V+DR +++PWC Q AV
Sbjct  304   VSKKDLIEIANGLLLSKVNFVWVLRPDIVSSNDTEPLPAGFREQVKDRAIVIPWCSQKAV  363

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             ++HPA+GGF+THCGWNS LESIWCSVPM+C+PL+ DQ TNRKLVVD+WKIGINLC  D +
Sbjct  364   LAHPAIGGFLTHCGWNSTLESIWCSVPMLCFPLLTDQFTNRKLVVDDWKIGINLC--DRR  421

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             ++SKEEV+ K+  LM  +S  E RKA+  V+K LE+A   NGSS KN+D F++ +KAK
Sbjct  422   AVSKEEVSEKINRLMDGKSRDEYRKAVVKVKKTLEDASTPNGSSEKNMDNFIKALKAK  479



>ref|XP_007206260.1| hypothetical protein PRUPE_ppa015843mg [Prunus persica]
 gb|EMJ07459.1| hypothetical protein PRUPE_ppa015843mg [Prunus persica]
Length=480

 Score =   538 bits (1386),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/479 (53%), Positives = 348/479 (73%), Gaps = 11/479 (2%)
 Frame = +3

Query  2160  VENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAP  2339
               + ++ HAI +  P QGH+ P++HL+I LASRGF +TF+NT  I     KA+  + + P
Sbjct  8     THHQKRPHAIFIAYPLQGHVIPSVHLAIKLASRGFKITFINTHSIHHQTSKAQPDSGSDP  67

Query  2340  TDDIFTQAR-NSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                 F   R +SGLDI YTT+SDG PL FDR+ +   FM  +++VFSAH +E+V K+   
Sbjct  68    ----FAYVRESSGLDIDYTTVSDGLPLEFDRSLNHDQFMASLLHVFSAHAEEVVGKVVKS  123

Query  2517  EP---PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKD  2687
                  P TC+IAD+F+ WPS IA K+ L+ VSF+TEPALVF +  HLDLL++NGHF C+D
Sbjct  124   SADITPVTCMIADTFFVWPSKIAKKFGLLYVSFWTEPALVFTLYYHLDLLRKNGHFACQD  183

Query  2688  CRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELE  2867
              R+D+IDY+PGV AIEP+D+  +LQ E +TTS  +  ++  F+DA+ A   +CNTVQE+E
Sbjct  184   VREDTIDYVPGVRAIEPKDMTSFLQ-ETDTTSVCHHIIFNAFKDARGAHFHLCNTVQEIE  242

Query  2868  PQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
              +TISAL+ K PFYAIGP+FP  F +     SL  ESDC +WL+++P  SVLY SFGS A
Sbjct  243   AETISALQSKTPFYAIGPIFPSKFNKNIVATSLWSESDCTQWLNTRPQDSVLYVSFGSYA  302

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
             H++K+ ++E+  GL+LS+VNF+WVLRP +  +++ +    GF+E V+DR +++PWC Q A
Sbjct  303   HVSKKDLIEIANGLLLSKVNFVWVLRPDIVSSNDTEPLPTGFREQVKDRAIVIPWCSQKA  362

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V++HPA+GGF+THCGWNS LESIWCSVPM+C+PL+ DQ TNRKLVVD+WKIGINLC  D 
Sbjct  363   VLAHPAIGGFLTHCGWNSTLESIWCSVPMLCFPLLTDQFTNRKLVVDDWKIGINLC--DR  420

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +++SKEEV+ K+  LM  +S  E RKA+  V+K LE+A   NGSS KN+D F++ +KAK
Sbjct  421   RAVSKEEVSEKINRLMDGKSRDEYRKAVVKVKKTLEDASTPNGSSEKNMDNFIKALKAK  479



>ref|XP_007151658.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
 gb|ESW23652.1| hypothetical protein PHAVU_004G065300g [Phaseolus vulgaris]
Length=575

 Score =   418 bits (1074),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 242/307 (79%), Gaps = 7/307 (2%)
 Frame = +3

Query  1107  WKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDVS  1286
             W PVDLGP++L+EI S L+ CKKI+WIGPVKF +S+    GASKL  ++D L Q NC+++
Sbjct  269   WVPVDLGPASLDEIGSTLTNCKKIVWIGPVKFVNSSEYTNGASKLTRILDKLGQNNCEIT  328

Query  1287  IVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYND  1466
             +VG MA        SS +  N+I+NASVVWEFLKGR LPG++A+DR YP E++W  IY+D
Sbjct  329   VVGAMASKLVRQEKSSLSFINIIENASVVWEFLKGRKLPGVMAVDRGYPSEINWNSIYSD  388

Query  1467  PDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATN  1643
             P + LVVDIGSGNGLFL  MARR+ D NFLGLEIN KLV RCLD ++Q  +KN +FVATN
Sbjct  389   PAQSLVVDIGSGNGLFLLEMARRRQDLNFLGLEINEKLVLRCLDSINQYDIKNGYFVATN  448

Query  1644  ATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQS  1823
             ATSTFRSI+S+YPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EAI DLLA  GK++LQS
Sbjct  449   ATSTFRSIVSTYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAIVDLLAPNGKIYLQS  508

Query  1824  DIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPMY  2003
             D+E V IRMKE+F +YGKGKL++E        Q  WL+ENPFG+RS+WE+HVL+R  PMY
Sbjct  509   DVEAVTIRMKEQFLRYGKGKLDLE------YGQSEWLEENPFGVRSNWEKHVLERQAPMY  562

Query  2004  RLCLSKS  2024
             R+  SKS
Sbjct  563   RMMFSKS  569


 Score =   225 bits (573),  Expect(2) = 3e-174, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 164/245 (67%), Gaps = 6/245 (2%)
 Frame = +1

Query  409   MVRFDSTILP---VDKKKLDPHSA-STVKYLCEARAKVILVGSWSSTINSKPLALEAVAE  576
             MVRFDS IL     DKK     +A  T+KYL +A AK+ILV  W+  +N+     ++V +
Sbjct  1     MVRFDSNILVKKVCDKKNQSVSNAVYTIKYLHKAGAKIILVSDWN--MNTPEHHTDSVTD  58

Query  577   YLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVD  756
             +LS VLQ++++P      +  A +    + +I LL N+S  K++V+NC +FA+ LS GVD
Sbjct  59    FLSEVLQIQIVPLHTIYFKKQAKMNSLEKENIHLLGNLSNFKEEVANCLEFARILSSGVD  118

Query  757   IFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNL  936
             IFVNDSFS  HK+LASTVG+  FC ACIAGFHF+  L+ L+ +    +KPYVAIIGGGNL
Sbjct  119   IFVNDSFSNCHKVLASTVGVTRFCYACIAGFHFEERLNLLKNLAEASRKPYVAIIGGGNL  178

Query  937   IDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNL  1116
              DKAA+  FLAS C   VFVG M+FQ+MHA G+ +P  LV+RKA+ +A  IV  A+  N+
Sbjct  179   YDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSIPCDLVDRKAINEALDIVRLAQDRNV  238

Query  1117  LILDP  1131
              IL P
Sbjct  239   QILYP  243



>ref|XP_007206586.1| hypothetical protein PRUPE_ppa020358mg [Prunus persica]
 gb|EMJ07785.1| hypothetical protein PRUPE_ppa020358mg [Prunus persica]
Length=481

 Score =   536 bits (1382),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 257/480 (54%), Positives = 347/480 (72%), Gaps = 6/480 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M + + K HAI++P+P QGH+ P  HL++ LAS GFT+TFVNT++I   I K+    +  
Sbjct  1     MEDKHSKPHAIMVPLPRQGHVIPFTHLALKLASNGFTITFVNTQIIHHQITKSESNGSEG  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               +DIF  AR SGLDIRY T+SDGFPL F+R+ +   ++ G+++VF AHVDELV  L   
Sbjct  61    -QEDIFAAARKSGLDIRYRTVSDGFPLAFNRSQNLDQYLEGLLHVFPAHVDELVGNLVQS  119

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +P  TCLIAD+F+ WP+ IA+KYNLV++SF+TE A V  I  H+DLL++NGHFG  D R+
Sbjct  120   DPSITCLIADTFHTWPATIANKYNLVHISFWTETAFVLCIYYHMDLLRKNGHFGSHDNRE  179

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGV+AIEP+DL  +L Q  NT++A +  +YK F+    A+ ++CNTVQELE Q+
Sbjct  180   DTIDYIPGVQAIEPKDLVSHL-QATNTSTAAHRILYKAFQQVINANFILCNTVQELESQS  238

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRS-LLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             + AL+EKQP YAIGP+FP   T+     + L+ E DC +WL++KPPGSVLY SFGS A +
Sbjct  239   LLALQEKQPAYAIGPVFPSKATKSVVVATNLISEFDCTEWLNAKPPGSVLYISFGSYAQV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSM--DGFQECVRDRGLIVPWCHQPA  3227
             TK  + E+  GL+LS V+FIWVLRP      E++ S+   GF++ ++DRGLIVPWC Q  
Sbjct  299   TKNVVEEIAHGLLLSRVSFIWVLRPDTISHGELETSILPVGFEDEIKDRGLIVPWCSQIE  358

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+S+PA+GGF+THCGWNSILES+WC VPM+CYP++ DQ TNRKLVVD+W IG+NLC D  
Sbjct  359   VLSNPAIGGFLTHCGWNSILESMWCGVPMLCYPILTDQTTNRKLVVDDWGIGLNLC-DRI  417

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             K I++ EVA K+  LM       L+K IK +R+ LE+ L  NGSS KN+ +F+  +KAK 
Sbjct  418   KPITRMEVAEKINRLMSGRLGDGLQKEIKKMRQKLEDGLAVNGSSQKNLCQFISDVKAKI  477



>emb|CDP07057.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   534 bits (1375),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 341/481 (71%), Gaps = 5/481 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M  + Q+ HAI++  P QGH+ P++HL+I LASRGFT+TF+NT+ I + I    +  T  
Sbjct  1     MAISPQRPHAILVSYPLQGHVIPSVHLAIKLASRGFTITFLNTQSIHNNITSGDK--TIN  58

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF + R SGLDIRYTT+ DG PLGFDR+ +   FM  +++VFSAHV+E V+K+   
Sbjct  59    GQGDIFAEVRKSGLDIRYTTVPDGLPLGFDRSLNHDQFMAALLHVFSAHVEEEVQKIVKS  118

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP + LIAD+F+ WP ++A KY LV +S +TE ALVF++  HLDLL+ NGHFGC D R+
Sbjct  119   GPPVSYLIADTFFVWPGMLAKKYGLVYISLWTEAALVFSLYYHLDLLRLNGHFGCIDMRE  178

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D IDYIPGV+ +EP D+P YLQ E   +S  +  +YK F+DA+ AD V+CNTV+ELEP+T
Sbjct  179   DPIDYIPGVKPLEPLDMPSYLQ-EMYPSSVCHKIIYKAFKDAQDADFVLCNTVEELEPET  237

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL+EK P + +GPLFP  FT+     SL  ESDC  WLD+KPPGSVLY SFGS AH+ 
Sbjct  238   ISALQEKLPIFPVGPLFPSGFTKSCVATSLWSESDCSHWLDTKPPGSVLYVSFGSYAHVQ  297

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+  G+  S ++F+WVLRP +  +++ +   DGF+    DRG+++PWC Q  V+ 
Sbjct  298   KRDLLEIANGIQESNISFVWVLRPDIVSSEDRNPLPDGFRAATSDRGMVIPWCCQINVLR  357

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNSILESIWC VP++C+PL  DQ TNRKLVVD+WKIG NL   D  S+
Sbjct  358   HPAIGGFLTHCGWNSILESIWCEVPLLCFPLYTDQFTNRKLVVDDWKIGANLY--DRVSV  415

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             ++ EV+ K+  LM  +S  E R AIK V+K LE AL  +GSS KN+D+F+  +K    + 
Sbjct  416   TQVEVSQKINRLMSKKSGDEFRNAIKVVKKTLEKALKEDGSSEKNMDRFIRDLKITLEKK  475

Query  3597  S  3599
             +
Sbjct  476   N  476



>ref|XP_008243982.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=479

 Score =   533 bits (1374),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 346/480 (72%), Gaps = 6/480 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M + + K HAI++P+P QGH+ P  HL++ LAS GFT+TFVNT++I   I K+    +  
Sbjct  1     MEDKHSKPHAIMVPLPRQGHVIPFTHLALKLASNGFTITFVNTQIIHHQITKSESNGSEG  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               +DIF  AR SGLDIRY T+SDGFPL F+R+ +   ++ G+++VF AHVDELV KL   
Sbjct  61    -QEDIFAAARKSGLDIRYRTVSDGFPLAFNRSQNLDQYLEGLLHVFPAHVDELVGKLVQS  119

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +P  +CLIAD+F+ WP+ IA+KYNLV +SF+TE A V  I  H+DLL++NGHFG  D R+
Sbjct  120   DPSISCLIADTFHTWPATIANKYNLVYISFWTETAFVLCIYYHMDLLRKNGHFGSHDNRE  179

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGV+AIEP+DL  +L Q  NT++A +  +YK F+    A+ ++CNTVQELE Q+
Sbjct  180   DTIDYIPGVQAIEPKDLVSHL-QATNTSTAAHRILYKAFQQVTNANFILCNTVQELESQS  238

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRS-LLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             + AL+EKQP YAIGP+FP   T+     + L+ E DC +WL++KPPGSVLY SFGS A +
Sbjct  239   LLALQEKQPTYAIGPVFPSKATKSVVVATNLISEFDCTEWLNAKPPGSVLYISFGSYAQV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSM--DGFQECVRDRGLIVPWCHQPA  3227
             TK  + E+  GL+LS V+FIWVLRP      E++ S+   GF++ ++DRG+IVPWC Q  
Sbjct  299   TKNVVEEIAHGLLLSRVSFIWVLRPDTISHGELETSILPVGFEDEIKDRGMIVPWCSQIE  358

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+S+PA+GGF+THCGWNSILES+WC VPM+CYP++ DQ TNRK VVD+W IG+NLC D  
Sbjct  359   VLSNPAIGGFLTHCGWNSILESMWCGVPMLCYPILTDQTTNRKRVVDDWGIGLNLC-DGI  417

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             K I++ EVA K+  LM       L+K IK +R+ LE+ L  NGSS KN+ +F+  +KAK 
Sbjct  418   KPITRMEVAEKINRLMSGRLGDGLQKEIKKMRQKLEDGLAVNGSSQKNLCQFISDVKAKI  477



>dbj|BAG80551.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=482

 Score =   533 bits (1374),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 260/480 (54%), Positives = 351/480 (73%), Gaps = 9/480 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E + K HAI++P P QGHI P I+L+I LAS+G T+TFVNT+     ++KA+  + ++  
Sbjct  4     EEHIKLHAIMIPAPLQGHIVPFINLAIKLASKGLTITFVNTQFTHQRLMKAQSISDSSLD  63

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGL  2516
              DIF++ARNSGLD+RYTTISDGFPL F R  +   FM G+ +VFSAHVD+LV  L  +  
Sbjct  64    YDIFSEARNSGLDVRYTTISDGFPLNFYRAGNHDQFMEGLFHVFSAHVDDLVGNLVNSNH  123

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP +CLIADSFY WPS IA KYNLVN+S +TEPAL F    H+DLL+ NGHFG +D R+
Sbjct  124   NPPVSCLIADSFYVWPSEIAKKYNLVNISVWTEPALAFTSYYHMDLLRINGHFGSQDNRE  183

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I YIPGVEAIEP DLP Y+Q +      ++  ++K  EDA+KADI+ICNTVQELE  T
Sbjct  184   DTIHYIPGVEAIEPGDLPSYIQ-DPEPWGIMHRYMFKSLEDARKADIIICNTVQELESST  242

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL+EK PFYA+GP+FP  FT+ T   +L  ESD  +WL+SKP G+V+Y SFGSLA+++
Sbjct  243   ISALQEKTPFYALGPIFPNGFTKSTIPTNLWTESDPVQWLNSKPKGTVMYISFGSLANIS  302

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             ++ I+E+  GL+LS V+FIWV+RP +  ++E +     F++ V+DRGL+VPWC Q  VIS
Sbjct  303   RQDILEMAHGLLLSRVSFIWVVRPDITSSEESNLLPSRFEDDVKDRGLVVPWCSQIDVIS  362

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             H A+GGF+THCGWNS+LESIWC VPM+C+P+  DQ TNRKLVV EWK+G+NLC+   + +
Sbjct  363   HQAIGGFLTHCGWNSVLESIWCKVPMLCFPIFTDQFTNRKLVVSEWKVGVNLCS--GRVL  420

Query  3417  SKEEVASKVK-FLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
               +E+A K+  F+ +A    +LR  +++ RK LE+AL  NGSS +N  + +  +K+K  Q
Sbjct  421   KGQEIARKIDCFITEAN---KLRINLEETRKKLEDALSENGSSGRNYKQLICDLKSKILQ  477



>ref|XP_006367686.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=485

 Score =   533 bits (1373),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 342/473 (72%), Gaps = 5/473 (1%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKA-RRGTTTAPTD  2345
             +QK HAI+ P P QGH+ P ++L+I LAS GFT+TF+NT+ I   I KA R       ++
Sbjct  7     HQKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFINTQSIHQQISKAGRSNINDNESN  66

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             D+F+ AR SGLDIR  +I DGF + FDR+ +   F   ++  F  HVDE+V  L    P 
Sbjct  67    DLFSGARKSGLDIRDVSIYDGFSVDFDRSLNHDEFFEAILNDFVFHVDEVVGTLMLSNPS  126

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCRKDS  2702
             P  LIAD+FY W S IA KYNLVNVS++TEPALVF++  H+DLLK+NGH+ C ++ R+D 
Sbjct  127   PNILIADTFYVWSSTIAKKYNLVNVSYWTEPALVFSVYYHMDLLKQNGHYDCIENKREDI  186

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV+AI+P DLP YLQ ++ T   V   + + F++ K  D +ICNTVQELEP+TI+
Sbjct  187   IDYIPGVKAIKPTDLPSYLQSDD-TNMVVNRIIKRAFKEVKNVDFIICNTVQELEPETIT  245

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             +L++    YAIGP+F   FT      SL  ES+C  WLD+KP GSVLY SFGS AH  KE
Sbjct  246   SLQKYHSIYAIGPIFSPGFTNTFVSTSLWSESNCTDWLDAKPHGSVLYVSFGSYAHTNKE  305

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              I+E+ RGLM+SEVNFIWVLRP +  ++E D+   G+++ ++DRGLIVPWC Q AVISHP
Sbjct  306   TIVEIARGLMVSEVNFIWVLRPDIVSSEESDYLPIGYEDNIKDRGLIVPWCCQTAVISHP  365

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             AVGGF+THCGWNSI+ESIWCSVP IC+PL+ DQ TNRKLVVD+WKIGI+L   D+ SIS+
Sbjct  366   AVGGFLTHCGWNSIMESIWCSVPFICFPLLTDQFTNRKLVVDDWKIGISL--RDEGSISR  423

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKA  3581
             +EVA KVKFLMK + + E+++ IK ++K LE+ L  NGSS  N  KF+  +++
Sbjct  424   DEVAEKVKFLMKGKEAEEMKQRIKKIKKELEDGLAINGSSQVNFTKFMGDLES  476



>ref|XP_011077327.1| PREDICTED: UDP-glycosyltransferase 86A1 [Sesamum indicum]
Length=477

 Score =   533 bits (1372),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/477 (54%), Positives = 341/477 (71%), Gaps = 9/477 (2%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
             + QK HAI+ P P QGH+ P  +L+I LAS GFT+TF+NTE I   I KA+      P D
Sbjct  5     HKQKPHAIMFPYPLQGHVIPFTNLAIKLASNGFTITFINTESIHHQISKAK----GRPVD  60

Query  2346  -DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
              D+F++AR SGLDIRY T+ DGFP+GFDR+ +   F  G+++VFSAHVDE+V+ L   + 
Sbjct  61    HDLFSEARKSGLDIRYATVPDGFPVGFDRSLNHDEFFEGILHVFSAHVDEIVRNLVREDS  120

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
                 +I D+FY W S+IA KY+LVN+SFFTEPALV  +  H+DLL++NGHF   + R D+
Sbjct  121   TINSIIVDTFYVWGSVIADKYDLVNISFFTEPALVLTLYYHVDLLRKNGHFASSENRTDA  180

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV++I PRDL  Y Q +++ ++  +  +YK FED KKAD +ICNT+QE E  TIS
Sbjct  181   IDYIPGVKSIMPRDLMSYFQDKDDISTIAHQIIYKCFEDVKKADFIICNTIQEFEEDTIS  240

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL++ QPFY+IGP+F   FT+     SL  ESDC +WL++KP GSVLY SFGS AH TK 
Sbjct  241   ALQQYQPFYSIGPIFAPGFTKSCISTSLWSESDCTQWLNTKPHGSVLYVSFGSYAHTTKH  300

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              I E+  GL+LS VNFIWVLRP +  ++E D    GF++ V+ RGL+V WC Q  VISHP
Sbjct  301   EIHEVANGLLLSGVNFIWVLRPDIVSSNETDILPVGFEDQVKGRGLVVGWCRQVEVISHP  360

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             AVGGF+THCGWNSILESI   VP+ICYPL+ DQ TNRKLVV + KIGI+L      ++SK
Sbjct  361   AVGGFLTHCGWNSILESIRSCVPLICYPLLTDQFTNRKLVVSDLKIGIDL----KSTLSK  416

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             E V+ K+ +LM  + S E+R+ +K VRK LE+A+ ++GSSV N ++FV+ ++ K  +
Sbjct  417   EGVSEKINYLMAGQKSEEIREQVKKVRKMLEDAMATDGSSVANFNRFVKDLENKIGE  473



>emb|CDP12501.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   531 bits (1367),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 338/482 (70%), Gaps = 6/482 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E + + HA++LP P QGH+ P IHL+  LAS GF +TFV TE I   I  ++  T   
Sbjct  1     MGEIHPRPHALLLPYPLQGHVIPFIHLATKLASNGFIITFVITESIHHQITTSKNQTNHY  60

Query  2337  PTD--DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                  +IF +AR SGLDIRY T+SDGFPLGFDR+ +   F  G+++VFSAHVDE+V KL 
Sbjct  61    KEGGINIFAEARKSGLDIRYATVSDGFPLGFDRSLNHDQFFEGIVHVFSAHVDEIVGKLV  120

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               EPP  CL+ D+FY + S IA KYNLVN+SF+TEPALVF++  H+DLL+ NGH+   D 
Sbjct  121   QSEPPVNCLVIDTFYVFASPIARKYNLVNISFWTEPALVFSLYYHMDLLRINGHYDNYDK  180

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D I YIPGVE+I+P DL  YLQ   + T+ V+  + K F D + +D VI NT+ ELEP
Sbjct  181   REDIITYIPGVESIKPTDLTSYLQ--TDPTTVVHRLITKAFVDIRNSDFVISNTIDELEP  238

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             Q IS L+E QPFY+IGP+ P   T+ +   S+  ESDC  WLD+KP GSVLY SFGS AH
Sbjct  239   QIISVLQENQPFYSIGPILPTGLTKSSVPVSMWSESDCGPWLDTKPKGSVLYISFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +K +I+E+  GL+LSEVNF+WVLRP +  ++E D+   G+   +   G+IVPWC Q  V
Sbjct  299   TSKHNIVEIAHGLLLSEVNFVWVLRPDIISSEETDYLPTGYDRLIEYSGMIVPWCSQADV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHPAVGGF+THCGWNSILESIW  VPMICYPL+ DQ TNRKLVVD+WKIG+NL   D +
Sbjct  359   LSHPAVGGFLTHCGWNSILESIWSGVPMICYPLLTDQFTNRKLVVDDWKIGVNL--HDKR  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             S+++EEVA  +  +M  +SS   ++ IK V+K LENAL   GSS KN+++F   +K K  
Sbjct  417   SVTREEVAENIGCVMSGKSSDRFKQEIKKVKKTLENALARGGSSQKNLNQFTMDVKKKIR  476

Query  3591  QS  3596
             ++
Sbjct  477   KN  478



>ref|XP_010263435.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nelumbo nucifera]
Length=478

 Score =   531 bits (1367),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 252/480 (53%), Positives = 349/480 (73%), Gaps = 10/480 (2%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
               QK HAI +P P QGH+ P+++L++ LAS+GF VTFVNT+ I   I KA+ G+      
Sbjct  6     TGQKPHAIFIPYPLQGHVIPSVNLALKLASKGFIVTFVNTQSIHHKISKAQPGSG----G  61

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF  AR SG+DIRY T+ DG P+ FDR+ +   FM  +++VFSAHV+EL++++     P
Sbjct  62    DIFADARKSGIDIRYETVCDGLPIDFDRSLNHDQFMASLLHVFSAHVEELIRRIVQQASP  121

Query  2526  P-TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+F+ WPSI+A K+ LV VSF+TE ALV+A+  H+DLL+ NGHFGC D R+D+
Sbjct  122   PLTCLIADTFFVWPSILAKKFGLVYVSFWTEAALVYALYYHVDLLRLNGHFGCIDKREDT  181

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV ++EP DL  YLQ + +T++ V+  ++K F+D K AD VICNT+QELEP+TIS
Sbjct  182   IDYIPGVSSLEPTDLMSYLQ-DTDTSTVVHQLIFKAFQDDKGADFVICNTIQELEPETIS  240

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL+ ++PF+AIGP+F   FT+     SL  ESDC +WLD+KP  SVLY SFGS AH+ K+
Sbjct  241   ALQLEKPFFAIGPIFSSGFTKSMVATSLWAESDCAQWLDTKPHESVLYVSFGSYAHIGKQ  300

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              I E+  G++LS V F+WV+RP +  +++ D   +GF+E + +RGLIVPWC+Q +V+ HP
Sbjct  301   EIEEIAHGILLSGVYFVWVVRPDIVSSEDTDPLPEGFREEMGNRGLIVPWCNQNSVLKHP  360

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             A+GGF+THCGWNS LESIWC VPM+C+PL+ DQ TNRKL VD+W++G+N        I++
Sbjct  361   AIGGFLTHCGWNSTLESIWCEVPMLCFPLLTDQFTNRKLAVDDWRVGLNF--KSKLGINQ  418

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSSV  3602
             +EVA K+K LM   +  E RK IK+V+K LENA G +GSS KN D+F++ +  +  +  +
Sbjct  419   KEVADKIKTLMNGNA--ECRKEIKNVKKALENASGPDGSSEKNFDQFIKDLTLRIQKKEL  476



>ref|XP_009784463.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana sylvestris]
Length=503

 Score =   531 bits (1367),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 263/487 (54%), Positives = 350/487 (72%), Gaps = 11/487 (2%)
 Frame = +3

Query  2142  VSFRKM-VENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKAR  2318
             +S+ KM VE + K HA+++P+P QGHINP  HL++ LAS+GFT+TFVNTE     I++A+
Sbjct  23    ISYTKMGVEEHPKLHAVMIPLPLQGHINPFTHLAMKLASKGFTITFVNTESTHQHIVRAQ  82

Query  2319  RGTTTAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELV  2498
                +    ++ F+ A+ SGLDIRY  ISDGFPL F+R   A  F+ G+++VF AHVD+ +
Sbjct  83    ---SLKDDENPFSHAQKSGLDIRYAKISDGFPLSFERRAKAGQFVEGLIHVFEAHVDDFI  139

Query  2499  KKL--AGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH  2672
             + L  +  +PP +C+IADSF+ W S IA KYNLVNVS +TEPA V  I  H+DLLK  GH
Sbjct  140   ENLILSKPDPPISCIIADSFHVWASTIAKKYNLVNVSLWTEPATVLTIYYHMDLLKSKGH  199

Query  2673  FGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNT  2852
             FGC D  +D+I YIPGV+AIEP DLP Y Q  +++T      V+K  EDA+KAD VICNT
Sbjct  200   FGCHDKCEDTIRYIPGVQAIEPADLPSYCQDPDSSTVMPRF-VFKCLEDAQKADFVICNT  258

Query  2853  VQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYAS  3032
             VQELEP  I A++EKQPFYAIGP+FP SFT++T    LLPESD   WL+SK  G+VLY S
Sbjct  259   VQELEPSAILAIQEKQPFYAIGPVFPASFTKRTIATGLLPESDYTDWLNSKQDGTVLYIS  318

Query  3033  FGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPW  3212
             FGSLA+++K+ I+E+ +G+++S+V+FIWVLR  +  + E +     F+E    RGL+VPW
Sbjct  319   FGSLANMSKQDILEIAQGILISKVSFIWVLRHNILGSGERNILPRKFKEETVGRGLVVPW  378

Query  3213  CHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINL  3392
             C Q AV+SHPAVGGF+THCGWNSILESIWC VPM+C P++ DQ TNRKLVVD+W+IG+NL
Sbjct  379   CSQLAVLSHPAVGGFLTHCGWNSILESIWCKVPMVCVPILTDQFTNRKLVVDDWRIGVNL  438

Query  3393  CNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEK  3572
             C    + I +EEVA  +  +M       LRK I+  +  L+NAL   GSS KN+++F+E+
Sbjct  439   CT--GRLIRREEVAENIGRIMSKSDG--LRKNIEKTKMILQNALSDEGSSKKNLNQFIEE  494

Query  3573  IKAKFNQ  3593
             +K K  Q
Sbjct  495   MKNKILQ  501



>ref|XP_010516934.1| PREDICTED: UDP-glycosyltransferase 86A1 [Camelina sativa]
Length=497

 Score =   529 bits (1362),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 355/482 (74%), Gaps = 15/482 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K H +++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDE----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP-  2522
             IF+ AR+SG LDIRYTT++DGFPLGFDR+ +   F  G+++VFSAHVD+L+ KL+  +  
Sbjct  62    IFSAARSSGQLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKLSRQDDH  121

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF C + R+D 
Sbjct  122   PVTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDV  181

Query  2703  IDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             IDY+PGV+AIEP+DL  YLQ   ++ +T + VY  + K F+D K+AD V+CNTVQELEP 
Sbjct  182   IDYVPGVKAIEPKDLMSYLQVSDKDVDTNTVVYQILSKAFKDVKRADFVLCNTVQELEPD  241

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             ++SAL+ KQP YAIGP+F    T+     SL  ESDC +WL  +P GSVLY SFGS AH+
Sbjct  242   SLSALQAKQPVYAIGPVFS---TDSVVPTSLWTESDCTEWLKGRPTGSVLYVSFGSYAHV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I+E+  GL+LS ++FIWVLRP +  +D  DF  DGF    +DRGL+V WC Q AVI
Sbjct  299   GKKEIVEIAHGLLLSGISFIWVLRPDIVGSDVPDFLPDGFVNQTQDRGLVVQWCCQMAVI  358

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC--NDDD  3407
             S+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINL   ND++
Sbjct  359   SNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWRIGINLYDNNDNN  418

Query  3408  KSISKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             K+I++++V++ V+ LM K E+S ELR  ++ V+++L++A+ + GSS  N   FV ++++ 
Sbjct  419   KTITRDQVSANVRRLMIKGETSSELRNNVEKVKRHLKDAVTAVGSSETNFKSFVGEVRSS  478

Query  3585  FN  3590
              +
Sbjct  479   ID  480



>ref|XP_010509409.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Camelina sativa]
Length=490

 Score =   528 bits (1360),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 353/479 (74%), Gaps = 15/479 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K H +++P P QGH+ P +HL+I LAS GFT+TFVNTE +   I  A +G       D
Sbjct  6     SRKSHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTESVHHNISTAHQG----DEGD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             IF+ AR+SG LDIRYTT++DGFPLGFDR+ +   F  G+++VFSAHVD+L+ KL+  +  
Sbjct  62    IFSAARSSGQLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKLSRQDDH  121

Query  2526  P-TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF C + R+D 
Sbjct  122   PVTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDV  181

Query  2703  IDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             IDY+PGV+AIEP+DL  YLQ   ++ +T + VY  + K F+D K+AD V+CNTVQELEP 
Sbjct  182   IDYVPGVKAIEPKDLMSYLQVSDKDVDTNTTVYQILSKAFKDVKRADYVLCNTVQELEPD  241

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             ++SAL+ KQP YAIGP+F    T+     SL  ESDC +WL  +P GSVLY SFGS AH+
Sbjct  242   SLSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I+E+  GL+LS ++FIWVLRP +  +D  DF  DGF    +DRGL+V WC Q AVI
Sbjct  299   GKKEIVEIAHGLLLSRISFIWVLRPDIVGSDVPDFLPDGFVNQTQDRGLVVQWCCQMAVI  358

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC--NDDD  3407
             S+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINL   N+++
Sbjct  359   SNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWRIGINLYDDNNNN  418

Query  3408  KSISKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKA  3581
             K+I++++V+  ++ LM K E+S ELR  ++ V+++L++A+ + GSS  N   FV+K+++
Sbjct  419   KTITRDQVSGNIRRLMVKGETSSELRNNVEKVKRHLKDAVTTVGSSETNFKIFVDKVRS  477



>ref|XP_008355190.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=480

 Score =   526 bits (1355),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 343/474 (72%), Gaps = 10/474 (2%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             ++ HAI +  P QGH+ P++HL+I LAS GF +TF+NT  I     KA+  +   P    
Sbjct  13    KRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNP----  68

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL---AGLEP  2522
             F     SGLDI YTT+SDG P+ FDR+ +   FM  +++VFSAHV+E+V K    +    
Sbjct  69    FAYLHESGLDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKAVKSSADTT  128

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TC+IAD+F+ WPS IA K+ ++ VSF+TEPALVF++  HLDLL+ +GHF C+D R+D+
Sbjct  129   PVTCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRMHGHFACQDVREDT  188

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV AI+P+D+  YLQ + +TTS  +  ++  F+DA+ A   +CNTVQE+E +TIS
Sbjct  189   IDYIPGVRAIDPKDMMSYLQ-DTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESETIS  247

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL+ K  FYAIGP+FP +F++  A  SL  ESDC +WL++KP GSVLY SFGS AH+ K+
Sbjct  248   ALQAKMKFYAIGPIFPTTFSKNIAATSLWSESDCTQWLNTKPHGSVLYVSFGSYAHVAKK  307

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              ++E+  GL LS+VNF+WVLRP +  +++ D    GF++ V+DR +++PWC Q AV++HP
Sbjct  308   DLIEITNGLKLSKVNFVWVLRPDIVSSNDTDPLPSGFRDDVKDRSIVIPWCSQKAVLAHP  367

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             A+GGF++HCGWNS LESIWC VP++C+PL+ DQ TNRKL+VD+WK+GINLCN   + +SK
Sbjct  368   AIGGFLSHCGWNSTLESIWCGVPLLCFPLLTDQFTNRKLIVDDWKVGINLCN--RRVVSK  425

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             EEV+ K+  LM  +S  E R+A+  V+  LE+AL  NGSS KN+D F++ +KAK
Sbjct  426   EEVSEKINRLMDGKSGNEYRRAVVKVKNTLEDALTPNGSSEKNMDNFIKDLKAK  479



>ref|XP_008243981.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=480

 Score =   526 bits (1355),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 340/478 (71%), Gaps = 5/478 (1%)
 Frame = +3

Query  2157  MVENNQ--KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             M E+NQ  K HAI++P+P QGH+ P  +L++ LAS GFT+TFVNT+ I   I K++    
Sbjct  1     MEEDNQCTKPHAILVPLPLQGHVIPFTNLAVKLASNGFTITFVNTQYIHHQITKSQPNNK  60

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
             T   DDIF  AR +GLDIRY T+SDGFPL F+R  +   F+ G ++V+ AHVDELV  L 
Sbjct  61    TK-QDDIFAAARKAGLDIRYKTVSDGFPLAFNRFQNLDQFLEGHLHVYPAHVDELVGDLV  119

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +P  TC IAD+F+ WP  IA+KYNLVNVSF+T+PALV +I  HLDLL++NGHFG  D 
Sbjct  120   QSDPSITCFIADTFHTWPETIANKYNLVNVSFWTQPALVLSIYYHLDLLRQNGHFGFHDK  179

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D IDYIPGV+AIEP+DL  +LQ   +  S +   +YK F + K+AD ++ N VQELE 
Sbjct  180   REDIIDYIPGVQAIEPKDLMSHLQ-TTDLLSPMLRIIYKAFHEVKRADFILINAVQELES  238

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +T+SAL EKQP YAIGP+FP   T+     +L+ E DC +WL++KP GSVL+ SFGS A 
Sbjct  239   ETLSALHEKQPTYAIGPVFPSKTTKSIVATNLMSEFDCTQWLNAKPHGSVLFISFGSYAQ  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             +T + I E+  GL+LS+V+FIWVLRP     +E +    GF + ++DRG+IVPWC Q  V
Sbjct  299   VTTKDIEEIAHGLLLSKVSFIWVLRPDTTSYEETNILPVGFDDEIKDRGMIVPWCSQIKV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHPAVGGF+THCGWNSILES+WC VPM+C+PL  DQ TNRKLVVD+W IG+N+C D  K
Sbjct  359   LSHPAVGGFLTHCGWNSILESMWCGVPMLCFPLWTDQITNRKLVVDDWGIGLNIC-DGVK  417

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              I++ EVA K+  +M  +    L+K IK VR+ +++AL  NGSS KN  +F+  +K K
Sbjct  418   PITRLEVAEKINHVMSGKLGHGLQKEIKIVRQTMQDALALNGSSQKNFFQFISDVKNK  475



>ref|XP_008363514.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=480

 Score =   525 bits (1353),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 343/474 (72%), Gaps = 10/474 (2%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             ++ HAI +  P QGH+ P++HL+I LAS GF +TF+NT  I     KA+  +   P    
Sbjct  13    KRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNP----  68

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL---AGLEP  2522
             F     SGLDI YTT+SDG P+ FDR+ +   FM  +++VFSAHV+E+V K    +    
Sbjct  69    FAYLHESGLDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKAVKSSADTT  128

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TC+IAD+F+ WPS IA K+ ++ VSF+TEPALVF++  HLDLL+ +GHF C+D R+D+
Sbjct  129   PVTCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRMHGHFACQDVREDT  188

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV AI+P+D+  YLQ + +TTS  +  ++  F+DA+ A   +CNTVQE+E +TIS
Sbjct  189   IDYIPGVRAIDPKDMMSYLQ-DTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESETIS  247

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL+ K  FYAIGP+FP +F++  A  SL  ESDC +WL++KP GSVLY SFGS AH+ K+
Sbjct  248   ALQAKMKFYAIGPIFPTTFSKNIAATSLWSESDCTQWLNTKPHGSVLYVSFGSYAHVAKK  307

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              ++E+  GL LS+VNF+WVLRP +  +++ D    GF++ V+DR +++PWC Q AV++HP
Sbjct  308   DLIEITNGLKLSKVNFVWVLRPDIVSSNDTDPLPSGFRDDVKDRSIVIPWCSQKAVLAHP  367

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             A+GGF++HCGWNS LESIWC VP++C+PL+ DQ TNRKL+VD+WK+GINLCN   + +SK
Sbjct  368   AIGGFLSHCGWNSTLESIWCGVPLLCFPLLTDQFTNRKLIVDDWKVGINLCN--RRVVSK  425

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             EEV+ K+  LM  +S  E R+A+  V+  LE+AL  NGSS KN+D F++ +KAK
Sbjct  426   EEVSEKINRLMDGKSGNEYRRAVVKVKNTLEDALTPNGSSEKNMDNFIKDLKAK  479



>gb|KDO49335.1| hypothetical protein CISIN_1g011724mg [Citrus sinensis]
Length=478

 Score =   525 bits (1353),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 260/478 (54%), Positives = 335/478 (70%), Gaps = 23/478 (5%)
 Frame = +3

Query  2160  VENNQKH---HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             +ENN K    HAI +  P QGH+ P ++L++ LAS GFT+TFVNT  I   I KA+   +
Sbjct  1     MENNHKKPKPHAIAICYPLQGHVIPFVNLALKLASSGFTITFVNTHSIHHQITKAQ---S  57

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DDIF  AR +GLDIRY T+SDG PL FDR+ +   FM  +++VFSAHVDELV  L 
Sbjct  58    NGDEDDIFAGARKAGLDIRYATVSDGLPLNFDRSLNHDQFMECLLHVFSAHVDELVGNLI  117

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
              L P   CL+ D+F+ W S+IA KYNLVN+SF+TEPALV  +  H+DLL+ +GHF   D 
Sbjct  118   QLNPEMNCLVTDTFFVWSSMIAKKYNLVNISFWTEPALVLTLYYHMDLLRSHGHFASTDN  177

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D+IDYIPGV AIE +DL  YLQ   +T++ V+  + K FED K+ D ++CNTV ELE 
Sbjct  178   REDTIDYIPGVRAIERKDLMSYLQA-TDTSTVVHRIIQKAFEDVKRVDFILCNTVHELES  236

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL +KQP YAIGP+FP  FT+     SL  ES+C +WL++KP GSVLY SFGS AH
Sbjct  237   ETISALHQKQPTYAIGPIFPAGFTKSLVPTSLWSESECTQWLNTKPRGSVLYVSFGSYAH  296

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVR--DRGLIVPWCHQP  3224
              +K  I+E+  GL+LSEV+F+WVLRP +  +DE DF   GF+E ++   RGLIVPWC Q 
Sbjct  297   ASKNDIVEIALGLLLSEVSFVWVLRPDIVSSDETDFLPVGFEEKIKISGRGLIVPWCSQI  356

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              VISH A+GGF+THCGWNSI ESIWCSVP++C+PL+ DQ TNRKLV              
Sbjct  357   DVISHSAIGGFLTHCGWNSIQESIWCSVPLLCFPLLTDQFTNRKLV--------------  402

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
               SI+KEEV+ K+  LM  +SS ELRK IK+VRK LENAL ++GSS KN ++F+  ++
Sbjct  403   KSSITKEEVSEKINRLMSGKSSDELRKNIKEVRKKLENALSADGSSQKNFNQFINDVQ  460



>ref|XP_009376817.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   525 bits (1352),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/468 (54%), Positives = 333/468 (71%), Gaps = 4/468 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P+P QGH+NP  HL+  LAS+GFT+TFVNT+ I   I+K++    T   DDIF  
Sbjct  9     HAIMVPLPLQGHVNPLTHLATKLASQGFTITFVNTQYIHHHILKSQPNDNTE--DDIFAM  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             AR SGLDIRYTT+SDGFPL FDR  +    + G ++VF AHVDELV  L   +P  TCLI
Sbjct  67    ARKSGLDIRYTTVSDGFPLVFDRIQNLDQSLEGALHVFPAHVDELVGNLVQSDPSITCLI  126

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F +W + IA+KYNL+++SF+T+PALVF I  HLDLLK+NGHFG  D R+D IDYIPG
Sbjct  127   VDTFQSWSATIANKYNLIHISFWTQPALVFNIYYHLDLLKKNGHFGSHDNREDIIDYIPG  186

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             V+AIEP+DL  +LQ   +  S +  T YK F + K+AD ++CNTVQELE +++SAL+ KQ
Sbjct  187   VKAIEPKDLMSHLQ-STDLFSPMLRTFYKSFREVKRADFILCNTVQELEFESLSALQAKQ  245

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             P YAIGP+ P S T      +L+PE DC  WL  KP GSVL+ SFGS A +TK+   E+ 
Sbjct  246   PTYAIGPVLPDSLTNNIVATNLMPEFDCIHWLHKKPHGSVLFISFGSYAQVTKDDFEEIA  305

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              GL+LS+ NFIWVLRP     DE      GF++ ++DRGL+VPWC Q  V+SHPAVGGF+
Sbjct  306   HGLLLSKANFIWVLRPDTTGYDETYILPVGFEDEIKDRGLMVPWCSQIEVLSHPAVGGFL  365

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNSILES+ C VPM+C+PL+ DQ TNRKLVVD+W +G+NLC D  K + + EVA K
Sbjct  366   THCGWNSILESMRCGVPMLCFPLVADQITNRKLVVDDWGVGLNLC-DRVKPVRRVEVAEK  424

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  L+  +S   L+K +  V + LE+A+  NGSS KN+ +F+  +K K
Sbjct  425   INRLICGKSGDGLQKKVMKVTQTLEDAVALNGSSQKNLSQFISNVKEK  472



>ref|XP_007207842.1| hypothetical protein PRUPE_ppa023014mg [Prunus persica]
 gb|EMJ09041.1| hypothetical protein PRUPE_ppa023014mg [Prunus persica]
Length=486

 Score =   525 bits (1351),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 342/481 (71%), Gaps = 3/481 (1%)
 Frame = +3

Query  2151  RKMVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             R + + + + HAI++PMP QGH+ P  HL++ LAS GFT+TFVNT+ I   I K++   T
Sbjct  7     RAVEDKHSQPHAIMVPMPLQGHLLPHTHLAMKLASNGFTITFVNTQHIHHQISKSQPNDT  66

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DDIF  AR SGLDIRY T+SDGFPL F+R  +    + G++YVF AHVDELV  L 
Sbjct  67    -EDQDDIFATARKSGLDIRYKTVSDGFPLAFNRFQNHNQAVEGLLYVFPAHVDELVGNLV  125

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +P  TCLI D+F+ W + IA+KYNLVN+SF+TEPALV +I  HLDLL+E GH+G  D 
Sbjct  126   QSDPSVTCLIVDTFHPWSATIANKYNLVNISFWTEPALVLSIYYHLDLLRERGHYGSHDN  185

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D++DYIPGV+AIEP+DL  +LQ E + ++ ++  ++K F + ++AD ++CNTVQELE 
Sbjct  186   REDTVDYIPGVQAIEPKDLMSHLQ-EADISTPMHRALHKAFHEVQRADFILCNTVQELES  244

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              T+SAL+EKQ  YAIGP+ P + T+     +L+ E DC +WL++KP GSVL+ SFGS   
Sbjct  245   NTLSALQEKQHTYAIGPVSPNNPTKSIVATNLMSEFDCTEWLNTKPNGSVLFVSFGSYVL  304

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             +TK  I E+  GL+LS+V+FIWVLRP     DE      GF+  ++DRGL+VPWC Q  V
Sbjct  305   VTKNDIEEIAHGLLLSKVSFIWVLRPNTTSYDETYILPVGFENEIKDRGLMVPWCSQIEV  364

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHPA GGF+THCGWNSILES+WC VPM+C+PL  DQ TNRKLVVD+W IG+NLC D  K
Sbjct  365   LSHPATGGFLTHCGWNSILESMWCGVPMLCFPLWTDQVTNRKLVVDDWGIGLNLC-DRVK  423

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
              I++ EVA K+  LM  +    L+K  K V++ LE+AL  NGSS KN+ +F+  +KA+  
Sbjct  424   PITRVEVAEKINRLMSGKLGDGLQKQSKKVKQTLEDALAVNGSSQKNLSQFIGDVKAEIQ  483

Query  3591  Q  3593
             +
Sbjct  484   K  484



>ref|XP_007206708.1| hypothetical protein PRUPE_ppa024090mg [Prunus persica]
 gb|EMJ07907.1| hypothetical protein PRUPE_ppa024090mg [Prunus persica]
Length=480

 Score =   525 bits (1351),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 339/478 (71%), Gaps = 5/478 (1%)
 Frame = +3

Query  2157  MVENNQ--KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             M E+NQ  K HAI++P+P QGH+ P  +L++ LAS GFT+TFVNT+ I   I K++    
Sbjct  1     MEEDNQCTKPHAILVPLPLQGHVIPFTNLAMKLASNGFTITFVNTQYIHHQITKSQPNNK  60

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
             T   DDIF  AR SGLDIRY T+SDGFPL F+R  +   F+ G ++V+ AHVDELV  L 
Sbjct  61    TK-QDDIFAAARKSGLDIRYKTVSDGFPLAFNRFQNLDQFLEGHLHVYPAHVDELVGDLV  119

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +P  TC IAD+F+ WP  IA+KYNLVN+SF+TEPALV +I  HLDLL++NGHFG  D 
Sbjct  120   QSDPSITCFIADTFHTWPETIANKYNLVNISFWTEPALVLSIYYHLDLLRQNGHFGSHDK  179

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              +D IDYIPGV+AIEP+DL  +LQ   +  S +   +YK F + K+AD ++ NTVQELE 
Sbjct  180   CEDIIDYIPGVQAIEPKDLMSHLQ-ATDLLSPMLRIIYKAFHEIKRADFILINTVQELES  238

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +T+SAL EKQP YAIGP+FP   T+     +L+ E DC +WL++KP GSVL+ SFGS A 
Sbjct  239   ETLSALHEKQPTYAIGPVFPSKTTKSIVATNLMSEFDCTQWLNAKPHGSVLFISFGSYAQ  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             +T + I E+  GL+LS+V+FIWVLRP     +E +    GF + ++D G+IVPWC Q  V
Sbjct  299   VTTKDIEEIAHGLLLSKVSFIWVLRPDTTSYEESNILPVGFDDEIKDSGMIVPWCSQVKV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHPAVGGF+THCGWNSILES+WC VPM+C+PL  DQ TNRKLVVD+W IG+N+C D  K
Sbjct  359   LSHPAVGGFLTHCGWNSILESMWCGVPMLCFPLWTDQITNRKLVVDDWGIGLNIC-DGVK  417

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              I++ EVA K+  +M  +    L+K I++VR+ +E AL  NGSS KN  +F+  +K K
Sbjct  418   PITRVEVAEKINHVMSGKLGHGLQKEIRNVRQTMEGALALNGSSQKNFFQFISDVKTK  475



>ref|XP_009623615.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Nicotiana tomentosiformis]
Length=477

 Score =   523 bits (1348),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 260/480 (54%), Positives = 343/480 (71%), Gaps = 9/480 (2%)
 Frame = +3

Query  2160  VENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAP  2339
             VE + K HA+++P+P QGHINP  HL++ LAS+GFT+TFVNTE     I +A+  +    
Sbjct  3     VEEHPKLHAVMIPLPLQGHINPFTHLAMKLASKGFTITFVNTESTHQHITRAQ--SLKDE  60

Query  2340  TDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AG  2513
              D+ F+ A+ SGLDIRY  ISDGFPL F+R   A  F+ G+++VF AHVD+ ++KL  + 
Sbjct  61    HDNPFSHAQKSGLDIRYAKISDGFPLSFERRAKADQFVEGLIHVFEAHVDDFIEKLILSK  120

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
              +PP +C+IADSF+ W S IA KYNL NVSF+TEPA V  I  H+DLLK  GHFGC    
Sbjct  121   PDPPVSCIIADSFHVWASTIAKKYNLFNVSFWTEPATVLTIYYHMDLLKSKGHFGCHGKC  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+I YIPGV+AIEP DLP Y Q  +++T      V+K  EDA+KAD VICNTVQELE  
Sbjct  181   EDTIRYIPGVQAIEPADLPSYCQDPDSSTVMPRF-VFKCLEDAQKADFVICNTVQELESS  239

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
              IS ++EKQPFYAIGP+FP SFT++T    LLPESD   WL+SK  G+VLY SFGSLA++
Sbjct  240   AISVIQEKQPFYAIGPVFPASFTKRTISTGLLPESDYTDWLNSKQDGTVLYISFGSLANM  299

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K  I+E+ +G+++S+V+FIWVLR  +  + E +     F+E    RGL+VPWC Q AV+
Sbjct  300   SKRDILEIAQGILISKVSFIWVLRHNILGSGERNILPRRFEEETVGRGLVVPWCSQLAVL  359

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPAVGGF+THCGWNSILESIWC VPM+C P++ DQ TNRKLVV++W+IG+NLC    + 
Sbjct  360   SHPAVGGFLTHCGWNSILESIWCKVPMVCVPILTDQFTNRKLVVNDWRIGVNLCT--GRL  417

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             I +EEVA  +  +M    S +LRK I+  +  L NAL   GSS KN+++F+E++K K  Q
Sbjct  418   IRREEVAENIGRIM--SKSDDLRKNIERTKMVLHNALSDEGSSKKNLNQFIEEMKNKILQ  475



>ref|XP_004249621.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=498

 Score =   524 bits (1350),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 260/480 (54%), Positives = 347/480 (72%), Gaps = 5/480 (1%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKA-RRGTTTAPTD  2345
             +QK HAI+ P P QGH+ P ++L+I LAS GFT+TF+NT+ I   I KA R        +
Sbjct  7     HQKPHAILFPYPLQGHVIPFVNLAIKLASNGFTITFINTQSIHQQISKAGRSNVIDNENN  66

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             D+F+ A  SGLDIR  +I DGFP+ +DR+ +   F   +M  F  HVDE+V KL    P 
Sbjct  67    DLFSCACKSGLDIRDVSIYDGFPVDYDRSLNHDKFFEAIMNDFVFHVDEVVGKLMLSNPS  126

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCRKDS  2702
             P  LI D+FY W S IA KY+LVNVS++TEPALVF++  H+DLLK+NGH+ C ++ R+D 
Sbjct  127   PNILIGDTFYVWSSTIAKKYSLVNVSYWTEPALVFSVYYHMDLLKQNGHYDCIENKREDI  186

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV+AI+P DLP YLQ ++ T   V   + + F++ +  D +ICNTV ELEP+ I+
Sbjct  187   IDYIPGVKAIKPTDLPSYLQSDD-TNMVVNRIIKRAFKEVQIVDFIICNTVHELEPEIIT  245

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL++    Y+IGP+F   FT  +   SL  ES+C  WLD+KP GSVLY SFGS AH  KE
Sbjct  246   ALQKYLSIYSIGPIFSPGFTNTSVSTSLWSESNCTDWLDTKPNGSVLYVSFGSYAHTNKE  305

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              I+E+ RGL++SEVNFIW+LRP +  ++E D+   G++E ++DRGLIVPWC Q AVISHP
Sbjct  306   TIVEIARGLVISEVNFIWILRPDIVSSEETDYLPIGYEESIKDRGLIVPWCCQTAVISHP  365

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             AVGGF+THCGWNSI+ESIWCSVP IC+PL+ DQ TNRKLVVD+WKIGINLC  D+ SIS+
Sbjct  366   AVGGFLTHCGWNSIMESIWCSVPFICFPLLTDQFTNRKLVVDDWKIGINLC--DEGSISR  423

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSSV  3602
             +EVA KVKFLMK + + E+++ IK ++K LE+ L  NGSS  N  KF++ +++K ++ +V
Sbjct  424   DEVAEKVKFLMKGKEAEEIKQRIKKIKKELEDGLALNGSSQVNFSKFMDDLESKISKKNV  483



>ref|XP_007205115.1| hypothetical protein PRUPE_ppa004816mg [Prunus persica]
 gb|EMJ06314.1| hypothetical protein PRUPE_ppa004816mg [Prunus persica]
Length=490

 Score =   524 bits (1349),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 259/487 (53%), Positives = 342/487 (70%), Gaps = 13/487 (3%)
 Frame = +3

Query  2157  MVENNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT  2333
             M  N  KH H ++   P QGH+ PA+HL+I LAS+G TVTFVNTE +    +K+      
Sbjct  1     MENNTSKHPHVVLFAYPLQGHVIPAVHLAIKLASKGITVTFVNTEAVHHQTVKSH----A  56

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                D+IF     SGLDIRY TI+DGFP+ FDR+ +   F   +++ F A VDEL+ KL  
Sbjct  57    MEDDNIFKGVLQSGLDIRYVTINDGFPVEFDRSLNHDQFWESVIHDFPAQVDELLAKLVL  116

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH---FGCK  2684
               PP  CLI+D+F+ W + IA KYNLV VSF+TEPALVF +  HLDLL +NGH       
Sbjct  117   SNPPVNCLISDTFFEWTTNIAKKYNLVTVSFWTEPALVFNLYYHLDLLNKNGHGHFTSHA  176

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             + R+D+I+YIPGV AIEP+DL  YLQ  ++ TS ++  + K FE  K AD ++CNTVQEL
Sbjct  177   NPRQDTINYIPGVRAIEPKDLSSYLQ-PSDYTSPIHRIIVKAFEKIKTADFILCNTVQEL  235

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             E +TISAL+EKQ  Y+IGP+FP  FT+     SL  ESDC +WL ++  GSVLY SFGS 
Sbjct  236   ESETISALQEKQQIYSIGPIFPTGFTKSRVATSLWSESDCIQWLSTRSRGSVLYVSFGSY  295

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRD--RGLIVPWCH  3218
             AH +K  I E+  GL+LS+V FIWVLRP +  +DE +    GF++ ++D  +GLIVPWC 
Sbjct  296   AHASKREIEEIANGLLLSKVGFIWVLRPDIVSSDEPEILPFGFEDEIKDQEQGLIVPWCS  355

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q  VISHPA+GGFITHCGWNSILESIWC++P++C+PL+ DQ TNRKLVVD+W++G+NLC 
Sbjct  356   QIEVISHPAIGGFITHCGWNSILESIWCNLPLLCFPLLTDQFTNRKLVVDDWRVGLNLC-  414

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D K I+KEEVA K+  LM  +S+ ELR+ +K+VRK LE AL   GSS +N+D+F++ +K
Sbjct  415   -DQKPITKEEVAEKISHLMSGKSADELRRNVKEVRKALEGALAIGGSSHRNLDQFIDGVK  473

Query  3579  AKFNQSS  3599
             AK  + +
Sbjct  474   AKVQEKT  480



>ref|XP_008465359.1| PREDICTED: UDP-glycosyltransferase 86A2 [Cucumis melo]
Length=487

 Score =   521 bits (1341),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 251/478 (53%), Positives = 345/478 (72%), Gaps = 8/478 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             NQK H I +  P QGH+ P++HL+I+LA+RGFTVTF+NT  I     +   G ++A  DD
Sbjct  7     NQKPHVIFIAYPLQGHVIPSVHLAIDLAARGFTVTFINTHAIHQ---QTCSGHSSA-GDD  62

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             +F+  R SGLDIRY T+SDG P+GFDR+ +   FM  +++VFSAHV+E V+ +   E   
Sbjct  63    LFSAVRKSGLDIRYRTVSDGLPVGFDRSLNHDQFMASLLHVFSAHVEEAVEGIVKTEAV-  121

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
             +CLIAD+F+ WPS +A K+ L+ VSF+TEPALVF +  HL+LL+ N HF C+D R+D+ID
Sbjct  122   SCLIADTFFVWPSKVAKKFGLLYVSFWTEPALVFTLYYHLNLLRINRHFACQDIREDAID  181

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             YIPGV  I+P+D+  YLQ E +TTS  +  ++  F+D +KAD V+CNT+Q+LE  TISAL
Sbjct  182   YIPGVPTIDPKDMMSYLQ-ETDTTSVCHQIIFAAFQDVRKADFVLCNTIQDLENDTISAL  240

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
             + +  FYAIGPLFP  FT+ +   SL PESDC  WL+SKP  SVLY SFGS AH+TK  I
Sbjct  241   QAQTQFYAIGPLFPPGFTKSSVPTSLWPESDCTHWLNSKPHTSVLYVSFGSYAHVTKSEI  300

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
              E+  GL LS V+FIWVLRP +  +++ D    GF+  V DR +IVPWCHQ  V++HPA+
Sbjct  301   TEIAHGLSLSGVHFIWVLRPDIVSSNDTDPLPVGFRTEVADRSMIVPWCHQKQVLAHPAI  360

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             GGF+THCGWNSILESIWC+VP++C+PL+ DQ TNRKLVV++WK+GINL  D  + I+KE+
Sbjct  361   GGFLTHCGWNSILESIWCAVPLLCFPLLTDQFTNRKLVVEDWKVGINL-KDGRQMITKEK  419

Query  3429  VASKVKFLMKAESSIELRK-AIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             V+ K+K LM  +S  +  K A++++RK LE+A+  NG S K +++F++ +    +  S
Sbjct  420   VSEKIKRLMDGKSGCQQYKDAVRELRKKLEDAVKPNGPSDKAMNQFIKDLNVAISSKS  477



>ref|XP_010505248.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Camelina sativa]
Length=497

 Score =   521 bits (1342),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 259/478 (54%), Positives = 349/478 (73%), Gaps = 15/478 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K H +++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP-  2522
             IF+ ARNSG LDIRYTT++DGFPLGFDR+ +   F  G+++VFSAHVD+L+ KL+  +  
Sbjct  62    IFSAARNSGKLDIRYTTVTDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKLSLQDDH  121

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF C + R+D 
Sbjct  122   PVTCLIADAFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKCLENREDV  181

Query  2703  IDYIPGVEAIEPRDLPLYLQQEN---NTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             IDY+PGV+ IEP+DL  YLQ  +   +T + VY  + K F+D K+AD V+CNTVQELEP 
Sbjct  182   IDYVPGVKEIEPKDLMSYLQASDKDVDTNTVVYQILSKAFKDVKRADFVLCNTVQELEPD  241

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             ++SAL+ KQP YAIGP+F    T+     SL  ESDC +WL  +P GSVLY SFGS AH+
Sbjct  242   SLSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I+E+  GL+LS ++FIWVLRP +  +   DF  DGF    +DRGL+V WC Q AVI
Sbjct  299   GKKEIVEIAHGLLLSGISFIWVLRPDIVGSVVPDFLPDGFVNQTQDRGLVVQWCCQMAVI  358

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD--  3407
             S+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINL +D++  
Sbjct  359   SNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWRIGINLYDDNNNK  418

Query  3408  KSISKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             K+I++++V++ V+ LM K E+S ELR  ++ V+ +L++A+ + GSS  N   FV +++
Sbjct  419   KTITRDQVSANVRRLMIKGETSSELRNNVEKVKLHLKDAVTAVGSSETNFKSFVVEVR  476



>ref|XP_008243980.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Prunus mume]
Length=490

 Score =   520 bits (1339),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 341/487 (70%), Gaps = 13/487 (3%)
 Frame = +3

Query  2157  MVENNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT  2333
             M  N  KH H ++   P QGH+ PA+HL+I LAS+G TVTFVNTE +    +K+      
Sbjct  1     MENNTSKHPHVVLFAYPLQGHVIPAVHLAIKLASKGITVTFVNTEAVHHQTVKSH----A  56

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                D+IF     SGLDIRY TI+DGFP+ FDR+ +   F   +++ F A VDEL+ KL  
Sbjct  57    MEDDNIFKGVLQSGLDIRYVTINDGFPVEFDRSLNHDQFWESVIHDFPAQVDELLAKLVL  116

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH---FGCK  2684
               PP  CLI+D+F+ W + IA KYNLV VSF+TEPALVF +  HLDLL +NGH       
Sbjct  117   SNPPVNCLISDTFFEWTTNIAKKYNLVTVSFWTEPALVFNLYYHLDLLNKNGHGHFTSHA  176

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             + R+D+I+YIPGV AIEP+DL  YLQ  N+ TS ++  + K FE  K AD ++CNTVQEL
Sbjct  177   NPRQDTINYIPGVRAIEPKDLSSYLQ-PNDYTSPIHRIIVKAFEKIKNADFILCNTVQEL  235

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             E +TISAL+E+Q  Y+IGP+FP  FT+     SL  ESDC +WL ++  GSVLY SFGS 
Sbjct  236   ESETISALQERQQIYSIGPIFPPGFTKSRVATSLWSESDCIQWLSTRSRGSVLYVSFGSY  295

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRD--RGLIVPWCH  3218
             AH +K  I E+  GL+LS+V FIWVLRP +  +DE +    GF++ ++D  +GLIVPWC 
Sbjct  296   AHASKREIEEIANGLLLSKVGFIWVLRPDIVSSDEPEILPVGFEDEIKDQEQGLIVPWCS  355

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q  VISHPA+GGFITHCGWNSILESIW ++P++C+PL+ DQ TNRKLVVD+W++G+NLC 
Sbjct  356   QIEVISHPAIGGFITHCGWNSILESIWRNLPLLCFPLLTDQFTNRKLVVDDWRVGLNLC-  414

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D K I+KEEVA K+  LM  +S+ ELR+ +K+VRK LE AL   GSS +N+D+F++ +K
Sbjct  415   -DQKPITKEEVAEKISRLMSGKSADELRRNVKEVRKALEGALAIGGSSYRNLDQFIDGVK  473

Query  3579  AKFNQSS  3599
             AK  + +
Sbjct  474   AKVQEKT  480



>ref|XP_002879636.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55895.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=487

 Score =   520 bits (1338),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 255/478 (53%), Positives = 349/478 (73%), Gaps = 15/478 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K H +++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  A  G       D
Sbjct  6     SRKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHHGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             IF+ AR+SG LDIRYTT++DGFPL FDR+ +   F  G+++VFSAHVD+L+  L+  + P
Sbjct  62    IFSSARSSGKLDIRYTTVTDGFPLDFDRSLNHDQFFEGILHVFSAHVDDLIATLSHRDDP  121

Query  2526  P-TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF   D RKD 
Sbjct  122   PVTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRKDV  181

Query  2703  IDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             IDY+PGV+AI+P+DL  YLQ   ++ +T + VY  ++K F+D K+AD V+CNTVQELEP+
Sbjct  182   IDYVPGVKAIDPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVLCNTVQELEPE  241

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             ++SAL+ KQP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH+
Sbjct  242   SLSALQAKQPVYAIGPVFS---TESVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I+E+  GL+LS ++FIWVLRP +  +DE DF   GF +  +DRGL+V WC Q AVI
Sbjct  299   GKKEIVEIAHGLLLSGISFIWVLRPDIVGSDEPDFLPVGFVDQAQDRGLVVQWCCQMAVI  358

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             S+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W IGI+LC  + K+
Sbjct  359   SNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWCIGIDLC--EKKT  416

Query  3414  ISKEEVASKV-KFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             I++++V+  V + +M  E+S ELR  ++ V+++L++A+ + GSS  N + F+ +++ +
Sbjct  417   ITRDQVSENVRRLMMNGETSCELRNNVEKVKRHLKDAVTAVGSSETNFNTFIGEVRDR  474



>ref|NP_181234.1| UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 sp|Q9SJL0.1|U86A1_ARATH RecName: Full=UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 gb|AAD31582.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAL06924.1| At2g36970/T1J8.15 [Arabidopsis thaliana]
 gb|AAM91353.1| At2g36970/T1J8.15 [Arabidopsis thaliana]
 gb|AEC09329.1| UDP-glycosyltransferase 86A1 [Arabidopsis thaliana]
 gb|AHL38804.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=490

 Score =   520 bits (1338),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 256/477 (54%), Positives = 347/477 (73%), Gaps = 14/477 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K H +++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  A +        D
Sbjct  6     SRKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHQDDA----GD  61

Query  2349  IFTQARNSGL-DIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             IF+ AR+SG  DIRYTT+SDGFPL FDR+ +   F  G+++VFSAHVD+L+ KL+  + P
Sbjct  62    IFSAARSSGQHDIRYTTVSDGFPLDFDRSLNHDQFFEGILHVFSAHVDDLIAKLSRRDDP  121

Query  2526  P-TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF   D RKD 
Sbjct  122   PVTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRKDV  181

Query  2703  IDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             IDY+PGV+AIEP+DL  YLQ   ++ +T + VY  ++K F+D K+AD V+CNTVQELEP 
Sbjct  182   IDYVPGVKAIEPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVVCNTVQELEPD  241

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             ++SAL+ KQP YAIGP+F    T+     SL  ESDC +WL  +P GSVLY SFGS AH+
Sbjct  242   SLSALQAKQPVYAIGPVFS---TDSVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHV  298

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ I+E+  GL+LS ++FIWVLRP +  ++  DF   GF +  +DRGL+V WC Q  VI
Sbjct  299   GKKEIVEIAHGLLLSGISFIWVLRPDIVGSNVPDFLPAGFVDQAQDRGLVVQWCCQMEVI  358

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             S+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W IGINLC  + K+
Sbjct  359   SNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWCIGINLC--EKKT  416

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             I++++V++ VK LM  E+S ELR  ++ V+++L++A+ + GSS  N + FV +++ +
Sbjct  417   ITRDQVSANVKRLMNGETSSELRNNVEKVKRHLKDAVTTVGSSETNFNLFVSEVRNR  473



>ref|XP_004295617.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   519 bits (1336),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 339/475 (71%), Gaps = 10/475 (2%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
             +N K HAI +P P QGH+ P++ L+I LASRGF +TFVNT+ I     KA+  T      
Sbjct  5     DNLKPHAIFIPYPLQGHVIPSVELAIKLASRGFKITFVNTQSIHHHTSKAQPKTG----G  60

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE--  2519
             ++F  AR +G DI YTT+SDG P+ FDR+ +   FM  +++VFSAHVDELV KL      
Sbjct  61    NLFAAAREAGQDIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVDELVGKLVKSSVN  120

Query  2520  -PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
               P TCLIAD+F+ WP  +A KY+L+ VSF+TEPALV+++  H+DLL++NGHF C D R+
Sbjct  121   TAPVTCLIADTFFVWPGKVAKKYDLLYVSFWTEPALVYSLYFHVDLLRKNGHFACHDVRE  180

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D I+YIPGV++I+P D+  YLQ + N T+  +  ++  F+D +++  V+CNTV+E+E +T
Sbjct  181   DDINYIPGVKSIDPSDMMSYLQ-DANVTTVCHQIIFNAFKDVRESHYVLCNTVEEIESET  239

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             I+ L  K PFYAIGPLFP  F +     SL  ESD  +WL++KP GSVLY SFGS AH++
Sbjct  240   ITPLHAKIPFYAIGPLFPNRFNKSIVATSLWSESDRSQWLNTKPQGSVLYVSFGSYAHVS  299

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+  GL LS+VNF+WVLRP +  +++ D    GF+E   DRG+I+ WC Q +V++
Sbjct  300   KRDLIEIADGLELSKVNFVWVLRPDIVSSEDTDPLPSGFKERTSDRGIIIQWCCQKSVLA  359

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPA+GGF+THCGWNS LESIWCSVP++C+PL+ DQ TNRKL+VD+WK+G NLC  D K +
Sbjct  360   HPAIGGFLTHCGWNSTLESIWCSVPLLCFPLLTDQFTNRKLIVDDWKVGTNLC--DWKVV  417

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKA  3581
              KE V++K+  LM  +S  E RKA+  VRK +ENAL  NGSS +N+D F++ +KA
Sbjct  418   KKEVVSNKINHLMDVKSGDEFRKAVAKVRKTMENALKPNGSSEQNIDTFIKDLKA  472



>ref|XP_009376097.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=480

 Score =   518 bits (1334),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 249/477 (52%), Positives = 345/477 (72%), Gaps = 11/477 (2%)
 Frame = +3

Query  2166  NNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             N QK  HAI +  P QGH+ P++HL+I LAS GF +TF+NT  I     KA+  +   P 
Sbjct  10    NRQKRPHAIFIAYPLQGHVIPSVHLAIKLASHGFKITFINTHFIQHHTSKAQPKSAGNP-  68

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL---AG  2513
                F     SGL+I YTT+SDG P+ FDR+ +   FM  +++VFSAHV+E+V K+   + 
Sbjct  69    ---FAYLHESGLNIDYTTVSDGLPVEFDRSLNHDQFMASLLHVFSAHVEEVVGKVVKSSA  125

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
                P TC+IAD+F+ WPS IA K+ ++ VSF+TEPALVF++  HLDLL+ +GHF C+D R
Sbjct  126   DTTPVTCIIADTFFVWPSKIARKFGIIYVSFWTEPALVFSLYYHLDLLRRHGHFACQDVR  185

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDYIPGV AI+P+D+  YLQ + +TTS  +  ++  F+DA+ A   +CNTVQE+E +
Sbjct  186   EDTIDYIPGVRAIDPKDMMSYLQ-DTDTTSVCHQIIFNAFKDARGAHFHLCNTVQEIESE  244

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISAL+ K  FYAIGP+FP  F++  A RSL  ESDC +WL++KP GSVLY SFGS AH+
Sbjct  245   TISALQAKMKFYAIGPIFPTIFSKNIAARSLWSESDCTQWLNTKPHGSVLYVSFGSYAHV  304

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
              K+ ++E+  GL LS+VNF+WVLRP +  +++ D    GF++ V+DR +++PWC Q AV+
Sbjct  305   AKKDLIEIANGLKLSKVNFVWVLRPDIVSSNDTDPLPLGFRDDVKDRSIVIPWCSQKAVL  364

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             +HPA+GGF+THCGWNS LESIWC VP++C+PL+ DQ TNRKL+VD+WK+GINLCN   + 
Sbjct  365   AHPAIGGFLTHCGWNSTLESIWCGVPLLCFPLLTDQFTNRKLIVDDWKVGINLCN--RRV  422

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +SKEEV+ K+  LM  +S  E R+A+  V+  LE+AL  NGSS KN+D F++ +KAK
Sbjct  423   VSKEEVSEKINRLMDGKSGHEYRRAVVKVKNTLEDALTPNGSSEKNMDNFIKDLKAK  479



>ref|XP_008350360.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=477

 Score =   518 bits (1333),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 251/468 (54%), Positives = 332/468 (71%), Gaps = 4/468 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P+P QGH+ P  HL+  LAS+GFT+TFVNT+ I   I+K++    T   DDIF  
Sbjct  9     HAIMVPLPLQGHVTPLTHLATKLASQGFTITFVNTQYIHHHILKSQPNDNTE--DDIFAT  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             AR SGLDIRYTT+SDGFPL F+R  +    + G ++VF AHVDELV  L   +P  TCLI
Sbjct  67    ARKSGLDIRYTTVSDGFPLAFNRIQNLDQSLEGALHVFPAHVDELVGBLVQSDPSITCLI  126

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F +W + IA+KYNL+++SF+TEPALVF I  HLDLL++NGHFG  D R+D IDYIPG
Sbjct  127   VDTFQSWSATIANKYNLIHISFWTEPALVFNIYYHLDLLQKNGHFGSHDNREDIIDYIPG  186

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             V+AIEP+DL  ++Q   +    +  T YK F + KKAD ++CNTVQELE +++SAL+ KQ
Sbjct  187   VKAIEPKDLMSHIQ-STDLFCPMLRTFYKSFREVKKADFILCNTVQELEFESLSALQAKQ  245

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             P Y IGP+FP + T+     +L+PE DC  WL  KP GSVL+ SFGS A +TK+   E+ 
Sbjct  246   PTYPIGPVFPDNLTKNIVATNLMPEFDCIHWLHEKPHGSVLFISFGSYAQVTKDDFEEIA  305

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              GL+LS+VNFIWVLR      DE      GF++ ++DRGL+VPWC Q  V+SHPAVGGF+
Sbjct  306   HGLLLSKVNFIWVLRSDTTGYDETYILPVGFEDEIKDRGLMVPWCSQIEVLSHPAVGGFL  365

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNSILES+ C VPM+C+PL+ DQ TNRKLVVD+W +G+NLC D  K + + +VA K
Sbjct  366   THCGWNSILESMRCGVPMLCFPLVADQITNRKLVVDDWGVGLNLC-DRVKPVRRVDVAEK  424

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  L+  ES   L+K +  V + LE+A+  NGSS KN+ +F+  +K K
Sbjct  425   INRLICGESGDGLQKKVMKVTQTLEDAVALNGSSQKNLSQFISNVKEK  472



>ref|XP_004145815.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Cucumis sativus]
 gb|KGN46865.1| hypothetical protein Csa_6G147580 [Cucumis sativus]
Length=482

 Score =   518 bits (1333),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 343/470 (73%), Gaps = 8/470 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             NQK HAI +  P QGH+ P++HL+I+LA+RGF VTF+NT  I     +   G ++A  DD
Sbjct  7     NQKPHAIFIAYPLQGHVIPSVHLAIHLAARGFIVTFINTHAIHQ---QTCNGHSSA-GDD  62

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             +F+  R SGLDIRY T+SDG P+GFDR+ +   FM  +++VFSAHV+E V+++   E   
Sbjct  63    LFSAVRKSGLDIRYKTVSDGLPVGFDRSLNHDQFMGSLLHVFSAHVEEAVERIVKTEAV-  121

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
             +CLIAD+F+ WPS +A K++L+ VSF+TEPALVF +  HL+LL+ N HF C+D R D+ID
Sbjct  122   SCLIADTFFVWPSKVAKKFDLLYVSFWTEPALVFTLYYHLNLLRINRHFDCQDIRDDAID  181

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             YIPGV  I P+D+  YLQ E++TTS  +  +   F+D +KAD V+CNT+Q+LE  TISAL
Sbjct  182   YIPGVPTINPQDMTSYLQ-ESDTTSVCHQIISAAFQDVRKADFVLCNTIQDLENDTISAL  240

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
             + +  FYAIGP+FP  FT+ +   SL PESDC  WL+SKP  SVLY SFGS AH+TK  +
Sbjct  241   QAQTQFYAIGPVFPPGFTKSSVPTSLWPESDCTNWLNSKPHTSVLYVSFGSYAHVTKSEL  300

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
              E+  GL LS V+FIWVLRP +  ++E +    GF+  V DR +IVPWCHQ  V++HPA+
Sbjct  301   TEIAHGLSLSGVHFIWVLRPDIVSSNETEPLPVGFRAEVADRSMIVPWCHQKQVLAHPAI  360

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             GGF+THCGWNS+LES WC VP++C+PL+ DQ TNRKLVV++WK+GINL  D  + I+KE+
Sbjct  361   GGFLTHCGWNSVLESTWCGVPLLCFPLLTDQFTNRKLVVEDWKVGINL-KDGRQMITKEK  419

Query  3429  VASKVKFLMKAES-SIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
             V+ ++K LM A+S S + + A+++VRK LE+A+  NGSS K  ++F++ +
Sbjct  420   VSERIKHLMDAKSGSRQYKDAVREVRKKLEDAVKPNGSSDKATNQFIKDL  469



>ref|XP_011089946.1| PREDICTED: UDP-glycosyltransferase 86A2 [Sesamum indicum]
Length=487

 Score =   517 bits (1332),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/494 (52%), Positives = 346/494 (70%), Gaps = 19/494 (4%)
 Frame = +3

Query  2148  FRKMVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGT  2327
              ++MV+  +K HAI++  P QGH+NP++HL+INLASRGFT+TF+NT  I   I      +
Sbjct  1     MKEMVDAREKPHAILVSYPLQGHVNPSVHLAINLASRGFTITFINTHSIHHQIT-----S  55

Query  2328  TTAPTD---DIFTQARNS-GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDEL  2495
             T++  D   DIF++ R S GLDIRY T+SDG P+GFDR+     FM  +++VFSAHV+E 
Sbjct  56    TSSAADGEGDIFSELRQSHGLDIRYATVSDGLPVGFDRSLHHDQFMAALLHVFSAHVEEA  115

Query  2496  VKKLA-GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH  2672
             ++K+    +P   CLIAD+++ WP  +A KY L+ VSF+TE AL+F +  H+DLL+ NGH
Sbjct  116   IEKIVRHSQPAVNCLIADTYFVWPGKLAKKYGLLYVSFWTEAALIFTLYYHMDLLRLNGH  175

Query  2673  FGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNT  2852
             FGC D R+D I YIPGVE+IEP+DL  +LQ E +TT+  +  +YK F DAK AD V+CNT
Sbjct  176   FGCVDTREDEIKYIPGVESIEPKDLTSFLQ-ETDTTTVCHQIIYKAFMDAKTADFVLCNT  234

Query  2853  VQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPP------G  3014
             VQELE +TISAL++K PF+A+GP+F   FT  T   SL  ESDC +WLDSKP       G
Sbjct  235   VQELEHETISALQQKIPFFAVGPVFSTGFTRTTITTSLWAESDCSRWLDSKPHAHGSPHG  294

Query  3015  SVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDR  3194
             SVLY SFGS AH+ K  ++E+ +GL+LS+V+FIW LRP +  +D+     DGF E   + 
Sbjct  295   SVLYVSFGSYAHVAKGDLIEIAKGLLLSKVDFIWALRPDIVSSDDQTPLPDGFIEETGEH  354

Query  3195  GLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEW  3374
             G+I+PWC Q  V++HPAVGGF+THCGWNS+LESIW  VPM+C+PL  DQ TNRKLVVD+W
Sbjct  355   GVIIPWCCQTQVLAHPAVGGFLTHCGWNSVLESIWFQVPMLCFPLYTDQFTNRKLVVDDW  414

Query  3375  KIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNV  3554
             KIGINLC  D   ++  EVA K+  L +     E+R +IK+V+   E AL S GSS  N+
Sbjct  415   KIGINLC--DKVRVTSVEVAEKINQLKEGTIGDEVRVSIKNVKSTSEKALASEGSSEMNI  472

Query  3555  DKFVEKIKAKFNQS  3596
              +F+ KI+ +  ++
Sbjct  473   GRFIRKIEGRIREN  486



>gb|KDP43993.1| hypothetical protein JCGZ_05460 [Jatropha curcas]
Length=491

 Score =   517 bits (1332),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/483 (52%), Positives = 339/483 (70%), Gaps = 11/483 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +  ++ HAI +P P QGH+ P++HL+I LAS+GFT+TF+NT+ I     KA  G+T  
Sbjct  1     MADKPKRPHAIFIPYPLQGHVIPSVHLAIKLASQGFTITFINTQYIHQQTSKA--GSTAG  58

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
             P  D+FT+ R SGLDIRYTT+SDG P+GFDR+ +   FM  +++VFSAHV+E+V ++   
Sbjct  59    P--DLFTKVRGSGLDIRYTTVSDGLPIGFDRSLNHDQFMAALLHVFSAHVEEVVGQIIAS  116

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCK----  2684
                  CLIAD+F+ WPS +A K+ L+ VSF+TE ALVF +  HLDLL+ NGHF C     
Sbjct  117   GEDVHCLIADTFFVWPSKVAKKFGLLYVSFWTEAALVFTLYYHLDLLRINGHFDCNGFVS  176

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             D R+D I+ IPGV+AIE +D   YLQ E + TS  +  ++  FED K AD V+CNTV+EL
Sbjct  177   DRREDVINCIPGVKAIELKDTMSYLQ-EKDATSVCHQIIFNCFEDTKNADFVLCNTVEEL  235

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             EP+TISAL+ K P+YAIGP+F   F++     SL  ESDC +WLD +P GSVLY SFGS 
Sbjct  236   EPETISALKAKIPYYAIGPIFSSDFSKTIVVTSLWSESDCTQWLDKRPNGSVLYVSFGSY  295

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQP  3224
             AH+TK  ++++  GL LS+V+F+WVLRP +  +D+ +    G+ E V DR +I+PWC Q 
Sbjct  296   AHVTKRDLLDIAAGLALSKVSFVWVLRPDIVSSDDANPLPAGYHEEVSDRAMIIPWCSQK  355

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              V++HPA+GGF+THCGWNS LESIWC VP++C+PL  DQ TNRK VVD+WKIGINL +  
Sbjct  356   EVLTHPAIGGFLTHCGWNSTLESIWCEVPLLCFPLYTDQFTNRKFVVDDWKIGINLSS--  413

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              K I+K+EV+  +  LM  ES  E R  IK+V+K LENA+   GSS KN+ +F++ +  K
Sbjct  414   KKVITKDEVSENINRLMCGESKDEFRNRIKEVKKTLENAVSPTGSSEKNMVQFIKDLGTK  473

Query  3585  FNQ  3593
               +
Sbjct  474   IEK  476



>emb|CDX74999.1| BnaA05g07450D [Brassica napus]
Length=484

 Score =   516 bits (1330),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 342/479 (71%), Gaps = 15/479 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF++AR+SG LDIRYTT+SDGFPL FDR+ +   F  G+++VF AHVD+L+ K++  G +
Sbjct  62    IFSEARSSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGIIHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TCLI D+FY W S+I  K+NLVNVSF+TEPALV  +  H+ LL  NGHF   D R+D
Sbjct  122   PPVTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHMHLLISNGHFKSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDYIPGV AIEP+DL  YLQ   ++ +TT+ VY  ++K F D KKAD V+CNT+QELEP
Sbjct  182   VIDYIPGVNAIEPKDLMSYLQVSDKDVDTTTVVYRIIFKAFTDVKKADFVLCNTIQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++S L+  QP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   DSLSVLQANQPVYAIGPVFS---TESVVPTSLWTESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS ++FIWVLRP +  +D  DF    F +    RG++V WC Q AV
Sbjct  299   VGKKEIVEIAHGLLLSGLSFIWVLRPDIVSSDVPDFLPTRFMDQAEGRGIVVQWCCQKAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+P +GGF+THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINLC  D K
Sbjct  359   ISNPVIGGFLTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWQIGINLC--DKK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              ++++EV+  +K LM  E+S ELR  ++ V+ ++++A+ S GSS  N + FV  ++ K 
Sbjct  417   MVTRDEVSVNIKRLMNQETSSELRSNVEKVKCHIKDAVTSVGSSDTNFNSFVGDVRDKI  475



>ref|XP_009334655.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   515 bits (1327),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 330/468 (71%), Gaps = 4/468 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P+P QGH+ P  HL+  LAS+GFT+TFVNT  I   I+K++    T   DDIF  
Sbjct  9     HAIMVPLPLQGHVIPFTHLATKLASQGFTITFVNTHYIHHHILKSQPNDKTE--DDIFAI  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             +R SGLDIRYTT+SDGFPL F+R  +   F+ G ++VF AHVDELV  L   +P  TCLI
Sbjct  67    SRKSGLDIRYTTVSDGFPLAFNRFQNLDQFLEGALHVFPAHVDELVGDLVQSDPSITCLI  126

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F +W + IA+KYNL+++SF+TEPALV  I  HLDLL++NGHFG  D R+D IDYIP 
Sbjct  127   VDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHDNREDIIDYIPS  186

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             V+AIEP+DL  YLQ   +    +    YK F + K+AD ++CNTVQELE +++SAL+ KQ
Sbjct  187   VKAIEPKDLMSYLQT-TDIFCPMLRIYYKAFREVKRADFILCNTVQELEFESLSALQAKQ  245

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             P YAIGP+ P S T      +L+PE DC  WL  KP GSVL+ SFGS A +TK+   E+ 
Sbjct  246   PTYAIGPVLPDSLTNNIVATNLMPEFDCIHWLHKKPHGSVLFISFGSYAQVTKDDFEEIA  305

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              GL+LS+VNFIWVLRP     DE      GF++ ++DRGL+V WC Q  V+SHPAVGGF+
Sbjct  306   HGLLLSKVNFIWVLRPDTTGYDETYILPVGFEDEIKDRGLMVSWCSQIEVLSHPAVGGFL  365

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNS+LES+ C VPM+C+PL+ DQ TNRKLVVD+W +G+NLC D  K + + EVA K
Sbjct  366   THCGWNSVLESMRCGVPMLCFPLVADQITNRKLVVDDWGVGLNLC-DRVKPVRRVEVAEK  424

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  L+  +S   L+K IK VR+ LE+AL  NGSS +N+ +F+  +K K
Sbjct  425   INRLICGKSGDGLQKKIKKVRQTLEDALAVNGSSERNLSQFICGVKEK  472



>ref|XP_009143540.1| PREDICTED: UDP-glycosyltransferase 86A1 [Brassica rapa]
Length=484

 Score =   514 bits (1323),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 254/479 (53%), Positives = 341/479 (71%), Gaps = 15/479 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHQISTARQGDA----GD  61

Query  2349  IFTQARNS-GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF++AR+S  LDIRYTT+SDGFPL FDR+ +   F  G+++VF AHVD+L+ K++  G +
Sbjct  62    IFSEARSSENLDIRYTTVSDGFPLEFDRSLNHDQFFEGIIHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TCLI D+FY W S+I  K+NLVNVSF+TEPALV  +  H+ LL  NGHF   D R+D
Sbjct  122   PPVTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHMHLLISNGHFKSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDYIPGV AIEP+DL  YLQ   ++ +T + VY  ++K F D KKAD V+CNTVQELEP
Sbjct  182   VIDYIPGVNAIEPKDLMSYLQVSDKDVDTNTVVYRIIFKAFTDVKKADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+  QP YAIGP+     +E     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   DSLSALQANQPVYAIGPVIS---SESVVPTSLWTESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS  +FIWVLRP +  +D  DF   GF +    RG++V WC Q AV
Sbjct  299   VGKKEIVEIAHGLLLSGFSFIWVLRPDIVSSDVPDFLPTGFMDQAEGRGIVVQWCCQKAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+P +GGF+THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINLC  D K
Sbjct  359   ISNPVIGGFLTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWQIGINLC--DKK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              ++++EV+  +K LM  E+S ELR  ++ V+ ++++A+ S GSS  N + FV +++ K 
Sbjct  417   MVTRDEVSVNIKRLMNQETSSELRSNVEKVKCHIKDAVTSVGSSDTNFNSFVGEVRDKI  475



>ref|XP_006345817.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=488

 Score =   513 bits (1322),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 345/483 (71%), Gaps = 10/483 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E N K HAI++P+P QGHI   I+L+I LAS+G T+TFVNT +    ++KA+  +  +  
Sbjct  4     EENIKLHAIMIPVPLQGHIVQFINLAIKLASKGLTITFVNTHITHQRLMKAQPVSENSSD  63

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG---  2513
              +IF++A+ SGLDIRYTTISDGFPL FDR  +   FM G+ +VFS HVD+L+  L     
Sbjct  64    YNIFSEAQKSGLDIRYTTISDGFPLNFDRMGNHDQFMEGLFHVFSTHVDDLIGNLVNSNN  123

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
               PP + LIAD+F+ WPS IA KY+LVN+SFFTE AL F    H+DLLK NGHFG +D R
Sbjct  124   QNPPVSFLIADTFFVWPSAIAKKYDLVNISFFTEAALAFTSYYHMDLLKINGHFGSQDNR  183

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDYIPGV+AIE  DLP Y+Q ++     ++  ++K  EDA KAD++ICNTVQELE  
Sbjct  184   EDTIDYIPGVQAIELGDLPSYIQ-DSEPWGTMHRYIFKSLEDAGKADMIICNTVQELESS  242

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TI+AL+EK+PFYA+GP+FP  FT+ T   +L  ESD  +WL+ KP GSV+Y SFGSLA++
Sbjct  243   TIAALQEKKPFYALGPIFPNGFTKSTIPTNLRMESDPTRWLNGKPKGSVMYISFGSLANI  302

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +++ I+E+  GL+LS V+FIWV+RP +  + E +     F++ V+DRGL+V WC Q  VI
Sbjct  303   SRQDILEMAHGLLLSRVSFIWVVRPDITWSLESNLLPPRFEDDVKDRGLVVSWCSQIDVI  362

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF+THCGWNS+LES WC VPM+C+P+  DQ TNRKLVV+EWK+G +L +   + 
Sbjct  363   SHPAIGGFLTHCGWNSVLESSWCKVPMLCFPIFTDQFTNRKLVVNEWKVGFDLSS--GRI  420

Query  3414  ISKEEVASKVK-FLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             + + E+A K+  F+ +A    +LR  +++ RK LE+AL  NGSS +N  + +  IK+K  
Sbjct  421   LKRHEIAQKIDCFITEAN---KLRINLEETRKKLEDALSENGSSGRNYKQLICDIKSKIQ  477

Query  3591  QSS  3599
             Q S
Sbjct  478   QKS  480



>ref|XP_008359642.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=522

 Score =   514 bits (1325),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 329/468 (70%), Gaps = 4/468 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P+P QGH+ P  HL+  LAS+GFT+TFVNT+ I   I+K++    T   DDIF  
Sbjct  54    HAIMVPLPLQGHVIPFTHLATKLASQGFTLTFVNTQYIHHHILKSQPNDKTE--DDIFAT  111

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             AR SGLDIRYTT+SDGFPL FDR  +   F+ G ++VF AHVDELV  L    P  TCLI
Sbjct  112   ARKSGLDIRYTTVSDGFPLAFDRFQNLDQFLEGTLHVFPAHVDELVGDLVQSXPSITCLI  171

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F +W + IA+KYNL+++SF+TEPALV  I  HLDLL++NGHFG  D R+D IDYIP 
Sbjct  172   VDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHDNREDIIDYIPS  231

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             V+AIEPRDL   LQ  +     + +  YK F + K+AD ++CNTVQELE +++SAL+ KQ
Sbjct  232   VKAIEPRDLMSXLQTTDLFCPMLRI-FYKAFREVKRADFILCNTVQELEFESLSALQAKQ  290

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             P YAIGP+FP S T+     +L+PE DC  WL  KP GSVL+ S  S A +TK+   E+ 
Sbjct  291   PTYAIGPVFPDSLTKNIVATNLMPEFDCIHWLHKKPHGSVLFISXXSYAQVTKDDFEEIA  350

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              GL+LSEVNFIWVLRP     DE      GF++ ++DRGL+VPWC Q  V+SHPAVGGF+
Sbjct  351   YGLLLSEVNFIWVLRPDTTGYDETYILPVGFEDEIKDRGLMVPWCSQIEVLSHPAVGGFL  410

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNSILES+ C VPM+C+PL+ DQ TNRKLVVD+W +G+NLC D  K + + +VA K
Sbjct  411   THCGWNSILESMRCGVPMLCFPLVADQITNRKLVVDDWGVGLNLC-DRVKPVRRVDVAEK  469

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  L+  ES   L+K +  V + LE+A+  NGSS KN+ +F+  +K K
Sbjct  470   INRLICGESGDGLQKKVMKVTQTLEDAVALNGSSQKNLSQFISNVKEK  517



>ref|XP_010107481.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16163.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=489

 Score =   513 bits (1320),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 251/477 (53%), Positives = 333/477 (70%), Gaps = 6/477 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD--  2345
             +K HAI++P+ YQGH+ P+++L+I LAS+GF +TFVNTE++   I K++   TT   +  
Sbjct  7     KKPHAIMIPLHYQGHVTPSVNLAIKLASKGFIITFVNTEIVHHQITKSKSFNTTELEEKD  66

Query  2346  -DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
              DIF  AR SGLDIRY T+SDGFPL FDR  +A  F  G ++VF AHVDELV  L   +P
Sbjct  67    RDIFAGARKSGLDIRYKTVSDGFPLSFDRFLNAKQFGEGSLHVFPAHVDELVGNLVREDP  126

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
               +CLIAD+F+ W S IA KY L+NVSF+TEPALVF +  H+DLL +NGHF   D R+D+
Sbjct  127   SVSCLIADTFFTWTSWIAKKYKLINVSFWTEPALVFTLYYHVDLLIQNGHFASNDNREDT  186

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             I+YIPGV+AIEP+DLP + Q   +T +  +  +YK FED K AD ++CNTVQELE  TIS
Sbjct  187   IEYIPGVKAIEPKDLPSFFQS-TDTNTLRHRIIYKSFEDVKAADFILCNTVQELESDTIS  245

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             A+++KQP YAIGP+ P  FT+     SL  E DC +WL+SKP GSVLY SFGS     K 
Sbjct  246   AIQDKQPIYAIGPVLPSEFTKSIVPTSLKAEFDCSQWLNSKPQGSVLYVSFGSALPSKKS  305

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              I E+  GL LS VNFIWVLRP     +E        ++ ++D+GLIV WC+Q  VIS+P
Sbjct  306   DIEEIAHGLALSGVNFIWVLRPDAVSYEEPYVLPLEIEDKIKDKGLIVQWCNQVEVISNP  365

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             A+GGF+THCGWNS++ES+ C VP++C+PL  DQPTNRKLVVD+ ++GINLC  +   +++
Sbjct  366   AIGGFLTHCGWNSVMESLRCGVPLLCFPLFTDQPTNRKLVVDDLRVGINLCIRE--PLTR  423

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
              EVA K+  LM  +S+ ELRK    VR   E AL   GSS KN+ +F++ +K K ++
Sbjct  424   SEVAQKINRLMSGKSAEELRKETMKVRSTSEKALAIAGSSEKNLCQFIDDVKDKISE  480



>gb|KFK36574.1| hypothetical protein AALP_AA4G141300 [Arabis alpina]
Length=488

 Score =   512 bits (1318),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 340/478 (71%), Gaps = 15/478 (3%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             +K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR G       +I
Sbjct  7     RKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARHGDA----GNI  62

Query  2352  FTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             F+ A +SG LDIRY T+SDGFPL FDR+ +   F  G+++VFSAHVD+L+ K++  + PP
Sbjct  63    FSAACSSGHLDIRYITVSDGFPLAFDRSLNHDQFFEGILHVFSAHVDDLITKISNRDDPP  122

Query  2529  -TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
              TC+IAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF   D R+D I
Sbjct  123   VTCMIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYHMDLLIANGHFKSLDNREDVI  182

Query  2706  DYIPGVEAIEPRDLPLYLQQEN---NTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             DYIPGV+AI+P+DL  YLQ  N   +T + VY  + K F+D K+AD V+CNTVQELEP +
Sbjct  183   DYIPGVKAIDPKDLMSYLQVRNKDVDTNTVVYRILDKAFKDVKRADFVLCNTVQELEPGS  242

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL+ KQP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH+ 
Sbjct  243   LSALQAKQPVYAIGPVFS---TESVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAHVG  299

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  I+E+  GL+LS  +FIWVLRP +  ++  DF   GF    + RGL+V WC Q AVI+
Sbjct  300   KTEIIEIAHGLLLSGFSFIWVLRPDIVGSNVPDFLPPGFTAQAQGRGLVVQWCCQMAVIT  359

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             +P +GGF+THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINLC  + K  
Sbjct  360   NPPIGGFLTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWRIGINLC--EKKMT  417

Query  3417  SKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             +++EVA+ VK LM   E+S ELR  ++ V+ +L+NA+ +NGSS  N + FV ++  K 
Sbjct  418   TRDEVAANVKRLMTNGETSSELRNNVEKVKSHLKNAVTTNGSSETNFNSFVGEVGDKI  475



>ref|XP_004239693.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=483

 Score =   511 bits (1315),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 343/482 (71%), Gaps = 11/482 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E N K HAI++P+P QGHI   I+L+I LAS+G T+TFVNT +    ++KA+  + ++  
Sbjct  4     EENIKPHAIMIPVPLQGHIVQFINLAIKLASKGLTITFVNTHITHQRLMKAQSVSESSSD  63

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGL  2516
              +IF++A+ SGLDIRYTTISDGFPL FDR  +   FM G+ +VFS HVD+L+  L  +  
Sbjct  64    YNIFSEAQKSGLDIRYTTISDGFPLNFDRMGNHDQFMEGLFHVFSTHVDDLIGNLVNSNH  123

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP +CLIAD+F+ WPS+IA KY+L+N+SFFTE AL F    H+DLL  NGHFG +D R+
Sbjct  124   NPPVSCLIADTFFVWPSVIAKKYDLLNISFFTEAALAFTSYYHMDLLTLNGHFGSQDNRE  183

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+IDYIPGV+AIEP DLP Y+Q ++     ++  ++K  EDA+ AD++ICNTVQELE  T
Sbjct  184   DTIDYIPGVQAIEPGDLPSYIQ-DSEPWDTMHRYIFKSLEDARNADMIICNTVQELESST  242

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTA--FRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             ISAL+EK+PFYA+GP+FP  FT  T     +L  ESD  +WL++KP GSV+Y SFGSLA 
Sbjct  243   ISALQEKKPFYALGPVFPNGFTNNTTPTKSNLWMESDTTEWLNAKPKGSVMYISFGSLAK  302

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +++ I+E+  GL+LS V+FIWV+RP +  + E +   + F+  V+DRGL+V WC+Q  V
Sbjct  303   SSRQDILEMAHGLLLSRVSFIWVVRPDITWSLESNLLPERFEHDVKDRGLVVSWCNQIDV  362

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             ISH A+GGF+THCGWNS+LES WC VPM+C+P+  DQ TNRKLVV EWK+G +L +   +
Sbjct  363   ISHRAIGGFLTHCGWNSVLESSWCKVPMLCFPIFTDQFTNRKLVVREWKVGFDLSS--GR  420

Query  3411  SISKEEVASKVK-FLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              + ++E+A K+  F+ +A    +LR  +   RK LE+AL  NGSS +N  + +  I +K 
Sbjct  421   ILKRQEIAQKLDCFITEAN---QLRINLDKTRKKLEDALSENGSSGRNYKQLICDINSKI  477

Query  3588  NQ  3593
              Q
Sbjct  478   QQ  479



>ref|XP_009143541.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Brassica rapa]
Length=479

 Score =   509 bits (1312),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 341/478 (71%), Gaps = 15/478 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHQISTARQGDA----GD  61

Query  2349  IFTQARNS-GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF++AR+S  LDIRYTT+SDGFPL FDR+ +   F  G+ +VF AHVD+L+ K++  G +
Sbjct  62    IFSEARSSENLDIRYTTVSDGFPLEFDRSLNHDQFFEGLFHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TC IAD+FY W S+I +K+NLVNVSF+T+PAL   I  HL LL  NGHF   D R+D
Sbjct  122   PPVTCFIADTFYVWSSMICNKHNLVNVSFWTQPALALNIYYHLHLLISNGHFNSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDYIPGV+AI+P+DL  YLQ   ++ +T   VY  +++ F D KKAD V+CNTVQELEP
Sbjct  182   VIDYIPGVKAIDPKDLMSYLQVSDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+  QP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   DSLSALQANQPVYAIGPVFS---TELVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS V+FIWVLRP +  +D  DF   GF +  + RG++V WC Q AV
Sbjct  299   VGKKEIVEIAHGLLLSGVSFIWVLRPDIVSSDVQDFLPTGFMDRAQSRGIVVQWCCQMAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+PA+GGF+T CGWNS+LES+WC +P++CYPL+ DQ TNRKLVVD+W+ GINLC  ++K
Sbjct  359   ISNPAIGGFLTQCGWNSVLESVWCGLPLLCYPLLNDQFTNRKLVVDDWRTGINLC--ENK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              ++++EV+  +K LM  E+  ELR  ++ V +++++A+ + GSS  N + FV  ++ +
Sbjct  417   MVTRDEVSVNIKRLMNEETLSELRSNVEKVNRHIKDAVTTVGSSEINFNSFVSDVQDR  474



>ref|XP_006410874.1| hypothetical protein EUTSA_v10016577mg [Eutrema salsugineum]
 gb|ESQ52327.1| hypothetical protein EUTSA_v10016577mg [Eutrema salsugineum]
Length=488

 Score =   510 bits (1313),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 347/480 (72%), Gaps = 16/480 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  A  G       D
Sbjct  6     SKKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTALHGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE--  2519
             IF+ A +SG LDIRYTT+SDGFPLGFDR+ +   F  G+++VFSAHVD+L+ K+A  +  
Sbjct  62    IFSTACSSGHLDIRYTTVSDGFPLGFDRSLNHDQFFEGILHVFSAHVDDLIAKIARQDDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TCLIAD+FY W S+I  K+NLVNVSF+TEPALV  +  H+DLL  NGHF   D R+D
Sbjct  122   PPVTCLIADTFYVWSSVICDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDY+PGV+AIEP+DL  YLQ   ++ +T + VY  ++K F+D K+AD V+CNTVQELEP
Sbjct  182   VIDYVPGVKAIEPKDLMSYLQVSDKDIDTNTVVYRILFKAFKDVKRADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+ KQP YAIGP+F    T+     SL  ESDC +WL  +P GSVLYASFGS AH
Sbjct  242   GSLSALQAKQPVYAIGPVFS---TQSVVPTSLWAESDCTEWLKGRPAGSVLYASFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS ++FIWVLRP +  ++  DF   GF +  + RGL+V WC Q  V
Sbjct  299   VGKKEIVEIAHGLLLSGLSFIWVLRPDIVGSNVPDFLPSGFVDQAQGRGLLVQWCCQMEV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+ AVGGF+THCGWNSILES+W  +P++CYPL+ DQ TNRKLVVD+W+IGINLC  + K
Sbjct  359   ISNRAVGGFLTHCGWNSILESVWFGLPLLCYPLLTDQFTNRKLVVDDWRIGINLC--ERK  416

Query  3411  SISKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             +I++E+V++ ++ LM   E+S ELR  +  V+ +L++A+ + GSS  N + FV +++ + 
Sbjct  417   TITREQVSANIRKLMINGETSSELRNNVGKVKHHLKDAVTAVGSSETNFNSFVGEVRDRM  476



>ref|XP_009376819.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=479

 Score =   509 bits (1311),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/477 (51%), Positives = 337/477 (71%), Gaps = 2/477 (0%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M EN+ K HAI++P+P QGH+ P  +L++ LAS GFT+TFVNT+ +   + K++    + 
Sbjct  1     MEENHSKPHAIMVPLPIQGHVIPFTNLAMKLASNGFTITFVNTKCVHHQLHKSQPNNNSG  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               DDIF++ R SGLDIRYTT+SDG PL F+R  +   F+   ++VF AHVDELV  L   
Sbjct  61    DQDDIFSKVRESGLDIRYTTVSDGLPLAFNRFQNLDQFLECSLHVFPAHVDELVGDLVQS  120

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +P  TCLIAD+++ WP+ IA+KYNLV++SF+T+PALVF I  HLDLL +NGHFG +D R+
Sbjct  121   DPSITCLIADTYHCWPATIANKYNLVHISFWTQPALVFNIYYHLDLLIKNGHFGSQDNRE  180

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
              +IDYIPGV+AIEP+DL +   QE + ++ ++  +YK +E+ K AD ++CNTVQELE ++
Sbjct  181   GTIDYIPGVKAIEPKDL-MSNFQETDISTLMHRVIYKAYEEVKGADFILCNTVQELESES  239

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +SAL+EKQP YAIGP+      +     +L+ E DC +WL +KP GSVL  SFGS   +T
Sbjct  240   LSALQEKQPTYAIGPVLSNKPAKGMVATNLMSEFDCTQWLHTKPHGSVLIISFGSYGQVT  299

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K    E+  GL+LS+V+FIWVLRP     DE      GF++  +DRGL++PWC Q  V+ 
Sbjct  300   KNDFEEIAHGLLLSKVSFIWVLRPDTTSYDETCIMPVGFEDETKDRGLMIPWCSQIEVLL  359

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HP +GGF+THCGWNS+LES+ C VPM+C+PL  DQ TNRKLVVD+W IG+NLC D  K +
Sbjct  360   HPTIGGFLTHCGWNSVLESMRCGVPMLCFPLWTDQITNRKLVVDDWGIGLNLC-DTVKLV  418

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             ++ EV  K+  LM  +S   L+K IK VR+ LE+AL +NGSS +N+ +F+  +K K 
Sbjct  419   TRAEVGEKINRLMCGDSGDGLQKQIKKVRQTLEDALAANGSSERNLSQFICGVKEKI  475



>ref|XP_006350954.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=473

 Score =   509 bits (1311),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 336/473 (71%), Gaps = 10/473 (2%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P+P QGHI P  HL++ LAS+GFT+TFVNTE     I KA+   +    D+ F+ 
Sbjct  7     HAVLVPLPLQGHITPFTHLAMKLASKGFTITFVNTESTHQQIAKAQ---SLKDDDNPFSH  63

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLEPPPTC  2534
              +  GLDIRY  ISDGFPL F  + +A  F+ G+++VF AHVD+ ++ L  +   PP +C
Sbjct  64    GQKCGLDIRYAKISDGFPLSFYWSANANQFVEGLIHVFQAHVDDFIENLVLSKPNPPISC  123

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             +IADSF+ W S I+ KYNLVNVSF+TEPA V     H+DLLK NGHFGC D  +D+I Y+
Sbjct  124   IIADSFHVWGSTISKKYNLVNVSFWTEPATVLTAYYHMDLLKSNGHFGCHDKCEDTIRYL  183

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PGV+AIEP DLP Y Q  +  T  ++  V+K  EDA+KA+ VI NTVQELE   ISAL+E
Sbjct  184   PGVQAIEPTDLPSYFQDADPNT-VMHRFVFKCLEDAQKANFVIGNTVQELESSPISALQE  242

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             KQPFYAIGPLFP SFT++T   +LLP SD   WL+SK  G+VLY SFGSL +L+K+ I+E
Sbjct  243   KQPFYAIGPLFPTSFTKRTISMNLLPASDYTNWLNSKQDGTVLYISFGSLINLSKQDILE  302

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             + +G+++S+V+FIWVLR  +  ++E +    GF+E    RGL+VPWC Q AV+SHPAVGG
Sbjct  303   IAQGILISKVSFIWVLRHNILGSEERNILPLGFEEETAGRGLVVPWCSQLAVLSHPAVGG  362

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
             F+THCGWNSILESIWC VPM+C+P++ DQ TNRKLVVD+W+IG+NLC    + I +E  A
Sbjct  363   FLTHCGWNSILESIWCKVPMVCFPILTDQFTNRKLVVDDWRIGVNLCT--GRLIRREVAA  420

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
               +  +M    S ELRK I+  +  L+ AL   GSS KN+++F+E +K K  Q
Sbjct  421   ENIGRIM--SKSDELRKNIEKTKMILQKALSDEGSSEKNLNQFIEDMKNKILQ  471



>ref|XP_009376816.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=477

 Score =   509 bits (1310),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/468 (53%), Positives = 327/468 (70%), Gaps = 4/468 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P+  QGH+ P  HL++ LAS+GFT+TFVNT  I   I+K++    T   DDIF  
Sbjct  9     HAIMVPLSLQGHVIPFTHLAMKLASQGFTITFVNTHYIHHHILKSQPNDNTE--DDIFAT  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             AR SGLDIRYTT+SDGFPL FDR  +   F+ G ++VF AHVDELV  L   +P  TCLI
Sbjct  67    ARKSGLDIRYTTVSDGFPLAFDRFQNLDQFLEGALHVFPAHVDELVGDLVQSDPSITCLI  126

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F +W + IA+KYNL+++SF+TEPALV  I  HLDLL++NGHFG  D  +D IDYIP 
Sbjct  127   VDTFQSWSATIANKYNLIHISFWTEPALVLNIYYHLDLLRKNGHFGAHDNCEDIIDYIPS  186

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             V+AIEP+DL  YLQ   +    +    YK F + K+AD ++CNTVQELE +++SAL+ KQ
Sbjct  187   VKAIEPKDLMSYLQT-TDIFCPMLRIYYKAFREVKRADFILCNTVQELEFESLSALQAKQ  245

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             P YAIGP+ P S T      +L+PE DC  WL  KP GSVL+ SFGS A +TK+   E+ 
Sbjct  246   PTYAIGPVLPDSLTNNIVATNLMPEFDCIHWLHKKPHGSVLFISFGSYAQVTKDDFEEIA  305

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              GL+LS+VNFIWVLRP     DE      GF++ ++DRGL+V WC Q  V+SHPAVGGF+
Sbjct  306   HGLLLSKVNFIWVLRPDTTGYDETYILPVGFEDEIKDRGLMVSWCSQIEVLSHPAVGGFL  365

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNS++ES+ C VPM+C+PL+ DQ TNRKLVVD+W +G+NLC D  K + + EVA K
Sbjct  366   THCGWNSVMESMRCGVPMLCFPLVADQITNRKLVVDDWGVGLNLC-DRVKPVRRVEVAEK  424

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  L+  +S   L+K +  V + LE+A+  NGSS KN+ +F+  +K K
Sbjct  425   INRLICGKSGDGLQKKVMKVAQTLEDAVALNGSSQKNLSQFISNVKEK  472



>ref|XP_010557349.1| PREDICTED: UDP-glycosyltransferase 86A2 [Tarenaya hassleriana]
Length=485

 Score =   509 bits (1311),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/475 (52%), Positives = 341/475 (72%), Gaps = 6/475 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P P+QGH+NP +HL+I LAS+G TVTFVNT+ I   I         + + DIF  
Sbjct  12    HALLIPYPFQGHVNPCVHLAIKLASQGITVTFVNTDYIHHQI--TSNPINGSSSGDIFAG  69

Query  2361  ARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG-LEPPPTC  2534
              R+ SGLDIRY T+SDG P+GFDR+ +   +   +++VFSAHV+ELV +LAG  +     
Sbjct  70    FRSESGLDIRYATVSDGLPIGFDRSLNHDQYQASLLHVFSAHVEELVARLAGDGDGGVNV  129

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             LIAD+F+ WPS IA K+ LV VSF+TE ALVF++  H+DLL+ +GHF  +  RKD IDYI
Sbjct  130   LIADTFFVWPSAIARKFGLVYVSFWTEAALVFSLYYHMDLLRLHGHFCSQGRRKDLIDYI  189

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PGV+AIEP+D   YLQ + +T+S V+  ++K FED KKAD V+CNT+ E E +TI AL  
Sbjct  190   PGVKAIEPKDTASYLQ-DTDTSSVVHQIIFKAFEDVKKADFVLCNTIYEFEDRTIQALNS  248

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             K PFYAIGP+ P     +T   SL  E+DC +WL++KP GSVLY SFGS AH+TK  ++E
Sbjct  249   KIPFYAIGPIIPFGIKNKTVTTSLWSEADCTQWLNTKPKGSVLYVSFGSYAHVTKHDLVE  308

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             + +GL+LS VNF+WV+RP +  ++E +   DGF+    + G+++PWC Q  V+SHP++GG
Sbjct  309   IAKGLLLSRVNFVWVVRPDIVSSEENNPLPDGFETEAENFGIVIPWCCQMTVLSHPSIGG  368

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
             F+THCGWNSILESIWC VP+IC+PL+ DQ TNRKLVVD+WKIG+NLC +D   ++KEEVA
Sbjct  369   FLTHCGWNSILESIWCEVPLICFPLLTDQVTNRKLVVDDWKIGMNLC-EDRSLVAKEEVA  427

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             + +  LM  +S  E++ AI  V+ +LENAL   GSS +N+  F++ +  K ++S+
Sbjct  428   TNISRLMCGKSREEVKGAIGRVKMSLENALSPTGSSDQNLGLFIDGLMDKAHKSN  482



>emb|CDX75000.1| BnaA05g07460D [Brassica napus]
Length=479

 Score =   509 bits (1310),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 250/478 (52%), Positives = 339/478 (71%), Gaps = 15/478 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF+ AR SG LDIRYTT+SDGFPL FDR+ +   F  G+ +VF AHVD+L+ K++  G +
Sbjct  62    IFSAARTSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGLFHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TC IAD+FY W S+I +K+NLVNVSF+T+PAL   I  HL LL  NGHF   D R+D
Sbjct  122   PPVTCFIADTFYVWSSMICNKHNLVNVSFWTQPALALNIYYHLHLLISNGHFNSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDYIPGV+AI+P+DL  YLQ   ++ +T   VY  +++ F D KKAD V+CNTVQELEP
Sbjct  182   VIDYIPGVKAIDPKDLMSYLQVSDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+  QP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   GSLSALQANQPVYAIGPIFS---TESVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS V+FIWVLRP +  +D  DF   GF +  + RG++V WC Q AV
Sbjct  299   VGKKEIVEIAHGLLLSGVSFIWVLRPDIVSSDVQDFLPTGFMDRAQSRGIVVQWCCQMAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+PA+GGF+T CGWNS+LES+WC +P++CYPL+ DQ TNRKLVVD+W+ GINLC  ++K
Sbjct  359   ISNPAIGGFLTQCGWNSVLESVWCGLPLLCYPLLNDQFTNRKLVVDDWRTGINLC--ENK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              ++++EV+  +K LM  E+  ELR   + V +++++A+ + GSS  N + FV  ++ +
Sbjct  417   MVTRDEVSVNIKRLMNEETLSELRSNAEKVNRHIKDAVTTVGSSEVNFNSFVGDVQDR  474



>ref|XP_004249916.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum lycopersicum]
Length=474

 Score =   508 bits (1308),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 337/475 (71%), Gaps = 12/475 (3%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P+P+QGHINP  HL++ LASRGFT+TFVNTE     I KA    +    D+ F+ 
Sbjct  10    HAVLIPVPFQGHINPFTHLAMKLASRGFTITFVNTESTHERIAKAH---SHKDDDNPFSH  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLEPPPTC  2534
             A  SGLDIRY  ISDGFPL FDR  +A  FM+G+ +VF AHVD+ ++ L  +   PP +C
Sbjct  67    AEESGLDIRYARISDGFPLSFDRRANASQFMIGLTHVFQAHVDDFIENLVLSKPNPPVSC  126

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             +IADSF+ W S+IA KYNL+NVSF+TEPA    +  + DLLK NGHFG  D   D+I YI
Sbjct  127   IIADSFHVWGSMIAKKYNLINVSFWTEPATALTVFYNADLLKRNGHFGRHDKYDDTISYI  186

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PG++AI+P DLP Y Q + +     Y  V+K  EDA+KADIVI NTVQELE  TISAL+E
Sbjct  187   PGIQAIKPEDLPSYCQ-DADPNDIKY--VFKCIEDAQKADIVIGNTVQELESSTISALQE  243

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             +QPFYAIGPL P +FT++T   +LLP +D   WL+++  G+VLY SFGSL +L+K+ I+E
Sbjct  244   QQPFYAIGPLCPTNFTKKTISTNLLPTTDYTNWLNNRQDGTVLYISFGSLVNLSKQDILE  303

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             + +G+++S+V+FIWVLR  + ++ E +    GF+E   DRGL+VPWC Q AV+SHPAVGG
Sbjct  304   IAQGILISKVSFIWVLRHNILVSGERNILPLGFEEETADRGLVVPWCSQLAVLSHPAVGG  363

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
             F+THCGWNSILESI C VPM+C+P+I DQ TNRKLVVD+W+IG+NLC      I +E VA
Sbjct  364   FLTHCGWNSILESILCKVPMVCFPVIGDQLTNRKLVVDDWRIGVNLCT--RGLIRREVVA  421

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
               +  +M    S E RK I   +  L+NAL   GSS KN+++F++ +K K  Q +
Sbjct  422   ENIGKIMN--RSDESRKNIDKTKMLLQNALSDEGSSDKNLNQFIQDMKNKILQKN  474



>ref|XP_004304453.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Fragaria vesca 
subsp. vesca]
Length=482

 Score =   507 bits (1306),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 249/480 (52%), Positives = 338/480 (70%), Gaps = 7/480 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M  N+ K HAI++P+  QGH+NP  HL++ LAS GFT+TFVNTE     I K++   T  
Sbjct  1     METNHPKPHAIMVPLSLQGHVNPFTHLAMKLASNGFTITFVNTEYFHHQITKSKLNNTAQ  60

Query  2337  PT--DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                 DDIF  AR +GLDIRY T+SDGFPL F+R  +    + G ++VF AH+DELV  L 
Sbjct  61    EQEQDDIFAAARETGLDIRYRTVSDGFPLSFNRFQNLDQSLEGAIHVFPAHIDELVGDLV  120

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
               +P   CLIAD+F+ W ++IA+K+NL+N+SF+TEPALV  I  HLDLL ++GHFGC D 
Sbjct  121   QSDPSINCLIADTFHTWTAMIANKHNLINISFWTEPALVLNIYYHLDLLVKHGHFGCHDN  180

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              +D+IDYIPGV+AIEP+DL  +L    NT+  +   V K F +AK+AD ++CNTVQELE 
Sbjct  181   CEDTIDYIPGVQAIEPKDLTSHLHI-TNTSDPMLRIVKKAFREAKRADFILCNTVQELEA  239

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +++S L++KQP YAIGP+FP   T+     +L+ E DC +WL +KP GSVLY SFGS   
Sbjct  240   ESLSTLQDKQPTYAIGPVFPTEPTKSVVATNLMSEIDCTQWLKTKPQGSVLYVSFGSYCQ  299

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMD-GFQECVRDRGLIVPWCHQPA  3227
             +TK    E+ +GL+LS+V+FIWVLRP     +E  + +  GF++ + DRGL+VPWC Q  
Sbjct  300   VTKNEFEEIAQGLLLSKVSFIWVLRPDTISYEEEGYIVPFGFEDQISDRGLMVPWCSQIE  359

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+S+PA+GGF+THCGWNSILES+W  VPM+C+P+  DQ TNRKLVVD+W+IG+NLC  D 
Sbjct  360   VLSNPAIGGFLTHCGWNSILESMWFGVPMLCFPISTDQFTNRKLVVDDWRIGLNLC--DR  417

Query  3408  KSISKEEVASKVKFLMKAE-SSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             K I++ EVA KV  LM        L+K IK  ++ LE+AL +NGSS +++ +F+  +KAK
Sbjct  418   KPIARLEVAHKVNRLMNGNLGDGILQKEIKKAKQTLEDALSANGSSQQSLCQFINDVKAK  477



>ref|XP_011091584.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=484

 Score =   506 bits (1304),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 253/479 (53%), Positives = 338/479 (71%), Gaps = 14/479 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAI++P PYQGH+ P I+L+I LASRGFT+TFV TE I   + KA+     A + D+F
Sbjct  7     KPHAILIPYPYQGHVTPMINLAIRLASRGFTITFVQTEFIHQFMCKAQN--LPAASFDLF  64

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG----LEP  2522
              +AR SGLDIRYTTISDGFPL FDR  +   +   M   F   VDE+V K        E 
Sbjct  65    AEARKSGLDIRYTTISDGFPLDFDRHLNFNEYWESMFRNFPDRVDEIVVKTMEDDVLPET  124

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             PP  L+AD+FY WP+ IA K+N+VN+SF+TEPA+VF+++ HL+LL++NG F  K    ++
Sbjct  125   PPFLLVADTFYTWPATIAKKHNMVNISFWTEPAIVFSLNYHLELLRQNG-FSDKTQHGNA  183

Query  2703  ---IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
                I+YIPG+++I  RDL  YLQ        + + V KGFE  KKAD ++CNTV+ELE +
Sbjct  184   ENYINYIPGIQSISTRDLMTYLQDPEAIPMLIKI-VEKGFEQVKKADFILCNTVEELELE  242

Query  2874  TISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             T++AL +K P YAIGP+ F    T+ +  +SL  ESDC +WL+SKP GSVLY SFGS+A 
Sbjct  243   TLAALNQKHPTYAIGPINFYTDLTQTSIAKSLWSESDCTQWLNSKPSGSVLYVSFGSIAE  302

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
               KE I EL  GL++SEV F+WVLRP +    E D   +GF++ V+++GLIVPWC+Q  V
Sbjct  303   SNKEEIGELAHGLLISEVYFVWVLRPDIIGGQESDALPEGFKDVVKNKGLIVPWCNQNMV  362

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S PA GGF+THCGWNSILESIW  VPMICYP +VDQPTNRKLVVD+WKIG++LC  + +
Sbjct  363   LSSPATGGFLTHCGWNSILESIWHGVPMICYPFLVDQPTNRKLVVDDWKIGVDLC--EGE  420

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              + +EEVAS++  LMK E+S+++++ I+ V K L ++L + GSS  N D+FV  +KAKF
Sbjct  421   QVRREEVASQIDILMKGENSVQMKRKIQKVSKKLHDSLDAEGSSCTNFDRFVVDLKAKF  479



>emb|CDY33212.1| BnaC04g08270D [Brassica napus]
Length=484

 Score =   506 bits (1302),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 343/479 (72%), Gaps = 15/479 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF++ R+ G LDIRYTT+SDGFPL FDR+ +   F  G+++VF AHVD+L+ K++  G +
Sbjct  62    IFSEVRSYGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGILHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TCLI D+FY W S+I  K+NLVNVSF+TEPALV  +  HL LL  N HF   D R+D
Sbjct  122   PPVTCLINDTFYVWSSMICEKHNLVNVSFWTEPALVLNLYYHLHLLISNCHFKSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDYIPGV+AI+P+DL  YLQ   ++ +T + VY  ++K F D KKAD V+CNTVQELEP
Sbjct  182   VIDYIPGVKAIDPKDLMSYLQVSDKDVDTNTVVYRIIFKAFTDVKKADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+  QP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   DSLSALQANQPVYAIGPVFS---TESVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K+ I+E+  GL+LS ++FIWVLRP +  +D  DF   GF +    RG++V WC Q AV
Sbjct  299   VGKKDIVEIAHGLLLSGISFIWVLRPDIVGSDVPDFLPTGFMDQAEGRGIVVQWCCQKAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             IS+P +GGF+THCGWNSILES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINLC  D K
Sbjct  359   ISNPVIGGFLTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWRIGINLC--DKK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              I+++EV+  +K LM  E+S ELR  ++ V+ ++++A+ S GSS  N + FV++++ K 
Sbjct  417   MITRDEVSVNIKRLMNQETSSELRSNVEKVKCHIKDAVTSVGSSETNFNSFVDEVRDKI  475



>gb|KFK32346.1| udp-glycosyltransferase-like protein [Arabis alpina]
Length=480

 Score =   505 bits (1300),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 239/480 (50%), Positives = 338/480 (70%), Gaps = 16/480 (3%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             ++++K HA+++P P+QGH+NP +HL+I LAS G TVTFVNT  ID  I           +
Sbjct  13    QHDKKLHALLIPYPFQGHVNPFVHLAIKLASEGITVTFVNTHYIDHQI----------GS  62

Query  2343  DDIFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
              DIF+  R+ SGLDIRY T+SDG P+GFDR+ +   +   +++VFSAHV+ELV  L G +
Sbjct  63    GDIFSGVRSESGLDIRYATVSDGLPIGFDRSLNHDQYQSSLLHVFSAHVEELVASLVGEK  122

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
                  +IAD+F+ WPS++ASK+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R+D
Sbjct  123   GGVNVMIADTFFVWPSVVASKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRED  182

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
              IDYIPGV+AI+P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+   E +TI
Sbjct  183   LIDYIPGVKAIKPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIHSFEDRTI  241

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
              AL  K PFYAIGP+ P S    +   SL  ESDC +WLD+KP GSVLY SFGS AH+TK
Sbjct  242   QALNSKIPFYAIGPIIPFSLQSGSITTSLWSESDCTQWLDTKPAGSVLYISFGSYAHVTK  301

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
             + ++E+  G+++S+VNF+WV+RP +  +DE +   + F+    DRG+++PWC Q  V+SH
Sbjct  302   KDLVEIANGVLMSQVNFVWVVRPDIVSSDEENPLPETFESETGDRGIVIPWCCQMTVLSH  361

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             P++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+W+IG+NLC  +   + 
Sbjct  362   PSIGGFLTHCGWNSILESIWCQVPLLCFPLLTDQVTNRKLVVDDWEIGMNLCQ-NRSFLH  420

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             ++EV   +   M A+    +++AI  V+  LE AL S GSS KN+  F++ +  K   S+
Sbjct  421   RDEVQRNIHLFMSAK---HVKEAIGRVKMTLETALTSAGSSQKNLGFFIDGLMGKLGLSN  477



>ref|XP_011091585.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=484

 Score =   504 bits (1298),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 252/479 (53%), Positives = 337/479 (70%), Gaps = 14/479 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAIV+P PYQGH+ P I+L+I LASRGFT+TFV TE I   + KA+     A + D+F
Sbjct  7     KPHAIVIPYPYQGHVTPMINLAIRLASRGFTITFVQTEFIHQFMCKAQN--LPAASFDLF  64

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL----EP  2522
              +AR S LDIRYTTISDGFPL FDR  +   +   M   F   VDE+V K        E 
Sbjct  65    AEARKSDLDIRYTTISDGFPLDFDRDLNFNEYWESMFRDFPDRVDEIVVKTMEADVLPET  124

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             PP  L+AD+FY WP+ IA K+N+VNVSF+TEPA+VF+++ HL+LL++NG F  K    ++
Sbjct  125   PPFLLVADTFYTWPATIAKKHNMVNVSFWTEPAIVFSLNYHLELLRQNG-FSDKTQHGNA  183

Query  2703  ---IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
                I+YIPG+++I  RDL  YLQ        + + V KGFE  KKAD ++CNTV+ELE +
Sbjct  184   ENYINYIPGIQSISTRDLMTYLQDPEAIPMLIKI-VEKGFEQVKKADFILCNTVEELELE  242

Query  2874  TISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             T+SAL +K P YAIGP+ F    T+ +  +SL  ESDC +WL+SKP GSVLY SFGS+A 
Sbjct  243   TLSALNQKHPTYAIGPINFYTDLTKTSIAKSLWSESDCTQWLNSKPSGSVLYVSFGSIAE  302

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
               KE I EL  GL++SEV F+WVLRP +    E D   +GF++ ++++GLIVPWC+Q  V
Sbjct  303   SNKEEIGELAHGLLISEVYFVWVLRPDIIGGQESDVLPEGFKDVIKNKGLIVPWCNQNMV  362

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S PA GGF+THCGWNSILESIW  VPMICYP +VDQPTNRKLVVD+WKIG++LC  + +
Sbjct  363   LSSPATGGFLTHCGWNSILESIWYGVPMICYPFLVDQPTNRKLVVDDWKIGVDLC--EGE  420

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              + +EEVA+++  LMK E+S+++++ I+ V K L +++ + GSS  N D+FV  +KAKF
Sbjct  421   QVRREEVANQIDILMKGENSVQMKQKIQKVSKKLHDSMDAEGSSCTNFDRFVVDLKAKF  479



>ref|XP_009413144.1| PREDICTED: UDP-glycosyltransferase 86A1 [Musa acuminata subsp. 
malaccensis]
Length=484

 Score =   503 bits (1295),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 333/472 (71%), Gaps = 9/472 (2%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P P QGHI PA+HL+  LASRGFT+TFV TE I     +A  G       DIF  
Sbjct  10    HALLVPYPLQGHIIPAVHLATKLASRGFTITFVYTEAIHHQTSRAASGVDR----DIFAA  65

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA-GLEPPPTCL  2537
             AR  GLD+R   ++DG P+ FDR+ +   FM  +++V  AHV+EL++KL+   +PP T L
Sbjct  66    ARARGLDVRCELVNDGLPVAFDRSLNHDRFMGSLLHVLPAHVEELMRKLSLYADPPITYL  125

Query  2538  IADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIP  2717
             IAD+F+ WPS +A K+ L  VSF+TEPALVF +  HLDLL ++GHF   D  KD+I Y+P
Sbjct  126   IADTFFVWPSTLAKKFGLPYVSFWTEPALVFTLYYHLDLLIKHGHFASHDNSKDTITYVP  185

Query  2718  GVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEK  2897
             GV AIEP DL  YLQ E + +S V+  +++ FE+AK AD+V+CNT+QELEP+TISAL+ +
Sbjct  186   GVAAIEPADLMSYLQ-ERDVSSVVHQIIFRAFEEAKGADLVLCNTLQELEPETISALQLE  244

Query  2898  QPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMEL  3077
             +PFYAIGP+FP  FT+     SL  ESDC +WLDSKPPGS+LY SFGS AH++   + E+
Sbjct  245   KPFYAIGPIFPAGFTKSAVATSLWAESDCSRWLDSKPPGSILYISFGSYAHISSRDLKEI  304

Query  3078  GRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGF  3257
              +G++ S+  F+WVLRP +  +DE D   + F E  + RG++VPWC Q AV+SH ++G F
Sbjct  305   VQGVLRSKARFLWVLRPDVVSSDEPDPLPESFIEDSKGRGMVVPWCCQTAVLSHRSIGAF  364

Query  3258  ITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVAS  3437
             +THCGWNSILES+WC VP++C+PL+ DQ TNRKLVV +WKIG++L   +   + ++EVA 
Sbjct  365   LTHCGWNSILESVWCGVPLLCFPLLTDQFTNRKLVVQDWKIGLDL--GEKNKVGRKEVAE  422

Query  3438  KVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +++ +M  E   ELR+ +KDVR+ LE ALG  GSS KN+D+F+  +     Q
Sbjct  423   RIESVM-GEVGDELREKVKDVRRTLERALGPQGSSQKNLDRFIADLMQHSQQ  473



>dbj|BAF75888.1| glucosyltransferase [Dianthus caryophyllus]
Length=476

 Score =   502 bits (1292),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 253/474 (53%), Positives = 334/474 (70%), Gaps = 10/474 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             + K HAI++P P QGH+ PA+HL+  LAS GFT+TF+NTE I   I K+     T    D
Sbjct  8     DSKPHAILIPYPLQGHVIPAVHLATKLASNGFTITFINTEFIHHEITKSNPNHQT----D  63

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-AGLEPP  2525
             IF++ R SGLDIRY T+SDGFP+GFDR+ +   FM G+++V SAHVDELV KL +  EP 
Sbjct  64    IFSETRESGLDIRYATVSDGFPVGFDRSLNHDQFMEGVLHVLSAHVDELVGKLVSSSEPK  123

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
              + +IAD+F+ W S+IA+KY LVNVSF+TEPALV  I  HL+LL  +GHFG ++ RKD+I
Sbjct  124   ISIMIADTFFVWTSVIANKYKLVNVSFWTEPALVLNIYYHLELLVSHGHFGSQENRKDAI  183

Query  2706  DYIPGVEAIEPRDLPLYLQQE-NNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             DYIPG+  I P DL  YLQ    +T++ ++  +YK F+D K AD ++ N+VQELE +TIS
Sbjct  184   DYIPGISTIIPDDLMSYLQPTIEDTSTVLHRIIYKAFKDVKHADYILINSVQELENETIS  243

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFR-SLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
              L  KQP +AIGPLFP   T+      S+  + DC KWLD KP GSVLY SFGS AH +K
Sbjct  244   TLNRKQPTFAIGPLFPIGDTKNKEVSTSMWEQCDCTKWLDEKPRGSVLYISFGSYAHTSK  303

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
             E +  +  GL+ SEVNFIWV+RP +  + +++   DGF+E    RGL+V WC Q +V+SH
Sbjct  304   EILHGIANGLLESEVNFIWVIRPDIVSSSDLNPLPDGFEEKSLGRGLVVTWCDQVSVLSH  363

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
              +VGGF+THCGWNSILESIW  +P++C+PL+ DQ TNRKLVVD+ KIGINLC  D K ++
Sbjct  364   QSVGGFLTHCGWNSILESIWYLIPLLCFPLLTDQFTNRKLVVDDLKIGINLC--DGKVLT  421

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENA-LGSNGSSVKNVDKFVEKIK  3578
             + EVA  +  LMK  SS +LR  IK V+  L NA +  NGSS +N D+FV+ ++
Sbjct  422   EVEVAKNINRLMKGNSSDDLRATIKRVKNVLANAWVDENGSSQRNFDEFVKIVQ  475



>ref|XP_006350953.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Solanum tuberosum]
Length=474

 Score =   501 bits (1289),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 248/475 (52%), Positives = 334/475 (70%), Gaps = 12/475 (3%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P+P QGHINP  HL++ LAS+GFT+TFVNTE     I KA+   +    D+ F+ 
Sbjct  10    HAVLIPVPLQGHINPFTHLAMKLASKGFTITFVNTESTHQRIAKAQ---SLKDDDNPFSH  66

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLEPPPTC  2534
             A  SGLDIRY  ISDGFPL FDR  +A  FM+G+ +VF AHVD+ ++ L  +   PP +C
Sbjct  67    AEESGLDIRYARISDGFPLSFDRRANASQFMIGLTHVFQAHVDDFIENLVLSKPNPPVSC  126

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             +I DSF+ W S IA KYNLVNVSF+TEPA V  +  + DLLK NGHFG  D   D+I YI
Sbjct  127   IITDSFHVWGSTIARKYNLVNVSFWTEPATVLTVFYNTDLLKRNGHFGRHDKYDDTISYI  186

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PG++AI+P DLP Y Q  +   +     V+K  EDA+KADIVI NTVQELE  TI AL+E
Sbjct  187   PGIQAIKPEDLPSYCQDADPNETKY---VFKCIEDAQKADIVIGNTVQELESSTILALQE  243

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             +QPFYAIGP+ P +FT++T   +LLP +D   WL++K  G+VLY SFGSLA+L+K+ I+E
Sbjct  244   QQPFYAIGPICPTNFTKKTISTNLLPATDYTNWLNTKQDGTVLYISFGSLANLSKQDILE  303

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             + +G+++S+V+FIWVLR  + ++ E +    GF+E    RGL+VPWC Q A++SHP+V G
Sbjct  304   IAQGILISKVSFIWVLRHNILVSGERNILPLGFEEETAGRGLVVPWCSQLAILSHPSVRG  363

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
             F+THCGWNSILESIWC VPM+C+P+  DQ TNRKLVVD+W+IG+NLC      I +E VA
Sbjct  364   FLTHCGWNSILESIWCKVPMVCFPVSGDQLTNRKLVVDDWRIGVNLCTRG--LIRREVVA  421

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
               +  +M   +S E R+ I   +  L+NAL   GSS KN+++F++ +K K  Q +
Sbjct  422   ENIGKIMN--NSDESRENIDKTKMILQNALSDEGSSEKNLNQFIQDMKNKILQKN  474



>gb|EPS66574.1| hypothetical protein M569_08200, partial [Genlisea aurea]
Length=462

 Score =   500 bits (1287),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 257/477 (54%), Positives = 333/477 (70%), Gaps = 24/477 (5%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             +K HAI+LP PYQGHINP   L++NLA+ GFTVTFVNT  +D  I +AR         DI
Sbjct  1     RKPHAIMLPYPYQGHINPFARLAVNLAAEGFTVTFVNTRSVDGRISRAR-----GDGGDI  55

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F  AR+SGLDIRY T+ DGFPL FDR  +   F+ G+++VF AHVDE    LAG +PP T
Sbjct  56    FGGARDSGLDIRYATVCDGFPLSFDRVLNHDRFVEGLIHVFPAHVDEFFDNLAGDDPPAT  115

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHF------GCKDCR  2693
             CLI+D+FY W S IA K+NLV VSF+TEPALVF++  HL+LL  NG F        K  +
Sbjct  116   CLISDTFYVWGSAIARKHNLVYVSFWTEPALVFSLYYHLELLINNGDFDSSGQNNLKKKK  175

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +  I YIPGVEAI P DLP YLQ +  TT+ V+  ++K F+D KKAD++ICNTVQ+LE +
Sbjct  176   ETMIHYIPGVEAINPTDLPSYLQSQ--TTTVVHRVIFKAFDDVKKADMIICNTVQKLEEE  233

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             T+SAL  KQP YA+GP+    FT      SL  ESDC  WL +KP GSVLY SFGS A  
Sbjct  234   TLSALHRKQPTYAVGPIISDVFTA-----SLWSESDCSDWLSAKPKGSVLYVSFGSHAGT  288

Query  3054  T-KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSM--DGFQECVRDRGLIVPWCHQP  3224
             T +  I E+  GL++SEVNFIWV+RP + + DE   S+  DGF +C+ +RGLIV WC+Q 
Sbjct  289   TSRNTISEISLGLLMSEVNFIWVIRPDI-VGDEDSTSIFPDGFNDCLGERGLIVRWCNQF  347

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              V+S PA+GGF++HCGWNS+LESI   VP+IC+PL  DQ TNR+LVV++WK+GINLC  D
Sbjct  348   KVLSDPAIGGFLSHCGWNSVLESIRFKVPIICFPLFTDQFTNRRLVVNDWKVGINLC--D  405

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
                +++EEV  K++F++  E+S  LRK++ DV    + AL  NGSSV+N   F+E++
Sbjct  406   RGRVTREEVREKIRFVIGEETSEVLRKSMADVGGIFDEALRLNGSSVQNFKLFIEEL  462



>emb|CDY33211.1| BnaC04g08280D [Brassica napus]
Length=477

 Score =   499 bits (1286),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 248/478 (52%), Positives = 340/478 (71%), Gaps = 17/478 (4%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HA+++P P QGH+ P +HL+I LAS GFT+TFVNT+ I   I  AR+G       D
Sbjct  6     SRKPHAMMIPFPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTARQGDA----GD  61

Query  2349  IFTQARNSG-LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA--GLE  2519
             IF+ AR SG LDIRYTT+SDGFPL FDR+ +   F  G+++VF AHVD+L+ K++  G +
Sbjct  62    IFSAARTSGNLDIRYTTVSDGFPLEFDRSLNHDQFFEGLIHVFPAHVDDLITKISRRGDD  121

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             PP TCLIAD+FY W S+I +K+NLVNVSF+T+PALV  I  HL LL  NGHF   D R+D
Sbjct  122   PPVTCLIADTFYVWSSMICNKHNLVNVSFWTQPALVLNIYYHLHLLISNGHFNSLDNRED  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              IDY+PGV+AI+P+DL  YLQ   ++ +T   VY  +++ F D KKAD V+CNTVQELEP
Sbjct  182   VIDYVPGVKAIDPKDLMSYLQVTDKDVDTNRVVYRIIFEAFTDVKKADFVLCNTVQELEP  241

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
              ++SAL+  QP YAIGP+F    TE     SL  ESDC +WL  +P GSVLY SFGS AH
Sbjct  242   GSLSALQANQPVYAIGPVFS---TELVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSYAH  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K  I+E+  GL+LS ++FIWVLRP +  +D  DF   GF +  + RG++V WC Q AV
Sbjct  299   VGKMEIVEIAHGLLLSGLSFIWVLRPDIVGSDVPDFLPTGFMDRAQSRGIVVQWCCQMAV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S+P +GGF+THCGWNS+LES+WC +P++CYPL+ DQ TNRKLVVD+W+IGINLC  + K
Sbjct  359   LSNPTIGGFLTHCGWNSVLESVWCGLPLLCYPLLNDQFTNRKLVVDDWRIGINLC--EKK  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              ++++EV+  ++     E S ELR  ++ V + +++A+ + GSS  N + FV +++ +
Sbjct  417   MVTRDEVSVNIRRF--KEISSELRSNVEKVNRYVKDAVTTVGSSEVNFNSFVGEVRDR  472



>ref|XP_006424499.1| hypothetical protein CICLE_v10029902mg [Citrus clementina]
 gb|ESR37739.1| hypothetical protein CICLE_v10029902mg [Citrus clementina]
Length=477

 Score =   499 bits (1286),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 327/471 (69%), Gaps = 7/471 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             QK HAI +  P QGH+NP++ L++ LAS+GFT+TFVNT  I   + KA    +     DI
Sbjct  7     QKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKA----SPEMGSDI  62

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F   R SGLDIRY T+SDG PLGFDR+ +   FM  +++VFSAH +E++ ++        
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGENVH  122

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
             CLIAD+++ WPS +A K+ L  +SF+TE ALVF +  HLDLL  NGHF C DCR+D+IDY
Sbjct  123   CLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCREDTIDY  182

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPGV+AI P+D   YLQ E +TTSA +  ++  F+D + AD V+CNTV ELE + ++AL+
Sbjct  183   IPGVKAINPKDTTSYLQ-ETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAVTALK  241

Query  2892  EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
              K PF  +GP+    F+++    SL  ESDC +WLD +P GSVLY SFGS AH++K  ++
Sbjct  242   AKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPKGSVLYVSFGSYAHVSKRDLI  301

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             E+  G+  S+V FIW+LRP +  +D+ +   + F++ V DR +I+ WC Q +V++HPA+G
Sbjct  302   EIANGIAKSKVTFIWILRPDIVSSDDPNPLPEDFKKEVADRSMIITWCCQTSVLAHPAIG  361

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF+THCGWNS+LE +WC VP++C+PL  DQ TNRKL VD+W +G+NL N  +K I+KEEV
Sbjct  362   GFLTHCGWNSVLEGLWCGVPLLCFPLYTDQFTNRKLAVDDWNVGLNLSN--EKVITKEEV  419

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  V  LM  +S  + R A K V+K +E AL  NGSS KN+D+F++ +KA+
Sbjct  420   SKNVHLLMGEKSGAKCRNAAKQVKKAMEYALQPNGSSEKNMDQFIKDLKAR  470



>emb|CDY30510.1| BnaA04g16230D [Brassica napus]
Length=480

 Score =   499 bits (1285),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 337/488 (69%), Gaps = 22/488 (5%)
 Frame = +3

Query  2160  VENNQKHH------AIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARR  2321
             V+N  KHH      A+++P P+QGH+NP +HL+I LAS+G TVTFVNT      I     
Sbjct  4     VKNPNKHHKHHRLHALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQI-----  58

Query  2322  GTTTAPTDDIFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELV  2498
                   + DIF   R+ SGLDIRY T+SDG PLGFDR+ +   +   +++VFSAHV+ELV
Sbjct  59    -----NSGDIFAGVRSESGLDIRYATVSDGLPLGFDRSLNHDQYQSALLHVFSAHVEELV  113

Query  2499  KKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
             + L G       +IAD+F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG
Sbjct  114   ESLVG--EGVNVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFG  171

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
              ++ R+D IDYIPGVEAI P+D   YLQ E + +S V+  ++K FED KK D V+CNT+ 
Sbjct  172   AQETRRDLIDYIPGVEAINPKDTASYLQ-ETDISSVVHQIIFKAFEDVKKVDFVLCNTIH  230

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSF-TEQTAFRSLLPESDCCKWLDSKPPGSVLYASF  3035
             + E +TI AL  K PFYAIGP+ P +  T  +   SL  ESDC +WL++KP GSVLY SF
Sbjct  231   QFESKTIHALNSKIPFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWLNTKPAGSVLYISF  290

Query  3036  GSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWC  3215
             GS AH+TK+ ++E+  G+ LS VNF+WV+RP +  +DE +    GF+    DRG+++PWC
Sbjct  291   GSYAHVTKKDLVEIAHGISLSRVNFVWVVRPDIVSSDETNPLPAGFESEAGDRGIVIPWC  350

Query  3216  HQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC  3395
              Q  V+SHP++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+WKIG+NLC
Sbjct  351   CQMTVLSHPSIGGFLTHCGWNSILESIWCEVPLLCFPLLTDQVTNRKLVVDDWKIGMNLC  410

Query  3396  NDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              +D   + ++EV   +  LM+ ES   +R AI  V+ +LE AL  +GSS +N+  FV+ +
Sbjct  411   -EDRGFVGRDEVKMSIGRLMRGESREGVRGAIGRVKMSLEGALKCSGSSGENLGLFVDGL  469

Query  3576  KAKFNQSS  3599
              AK   S+
Sbjct  470   VAKVGLSN  477



>ref|XP_011074004.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=479

 Score =   499 bits (1285),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 250/477 (52%), Positives = 326/477 (68%), Gaps = 16/477 (3%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
             N+ K HAI+L  P+QGHI P ++L++NLASRGFT+T+V  E I   + K   G   A   
Sbjct  5     NHSKPHAILLAYPFQGHITPMVNLAVNLASRGFTITYVQLEFIHHTLSK---GHDRAGDV  61

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             D+F +AR SGLDIRYTT+SDGF L FDR  +   +  GM+  F A VDEL+  +   +  
Sbjct  62    DVFVEARKSGLDIRYTTMSDGFSLEFDRKLNMSEYWEGMIRDFPALVDELIGSITTSDSS  121

Query  2526  PTC--LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
              T   L+AD+ Y+WP+ IA K+NLV+VS +TEPA VFAID HLDLL+ENGH  C     +
Sbjct  122   ATASILVADTLYSWPAAIAKKHNLVHVSLWTEPATVFAIDYHLDLLRENGHLPCSGNGDN  181

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
              I+YIPGV++I  +DL  Y+Q  +     +   V K FE  K AD ++CNTVQELE + +
Sbjct  182   CINYIPGVKSISSKDLMSYIQAPD-VVPVLMKIVAKAFEQVKNADFILCNTVQELEAECL  240

Query  2880  SALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             SAL  KQP YAIGP+ F   FT     +SL PESDC  WL SKPP SVLY SFGS+  + 
Sbjct  241   SALNLKQPTYAIGPMNFFSDFTNTVVEKSLWPESDCTHWLSSKPPASVLYISFGSIVQIN  300

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K+ I+E+  GL+LS+VNFIW+LR   A+         GFQ+ V+D GLIVPWC+Q AV+S
Sbjct  301   KQEIVEIAHGLLLSQVNFIWILRSTDALPA-------GFQDDVKDGGLIVPWCNQNAVLS  353

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
              PAVGGF+THCGWNS+LES+W  VPMICYPL VDQPTNRKLVVD+WK+GI+LC  D   +
Sbjct  354   SPAVGGFLTHCGWNSVLESMWSGVPMICYPLYVDQPTNRKLVVDDWKVGIDLC--DGGRV  411

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             + E VASK+  LM+ +SSI LR+ IK V + + NA  ++GSS +  D+FV+ ++ + 
Sbjct  412   TSEGVASKINILMRGKSSIVLREQIKKVSRIMRNAFETDGSSQRTFDQFVDDLRGRL  468



>ref|XP_010907029.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   499 bits (1286),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 248/476 (52%), Positives = 338/476 (71%), Gaps = 7/476 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E  QK HA+++P+P QGHINPA  L+I LA+RGFT+T+VNTE +     +ARR  ++ 
Sbjct  1     MAEPPQKPHAVLIPVPLQGHINPATRLAIKLATRGFTITYVNTEAVHHQSSRARRSASSI  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA-G  2513
                 IF  A  SGLDIRY  ISDG P+ FDRT +   F+  ++YVFSAHV+E ++KL   
Sbjct  61    -DHHIFADACASGLDIRYELISDGLPVSFDRTANPIQFLHSLLYVFSAHVEEFMRKLTRA  119

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG-CKDC  2690
               PP TCLIAD+F+ WPS IA K+++  VSF+TEPA+VF +  H+DLL +NGHF  C + 
Sbjct  120   ASPPITCLIADTFFVWPSTIAKKFDIPYVSFWTEPAVVFTLYYHMDLLIKNGHFASCAEN  179

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             RKD+I YIPGV AIEP DL  YLQ E NTTS ++  ++K FE+A+ AD V+CNTVQELEP
Sbjct  180   RKDTIAYIPGVPAIEPTDLMSYLQ-ETNTTSVLHQIIFKAFEEARGADFVLCNTVQELEP  238

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLP-ESDCCKWLDSKPPGSVLYASFGSLA  3047
             +TISA+++++PFYA+GPL P  F    + ++ L  ESDC +WLD+KP GSVLY SFGS A
Sbjct  239   ETISAIQQEKPFYAVGPLIPPGFIPGISVQTTLQVESDCSQWLDTKPAGSVLYISFGSFA  298

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
             +++K  + E+  G++ ++ NFIWV+RP +  + E +     F E    RG+ +PWC Q  
Sbjct  299   NVSKRDLEEIAYGILDTKANFIWVIRPDIVSSKEHEPLPQRFLEESYGRGMCIPWCCQME  358

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+SHP++GGF+THCGWNSILES+WC VPM+C+PL  DQ TNRKLVV +WKIGI+L   D+
Sbjct  359   VLSHPSIGGFLTHCGWNSILESMWCEVPMLCFPLQTDQFTNRKLVVKDWKIGIDLGRIDE  418

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
               +S++EV+ +V  LM  E   E +K +K+V + L  A+ ++GSS KN D+FV  +
Sbjct  419   --VSRKEVSKRVDSLMGGEEGNEAKKVMKEVTRALHGAVTADGSSQKNFDQFVADL  472



>ref|XP_009140842.1| PREDICTED: UDP-glycosyltransferase 86A2 [Brassica rapa]
Length=480

 Score =   499 bits (1285),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 338/488 (69%), Gaps = 22/488 (5%)
 Frame = +3

Query  2160  VENNQKHH------AIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARR  2321
             V+N  KHH      A+++P P+QGH+NP +HL+I LAS+G TVTFVNT      I     
Sbjct  4     VKNPNKHHKHHRLHALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQI-----  58

Query  2322  GTTTAPTDDIFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELV  2498
                   + DIF   R+ SGLDIRY T+SDG PLGFDR+ +   +   +++VFSAHV+ELV
Sbjct  59    -----NSGDIFAGVRSESGLDIRYATVSDGLPLGFDRSLNHDQYQSALLHVFSAHVEELV  113

Query  2499  KKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
             + L G       +IAD+F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG
Sbjct  114   ESLVG--EGVNVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFG  171

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
              ++ R+D IDYIPGVEAI P+D   YLQ E + +S V+  ++K FED KK D V+CNT+ 
Sbjct  172   AQETRRDLIDYIPGVEAINPKDTASYLQ-ETDISSVVHQIIFKAFEDVKKVDFVLCNTIH  230

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSF-TEQTAFRSLLPESDCCKWLDSKPPGSVLYASF  3035
             + E +TI AL  K PFYAIGP+ P +  T  +   SL  ESDC +WL++KP GSVLY SF
Sbjct  231   QFESKTIHALNSKIPFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWLNTKPAGSVLYISF  290

Query  3036  GSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWC  3215
             GS AH+TK+ ++E+  G+ LS+VNF+WV+RP +  +DE +    GF+    DRG+++PWC
Sbjct  291   GSYAHVTKKDLVEIAHGISLSKVNFVWVVRPDIVSSDETNPLPAGFESEAGDRGIVIPWC  350

Query  3216  HQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC  3395
              Q  V+SHP++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+WKIG+NLC
Sbjct  351   CQMTVLSHPSIGGFLTHCGWNSILESIWCEVPLLCFPLLTDQVTNRKLVVDDWKIGMNLC  410

Query  3396  NDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              +D   + ++EV   +  LM+ ES   +R AI  V+ +LE AL  +GSS +N+  FV+ +
Sbjct  411   -EDRGFVGRDEVRMSIGRLMRGESREGVRGAIGRVKMSLEGALECSGSSGENLGLFVDGL  469

Query  3576  KAKFNQSS  3599
              AK   S+
Sbjct  470   VAKVGLSN  477



>emb|CDP07058.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   499 bits (1284),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 246/465 (53%), Positives = 324/465 (70%), Gaps = 8/465 (2%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             QK HAI++  P QGH+NPA+ L+I LAS+GFT+TF+NT+ I   I      T     +DI
Sbjct  6     QKPHAILVCFPLQGHLNPAVQLAIKLASKGFTITFINTQSIHHQITS---NTQKDSDEDI  62

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F+ AR SGLDI YTT+SDG PL FDR+ +   FM  M +VFSAH+DE +++L    PP +
Sbjct  63    FSDARKSGLDIHYTTVSDGLPLEFDRSLNHDQFMAAMFHVFSAHIDEAIQRLMESGPPVS  122

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
             CLIADSF      +A K+ L+  SF+T+PA VF I  HLDLL+ NGHF C D R+D+IDY
Sbjct  123   CLIADSFLVQLGRVAKKHGLLYASFWTQPATVFTIYYHLDLLRLNGHFDCIDRREDAIDY  182

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPGV++IEP+DL  YLQ+E   T    +T +K   DAKKAD V+ N + ELE Q ++ L 
Sbjct  183   IPGVQSIEPKDLTSYLQEEQTNTICHQIT-FKAIHDAKKADFVLSNNIHELELQAMTDLR  241

Query  2892  EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
             +K PFYAIGPL   +        SL  +SDC +WLD+KP GSVLY SFGS AH+TK  + 
Sbjct  242   KKVPFYAIGPLLEFTKCRVAVATSLWSKSDCTQWLDTKPTGSVLYISFGSYAHVTKNELQ  301

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             E+  G+ LS+V F+WVLRP +  +++ D    GF+E   DRG+I+PWC Q  V+SHPA+G
Sbjct  302   EIADGVKLSQVTFVWVLRPDIVSSNDSDPLPKGFREETGDRGMIIPWCFQNQVLSHPAIG  361

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF T CGW+SILESIW +VP++C+PLI DQPTNRKLVVD WKIGINLC  D   I+K EV
Sbjct  362   GFFTQCGWSSILESIWYAVPLMCFPLIADQPTNRKLVVD-WKIGINLC--DKSQINKLEV  418

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFV  3566
             + K+  LMK+ +  EL+  IK++R+ +E+AL   GSS +N+D+F+
Sbjct  419   SEKINILMKSGNH-ELKNIIKELRRTMEHALSREGSSERNMDQFI  462



>ref|XP_010907030.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Elaeis 
guineensis]
Length=482

 Score =   499 bits (1284),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 247/475 (52%), Positives = 337/475 (71%), Gaps = 6/475 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E  QK HA+++P+P QGHINPA  L+I LA+RGFT+T+VNTE +     +ARR  ++ 
Sbjct  1     MAEPPQKPHAVLIPVPLQGHINPATRLAIKLATRGFTITYVNTEAVHHQSSRARRSASSI  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA-G  2513
                 IF  A  SGLDIRY  ISDG P+ FDRT +   F+  ++YVFSAHV+E ++KL   
Sbjct  61    -DHHIFADACASGLDIRYELISDGLPVSFDRTANPIQFLHSLLYVFSAHVEEFMRKLTRA  119

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
               PP TCLIAD+F+ WPS IA K+++  VSF+TEPA+VF +  H+DLL +NGHF   + R
Sbjct  120   ASPPITCLIADTFFVWPSTIAKKFDIPYVSFWTEPAVVFTLYYHMDLLIKNGHFASCENR  179

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             KD+I YIPGV AIEP DL  YLQ E NTTS ++  ++K FE+A+ AD V+CNTVQELEP+
Sbjct  180   KDTIAYIPGVPAIEPTDLMSYLQ-ETNTTSVLHQIIFKAFEEARGADFVLCNTVQELEPE  238

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLP-ESDCCKWLDSKPPGSVLYASFGSLAH  3050
             TISA+++++PFYA+GPL P  F    + ++ L  ESDC +WLD+KP GSVLY SFGS A+
Sbjct  239   TISAIQQEKPFYAVGPLIPPGFIPGISVQTTLQVESDCSQWLDTKPAGSVLYISFGSFAN  298

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             ++K  + E+  G++ ++ NFIWV+RP +  + E +     F E    RG+ +PWC Q  V
Sbjct  299   VSKRDLEEIAYGILDTKANFIWVIRPDIVSSKEHEPLPQRFLEESYGRGMCIPWCCQMEV  358

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHP++GGF+THCGWNSILES+WC VPM+C+PL  DQ TNRKLVV +WKIGI+L   D+ 
Sbjct  359   LSHPSIGGFLTHCGWNSILESMWCEVPMLCFPLQTDQFTNRKLVVKDWKIGIDLGRIDE-  417

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              +S++EV+ +V  LM  E   E +K +K+V + L  A+ ++GSS KN D+FV  +
Sbjct  418   -VSRKEVSKRVDSLMGGEEGNEAKKVMKEVTRALHGAVTADGSSQKNFDQFVADL  471



>gb|KDO60213.1| hypothetical protein CISIN_1g011789mg [Citrus sinensis]
Length=477

 Score =   498 bits (1281),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 326/471 (69%), Gaps = 7/471 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             QK HAI +  P QGH+NP++ L++ LAS+GFT+TFVNT  I   + KA    +     DI
Sbjct  7     QKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKA----SPEMGSDI  62

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F   R SGLDIRY T+SDG PLGFDR+ +   FM  +++VFSAH +E++ ++        
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGENVH  122

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
             CLIAD+++ WPS +A K+ L  +SF+TE ALVF +  HLDLL  NGHF C DCR+D+IDY
Sbjct  123   CLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCREDTIDY  182

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPGV+AI P+D   YLQ E +TTSA +  ++  F+D + AD V+CNTV ELE + ++AL+
Sbjct  183   IPGVKAINPKDTTSYLQ-ETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAVTALK  241

Query  2892  EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
              K PF  +GP+    F+++    SL  ESDC +WLD +P GSVLY SFGS AH++K  ++
Sbjct  242   AKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPKGSVLYVSFGSYAHVSKRDLI  301

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             E+  G+  S+V FIW+LRP +  +D+ +   + F++ V DR +I+ WC Q +V++HPA+G
Sbjct  302   EIANGIAKSKVTFIWILRPDIVSSDDPNPLPEDFKKEVADRSMIITWCCQTSVLAHPAIG  361

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF+THCGWNS+LE +WC VP++C+PL  DQ TNRKL VD+W +G+NL N  +K I+KEEV
Sbjct  362   GFLTHCGWNSVLEGLWCGVPLLCFPLYTDQFTNRKLAVDDWNVGLNLSN--EKVITKEEV  419

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  V  LM  +S  + R A K V+K +E AL  NGSS KN+D+F++ +K +
Sbjct  420   SKNVHLLMGEKSGAKYRNAAKQVKKAMEYALQPNGSSDKNMDQFIKDLKTR  470



>ref|XP_006488636.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Citrus sinensis]
Length=477

 Score =   497 bits (1280),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 326/471 (69%), Gaps = 7/471 (1%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             QK HAI +  P QGH+NP++ L++ LAS+GFT+TFVNT  I   + KA    +     DI
Sbjct  7     QKPHAIFISYPLQGHVNPSVQLALKLASQGFTITFVNTHFIHQQMTKA----SPEMGSDI  62

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F   R SGLDIRY T+SDG PLGFDR+ +   FM  +++VFSAH +E++ ++        
Sbjct  63    FAGVRKSGLDIRYMTLSDGLPLGFDRSLNHEQFMSSLLHVFSAHAEEVIGQIVRSGENVH  122

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
             CLIAD+++ WPS +A K+ L  +SF+TE ALVF +  HLDLL  NGHF C DCR+D+IDY
Sbjct  123   CLIADTYFVWPSKLAKKFGLYYISFWTESALVFTLYYHLDLLTINGHFQCYDCREDTIDY  182

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPGV+AI P+D   YLQ E +TTSA +  ++  F+D + AD V+CNTV ELE + ++AL+
Sbjct  183   IPGVKAINPKDTTSYLQ-ETDTTSACHQIIFNSFQDTRNADYVLCNTVHELESEAVTALK  241

Query  2892  EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
              K PF  +GP+    F+++    SL  ESDC +WLD +P GSVLY SFGS AH++K  ++
Sbjct  242   AKIPFITMGPISLNKFSDRVVATSLWSESDCSQWLDKQPEGSVLYVSFGSYAHVSKRDLI  301

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             E+  G+  S+V FIW+LRP +  +D+ +   + F++ V DR +I+ WC Q +V++HPA+G
Sbjct  302   EIANGIAKSKVTFIWILRPDIVSSDDPNPLPEDFKKEVADRSMIITWCCQTSVLAHPAIG  361

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF+THCGWNS+LE +WC VP++C+PL  DQ TNRKL VD+W +G+NL N  +K I+KEEV
Sbjct  362   GFLTHCGWNSVLEGLWCGVPLLCFPLYTDQFTNRKLAVDDWNVGLNLSN--EKVITKEEV  419

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +  V  LM  +S  + R A K V+K +E AL  NGSS KN+D+F++ +K +
Sbjct  420   SKNVHLLMGEKSGAKYRNAAKQVKKAMEYALQPNGSSDKNMDQFIKDLKTR  470



>emb|CDX77151.1| BnaC04g39460D [Brassica napus]
Length=480

 Score =   497 bits (1280),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 244/483 (51%), Positives = 337/483 (70%), Gaps = 19/483 (4%)
 Frame = +3

Query  2166  NNQKHH---AIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             N+ KHH   A+++P P+QGH+NP +HL+I LAS+G TVTFVNT      I          
Sbjct  9     NHHKHHRLHALLIPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQI----------  58

Query  2337  PTDDIFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
              + DIF   R+ SGLDIRY T+SDG PLGF+R+ +   +   +++VFSAHV+ELV+ L G
Sbjct  59    NSGDIFAGVRSESGLDIRYATVSDGLPLGFNRSLNHDQYQSSLLHVFSAHVEELVESLVG  118

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
                    +IAD+F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R
Sbjct  119   --EGVNVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETR  176

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D IDYIPGVEAI P+D   YLQ E + +S V+  ++K FED KK D V+CNT+ + E +
Sbjct  177   RDLIDYIPGVEAINPKDTASYLQ-ETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESK  235

Query  2874  TISALEEKQPFYAIGPLFPQSF-TEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             TI AL  K PFYAIGP+ P +  T  +   SL  ESDC +WL++KP GSVLY SFGS AH
Sbjct  236   TIRALNSKIPFYAIGPIIPFNLKTGSSVTTSLWSESDCTQWLNAKPAGSVLYISFGSYAH  295

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             +TK+ ++E+  G+ LS+VNF+WV+RP +  +DE +   +GF+    DRG+++PWC Q  V
Sbjct  296   VTKKDLVEIAHGISLSKVNFVWVVRPDIVSSDETNPLPEGFESEAGDRGIVIPWCCQMTV  355

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHP++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+WKIG+NLC +D  
Sbjct  356   LSHPSIGGFLTHCGWNSILESIWCEVPLLCFPLLTDQVTNRKLVVDDWKIGMNLC-EDRG  414

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
              + ++EV   +  LM  ES   +R AI  V+ +LE AL  +GSS +N+  FV+ + AK  
Sbjct  415   FVGRDEVKMSIGRLMCGESREGVRGAIGRVKMSLEGALKCSGSSEENLGLFVDGLVAKVG  474

Query  3591  QSS  3599
              S+
Sbjct  475   LSN  477



>ref|XP_009401822.1| PREDICTED: UDP-glycosyltransferase 86A1 [Musa acuminata subsp. 
malaccensis]
Length=508

 Score =   496 bits (1276),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 241/492 (49%), Positives = 333/492 (68%), Gaps = 30/492 (6%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+++P P QGHI PA+HL+I LASRGF +TFVNTE +      A R + +    DIF  
Sbjct  10    HALLVPYPLQGHIIPAVHLAIKLASRGFAITFVNTEAVHHQTCCAARRSGSDLGHDIFPA  69

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA-GLEPPPTCL  2537
             AR SGLDIRY  +SDG P+ FDR+ +   FM  +++V SAHV+EL++KL+   +PP TCL
Sbjct  70    ARASGLDIRYELVSDGLPVAFDRSLNHDQFMFAVLHVLSAHVEELIRKLSLRADPPLTCL  129

Query  2538  IADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCK-----------  2684
             IAD+F+ WPS +A K+ +  VSF+TEPAL+F++  H+DLL  NGHF              
Sbjct  130   IADTFFVWPSTLAKKFGIPYVSFWTEPALIFSLYYHMDLLIRNGHFASHGDRHISIPTRL  189

Query  2685  ---------------DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFED  2819
                            D  KD+I Y+PGV AIEP DL  YLQ E + ++ V+  ++K F++
Sbjct  190   LFLFFPHDSFMCLVVDNSKDTITYVPGVAAIEPADLMSYLQ-ETDVSTVVHQIIFKAFDE  248

Query  2820  AKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLD  2999
             AK AD V+CNTVQELE  TISAL+ ++PFYA+GP+FP  FT      SL  ESDC +WLD
Sbjct  249   AKAADFVLCNTVQELESDTISALQREKPFYAVGPIFPAGFTRSAVATSLWAESDCSQWLD  308

Query  3000  SKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQE  3179
             SKPPGSVLY SFGS AH+ +  + E+  G++ S V+FIWVLR  +  +DE D   + F E
Sbjct  309   SKPPGSVLYISFGSYAHIGRRDLEEIAHGVLGSTVSFIWVLRSDVVSSDEPDPLPEDFAE  368

Query  3180  CVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKL  3359
               + RG++VPWC Q  ++ H ++GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKL
Sbjct  369   ESQGRGVVVPWCCQVELLKHRSIGGFLTHCGWNSILESIWCGVPLLCFPLLTDQFTNRKL  428

Query  3360  VVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGS  3539
             VV++W+IG++L   +   +++EEV+ +++ LM+ E+  E RK  ++VR+ LE AL   GS
Sbjct  429   VVNDWRIGLDLGRTN--KVNREEVSKRIEILMEGEAGNEARKNTREVRRALEIALTPEGS  486

Query  3540  SVKNVDKFVEKI  3575
             S KN+D+F+  +
Sbjct  487   SHKNLDQFIADL  498



>ref|XP_011094627.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=481

 Score =   494 bits (1273),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 247/478 (52%), Positives = 335/478 (70%), Gaps = 11/478 (2%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             +K HAI++   +QGHI P I+L++ LAS GFTVTFV+TE I  ++ KA    T    +D 
Sbjct  4     RKLHAIMIAFSFQGHITPFINLALKLASNGFTVTFVHTEFIHHMLSKAHHNITHVDDEDF  63

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-AGLEPPP  2528
             F+ AR SGLDIRY TISDGFPL +DR  +   +   ++  F + V ELV ++    E   
Sbjct  64    FSGARQSGLDIRYMTISDGFPLDYDRILNFNEYWEAILRDFPSRVHELVGRIIQSNESLV  123

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
               L+AD+FY+WP+ IA ++N++NVSF+TEPALVF+ID HLDLL+ENG F  K  ++D ID
Sbjct  124   PFLVADTFYSWPASIAEEFNILNVSFWTEPALVFSIDYHLDLLRENGFFPSKGNQEDLID  183

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             ++PGV++I+ +DL  YLQ + + T+ ++  V+K F+  K AD ++ NTV ELE +T+ AL
Sbjct  184   FVPGVQSIKTKDLMSYLQ-DAHITTVIHQIVFKAFDQVKHADFILINTVNELEHETLLAL  242

Query  2889  EEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
              +KQP YAIG + F   FT+    +SL  E+DC +WL+SKP GSVLY SFGSLA +TK+ 
Sbjct  243   NKKQPSYAIGSINFSTDFTKTVVPKSLWSETDCTEWLNSKPAGSVLYISFGSLAQITKQL  302

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPA  3245
             + E+  GL+LSEVNF+ VLR      +  D   DGF+  +R RGLIV WC+Q +V+S PA
Sbjct  303   VDEIANGLLLSEVNFVLVLR------ENTDVLPDGFKNEIRGRGLIVSWCNQNSVLSSPA  356

Query  3246  VGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKE  3425
             +GGF+THCGWNSILESIWC VPMIC+P   DQPTNRKLVVD+WKIGINLC  D  SI ++
Sbjct  357   IGGFLTHCGWNSILESIWCGVPMICFPFYADQPTNRKLVVDDWKIGINLC--DGSSIDRK  414

Query  3426  EVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             EVA K+K LM  E S  LR  IK +R  L+NAL  +GS+ +N ++F++ ++AK +  S
Sbjct  415   EVAEKIKQLMSGEISNGLRDEIKKIRTILQNALAEDGSTHRNFNQFLKDLRAKVHGRS  472



>gb|AFJ53012.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=486

 Score =   494 bits (1272),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 333/475 (70%), Gaps = 14/475 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT-D  2345
             ++K HAIV+P P QGH+ PA+HL+  LAS+GFT+T+VNTE I          ++TAPT D
Sbjct  13    HRKPHAIVIPFPLQGHVIPAVHLAFKLASQGFTITYVNTEYIH----HKTSSSSTAPTGD  68

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLE  2519
             D F   R SGLDIRY TISDG PL FDR+ +   F+  M +VFSAHV+ELV  +  AG E
Sbjct  69    DFFAGVRKSGLDIRYKTISDGLPLRFDRSLNHDQFIASMFHVFSAHVEELVAGMVAAGKE  128

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
                +CL+AD+F+ WPS +A K+ LV VS +T+PALVF +  H+ LL+ N HFGC+D R+D
Sbjct  129   EKVSCLVADTFFVWPSKVAKKFGLVFVSIWTQPALVFTLYHHVHLLRRNCHFGCQDRRED  188

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I+YIPGV+ IEP+D+P  LQ+ +     V  T +  F D + AD ++ NTVQELE  TI
Sbjct  189   AIEYIPGVKRIEPKDMPSILQEVDEN---VEKTAFVAFRDVRYADFILANTVQELEHDTI  245

Query  2880  SALEE--KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             S L++  K  FY+IGP+FP  FT  +   SL  ESDC +WL+SKP GSVLY SFGS AH+
Sbjct  246   SGLKQAHKAQFYSIGPIFPPEFTTSSISTSLWSESDCTEWLNSKPSGSVLYVSFGSYAHV  305

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             TK  ++E+ RG+ LS V+F+WVLR  +  +++ D  + GF+E V DR +IV WC+Q  V+
Sbjct  306   TKSDLVEIARGIALSGVSFLWVLRDDIVSSNDPDPLIAGFREEVSDRAMIVGWCNQKEVL  365

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             +H A+GGF+THCGWNS+LES WC V M+C+PL VDQ TNRKLV+D+WK+GINL   D   
Sbjct  366   AHTAIGGFLTHCGWNSVLESTWCGVSMLCFPLFVDQFTNRKLVMDDWKVGINLV--DRAI  423

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             ++KEEV   V  LM  ++  EL++ IK V+K L +AL  +GSS +N+ +FV ++K
Sbjct  424   VTKEEVLKNVSRLMVGKTRDELQEKIKVVKKILVDALEPSGSSEQNLARFVRELK  478



>ref|XP_011094737.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=479

 Score =   492 bits (1266),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 331/473 (70%), Gaps = 13/473 (3%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             N+K HAI++ +  QGHI P ++L+I LAS+GF+VTF + E +   I K++  +T     D
Sbjct  6     NRKPHAIMISLHLQGHIIPFVNLAIKLASKGFSVTFAHLEFVHHQISKSQFNSTDI---D  62

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             IF QAR+SGLDI YTTISDGF + FDR+TD Y  +   +  F   VDELV K+       
Sbjct  63    IFAQARSSGLDINYTTISDGFAVEFDRSTDLY--VEAFLCRFPEKVDELVGKIMQSHSSA  120

Query  2529  TC---LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
                  L++D+F  WP+ IA KY LV+VSF+TEPALVF++  HL LL+ENGH    + R++
Sbjct  121   GSNFFLVSDTFSVWPAKIAEKYGLVDVSFWTEPALVFSLYYHLQLLRENGHVPV-NGRRE  179

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             ++DY+PG+++I  +D   YLQ  ++  + ++  +++ F+  K AD ++CNTVQELE + I
Sbjct  180   NVDYLPGIQSINTKDFMSYLQ--DSELTLLHKLIFQAFDTVKSADFILCNTVQELETEAI  237

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
             SAL+EKQPFYAIGPLF     +    RSLLPES+C +WL+S+P GSVLY SFGSLA   K
Sbjct  238   SALKEKQPFYAIGPLFLGDLKKNPVARSLLPESNCTEWLNSRPAGSVLYVSFGSLAKTDK  297

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
               I+E+  G++LS+VNFIWVLRPGM  ++      +GF++  RDRGLIVPWC Q  V+ +
Sbjct  298   NVILEIAGGILLSQVNFIWVLRPGMVDSEGGGILPEGFEDRTRDRGLIVPWCTQNQVLMN  357

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             PA GGF+THCGWNSI+ESIW  VPMICYPL  DQ TNRKLVVD+WK+GINLC  D  S++
Sbjct  358   PATGGFLTHCGWNSIVESIWACVPMICYPLFTDQITNRKLVVDDWKVGINLC--DGASLT  415

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             +EEVA  +  LM  + + ELR+  K VR+ L+NAL  +GSS KN + FVE +K
Sbjct  416   REEVAENIGVLMSGKRADELRQETKKVRETLQNALTEDGSSEKNFNCFVEDVK  468



>gb|AFJ53014.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=492

 Score =   491 bits (1264),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 329/481 (68%), Gaps = 14/481 (3%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             ++  K HAIV+P P QGH+ PA++L+I LAS+GFT+T+VNT  I          +  A  
Sbjct  17    DHTPKPHAIVVPFPLQGHVIPAVYLAIKLASQGFTITYVNTHYIH----HKTSSSAAATG  72

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL--  2516
             DD F   R SGLDIRY TISDG PLGFDR+ +   F+  +M+VF A+V+ELV  +     
Sbjct  73    DDFFAGVRESGLDIRYKTISDGKPLGFDRSLNHDEFLASIMHVFPANVEELVAGMVAAGE  132

Query  2517  ---EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKD  2687
                E   +CL+AD+F+ WPS +A K+ LV VS +T+PALVF +  H+ LL++NGHFGC+D
Sbjct  133   KEEEGKVSCLVADTFFVWPSKVAKKFGLVYVSVWTQPALVFTLYHHVHLLRQNGHFGCRD  192

Query  2688  CRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELE  2867
              RKD+IDY+PGV+ IEP+D P  LQ+++ TT  V+ T    F D + AD V+ NT+QELE
Sbjct  193   RRKDTIDYVPGVKRIEPKDTPSPLQEDDETT-IVHQTTLGAFHDVRSADFVLINTIQELE  251

Query  2868  PQTISALEE--KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGS  3041
               TIS LE   +   YAIGP+FP+ FT +    SL  ESDC +WL+SKPPGSVLY SFGS
Sbjct  252   QDTISGLEHVHEAQVYAIGPIFPRGFTTKPISMSLWSESDCTQWLNSKPPGSVLYVSFGS  311

Query  3042  LAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQ  3221
              AH+ K  ++E+  GL LS V+F+WVLR  +  +D+ D    GF+E V DR +IV WC Q
Sbjct  312   YAHVAKPDLVEIAYGLALSGVSFLWVLRDDIVSSDDPDPLPVGFKEEVSDRAMIVGWCSQ  371

Query  3222  PAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCND  3401
               V+ H A+GGF+THCGWNS+LESIWC VPMIC+PL VDQ TNRKL+VD+WK+GINL   
Sbjct  372   KEVLDHEAIGGFLTHCGWNSVLESIWCGVPMICFPLFVDQFTNRKLMVDDWKVGINLV--  429

Query  3402  DDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKA  3581
             D   ++KEEV+  V  LM  +S  EL++ I +V+K L  AL  +GSS +N  +F+ ++K 
Sbjct  430   DRAVVTKEEVSENVNHLMVGKSRNELKEKINEVKKILVWALEPSGSSEQNFIRFIGELKD  489

Query  3582  K  3584
             K
Sbjct  490   K  490



>ref|XP_011074246.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=478

 Score =   490 bits (1262),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 322/480 (67%), Gaps = 16/480 (3%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E + + HAIV   P+QGHI P ++L+ NLASRGFT+T+V  E +   I KA  G    
Sbjct  1     MGETHPRPHAIVFSYPFQGHITPTLNLATNLASRGFTITYVQLEFVHHTISKAHDGVEDV  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                D F QAR SGLD+RYTTISDGFPL FDR  +      GM+  F   VDELV  +   
Sbjct  61    ---DFFVQARRSGLDMRYTTISDGFPLEFDRNLNFNEHWEGMVRDFPDRVDELVGSITRS  117

Query  2517  EPPPTC--LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
             +       L+AD+ Y WP+ IA K+NLVNVS +T  A VF+I+SHL+LL+ENGH  C+  
Sbjct  118   DASAAAFFLVADTLYTWPAAIAKKHNLVNVSLWTGAATVFSINSHLNLLRENGHLPCRGN  177

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              ++ I YIPGV++I  +DL  Y+Q + +    +   V K FE  K AD ++CNTVQELE 
Sbjct  178   DEEHISYIPGVQSIRTKDLMPYIQ-DPDVVPVLMKIVVKAFEQVKNADFILCNTVQELEA  236

Query  2871  QTISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
             + +SAL  KQP YAIGP+ F   FT+    +SL PESDC  WL SKPP SVLY SFGS+ 
Sbjct  237   ECLSALNLKQPTYAIGPMNFFSDFTKTVVEKSLWPESDCTHWLSSKPPASVLYISFGSIV  296

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
              + K+ I+E+  GL+ S+VNFIW+LR   A+         GFQ+ V+D GLIVPWC+Q A
Sbjct  297   QINKQEIVEIAHGLLHSQVNFIWILRTTDALPA-------GFQDDVKDGGLIVPWCNQNA  349

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+S PAVGGF+THCGWNS+LESIW  VPMICYP  VDQPTNRKLVVD+WK+GI+LC  D 
Sbjct  350   VLSSPAVGGFLTHCGWNSVLESIWSGVPMICYPHYVDQPTNRKLVVDDWKVGIDLC--DG  407

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
               ++ E VASK+  LM+ +SSI LR+ IK V K + NA  ++GSS +  D+FV++++ + 
Sbjct  408   GRVTSEAVASKINILMRGKSSIVLREQIKKVSKIMRNAFETDGSSQRTFDQFVDELRGRL  467



>ref|XP_004983013.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Setaria 
italica]
Length=493

 Score =   491 bits (1263),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/476 (48%), Positives = 327/476 (69%), Gaps = 8/476 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD-  2345
               K HA+V+P P QGH+ PA+HL++ LA RGF VTFVNTE +     +A           
Sbjct  17    GTKPHAVVVPYPLQGHVIPAVHLALRLAERGFAVTFVNTESVHHQTTRALAVLGGGAGGG  76

Query  2346  DIFTQARNSG---LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
             DIF   R S    LD+RY  +SDGFPLGFDR+ +   FM G+++V  AHV+EL++++  +
Sbjct  77    DIFAGVRASSAEQLDLRYEVVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEELLRRVV-V  135

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +PP TCL+ D+F+ WP+ +A K  +  VSF+TEPAL+F++  H+DLL ++GHF CK+ RK
Sbjct  136   DPPSTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFSLYYHMDLLTKHGHFNCKEPRK  195

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I YIPGV +IEP +L  YLQ E +TTS V+  ++K F++A++AD V+CNTV+ELEP T
Sbjct  196   DTITYIPGVPSIEPTELMSYLQ-ETDTTSVVHRIIFKAFDEARRADYVLCNTVEELEPST  254

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             I+AL  ++PFYA+GP+ P  F       S+  ESDC +WLD++PPGSVLY SFGS AH+T
Sbjct  255   IAALRAEKPFYAVGPVLPAGFARSAVATSMWAESDCSRWLDAQPPGSVLYISFGSYAHVT  314

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             +  + E+  G++ S   F+WVLRP +  +D+ D   +GF      RG++VPWC Q  V+S
Sbjct  315   RRELHEIAAGVLASGARFLWVLRPDVVSSDDPDPLPEGFAAAAAGRGVVVPWCCQVEVLS  374

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             H AVGGF+THCGWNSILES+W  VPM+C+PL+ DQ TNR+LV  EW+ G+++   D  ++
Sbjct  375   HAAVGGFLTHCGWNSILESVWAGVPMLCFPLLTDQITNRRLVAREWRAGVSI--GDRGAV  432

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
                EV ++V+ +M  E  ++LR+ ++ +R  LE A+   GSS  + D+FV+ +K +
Sbjct  433   HAAEVRARVEGVMGGEEGVKLREQVRKLRATLEAAVAPGGSSRSSFDEFVDVLKRR  488



>gb|AFJ53011.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=489

 Score =   489 bits (1258),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 333/481 (69%), Gaps = 13/481 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAI++P P QGHI PA+HL+I LAS+GFT+T++NTE I      A  G      DD+F
Sbjct  15    KPHAILVPYPLQGHIIPAVHLAIKLASQGFTITYINTEYIHHKTSSAAAGGG----DDVF  70

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLEPPP  2528
             +  R+SGLDIRY T+SDG P+GFDR+ +   FM  +++V   +V+E++  +  AG E   
Sbjct  71    SGVRDSGLDIRYKTVSDGKPVGFDRSLNHDEFMASILHVLPGNVEEVIAGIVSAGEEEDE  130

Query  2529  --TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
               +CL+AD+F+ WPS +A K+ LV VS +TEP LV+ +  H+ LL++NGH+GCKD RKD+
Sbjct  131   EVSCLVADTFFVWPSKVAKKFGLVYVSVWTEPILVYTLYHHVHLLRQNGHYGCKDRRKDA  190

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV+ IEP+D   +LQ+ +  T  ++  ++  F+DA+ AD ++ NTVQELE  TIS
Sbjct  191   IDYIPGVKRIEPKDTMSFLQEADENT-IIHQIIFPAFQDARGADFILANTVQELEQDTIS  249

Query  2883  ALEE--KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
              L++  K   Y+IGP+FP  FT+ +   SL  ESDC KWL++KPPGSVLY SFGS AH+T
Sbjct  250   GLKQAHKGQVYSIGPIFPPRFTKSSVSTSLWAESDCTKWLNTKPPGSVLYVSFGSYAHVT  309

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  ++E+  GL LS+V+FIWVLR  +   D+ +    GF+E + DR +IV WC+Q  V+S
Sbjct  310   KADLVEIAHGLALSKVSFIWVLRDDIVSADDPNPLPVGFKEEISDRAMIVGWCNQKEVLS  369

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             H A+GGF+THCGWNS+LES WC VPM+C+PL  DQ TNRKLVVD+WKIGINL N     +
Sbjct  370   HTAIGGFLTHCGWNSVLESTWCGVPMVCFPLYTDQFTNRKLVVDDWKIGINLIN--HTVV  427

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             +KE+VA  +  LM  +S   +++ +K+V K L  A+  NGSS +N  +FV +++    Q 
Sbjct  428   TKEDVAENINHLMDGKSRERIKEKVKEVNKILVGAIEPNGSSERNFTRFVRELEDNITQL  487

Query  3597  S  3599
             S
Sbjct  488   S  488



>ref|XP_010907028.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Elaeis guineensis]
Length=469

 Score =   488 bits (1256),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 323/473 (68%), Gaps = 7/473 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             MV+ ++K HA+++PMP+QGHI PA+ L+I LAS+GFT+TFVNTE  +  I +A       
Sbjct  1     MVDPDRKPHAVLIPMPFQGHIFPAVQLAIKLASKGFTITFVNTEATNYQISQAHHSPIN-  59

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF+ AR SGLDIRY  ISDG P  +DR+ +        +Y+FS HV+ L++KL   
Sbjct  60    --HDIFSDARASGLDIRYELISDGLPTSYDRSRNDEQLWYAYLYLFSTHVEALMQKLLLT  117

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP TCLIAD+F+ WPS +A K  L  VSF+TEPA VF +  H+DLL  +GH  C++ RK
Sbjct  118   SPPVTCLIADTFFVWPSTMAKKLGLTYVSFWTEPATVFTLFYHMDLLIAHGHHACQENRK  177

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I YIPGV AIEP DL  YLQ +        L  +K  E+ K AD V+CNT +ELE +T
Sbjct  178   DTITYIPGVPAIEPTDLMSYLQLDIPPMPRQML--FKAMEETKGADFVLCNTAEELELET  235

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL+ ++PFYA+GP+FP  FT  T   +L  ESDC +WLDSKP GSVLY SFGS A+++
Sbjct  236   ISALQREKPFYAVGPIFPVDFTRSTVAATLWTESDCSQWLDSKPAGSVLYISFGSYANVS  295

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  + E+  G++ S+ NF+W +R  +  TDE +     F E   +RG++VPWC Q  V+S
Sbjct  296   KRDLEEIAYGILDSKANFLWAIRRDIVSTDEPEPLPKEFLEECDERGIVVPWCCQREVLS  355

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HP++GGF+THCGWNS+LESIWC+VP++C+PLI DQ TNRKLVV +WKIG  +       +
Sbjct  356   HPSIGGFLTHCGWNSVLESIWCAVPLLCFPLISDQLTNRKLVVQDWKIGTEIGG--LGIV  413

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
             S+ EV+ K++ LM  E   + RK IK+++K LE AL  +GSS KN D+F+E +
Sbjct  414   SRNEVSEKIESLMGGEIGDQARKEIKELKKALETALSPDGSSPKNFDQFIEDL  466



>emb|CBI32766.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   487 bits (1253),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 244/480 (51%), Positives = 323/480 (67%), Gaps = 58/480 (12%)
 Frame = +3

Query  2157  MVENNQKH-HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT  2333
             MV+NN  + HAI++P P QGH+ P +HL+I LAS GFT+TFVNT+ +   I +A+   + 
Sbjct  1     MVDNNPPNPHAILIPYPLQGHVIPFVHLAIKLASNGFTITFVNTQSVHHQISQAQPHNSP  60

Query  2334  APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAG  2513
                +DIF  ARNSGLDIRY T+SDGFP+GFDR+ +   FM G+++V+SAHVDELV  +  
Sbjct  61    ---EDIFAGARNSGLDIRYATVSDGFPVGFDRSLNHDQFMEGILHVYSAHVDELVGSIVH  117

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
              +PP TCLIAD+FY WPS I++KYNLVNVSF+TEPALV ++  H+ LL+ +GHF   D R
Sbjct  118   SDPPATCLIADTFYVWPSKISNKYNLVNVSFWTEPALVLSLYYHMHLLRSHGHFASFDNR  177

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +D+IDYIPGV  I+P DL  YLQ  + TT  V+  +YK F+D K+AD +ICNTV+ELE  
Sbjct  178   EDAIDYIPGVPEIKPTDLTSYLQATDITT-VVHRIIYKAFDDVKRADFIICNTVEELESN  236

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISA+ +KQP+YAIGPLFP  FT+     ++  ESDC  WL ++P GSVLY SFGS AH 
Sbjct  237   TISAIHQKQPYYAIGPLFPTGFTKSPVPMNMWSESDCAHWLTARPNGSVLYLSFGSYAHT  296

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K +I+E                                                   VI
Sbjct  297   SKHNIIE---------------------------------------------------VI  305

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHPA+GGF+THCGWNSILES+WC+VP++CYPL+ DQ TNRKLVVD+WKIGINLC  D + 
Sbjct  306   SHPAIGGFVTHCGWNSILESVWCTVPLLCYPLLTDQFTNRKLVVDDWKIGINLC--DGRR  363

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +++EEV+ K+  +M  +++ +LRK IKDVRK LENA+   GSS +N  +FV++   K  +
Sbjct  364   MTREEVSEKISRVMFGKTADDLRKRIKDVRKTLENAVSPVGSSERNFSQFVKEAGDKIQE  423



>ref|XP_002464565.1| hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
 gb|EER91563.1| hypothetical protein SORBIDRAFT_01g020920 [Sorghum bicolor]
Length=490

 Score =   486 bits (1252),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 224/478 (47%), Positives = 324/478 (68%), Gaps = 4/478 (1%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
                 + HA+V+P P QGH+ PA+HL++ LA RGF VTFVNTE +   I            
Sbjct  16    RRRARPHAVVMPYPLQGHVIPAVHLALRLAERGFAVTFVNTESVHHQIGAGGDIFAAVRA  75

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
                      + LD+RY  +SDGFPLGFDR+ +   FM G+++V  AHV+EL++++  ++P
Sbjct  76    GGGGATTTTTELDVRYELVSDGFPLGFDRSLNHDQFMEGILHVLPAHVEELLRRVV-VDP  134

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
             P TCL+ D+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL ++GHF CK+ RKD+
Sbjct  135   PTTCLVIDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKEPRKDT  194

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             I YIPGV +IEP +L  YLQ E +TTS V+  ++K F++A+ AD V+CNTV+ELEP TI+
Sbjct  195   ITYIPGVASIEPSELMSYLQ-ETDTTSVVHRIIFKAFDEARDADYVLCNTVEELEPSTIA  253

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL   +PFYA+GP+FP  F       S+  ESDC +WLD++PPGSVLY SFGS AH+TK+
Sbjct  254   ALRADRPFYAVGPIFPAGFARSAVATSMWAESDCSRWLDAQPPGSVLYISFGSYAHVTKQ  313

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              + E+  G++ S   F+WV+RP +  +D+ D   +GF +    RGL+V WC Q  V+SH 
Sbjct  314   ELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFADAAAGRGLVVQWCCQVEVLSHA  373

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             AVGGF+THCGWNSILES+W  VPM+C+PL+ DQ TNR+LV  EW+ G+++   D  ++  
Sbjct  374   AVGGFLTHCGWNSILESVWAGVPMLCFPLLTDQITNRRLVAREWRAGVSI--GDRGAVRA  431

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
             +EV ++++ LM  E  + LR+ +K +R  LE A+   GSS ++ D+FV+++K +   S
Sbjct  432   DEVRARIEGLMGGEDGVMLREQVKKLRGTLEAAVAPGGSSRRSFDEFVDELKRRCGGS  489



>ref|XP_010414605.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Camelina sativa]
Length=481

 Score =   486 bits (1250),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/482 (49%), Positives = 331/482 (69%), Gaps = 16/482 (3%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
              N+   HA+++P P+QGH+NP + L+I LAS+G TVTFVNT  I   I     G      
Sbjct  10    HNHHNLHALLIPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQITNGSDG------  63

Query  2343  DDIFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
              DIF   R+ SGLDIRY T+SDG P+GFDR+ +   +   ++YVF AHV+ELV  L G +
Sbjct  64    -DIFAGVRSESGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLYVFYAHVEELVASLVGGD  122

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
                  +IAD+F+ WPS++A K+ LV VSF+TE ALVF++  HLDLL+ +GHFG ++ R+D
Sbjct  123   SGVNVMIADTFFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRVHGHFGAQETRED  182

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
              IDYIPGV AI P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI
Sbjct  183   LIDYIPGVAAINPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTI  241

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAF-RSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
              AL  K PFYA+GP+ P +    ++   SL  ESDC +WL++KP  SVLY SFGS AH+T
Sbjct  242   KALNSKIPFYAVGPIIPFNLQSGSSVATSLWSESDCTQWLNAKPKSSVLYVSFGSYAHVT  301

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K+ ++E+  G++ S+VNF+WV+RP +  +DE +   +GFQ    DRG+++PWC Q  V+S
Sbjct  302   KKDLVEIAHGILQSKVNFVWVVRPDIVSSDETNPLPEGFQTEAGDRGIVIPWCCQMTVLS  361

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             H +VGGF+THCGWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D    
Sbjct  362   HESVGGFLTHCGWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDRSDF  420

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQ  3593
              ++EV   +  LM   S    ++ I  V+ +LE A+ ++GSS + N+  F++ + AK   
Sbjct  421   GRDEVGRNINRLMCGVS----KEKIGRVKMSLEGAVKNSGSSSEMNLGLFIDGLMAKVGL  476

Query  3594  SS  3599
             S+
Sbjct  477   SN  478



>ref|XP_011094740.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=486

 Score =   486 bits (1250),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 332/481 (69%), Gaps = 12/481 (2%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKA---RRGTTTAPTD  2345
             K HAI++ +PYQGH NP  HL+I LAS+GFT+TFV+TE     I K+   R  T+ +   
Sbjct  8     KLHAIMIAVPYQGHANPFTHLAIKLASKGFTITFVHTEDAHHRISKSYQKRNSTSNSNEV  67

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF++AR+SGLDIRYTTISDGFPL FDR  +   +   M + F + VDE +  L     P
Sbjct  68    DIFSEARDSGLDIRYTTISDGFPLEFDRIHNIDEYWESMFHDFPSRVDEFIGNLIESSDP  127

Query  2526  PTC--LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSH-LDLLKENGHFGCKDCRK  2696
                  L+AD+ Y+WP+ IA KYNLVNVSF+TEPALVFAI ++  DLL  NGHF   D   
Sbjct  128   SLVPFLVADTVYSWPATIAKKYNLVNVSFWTEPALVFAISNYYFDLLSTNGHFPRTDDPL  187

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
              SIDYIPGVE I  +DL  YL  E +TT+  +  + K FE+ KKAD ++ NTVQELE  T
Sbjct  188   YSIDYIPGVELISNKDLMPYLH-EVDTTTVTHKILIKAFEEVKKADFILHNTVQELELYT  246

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAF-RSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             +S L +KQP YAIGP+   S   +T   +SL  E DC KWL+SKPPGSVLY SFGS+   
Sbjct  247   LSILNQKQPTYAIGPVNLSSECIKTRVSKSLFFEIDCSKWLESKPPGSVLYVSFGSIVQT  306

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGM--AITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
              K+ I  + +GL+LSEV+FIW +RP +  +  D  +   DGF++ ++D+GLIVPWC+Q A
Sbjct  307   NKQIIEAIAQGLLLSEVSFIWAIRPKIVSSTDDNENVLPDGFEDNIKDKGLIVPWCNQNA  366

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+S+PAVGGF+THCGWNSILES+ C VPMICYP++ DQPTNRKLVVD WKIG+NLC  D 
Sbjct  367   VLSNPAVGGFLTHCGWNSILESMSCGVPMICYPIMYDQPTNRKLVVDNWKIGVNLC--DG  424

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              S++  EVASK+K LM  ++S+ +R  +   R  L +AL   GSS +N D+F++ ++ K 
Sbjct  425   VSVNGAEVASKIKQLMCEKTSVGIRNEMMKFRSILHDALAEEGSSNRNFDQFIQDLRHKM  484

Query  3588  N  3590
             +
Sbjct  485   H  485



>ref|XP_003573977.1| PREDICTED: UDP-glycosyltransferase 86A1 isoform X2 [Brachypodium 
distachyon]
Length=488

 Score =   483 bits (1242),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 330/489 (67%), Gaps = 18/489 (4%)
 Frame = +3

Query  2157  MVENNQ-----KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARR  2321
             M  NN      K HA+V+P P QGH+ PA HL++ LA+RGF VTFVNTE +      AR 
Sbjct  1     MAANNGTGGRGKPHAVVIPYPLQGHVIPAAHLALRLATRGFAVTFVNTESVHQQ--TARA  58

Query  2322  GTTTAPTDDIFTQARN------SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAH  2483
                +A   DIF  AR       + LD+RY  +SDGFPLGFDR+ +   +M G+++V  AH
Sbjct  59    LGVSAAGYDIFAAARAEDEEEENKLDVRYELVSDGFPLGFDRSLNHDQYMEGVLHVLPAH  118

Query  2484  VDELVKKLAGL--EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLL  2657
             V+EL+ +L     +   TCL+AD+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL
Sbjct  119   VEELLCRLVCDVDQAASTCLVADTFFVWPATLARKLGVPYVSFWTEPALIFTLYYHMDLL  178

Query  2658  KENGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADI  2837
              ++GHF C++ RKD+I YIPGV AIEPR+L  YLQ E +TT+ V+  ++K FE+A+ AD 
Sbjct  179   AKHGHFKCQEPRKDTITYIPGVPAIEPRELMSYLQ-ETDTTTVVHRIIFKAFEEARGADY  237

Query  2838  VICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGS  3017
             V+CNTV+ELEP TI+AL  ++PFYA+GP+FP  F       S+  ESDC  WLD++PPGS
Sbjct  238   VLCNTVEELEPSTIAALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSHWLDAQPPGS  297

Query  3018  VLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRG  3197
             VLY SFGS AH+TK+ + E+  G++ S   F+WV+RP +  +D+ D   +GF      RG
Sbjct  298   VLYISFGSYAHVTKQELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFVAASAGRG  357

Query  3198  LIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWK  3377
             L+VPWC Q  V+SH AVG F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LV  EW+
Sbjct  358   LVVPWCCQVEVLSHAAVGAFLTHCGWNSVLESVWAGVPMLCFPLLTDQFTNRRLVAREWR  417

Query  3378  IGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVD  3557
             +G+ +   D  ++  +EV ++++ +M  E   ELRKA+K VR  LE A    GSS ++ D
Sbjct  418   VGVPV--GDRGAVFADEVRARIEGVMAGEEGEELRKAVKKVRATLEAAAAPGGSSQRSFD  475

Query  3558  KFVEKIKAK  3584
             +FV+++  +
Sbjct  476   QFVDELTRR  484



>ref|XP_002879117.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55376.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   482 bits (1241),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 324/470 (69%), Gaps = 14/470 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP +HL+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  74

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  75    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGGDGGVNVMIADT  134

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R+D IDYIPGV A
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRRDLIDYIPGVAA  194

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  195   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFY  253

Query  2910  AIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGL  3089
             AIGP+ P +    +   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  G+
Sbjct  254   AIGPIIPFNNQTGSVTTSLWSESDCTQWLNTKPKSSVLYVSFGSYAHVTKKDLVEIAHGI  313

Query  3090  MLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHC  3269
             +LS+VNF+WV+RP +  +DE +   +GF+    DRG+++PWC Q  V+SH +VGGF+THC
Sbjct  314   LLSKVNFVWVVRPDIVSSDETNPLPEGFETEAGDRGIVIPWCCQMTVLSHESVGGFLTHC  373

Query  3270  GWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKF  3449
             GWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EV   +  
Sbjct  374   GWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDKSDFGRDEVGRNINR  432

Query  3450  LMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             LM   S    +  I  V+ +LE A+ ++GSS  N+  F++ + +K   S+
Sbjct  433   LMCGVS----KGKIGRVKMSLEGAVINSGSSEMNLGLFIDGLLSKVGLSN  478



>ref|XP_003573976.1| PREDICTED: UDP-glycosyltransferase 86A1 isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   482 bits (1241),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 227/474 (48%), Positives = 320/474 (68%), Gaps = 11/474 (2%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD-DI  2351
             K HA+V+  P QGHI P  HL++ LASRGF VTFVNTE +     +  R     P   D+
Sbjct  18    KPHAVVVVYPLQGHIIPVTHLALRLASRGFAVTFVNTEAVHD---QTARALGVDPAGYDV  74

Query  2352  FTQAR---NSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
             F  AR   +S +D+RY  +SDG P+GFDR+     FM  +    S HV+ L++++  ++P
Sbjct  75    FAGARGEWSSEMDVRYELVSDGLPVGFDRSLHHDEFMEALFSALSGHVEALLRRVV-VDP  133

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
               TCL+AD+F+ WP+ +A K+ +  VSF+TEPAL+F +  H+ LL  NGHFGC + RKD+
Sbjct  134   ASTCLVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFGCDEPRKDT  193

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             I YIPGV AIEPR+L  YLQ E +TT+ V+  ++K FE+A+ AD V+CNTV+ELEP TI+
Sbjct  194   ITYIPGVPAIEPRELMSYLQ-ETDTTTVVHRIIFKAFEEARGADYVLCNTVEELEPSTIA  252

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKE  3062
             AL  ++PFYA+GP+FP  F       S+  ESDC  WLD++PPGSVLY SFGS AH+TK+
Sbjct  253   ALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSHWLDAQPPGSVLYISFGSYAHVTKQ  312

Query  3063  HIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHP  3242
              + E+  G++ S   F+WV+RP +  +D+ D   +GF      RGL+VPWC Q  V+SH 
Sbjct  313   ELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFVAASAGRGLVVPWCCQVEVLSHA  372

Query  3243  AVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISK  3422
             AVG F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LV  EW++G+ +   D  ++  
Sbjct  373   AVGAFLTHCGWNSVLESVWAGVPMLCFPLLTDQFTNRRLVAREWRVGVPV--GDRGAVFA  430

Query  3423  EEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             +EV ++++ +M  E   ELRKA+K VR  LE A    GSS ++ D+FV+++  +
Sbjct  431   DEVRARIEGVMAGEEGEELRKAVKKVRATLEAAAAPGGSSQRSFDQFVDELTRR  484



>ref|XP_006409826.1| hypothetical protein EUTSA_v10016590mg [Eutrema salsugineum]
 gb|ESQ51279.1| hypothetical protein EUTSA_v10016590mg [Eutrema salsugineum]
Length=478

 Score =   481 bits (1237),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 325/470 (69%), Gaps = 15/470 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP +HL+I LAS+G TVTFVNT      I           + DIF   R+ 
Sbjct  20    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYNHHQI----------NSGDIFAGVRSE  69

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VFSAHV+ELV  L G       +IAD+
Sbjct  70    SGLDIRYATVSDGLPIGFDRSLNHDQYQSSLLHVFSAHVEELVASLVG--EGVNVMIADT  127

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R D IDYIPGVEA
Sbjct  128   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRGDLIDYIPGVEA  187

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E + +S V+  ++K FED KK D V+CNT+ + E +TI AL  K PFY
Sbjct  188   INPKDTASYLQ-ETDISSVVHQIIFKAFEDVKKVDFVLCNTIHQFESKTIQALNSKIPFY  246

Query  2910  AIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGL  3089
             AIGP+ P +    +   SL  ESDC +WL++KP GSVLY SFGS AH+TK+ ++E+  G+
Sbjct  247   AIGPIIPFNLQTGSVTTSLWSESDCTQWLNTKPAGSVLYISFGSYAHVTKKDLVEIAHGI  306

Query  3090  MLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHC  3269
             + S+VNF+WV+RP +  +DE +   + F+    DRG+++PWC Q  V+SH ++GGF+THC
Sbjct  307   LKSKVNFVWVVRPDIVSSDENNPLPESFESEAGDRGIVIPWCCQMTVLSHRSIGGFLTHC  366

Query  3270  GWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKF  3449
             GWNSILESIWC VP++C+PL+ DQ TNRKLVVD+W+IG+NLC +D   + ++EV   +  
Sbjct  367   GWNSILESIWCEVPLLCFPLLTDQVTNRKLVVDDWEIGMNLC-EDRGFVGRDEVRMSIDR  425

Query  3450  LMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             LM   S  E++++I  V+ +LE AL  +GSS +N+  F+  ++AK   S+
Sbjct  426   LMCGNSREEVKESIGRVKMSLEGALRCSGSSERNLGLFINGLRAKVGLSN  475



>ref|NP_180375.1| UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 sp|Q9ZUV0.1|U86A2_ARATH RecName: Full=UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 gb|AAC98458.1| putative glucosyltransferase [Arabidopsis thaliana]
 dbj|BAD95413.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEC08076.1| UDP-glycosyltransferase 86A2 [Arabidopsis thaliana]
 gb|AHL38835.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=482

 Score =   478 bits (1231),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 325/471 (69%), Gaps = 15/471 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP +HL+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  74

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  75    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGGDGGVNVMIADT  134

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R D IDYIPGV A
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRSDLIDYIPGVAA  194

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  195   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFY  253

Query  2910  AIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGL  3089
             AIGP+ P +    +   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  G+
Sbjct  254   AIGPIIPFNNQTGSVTTSLWSESDCTQWLNTKPKSSVLYISFGSYAHVTKKDLVEIAHGI  313

Query  3090  MLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHC  3269
             +LS+VNF+WV+RP +  +DE +   +GF+    DRG+++PWC Q  V+SH +VGGF+THC
Sbjct  314   LLSKVNFVWVVRPDIVSSDETNPLPEGFETEAGDRGIVIPWCCQMTVLSHESVGGFLTHC  373

Query  3270  GWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKF  3449
             GWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EV   +  
Sbjct  374   GWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDKSDFGRDEVGRNINR  432

Query  3450  LMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQSS  3599
             LM   S    ++ I  V+ +LE A+ ++GSS + N+  F++ + +K   S+
Sbjct  433   LMCGVS----KEKIGRVKMSLEGAVRNSGSSSEMNLGLFIDGLLSKVGLSN  479



>gb|AAM61749.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=482

 Score =   478 bits (1230),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 325/471 (69%), Gaps = 15/471 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP +HL+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  22    IPYPFQGHVNPFVHLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  74

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  75    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGGDDGVNVMIADT  134

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R D IDYIPGV A
Sbjct  135   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRIHGHFGAQETRGDLIDYIPGVAA  194

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  195   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNTKIPFY  253

Query  2910  AIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGL  3089
             AIGP+ P +    +   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  G+
Sbjct  254   AIGPIIPFNNQTGSVTTSLWSESDCTQWLNTKPKSSVLYISFGSYAHVTKKDLVEIAHGI  313

Query  3090  MLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHC  3269
             +LS+VNF+WV+RP +  +DE +   +GF+    DRG+++PWC Q  V+SH +VGGF+THC
Sbjct  314   LLSKVNFVWVVRPDIVSSDETNPLPEGFETEAGDRGIVIPWCCQMTVLSHESVGGFLTHC  373

Query  3270  GWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKF  3449
             GWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EV   +  
Sbjct  374   GWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDKSDFGRDEVGRNINR  432

Query  3450  LMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQSS  3599
             LM   S    ++ I  V+ +LE A+ ++GSS + N+  F++ + +K   S+
Sbjct  433   LMCGVS----KEKIGRVKMSLEGAVRNSGSSSEMNLGLFIDGLLSKVGLSN  479



>ref|XP_008645070.1| PREDICTED: uncharacterized protein LOC100383459 isoform X1 [Zea 
mays]
 tpg|DAA49848.1| TPA: hypothetical protein ZEAMMB73_668920 [Zea mays]
Length=492

 Score =   478 bits (1229),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/483 (46%), Positives = 323/483 (67%), Gaps = 22/483 (5%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+V+P P QGH+ PA+HL++ LA RGF VTF+NTE +   I             DIF  
Sbjct  22    HAVVMPYPLQGHVIPAVHLALRLAERGFAVTFINTESVHHQI---------GAGGDIFAG  72

Query  2361  ARNSG-------LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
              R  G       LD+RY  +SDGFPLGFDR+ +   FM G+++V  AHV++L+++   ++
Sbjct  73    VRARGGGTTTEELDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEDLLRRRVVVD  132

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             P  TCL+ D+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL ++GHF CKD RKD
Sbjct  133   PATTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKDPRKD  192

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I YIPGV +IEP +L  YL Q+ +TTS V+  +++ F++A++AD V+CNTV+ELEP TI
Sbjct  193   TITYIPGVASIEPSELMSYL-QDTDTTSVVHRIIFRAFDEARRADYVLCNTVEELEPSTI  251

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPES-DCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +AL   +PFYA+GP+FP  F       S+ PES DC +WL ++PPGSVLY SFGS AH+T
Sbjct  252   AALRADRPFYAVGPIFPAGFARSAVATSMWPESDDCSRWLGAQPPGSVLYISFGSYAHVT  311

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGF--QECVRDRGLIVPWCHQPAV  3230
             K+ + E+  G++ S   F+WV+RP +  +D+     +GF        RGL+V WC Q  V
Sbjct  312   KQELREIAGGVLASGARFLWVMRPDIVSSDDPRPLPEGFAEAAAAAGRGLVVQWCCQVEV  371

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +SHPAV  F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW  G+++   D  
Sbjct  372   LSHPAVAAFLTHCGWNSVLESVWAGVPMLCFPLLTDQLTNRRLVVREWGAGVSI--GDRG  429

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             ++  +EV ++++ +M  E  ++LR  ++ +R  LE A+   GSS +N D FV+++K K  
Sbjct  430   AVHADEVRARIQGIMAGEHGLKLRDQVRKLRATLEAAVAPGGSSRRNFDDFVDELKRKLK  489

Query  3591  QSS  3599
              +S
Sbjct  490   DAS  492



>gb|AFJ53013.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   477 bits (1227),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 240/475 (51%), Positives = 326/475 (69%), Gaps = 11/475 (2%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
             +++K HAIV+P P QGH+ P + L++ LA +GFT+TFVNTE I      +  G      +
Sbjct  12    HHRKPHAIVIPFPLQGHVIPPVPLAVKLAPQGFTITFVNTEYIHHKTSSSAGGCD----E  67

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLE  2519
             D F   R SGLDIRY TISDG PL FDR+ +   FM  M +VF AHV+ELV  +  AG E
Sbjct  68    DFFAGVRKSGLDIRYKTISDGLPLRFDRSLNHDQFMASMSHVFPAHVEELVAGMVAAGEE  127

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
                +CLI D+F+AWPS +  K+ LV VS +T+PALVF +  H+ LL++NGH+GC+D R+D
Sbjct  128   EKVSCLITDTFFAWPSKVVKKFGLVFVSIWTQPALVFTLYHHVHLLRQNGHYGCQDRRED  187

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             SIDYIPGV+ IEP+DLP  LQ+ + T+  +  T +   +D K AD ++ NTVQELE  TI
Sbjct  188   SIDYIPGVKKIEPKDLPSILQEIDETSLFIQAT-FHVLQDVKSADFILANTVQELEHDTI  246

Query  2880  SALEE--KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             S+L++     FYAIGP+FP  FT      SL PESDC +WL+SKP GSVLY SFGS  H+
Sbjct  247   SSLKQAYNDQFYAIGPVFPPGFTISPVSTSLWPESDCTQWLNSKPSGSVLYVSFGSYVHV  306

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             TK  ++E+  G+ LS + F+WVLR  +  +++ D    GF++ V DR +IV WC Q  V+
Sbjct  307   TKPDLVEVACGMALSGICFLWVLRDDIVSSEDPDPLPVGFRKEVSDRAMIVGWCSQKEVL  366

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             +H A+GGF+THCGWNS+LES WC VPM+C+PL VDQ TN+KLVVD+WK+GINL   D   
Sbjct  367   AHEAIGGFLTHCGWNSVLESTWCGVPMLCFPLFVDQFTNQKLVVDDWKVGINLV--DQTI  424

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             ++KEEV+     LM  +S  EL++ IK+V + L +AL  NGSS +N+ +F+ ++K
Sbjct  425   VTKEEVSKNATRLMVGKSRDELKERIKEVNRILVDALEPNGSSKQNLVRFIRELK  479



>ref|XP_011094621.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=476

 Score =   476 bits (1226),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 242/479 (51%), Positives = 330/479 (69%), Gaps = 12/479 (3%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E+  K HAI+L +PYQGHI P ++L++ LAS+G  VTFV+ E I   + ++++ ++  
Sbjct  1     MSESCPKPHAIMLALPYQGHITPFVNLALKLASKGIVVTFVHLEFIHHTLSQSQQSSS--  58

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                D+F++AR  GL++RYTTI DGF L FDR   +  +   M+  F   V+E V K    
Sbjct  59    ---DLFSEARECGLEVRYTTIDDGFSLEFDRVVHSDEYWESMLRDFPGRVEEFVVKTIQS  115

Query  2517  EPPPTC--LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
             + P     LIAD+FY WP+ IA K+NL+NVSF+TEPAL+F++  H++LLKENGHF CKD 
Sbjct  116   DDPSFAHFLIADTFYTWPAAIAKKHNLLNVSFWTEPALMFSLAYHMNLLKENGHFPCKDH  175

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
              ++ I+Y+PGVE I  +DL  YL+   +T + V   V K FE+ KKAD ++ NTV ELE 
Sbjct  176   VEEEINYLPGVEEISTKDLMSYLKA-TDTATIVDKVVPKAFEEVKKADFILHNTVHELES  234

Query  2871  QTISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
             +T+SAL + QP YA+GP+ F ++    T  +SL  E DC  WL+SK PGSVLY SFGS  
Sbjct  235   ETLSALNKYQPNYAVGPINFSKTLATITVSKSLRSELDCTNWLNSKSPGSVLYVSFGSHV  294

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
               +K+ I E+  GL+LSEVNFIWV+R   A++   D    G+   ++D+GLIVPWC+Q  
Sbjct  295   QTSKQVIEEIAYGLLLSEVNFIWVVRAD-AVSSADDVLPPGYVNEIKDKGLIVPWCNQMM  353

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V+SH AVGGF+THCGWNS+LESIWC  PMICYP++ DQPTNRKL+VD+WKIGINLC  D+
Sbjct  354   VLSHLAVGGFLTHCGWNSVLESIWCGTPMICYPIMYDQPTNRKLLVDDWKIGINLC--DE  411

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              S+ ++EVA K+K  +   +S  LR+  K V   L+NAL S+GSS +N D+FVE +K K
Sbjct  412   TSVERKEVAEKIKSFISGAASKSLREEAKKVNAILQNALESDGSSERNFDQFVEDLKVK  470



>dbj|BAJ86664.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   476 bits (1225),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 233/486 (48%), Positives = 335/486 (69%), Gaps = 16/486 (3%)
 Frame = +3

Query  2157  MVENN----QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRG  2324
             M EN     +K HA+V+P P QGH+ PA HL++ LA+RGF VTFVNTE +     +A   
Sbjct  1     MAENGTGGRKKPHAVVIPYPLQGHVIPAAHLALRLAARGFAVTFVNTESVHQQTARALGA  60

Query  2325  TTTAPTDDIFTQARNSG------LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHV  2486
                  + DIF  AR  G      LD+RY  +SDGFPLGFDR+ +   FM G+++V  AHV
Sbjct  61    DRR--SYDIFAGARAPGKEEEERLDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHV  118

Query  2487  DELVKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKEN  2666
             +EL+++L  ++P  TCL+AD+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL  +
Sbjct  119   EELLRRLV-VDPASTCLVADTFFVWPATLAGKLGVPYVSFWTEPALIFNLYYHMDLLAMH  177

Query  2667  GHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVIC  2846
             GHF CK+ RKD+I YIPGV AIEP +L  YLQ E +TTS V+  ++K F++A+ AD V+C
Sbjct  178   GHFKCKEPRKDTIMYIPGVPAIEPHELMSYLQ-ETDTTSVVHRIIFKAFDEARGADYVLC  236

Query  2847  NTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLY  3026
             NTV+ELEP TI+AL  ++PFYA+GP+FP  F       S+  ESDC +WLD++PPGSVLY
Sbjct  237   NTVEELEPSTIAALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSQWLDAQPPGSVLY  296

Query  3027  ASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIV  3206
              SFGS AH+T++ + E+  G++ S   F+WV+RP +  +D+ D   +GF E    RGL+V
Sbjct  297   ISFGSYAHVTRQELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFAEASAGRGLVV  356

Query  3207  PWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGI  3386
             PWC Q  V+SH A+GGF+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW++G+
Sbjct  357   PWCCQVEVLSHAALGGFLTHCGWNSVLESVWSGVPMLCFPLLTDQFTNRRLVVREWRVGV  416

Query  3387  NLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFV  3566
              +   D  ++  +EV ++++ +M  +   ELR+A++ VR  L+ A    GSS ++ D+FV
Sbjct  417   PI--GDRGAVFADEVRARIEGVMSGKEGEELREAVEKVRTTLKAAAAQGGSSQRSFDEFV  474

Query  3567  EKIKAK  3584
             +++  +
Sbjct  475   DELTRR  480



>dbj|BAJ89423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   476 bits (1225),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 219/472 (46%), Positives = 316/472 (67%), Gaps = 6/472 (1%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HA+V+  P QGHI P  HL++ LA+RGF VT V TE +      AR         D F
Sbjct  19    KPHAVVVVYPLQGHIIPETHLALRLAARGFAVTVVTTEAVHDQ--TARALGVDPAGHDAF  76

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTC  2534
               AR++G+D+RY  +SDG P+GFDR+     F   +++  S HV+E++ ++  L+P  TC
Sbjct  77    AGARSAGMDVRYELVSDGLPVGFDRSLHHDEFHESLLHALSGHVEEVLGRVV-LDPATTC  135

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             L+AD+F+ WP+ +A K+ +  VSF+TEPAL+F +  H+ LL +NGHFGC + RKD+I YI
Sbjct  136   LVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTQNGHFGCNEPRKDTITYI  195

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PGV AIEP +L  YLQ E + TS V+  ++K F++A+ AD V+CNTV+ELEP TI+AL  
Sbjct  196   PGVPAIEPHELMSYLQ-ETDATSVVHRVIFKAFQEARGADYVLCNTVEELEPSTIAALRA  254

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             ++PFYA+GP+FP  F       S+  ESDC  WLD++P GSVLY SFGS AH+TK+ + E
Sbjct  255   EKPFYAVGPIFPAGFARSAVATSMWAESDCSHWLDAQPAGSVLYISFGSYAHVTKQELHE  314

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             +  G++ S   F+WV+RP +  +D+ D   +GF      RGL+VPWC Q  V+SH AVGG
Sbjct  315   IAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFVAASAGRGLVVPWCCQVEVLSHAAVGG  374

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
             F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW++G+ +   D  ++  +EV 
Sbjct  375   FLTHCGWNSVLESVWAGVPMLCFPLLTDQFTNRRLVVREWRVGVTI--GDRGAVFADEVK  432

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             + ++ +M  +   ELR+++K VR  LE A    GSS ++ D+F+  +  ++ 
Sbjct  433   ATIERVMSGKEGEELRESVKKVRATLEAAAADGGSSQRSFDEFIAVLTRRYG  484



>ref|XP_011094624.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=482

 Score =   476 bits (1225),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 238/483 (49%), Positives = 328/483 (68%), Gaps = 6/483 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E++ K HAI++ +PYQGHINP ++L++ +AS+GF++TFV+ E +   + K    TTTA
Sbjct  1     MGESHGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHLEFVHHKLSKVHDHTTTA  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                D F  AR SGLDIRYTTISDG+PL FDR      +   + + F A VDE V  +   
Sbjct  61    DQVDFFFVARESGLDIRYTTISDGYPLEFDRDLHQLEYFNTLFHDFPARVDEFVGNIIQS  120

Query  2517  EPPPT-CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
             +P     L+ D+ Y WP+ IA KYNLVNVSF+TE ALVF++  H DLL+E GH  CKD +
Sbjct  121   DPFSVHFLVTDTIYHWPATIAHKYNLVNVSFWTELALVFSLGYHWDLLREKGHVPCKDNK  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +  I+Y+PG+E+I  RD+  YL++E    S V   ++  F++ KKAD V+ NTVQELE +
Sbjct  181   EVEINYLPGIESISTRDVMSYLREEEIVLSEV---LFVAFQEVKKADFVLHNTVQELESE  237

Query  2874  TISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             T+SAL +  P YAIGP+ F +     T  +SL PESDC +WLDSK PGSVLY SFGSL  
Sbjct  238   TLSALNKYLPNYAIGPINFSKILDTNTISKSLWPESDCTEWLDSKAPGSVLYVSFGSLVQ  297

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +K+ I E+  GL+LSEVNFIWV+R G+    + +    G+Q+ VRD+GL++ WC+Q  V
Sbjct  298   TSKQVIQEIAYGLLLSEVNFIWVVREGIVSPGDTNVLPAGYQDKVRDKGLVISWCNQIKV  357

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S+PAVGGF+TH GWNS +ES+WC VPMIC P+  DQ TNRKLVVD WKIGI+LC D   
Sbjct  358   LSNPAVGGFLTHNGWNSTVESMWCGVPMICCPITYDQLTNRKLVVDTWKIGISLC-DGTS  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             ++ + EVA K+K  MK  +   L+K  + V++ L +AL  +GSS +N  +F++ +K K +
Sbjct  417   TVERNEVAEKIKSFMKGTALEGLKKEAEKVKETLHDALQIDGSSERNFHQFIKDLKGKIH  476

Query  3591  QSS  3599
              ++
Sbjct  477   ATA  479



>ref|XP_006294108.1| hypothetical protein CARUB_v10023101mg [Capsella rubella]
 gb|EOA27006.1| hypothetical protein CARUB_v10023101mg [Capsella rubella]
Length=486

 Score =   476 bits (1225),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 231/472 (49%), Positives = 326/472 (69%), Gaps = 16/472 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP + L+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  23    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  75

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  76    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGGDDGVNVMIADT  135

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  H+DLL+ +GHFG ++ R+D IDYIPGV A
Sbjct  136   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHMDLLRSHGHFGSQETRRDLIDYIPGVAA  195

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  196   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFY  254

Query  2910  AIGPLFPQSFTEQTAFR-SLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRG  3086
             A+GP+ P      ++   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  G
Sbjct  255   AVGPIIPLHLQSGSSVTTSLWSESDCTQWLNTKPKSSVLYVSFGSYAHVTKKDLVEIAHG  314

Query  3087  LMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITH  3266
             ++ S+VNF+WV+RP +  +DE +   +GF++   DRG+++PWC Q  V+SH +VGGF+TH
Sbjct  315   ILQSKVNFVWVVRPDIVSSDETNPLPEGFEKEAGDRGIVIPWCCQMTVLSHDSVGGFLTH  374

Query  3267  CGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVK  3446
             CGWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EVA  + 
Sbjct  375   CGWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDRSDFGRDEVARNIN  433

Query  3447  FLMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQSS  3599
              LM   S    ++ I  V+ +LE A+ ++GSS + N+  F++ + AK   S+
Sbjct  434   RLMCGVS----KEKIGRVKMSLEGAVRNSGSSSEMNLGLFIDGLMAKVGLSN  481



>gb|EYU34477.1| hypothetical protein MIMGU_mgv1a005487mg [Erythranthe guttata]
Length=482

 Score =   475 bits (1222),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/479 (53%), Positives = 322/479 (67%), Gaps = 19/479 (4%)
 Frame = +3

Query  2157  MVENN--QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTT  2330
             M  NN  QK HAI++    QGHI P ++L++ LAS+GF+VTF + + I   I +++   T
Sbjct  1     MGNNNKKQKPHAIMISFHLQGHIIPFVNLTLKLASKGFSVTFAHLDFIHHQISQSQPAQT  60

Query  2331  TAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                  DIF  AR SGL+I YTT SDGFPL FDR+ D   ++   ++ F   VDELV K+ 
Sbjct  61    -----DIFAGARASGLNISYTTFSDGFPLDFDRSADFDAYLKFFLHRFPDKVDELVGKII  115

Query  2511  GLEPPPT--CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCK  2684
                PP +   LIAD+F  WP  I+ KY LVNVSF+TEPALVF++  HL LL+ NGH    
Sbjct  116   SSSPPGSEHFLIADTFSVWPEKISEKYGLVNVSFWTEPALVFSLYYHLPLLRVNGHVPV-  174

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             + R++ + Y+PGVE+I  +D   Y   + +    ++  ++  F+  KKAD V+CNTVQEL
Sbjct  175   NGRREDVGYVPGVESINTKDFMSYF--DYSEMEMIHTVIFGAFDAVKKADFVLCNTVQEL  232

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             E + ISAL++KQ FYA+GPLFP  F+      SLLPESDC +WL SKP  SVLY SFGSL
Sbjct  233   EEEAISALQQKQRFYAVGPLFPAKFSVAG---SLLPESDCTEWLKSKPFRSVLYVSFGSL  289

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGM-AITDEMDFSMDGFQECVRDRGLIVPWCHQ  3221
             A   K  I+E+  GL+L  V+FIWVLRPG+ A +        GF+E  RDRGLIVPWC Q
Sbjct  290   ATTDKNVILEIAGGLLLCGVSFIWVLRPGIVADSGGGGILPPGFEESTRDRGLIVPWCTQ  349

Query  3222  PAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCND  3401
               V+S PA+GGF+THCGWNSILES+WC+VPM CYPL  DQ TNRKLVVD+W++GINLC+ 
Sbjct  350   NLVLSDPAIGGFVTHCGWNSILESVWCNVPMSCYPLFTDQITNRKLVVDDWRVGINLCDG  409

Query  3402  DDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSN-GSSVKNVDKFVEKI  3575
             D  SI+KEEVA K+  LM  E S ELR  IK VRK L+NA+  N GSS KN D FV  +
Sbjct  410   D--SITKEEVAEKIGILMSGEKSDELRHEIKKVRKTLQNAVTDNYGSSEKNFDCFVRDV  466



>ref|XP_010470154.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Camelina sativa]
Length=482

 Score =   475 bits (1222),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 232/473 (49%), Positives = 323/473 (68%), Gaps = 17/473 (4%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP + L+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  20    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  72

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  73    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGRDGGVNVMIADT  132

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  HLDLL+ +GHFG ++ R D IDYIPGV A
Sbjct  133   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRVHGHFGAQETRDDLIDYIPGVAA  192

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  193   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFY  251

Query  2910  AIGPLFPQSFTE--QTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGR  3083
             A+GP+ P +      +   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  
Sbjct  252   AVGPIIPFNLQSGSSSVTTSLWSESDCTQWLNTKPKSSVLYVSFGSYAHVTKKDLVEIAH  311

Query  3084  GLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFIT  3263
             G++ S+VNF+WV+RP +  +DE +   +GFQ    DRG+++PWC Q  V+SH +VGGF+T
Sbjct  312   GILQSKVNFVWVVRPDIVSSDETNPLPEGFQTEAGDRGIVIPWCCQMTVLSHESVGGFLT  371

Query  3264  HCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKV  3443
             HCGWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EV   +
Sbjct  372   HCGWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDRSDFGRDEVGRNI  430

Query  3444  KFLMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQSS  3599
               LM   S    ++ I  V+ +LE A+ ++GSS + N+  F++ + AK   S+
Sbjct  431   NRLMCGVS----KEKIGRVKMSLEGAVRNSGSSSEMNLGLFIDGLMAKVGLSN  479



>gb|AFJ53015.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=494

 Score =   474 bits (1221),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 232/475 (49%), Positives = 317/475 (67%), Gaps = 9/475 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
             ++K HAIV+P P QGH+ PA+HL+I LAS GFT+TF+NT  I   I  +         DD
Sbjct  12    HRKPHAIVIPFPLQGHVIPAVHLAIKLASEGFTITFINTHYIHHKITSS--SAAGGAGDD  69

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL----  2516
              F   R +GLDIRY T+SDG PLGFDR+ +   FM  +M V   HV+ELV  +       
Sbjct  70    FFAGVRETGLDIRYKTVSDGKPLGFDRSLNHNEFMASVMQVLPVHVEELVAGMVAAGEEE  129

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             E   +CL+AD+F+ W S +A K+ LV VS +TEPALVF +  H+ LL++NGHFGC+  R 
Sbjct  130   EEKVSCLVADTFFVWSSKVAKKFGLVYVSVWTEPALVFTLYHHVHLLRQNGHFGCQGRRD  189

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D IDYIPGV+ IEP+D P  LQ +++ T   +  V+   +DAK AD ++ NT+QELE  T
Sbjct  190   DPIDYIPGVKIIEPKDTPSSLQGDDDETVIDHQVVFGAIQDAKSADFILANTIQELEQDT  249

Query  2877  ISALE--EKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             ++ L+   +   YAIGP+FP  FT+     SL  ESDC +WL+SKP GSVLY SFG+ AH
Sbjct  250   LAGLKLAHEAQVYAIGPIFPTEFTKSLVSTSLWSESDCTRWLNSKPLGSVLYVSFGTFAH  309

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             + K  ++E+ RG  LS V+F+W LR  +  +++ D    GF+E V DR +IV WC+Q  V
Sbjct  310   MAKPDLVEIARGFALSGVSFLWTLRNDIVSSNDPDPLPFGFREEVSDRAMIVGWCNQKEV  369

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             ++H A+GGF+THCGWNS+LES WC VPM+C+PL VDQ TNRKLVVD+WK+GINL + D  
Sbjct  370   LAHTAIGGFLTHCGWNSVLESTWCGVPMLCFPLFVDQFTNRKLVVDDWKVGINLIS-DRA  428

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              ++KEEVA     LM  +S  EL++ I  ++K L +A+  +GSS +N  +FV ++
Sbjct  429   VVTKEEVAMNANHLMVGKSRNELKERINGLQKILVDAIKPSGSSKQNFARFVREL  483



>dbj|BAJ89293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   474 bits (1220),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 221/475 (47%), Positives = 320/475 (67%), Gaps = 8/475 (2%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
                K HA+V+  P QGH+ P  HL++ LA RGF VT VNTE +      AR         
Sbjct  15    GKAKPHAVVVVYPLQGHVIPVTHLALRLAVRGFAVTVVNTEAVHHQ--TARALGVDPAGH  72

Query  2346  DIFTQARNSG--LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
             D F  AR S   +D+RY  +SDG P+GFDR+     FM  +++  S HV+EL+ ++  ++
Sbjct  73    DFFDGARASAPEMDVRYELVSDGLPVGFDRSLHHDEFMGSLLHALSGHVEELLGRVV-VD  131

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             P  TCL+AD+F+ WP+ +A K+ +  VSF+TEPAL+F +  H+ LL  NGHFGC + RKD
Sbjct  132   PAATCLVADTFFVWPATLARKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFGCNEPRKD  191

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I YIPGV AIEP +L  YLQ E +TTS V+  ++K F++A+ AD V+CNTV+ELEP TI
Sbjct  192   TIMYIPGVPAIEPHELMSYLQ-ETDTTSVVHRIIFKAFDEARGADYVLCNTVEELEPSTI  250

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
             +AL  ++PFYA+GP+FP  F       S+  ESDC +WLD++PPGSVLY SFGS AH+T+
Sbjct  251   AALRAEKPFYAVGPIFPAGFARSAVATSMWAESDCSQWLDAQPPGSVLYISFGSYAHVTR  310

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
             + + E+  G++ S   F+WV+RP +  +D+ D   +GF E    RGL+VPWC Q  V+SH
Sbjct  311   QELHEIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFAEASAGRGLVVPWCCQVEVLSH  370

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
              A+GGF+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW++G+ +   D  ++ 
Sbjct  371   AALGGFLTHCGWNSVLESVWSGVPMLCFPLLTDQFTNRRLVVREWRVGVPI--GDRGAVF  428

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              +EV ++++ +M  +   ELR+A++ VR  L+ A    GSS ++ D+FV+++  +
Sbjct  429   ADEVRARIEGVMSGKEGEELREAVEKVRTTLKAAAAQGGSSQRSFDEFVDELTRR  483



>ref|XP_010510698.1| PREDICTED: UDP-glycosyltransferase 86A2 [Camelina sativa]
Length=481

 Score =   471 bits (1211),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 230/472 (49%), Positives = 323/472 (68%), Gaps = 16/472 (3%)
 Frame = +3

Query  2193  LPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQARN-  2369
             +P P+QGH+NP + L+I LAS+G TVTFVNT  I   I     G       DIF   R+ 
Sbjct  20    IPYPFQGHVNPFVQLAIKLASQGITVTFVNTHYIHHQITNGSDG-------DIFAGVRSE  72

Query  2370  SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLIADS  2549
             SGLDIRY T+SDG P+GFDR+ +   +   +++VF AHV+ELV  L G +     +IAD+
Sbjct  73    SGLDIRYATVSDGLPVGFDRSLNHDTYQSSLLHVFYAHVEELVASLVGGDGGVNVMIADT  132

Query  2550  FYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEA  2729
             F+ WPS++A K+ LV VSF+TE ALVF++  HLDLL+ +GHFG ++ R D I+YIPGV A
Sbjct  133   FFVWPSVVARKFGLVCVSFWTEAALVFSLYYHLDLLRIHGHFGAQETRDDLINYIPGVAA  192

Query  2730  IEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFY  2909
             I P+D   YLQ E +T+S V+  ++K FED KK D V+CNT+Q+ E +TI AL  K PFY
Sbjct  193   INPKDTASYLQ-ETDTSSVVHQIIFKAFEDVKKVDFVLCNTIQQFEDKTIKALNSKIPFY  251

Query  2910  AIGPLFPQSFTEQTAFR-SLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRG  3086
             A+GP+ P +    ++   SL  ESDC +WL++KP  SVLY SFGS AH+TK+ ++E+  G
Sbjct  252   AVGPIIPFNLQSGSSVTTSLWSESDCTQWLNTKPKSSVLYVSFGSYAHVTKKDLVEIAHG  311

Query  3087  LMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITH  3266
             ++ S+VNF+WV+RP +  +DE +   +GF+    DRG+++PWC Q  V+SH +VGGF+TH
Sbjct  312   ILQSKVNFVWVVRPDIVSSDETNPLPEGFETEAGDRGIVIPWCCQMTVLSHESVGGFLTH  371

Query  3267  CGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVK  3446
             CGWNSILE+IWC VP++C+PL+ DQ TNRKLVVD+W+IGINLC +D     ++EV   + 
Sbjct  372   CGWNSILETIWCEVPVLCFPLLTDQVTNRKLVVDDWEIGINLC-EDRSDFGRDEVGRNIN  430

Query  3447  FLMKAESSIELRKAIKDVRKNLENALGSNGSSVK-NVDKFVEKIKAKFNQSS  3599
              LM   S    +  I  V+ +LE A+ ++GSS + N+  F++ + AK   S+
Sbjct  431   RLMCGVS----KDKIGRVKMSLEGAVRNSGSSSEMNLGLFIDGLMAKVGLSN  478



>ref|NP_001169578.1| uncharacterized protein LOC100383459 [Zea mays]
 gb|ACN34169.1| unknown [Zea mays]
Length=481

 Score =   471 bits (1211),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 220/481 (46%), Positives = 319/481 (66%), Gaps = 29/481 (6%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+V+P P QGH+ PA+HL++ LA RGF VTF+NTE +   I             DIF  
Sbjct  22    HAVVMPYPLQGHVIPAVHLALRLAERGFAVTFINTESVHHQI---------GAGGDIFAG  72

Query  2361  ARNSG-------LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE  2519
              R  G       LD+RY  +SDGFPLGFDR+ +   FM G+++V  AHV++L+++   ++
Sbjct  73    VRARGGGTTTEELDVRYELVSDGFPLGFDRSLNHDQFMEGVLHVLPAHVEDLLRRRVVVD  132

Query  2520  PPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKD  2699
             P  TCL+ D+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL ++GHF CKD RKD
Sbjct  133   PATTCLVVDTFFVWPATLARKLGVPYVSFWTEPALIFNLYYHMDLLTKHGHFKCKDPRKD  192

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I YIPGV +IEP +L  YL Q+ +TTS V+  +++ F++A++AD V+CNTV+ELEP TI
Sbjct  193   TITYIPGVASIEPSELMSYL-QDTDTTSVVHRIIFRAFDEARRADYVLCNTVEELEPSTI  251

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPES-DCCKWLDSKPPGSVLYASFGSLAHLT  3056
             +AL   +PFYA+GP+FP  F       S+ PES DC +WL ++PPGSVLY SFGS AH+T
Sbjct  252   AALRADRPFYAVGPIFPAGFARSAVATSMWPESDDCSRWLGAQPPGSVLYISFGSYAHVT  311

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K+ + E+  G++ S   F+WV+RP +  +D+               GL+V WC Q  V+S
Sbjct  312   KQELREIAGGVLASGARFLWVMRPDIVSSDDPR---------PLPEGLVVQWCCQVEVLS  362

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPAV  F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW  G+++   D  ++
Sbjct  363   HPAVAAFLTHCGWNSVLESVWAGVPMLCFPLLTDQLTNRRLVVREWGAGVSI--GDRGAV  420

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQS  3596
               +EV ++++ +M  E  ++LR  ++ +R  LE A+   GSS +N D FV+++K K   +
Sbjct  421   HADEVRARIQGIMAGEHGLKLRDQVRKLRATLEAAVAPGGSSRRNFDDFVDELKRKLKDA  480

Query  3597  S  3599
             S
Sbjct  481   S  481



>ref|XP_010107479.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16161.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=487

 Score =   469 bits (1208),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 244/482 (51%), Positives = 330/482 (68%), Gaps = 12/482 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             +N+ K HAI+ P+ YQGH+ P+IHL++ LAS+GF +TFVNTE I   + K++  +T+A  
Sbjct  5     KNHSKPHAIMFPLTYQGHVTPSIHLAMKLASKGFAITFVNTEFIHHQLTKSQPNSTSAAA  64

Query  2343  --DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               DDIFT AR SGLDIRY T++DGFPL F+R  +     +  + +   HVDELV  L   
Sbjct  65    IEDDIFTGARESGLDIRYKTMTDGFPLDFNRILNPQFVALNFLSL-PVHVDELVGNLVNS  123

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
             +P  +CLIAD+FY W S IA KY LVN+SF+T+PALVF I  H++LL  N HF  +D +K
Sbjct  124   DPSISCLIADTFYTWASHIAHKYKLVNISFWTQPALVFNIYYHMELLITNSHFPPQDEQK  183

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I+YIPGV  IE +DLP YLQQ  NT    +L   K F++ KKAD ++CNTVQELE  +
Sbjct  184   DTIEYIPGVRVIEQKDLPSYLQQ-TNTEGQQFLD--KAFKEVKKADFILCNTVQELESHS  240

Query  2877  ISALEEKQPFYAIGPL--FPQSFTEQTAF-RSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
             I  L+EK+  YAIGPL  FP  FT++     S+  E DC +WL++KP GSVLY SFGS  
Sbjct  241   IFVLQEKKSIYAIGPLLNFPNGFTKRNIVPTSMRTEFDCSQWLNTKPQGSVLYISFGSSI  300

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
                K  I E+  GL+ S VNFIWVLR      +E  F   G Q+ ++ +GL+V W +Q  
Sbjct  301   PSQKSDIEEIAHGLVKSGVNFIWVLRHDCVSFEEPYFLPIGIQDEIKGKGLVVTWTNQIE  360

Query  3228  VISHPAVGGFITHCGWNSILESIWCS-VPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
             ++SHP++GGF+THCGWNSI+ES+ CS VP++C+PL  DQ TNRK+VVD+W IGINLC  D
Sbjct  361   IMSHPSIGGFLTHCGWNSIIESLQCSGVPLLCFPLRGDQFTNRKIVVDDWGIGINLC--D  418

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
              K +++ EVA+K+  LM  +S+ +L+K +  VR+ + NAL  NGSS K++  F+  +KAK
Sbjct  419   SKPLTRVEVAAKINRLMLGKSANKLKKEVIKVRQMVLNALPINGSSEKSLSNFIIDVKAK  478

Query  3585  FN  3590
              N
Sbjct  479   IN  480



>ref|XP_011094622.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=485

 Score =   469 bits (1208),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 228/484 (47%), Positives = 329/484 (68%), Gaps = 4/484 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E ++K HAI++ +PYQGHINP ++L++ +AS+GF++TFV+ E +   + KA       
Sbjct  1     MAECHRKPHAIMISIPYQGHINPFVNLALKIASKGFSITFVHFESVHHRVSKAHHLHCNK  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF++AR SGLDIRYTTISDG P+ FDR ++   +   ++  F A VDE V K+   
Sbjct  61    TQVDIFSEARESGLDIRYTTISDGLPVEFDRYSNFEEYWGRILRDFPARVDEFVGKIIQS  120

Query  2517  EP-PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
             +P      +AD+F+ +P+ IA KYNLVNVS +T+PALVF +  HLDLL+ENGHF CKD  
Sbjct  121   DPYVDYFFVADTFFPYPATIAEKYNLVNVSLWTQPALVFTLAYHLDLLRENGHFPCKDNI  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
              + ++YIPGV+ I  RDL   +++       +  +++   + AKKAD ++ NTV ELE  
Sbjct  181   HEEVNYIPGVKPISTRDLVSVMKESEQGYHTMLTSLFMASDQAKKADFILHNTVHELEAD  240

Query  2874  TISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             T+SAL + QP YAIGP+ F ++    T  +SL  ESDC +WL+SKPP SVLY SFGS  H
Sbjct  241   TLSALNKYQPNYAIGPINFFKNLPTYTVSKSLWSESDCSEWLESKPPDSVLYVSFGSFVH  300

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +++ I E+  GL+LS+VNFIW +R G+  + + +   +G+++ V D+GLI+PWC+Q  V
Sbjct  301   TSRQVIEEIAYGLLLSQVNFIWAIREGILSSGDTNIMPNGYEDEVEDKGLIIPWCNQIRV  360

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S+PAVGGF+TH GWNS +ES+WC+VPMICYP   DQPTNRKLVVD+WK GI+LC  D  
Sbjct  361   LSNPAVGGFLTHNGWNSTIESMWCAVPMICYPFSYDQPTNRKLVVDDWKCGISLC--DGT  418

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             S+ ++EVA K+K  M   ++   R+    V+  L +AL  +GSS +N D+F++ +K K +
Sbjct  419   SVDRKEVAEKIKSFMSGAATKSFRQEADKVKTILHHALEVDGSSERNFDQFIKDLKDKIH  478

Query  3591  QSSV  3602
              ++ 
Sbjct  479   STTT  482



>ref|XP_004983012.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Setaria 
italica]
Length=495

 Score =   469 bits (1207),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/482 (45%), Positives = 319/482 (66%), Gaps = 14/482 (3%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD  2345
                K HA+V+  P QGHI P  HL++ LA+RGF VTFV+TE +     +A  G       
Sbjct  14    GGNKPHAVVVAYPLQGHIIPVAHLALRLAARGFAVTFVSTEAVHDQTARAM-GVDDPDGY  72

Query  2346  DIFTQARNS---------GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELV  2498
             D+F  AR S          LD+ Y  +SDG P+GFDR+     FM  +++   AHV+EL+
Sbjct  73    DVFAAARASVASGGEGEEELDVAYELVSDGLPVGFDRSLHHDDFMGALLHALPAHVEELL  132

Query  2499  KKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
             +++  ++P  T L+AD+F+ WP+ +A++  +  VSF+TEPAL+F +  H+DLL  NGHF 
Sbjct  133   RRVV-VDPAATFLVADTFFVWPATLATRLGVAYVSFWTEPALIFNLYYHMDLLTHNGHFR  191

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
             C + RKD+I YIPGV +IEP +L  YLQ E +TTS V+  ++K F++A++AD V+CNTV+
Sbjct  192   CNEPRKDTITYIPGVPSIEPTELMSYLQ-ETDTTSVVHRIIFKAFDEARRADYVLCNTVE  250

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFG  3038
             ELEP TI+AL  ++PFYA+GP+ P  F       S+  ESDC +WLD++PPGSVLY SFG
Sbjct  251   ELEPSTIAALRAEKPFYAVGPVLPAGFARSAVATSMWAESDCSRWLDAQPPGSVLYISFG  310

Query  3039  SLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCH  3218
             S AH+T+  + E+  G++ S   F+WVLRP +  +D+ D   +GF      RG++VPWC 
Sbjct  311   SYAHVTRRELHEIAAGVLASGARFLWVLRPDVVSSDDPDPLPEGFAAAAAGRGVVVPWCC  370

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q  V+SH AVGGF+THCGWNSILES+W  VPM+C+PL+ DQ TNR+LV  EW+ G+++  
Sbjct  371   QVEVLSHAAVGGFLTHCGWNSILESVWAGVPMLCFPLLTDQITNRRLVAREWRAGVSI--  428

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D  ++   EV ++V+ +M  E  ++LR+ ++ +R  LE A+   GSS  + D+FV+ +K
Sbjct  429   GDRGAVHAAEVRARVEGVMGGEEGVKLREQVRKLRATLEAAVAPGGSSRSSFDEFVDVLK  488

Query  3579  AK  3584
              +
Sbjct  489   RR  490



>ref|XP_008778580.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Phoenix dactylifera]
Length=454

 Score =   467 bits (1201),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 321/474 (68%), Gaps = 32/474 (7%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E   K HA+++P+P QGHINPA  L+I LA+RGF +T+VNTE +     +ARR  ++ 
Sbjct  1     MAELPPKPHAVLIPLPLQGHINPAACLAIKLATRGFAITYVNTEAVHHQSSRARRSASSI  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA-G  2513
                DIF  AR SGLDIRY  ISDG P+ FDR  +   F+  ++YVFSAHV+EL++KL   
Sbjct  61    -DHDIFADARASGLDIRYELISDGLPISFDRAANPIQFLHSLLYVFSAHVEELMRKLTRA  119

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
               PP TCLIAD+F+ WP  IA+K+ +  VSF+TEPA+VFA+  H+DLL +NGHF  ++ R
Sbjct  120   AGPPITCLIADTFFVWPDTIANKFGIPYVSFWTEPAVVFALYYHIDLLIKNGHFASRENR  179

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             KD+I YIPGV A+EP DL  YLQ E +TTS ++  ++K FE+AK AD V+CN+VQELEP+
Sbjct  180   KDTITYIPGVPAVEPTDLMSYLQ-ETDTTSLLHQIIFKAFEEAKGADFVLCNSVQELEPE  238

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
                                          +L  ESDC +WLDSKP GSVLY SFGS A++
Sbjct  239   ---------------------------ITTLQVESDCSQWLDSKPAGSVLYVSFGSFANV  271

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K  + E+  G++ S+ NF+WVLRP +  +DE +    GF E    RG++VPWC Q  V+
Sbjct  272   SKRDLGEIAYGILHSKANFMWVLRPDIVSSDEHEPLPQGFLEESHGRGILVPWCCQMEVL  331

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             SHP+VGGF+THCGWNS+LESI C VPM+C+PL  DQ TNRKLVV +WK+GI+L   ++  
Sbjct  332   SHPSVGGFLTHCGWNSVLESIRCGVPMLCFPLQTDQFTNRKLVVRDWKVGIDLGRIEE--  389

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
             +S+EEV+ +V  LM  E   E +K I++ R+ LE+A+ + GSS KN D+FVE +
Sbjct  390   VSREEVSKRVDSLMGGEEGNEAKKMIEEARRALESAVAAEGSSQKNFDQFVEDL  443



>ref|XP_010107499.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16181.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=940

 Score =   482 bits (1240),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 329/480 (69%), Gaps = 5/480 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M +N+ + HAI+  + YQGH+ P+IHL++ LAS+GFT+TFVNT+++   + K++   T  
Sbjct  458   MEDNHPRPHAIMFSLDYQGHVTPSIHLAMKLASKGFTITFVNTQIVHHQLTKSQPDCTNT  517

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                DIF  AR  GLDIRY T+SDG  L F++  +   F+   +YV  +  DEL+  L   
Sbjct  518   DDYDIFAGARELGLDIRYKTMSDGLSLDFNKILNHDEFLKSNLYVLPSLADELIGNLVKE  577

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHF-GCKDCR  2693
             +P  +CLIAD+F  W   +A KYNL++VSF+T+PA+VF +D HLDLLK NGH+      R
Sbjct  578   DPSISCLIADTFQPWALRLAKKYNLISVSFWTQPAIVFTLDYHLDLLKINGHYLSLNGNR  637

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQ-ENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             +D+IDYIPGV++IEP+DL  YL++ + +T +  +L +YK FED K  D ++CNT++ELE 
Sbjct  638   EDTIDYIPGVKSIEPKDLMPYLRETKGSTVTHGHLLLYKSFEDVKNVDFILCNTLEELEY  697

Query  2871  QTISALEEKQPFYAIGPLF-PQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
               I A+ +KQP YAIGP+  P  FT+     SL  E DC +WL SKP GSVLY S GSL 
Sbjct  698   DAIWAIRQKQPMYAIGPIISPFGFTKSPVSTSLRTEFDCSQWLSSKPHGSVLYVSLGSLY  757

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
                K+ + E+  GL+LS+ NFI VLRP     +E      GF++ ++D+GLIVPWC Q  
Sbjct  758   PSNKDDLEEIAHGLVLSKANFILVLRPDAVGCEESYALPIGFEDQIKDKGLIVPWCRQVE  817

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             VISH AVGGF+THCGWNS+L+S+WC VPM+C+PL++DQ TNRKLVVD+W+IG+NLC  D 
Sbjct  818   VISHQAVGGFLTHCGWNSVLDSMWCGVPMLCFPLLIDQVTNRKLVVDDWRIGVNLC--DG  875

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             KS+++ EVA K+  LM  +S  EL++ +  VR  L+NA   +GSS  N+ +F+  +KAK 
Sbjct  876   KSLTRVEVAEKINRLMSGKSGEELKREVMKVRNMLKNASTKDGSSETNLCQFITNVKAKI  935


 Score =   372 bits (956),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 260/404 (64%), Gaps = 29/404 (7%)
 Frame = +3

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF  AR  GLD+RY T+SDGFPL ++R  +   F    ++ F  HVDELV  L   +  
Sbjct  72    DIFAGARELGLDVRYKTMSDGFPLDYNRMLNHEEFFENTLFSFPFHVDELVGNLVKEDSS  131

Query  2526  PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHF-GCKDCRKDS  2702
              +CLIAD+F  W S IA KYNL++VSF+T+PA+VF +  HLDLLK NGH+      R+D+
Sbjct  132   ISCLIADTFQPWTSQIAKKYNLISVSFWTQPAIVFTLGYHLDLLKMNGHYLSLNGNREDT  191

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             IDYIPGV++IEP++L  YL++ N +T  ++  ++K FED K  D ++CNTV+ELE   I 
Sbjct  192   IDYIPGVKSIEPKNLMTYLRETNEST-VMHKLLHKSFEDVKNVDFILCNTVEELEHDAIW  250

Query  2883  ALEEKQPFYAIGPLF-PQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
             A+ +KQP Y IGPL  P  F                   D  P  + L     SL    K
Sbjct  251   AVRQKQPMYGIGPLMSPFGF-------------------DKSPVSTSL-----SLIPSNK  286

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
              H+ E+G GL+LS+VNFIWVLRP     +E      GF++ ++D+GLIVPWC Q  VISH
Sbjct  287   VHLEEIGHGLVLSKVNFIWVLRPDAVGCEESYALPIGFEDQIKDKGLIVPWCSQVEVISH  346

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
              AVGGF+THCGWNS+L+S+WC VPM+  PLI+DQ +NRKLVVD+W+IG+NL   D KS++
Sbjct  347   QAVGGFLTHCGWNSVLDSMWCGVPMLSLPLILDQVSNRKLVVDDWRIGVNL--SDGKSLT  404

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKN  3551
             + EVA K+  LM  +S  EL++    VR  L+NA   +GSS  N
Sbjct  405   RVEVAEKINRLMSGKSGEELKREAMKVRNMLKNASTKDGSSETN  448


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K +I E+  GL LS+VNFIWVL       +E      GF+E V+D+GLIV W +Q  VIS
Sbjct  5     KSNIDEIALGLALSKVNFIWVLGHDAVNYEEPYVLAIGFEEEVKDKGLIVTWTNQIEVIS  64

Query  3237  HPAVGGFITHCG  3272
             HP++  +    G
Sbjct  65    HPSIDDYDIFAG  76



>ref|XP_011094623.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=482

 Score =   466 bits (1198),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 236/483 (49%), Positives = 324/483 (67%), Gaps = 6/483 (1%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E++ K HAI++ +PYQGHINP ++L++ +AS+GF++TFV+ E +   + KA   TTT 
Sbjct  1     MGESHGKPHAIMISVPYQGHINPFVNLALKIASKGFSITFVHLEFVHHKLSKAHDHTTTT  60

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
                D F+ AR S LDIRYTTI DG+PL FDR      +   + + F A VDE V  +   
Sbjct  61    DQVDFFSVARESCLDIRYTTICDGYPLEFDRDLHFLEYFNSLYHDFPARVDEFVGNIIQS  120

Query  2517  EPPPT-CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
             +P     L+AD+ Y WP+ IA KYNLVNVSF+TEPALVF++  H DLL+E GH  CKD +
Sbjct  121   DPYSLHFLVADTIYHWPATIAHKYNLVNVSFWTEPALVFSLGYHWDLLREKGHVPCKDNK  180

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             +  I+Y+PGVE+I  RD+  YL  E    S V   ++  F++ KKAD ++ NTVQELE +
Sbjct  181   EVEINYLPGVESISTRDVMSYLSGEEIILSDV---LFLAFQEVKKADFILHNTVQELECE  237

Query  2874  TISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             T+SAL +  P YAIGP+ F +     T  +SL  ESDC +WLDSK PGSVLY SFGSL  
Sbjct  238   TLSALNKYLPNYAIGPINFSKILDTNTISKSLWAESDCTEWLDSKSPGSVLYVSFGSLVQ  297

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +K+ I E+  GL+LSEVNFIWV+R G+      +    G+Q+ VRD+GL++ WC+Q  V
Sbjct  298   TSKQVIQEIAYGLLLSEVNFIWVVREGVVSPVNTNVLPTGYQDKVRDKGLVISWCNQIKV  357

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S+PAVGGF+TH GWNS +E + C VPMICYP+  DQ TNRKLVVD WKIGI+LC D   
Sbjct  358   LSNPAVGGFLTHNGWNSTVERMRCGVPMICYPIAYDQLTNRKLVVDTWKIGISLC-DGTS  416

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFN  3590
             ++ + EVA K+K  M   +   L+K  + V++ L +AL  +GSS +N D+F++ +K K +
Sbjct  417   TVERNEVAEKIKSFMNGTAVEGLKKEAEKVKETLRDALQIDGSSERNFDQFIKDLKEKIH  476

Query  3591  QSS  3599
              ++
Sbjct  477   ATA  479



>ref|XP_009400676.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   468 bits (1205),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/471 (47%), Positives = 315/471 (67%), Gaps = 5/471 (1%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HA+ +  PYQGH  PA+ L+INLA+RGF VTF  TE       +   G ++A   D+F  
Sbjct  73    HALFVTAPYQGHFAPAVDLAINLAARGFVVTFACTEAFQHQ--RTASGASSADHRDVFAG  130

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             AR+ GLDIRY  +SDG P+ FDR +    F   ++++  +HVDEL++KL   E P   ++
Sbjct  131   ARSRGLDIRYELVSDGLPVSFDRHSHPEQFYSALLHLLPSHVDELIRKLLLSEVPVDFIL  190

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
              D+F++W S +A  + L  VSF+T+PALVF +  H+DLL  NGHF   + RKD+I YIPG
Sbjct  191   TDTFFSWASTLAKNHGLPCVSFWTKPALVFTLYYHMDLLIANGHFASPENRKDTITYIPG  250

Query  2721  VEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQ  2900
             + AIE  DL  YL+ E +TT+ +   + + FE+ K+ DIV+ NTVQELE +TI+ L+++Q
Sbjct  251   IPAIETTDLASYLR-ETDTTTPLQQMIARSFEEVKRCDIVLANTVQELEEETIAVLQQEQ  309

Query  2901  PFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELG  3080
             PFYA+GP+FP  FT  T   SL PESDC  WLDS PP SVLY SFGS+A ++K+   E+ 
Sbjct  310   PFYAVGPVFPDGFTGGTVMTSLWPESDCSSWLDSMPPSSVLYVSFGSIASVSKKDFEEIA  369

Query  3081  RGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFI  3260
              G++ S+ NF+WVLRPG + +   +    GF E  R+RG++VPWC Q  V+ HPAVG F+
Sbjct  370   YGVLNSKANFVWVLRPGSSGSGAANPLPQGFLEASRERGMVVPWCRQREVLQHPAVGAFL  429

Query  3261  THCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASK  3440
             THCGWNS+ ES+WC VPM+C+PL  DQP NRKLVV+   IG++L   +   +S+ +V+S+
Sbjct  430   THCGWNSVAESMWCGVPMLCFPLFSDQPPNRKLVVENLGIGMDL--GEIGEVSRGKVSSR  487

Query  3441  VKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             +  LM  E   ELR+ +K+V+K ++ A+  +GSS KN+D+F   +    +Q
Sbjct  488   IDDLMGGEGGAELRRKMKEVKKAVQGAVAPHGSSQKNLDQFTADLLRLISQ  538



>ref|XP_008809704.1| PREDICTED: UDP-glycosyltransferase 86A2-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   462 bits (1189),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 292/403 (72%), Gaps = 7/403 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E  QK HA+++  P QGHI P +HL+I LAS+GFT+TF NTE +     +A       
Sbjct  1     MAEQGQKPHALIIAYPLQGHIIPVVHLAIKLASKGFTITFANTEAVHHQTTQAHN-----  55

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
              +DDIF  AR SGLDIRY  +SDG P+ FDR+ +   FM  +++V SAHV+EL++KL+  
Sbjct  56    -SDDIFAGARASGLDIRYELVSDGLPVSFDRSLNHDQFMAALLHVLSAHVEELMQKLSHA  114

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP TCLI D+F+ WPS IA K+ +  VS++TE A++FA+  H++LL ++GHF   + RK
Sbjct  115   SPPITCLITDTFFVWPSTIAKKFGVPYVSYWTEAAIIFALYYHMNLLTKHGHFASLENRK  174

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I YIPGV  IEP +L  YLQ E +T+S V+  ++K FE+AK AD V+CNTVQELEP+T
Sbjct  175   DAITYIPGVPKIEPTELMSYLQ-ETDTSSVVHQIIFKSFEEAKGADFVLCNTVQELEPET  233

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL++++PFYAIGP+FP  FT+ T   SL  ESDC +WL SKP GSVLY SFGS AH++
Sbjct  234   ISALQKEKPFYAIGPIFPAGFTKSTVATSLWTESDCSQWLHSKPAGSVLYISFGSYAHVS  293

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  + E+  G++ S+ NFIWVLRP +  +D+ +    GF +    RG++V WC Q  V+S
Sbjct  294   KRDLEEIAYGILGSKANFIWVLRPDIVSSDDPEPLPRGFLKESHGRGIVVQWCCQIEVLS  353

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVV  3365
             HP++GGF+THCGWNSILESIWC++P++C+PL+ DQ TNRKLVV
Sbjct  354   HPSIGGFLTHCGWNSILESIWCAIPLLCFPLLTDQFTNRKLVV  396



>gb|EYU34489.1| hypothetical protein MIMGU_mgv1a005852mg [Erythranthe guttata]
Length=468

 Score =   464 bits (1195),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 319/478 (67%), Gaps = 24/478 (5%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAI++ +PYQGHI P I+L+  LAS+GF +TFV+ E I  +++   R  T  P  D+F
Sbjct  4     KAHAIMIALPYQGHITPLINLATKLASKGFVITFVHLEFIHQMMLSQSRDNTIQP--DLF  61

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP-PPT  2531
             + AR SGLDIRY TISDGFPL FDR      +   M+  F   VDELV ++    P    
Sbjct  62    SGARESGLDIRYETISDGFPLEFDRALHTDEYWESMLSDFPHRVDELVTEIIRANPCSAH  121

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
              L+ D+ Y WP+ IA K+NLVNVSF+TEPALVF++  H+DLL ENGHF CKD  ++ I Y
Sbjct  122   FLVTDTLYTWPAEIAKKHNLVNVSFWTEPALVFSLAYHIDLLTENGHFPCKDHVEEEIKY  181

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYK----GFEDAKKADIVICNTVQELEPQTI  2879
             +PG+E+I  +DL  YL++     SA+  TV+K     F+  KKAD ++ NTVQE E  T+
Sbjct  182   LPGIESISTKDLMPYLKE-----SAIGTTVHKIETRAFQQVKKADFILHNTVQEFESSTL  236

Query  2880  SALEEKQPFYAIGPL-FPQSF-TEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             SAL + QP YAIGP+ F ++  T      SL  E DC  WL+ KPPGSVLY SFGSL  +
Sbjct  237   SALNKHQPNYAIGPVNFSKNLGTNYAVSNSLWSEHDCTHWLEHKPPGSVLYISFGSLVEI  296

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             +K+ + E+  GL+LSEV+FIWV+R      D  D  MD  +   +++GLI+PWC Q  V+
Sbjct  297   SKQLVEEIAYGLLLSEVDFIWVVR-----GDSFDSLMDNLRVESKEKGLIIPWCDQIRVL  351

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
             S PA+GGF THCGWNSILES+WC VPMICYPL  DQPTNRKLVVD+WKIGI+LC D   S
Sbjct  352   SDPAIGGFFTHCGWNSILESMWCGVPMICYPLEYDQPTNRKLVVDDWKIGISLC-DYGIS  410

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
             + ++EVA K+K +M      +L+  +K V + L +AL + GSS +N D+F + ++AK 
Sbjct  411   VDRKEVAKKIKKVMSG----DLKHEVKKVNRILVDALDAVGSSERNFDQFTKDLRAKL  464



>ref|XP_008809703.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Phoenix dactylifera]
Length=548

 Score =   466 bits (1200),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 292/403 (72%), Gaps = 7/403 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M E  QK HA+++  P QGHI P +HL+I LAS+GFT+TF NTE +     +A       
Sbjct  1     MAEQGQKPHALIIAYPLQGHIIPVVHLAIKLASKGFTITFANTEAVHHQTTQAHN-----  55

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
              +DDIF  AR SGLDIRY  +SDG P+ FDR+ +   FM  +++V SAHV+EL++KL+  
Sbjct  56    -SDDIFAGARASGLDIRYELVSDGLPVSFDRSLNHDQFMAALLHVLSAHVEELMQKLSHA  114

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRK  2696
              PP TCLI D+F+ WPS IA K+ +  VS++TE A++FA+  H++LL ++GHF   + RK
Sbjct  115   SPPITCLITDTFFVWPSTIAKKFGVPYVSYWTEAAIIFALYYHMNLLTKHGHFASLENRK  174

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
             D+I YIPGV  IEP +L  YLQ E +T+S V+  ++K FE+AK AD V+CNTVQELEP+T
Sbjct  175   DAITYIPGVPKIEPTELMSYLQ-ETDTSSVVHQIIFKSFEEAKGADFVLCNTVQELEPET  233

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             ISAL++++PFYAIGP+FP  FT+ T   SL  ESDC +WL SKP GSVLY SFGS AH++
Sbjct  234   ISALQKEKPFYAIGPIFPAGFTKSTVATSLWTESDCSQWLHSKPAGSVLYISFGSYAHVS  293

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             K  + E+  G++ S+ NFIWVLRP +  +D+ +    GF +    RG++V WC Q  V+S
Sbjct  294   KRDLEEIAYGILGSKANFIWVLRPDIVSSDDPEPLPRGFLKESHGRGIVVQWCCQIEVLS  353

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVV  3365
             HP++GGF+THCGWNSILESIWC++P++C+PL+ DQ TNRKLVV
Sbjct  354   HPSIGGFLTHCGWNSILESIWCAIPLLCFPLLTDQFTNRKLVV  396



>gb|EYU34484.1| hypothetical protein MIMGU_mgv1a005271mg [Erythranthe guttata]
 gb|EYU34485.1| hypothetical protein MIMGU_mgv1a017916mg [Erythranthe guttata]
Length=490

 Score =   464 bits (1194),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 331/487 (68%), Gaps = 18/487 (4%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD-D  2348
             +K HAI++ +PYQGHINP + L++ LAS GF++TFV+ E I   + KA       P + D
Sbjct  8     KKSHAIMISVPYQGHINPFVGLALKLASNGFSITFVHLEFIHHKLSKAHHKN---PEEFD  64

Query  2349  IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPP  2528
             +F++AR SGLDIRYTT+SDGFPL FDR      +   ++  F   V+E V K+   +   
Sbjct  65    LFSEARESGLDIRYTTMSDGFPLEFDRDLHIMEYWESLLRDFPTIVEEFVGKIIRSDQVS  124

Query  2529  TC-LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
                L+AD+ Y WP+ IA KYNLVNVS +TEPALVF++  HLDLL+E GHF CKD  ++ I
Sbjct  125   VYFLVADTNYFWPATIAKKYNLVNVSLWTEPALVFSLIYHLDLLREKGHFPCKDNIEEEI  184

Query  2706  DYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
             DY+PGV  I  RDL  YL+ E  + S +   +   F++ KKAD ++ NTVQELE +T+S+
Sbjct  185   DYVPGVGKISTRDLMPYLK-EAESQSVLTRILSASFKEVKKADFILHNTVQELESETLSS  243

Query  2886  LEEKQPFYAIGPL-FPQSF--TEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             L + QP YA+GP+ F +S   T  T  +SL  ESDC KWLDSKP GSVLY SFGSL   +
Sbjct  244   LNKYQPNYAVGPINFSKSNLPTNTTVSKSLWSESDCTKWLDSKPMGSVLYVSFGSLVQTS  303

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMA-------ITDEMDFSMDGFQECVRDRGLIVPWC  3215
             K+ I EL  GL+LSEVNFIWV+R G+A         + + F  +  +  ++D+GLI+PWC
Sbjct  304   KQVIEELAHGLLLSEVNFIWVVRLGIAGFGDDCGDNNVLPFEFED-EIKMKDKGLIIPWC  362

Query  3216  HQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC  3395
              Q  V+S+ A+GGF+TH GWNS LES+WC VPMICYP+  DQPTNRKLVVD+WKIGINLC
Sbjct  363   DQIRVLSNTAIGGFLTHNGWNSTLESMWCGVPMICYPINWDQPTNRKLVVDDWKIGINLC  422

Query  3396  NDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              D   S+ +++VA K+K LM   +S+ LRK   +++  L+ A+  +GSS KN D+F+E +
Sbjct  423   -DYGTSVDRKQVAEKIKQLMSGTTSMSLRKEADNIKAILQKAVEVDGSSEKNFDQFIENL  481

Query  3576  KAKFNQS  3596
             +AK + +
Sbjct  482   RAKISNN  488



>ref|XP_011094738.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Sesamum indicum]
Length=495

 Score =   464 bits (1193),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 243/481 (51%), Positives = 330/481 (69%), Gaps = 12/481 (2%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKA-RRGTTTAPTD--  2345
             K HAI++ +PYQGH NP  HL+I LAS+GFT+TFV+T+     I K+ ++  +T+ +D  
Sbjct  8     KPHAIMISVPYQGHANPFTHLAIKLASKGFTITFVHTQDAHHRISKSYQKLNSTSSSDEV  67

Query  2346  DIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             DIF++AR+SGLDIRYTTI+DGFPL FDR  +   +   +++ F + VDE +  L     P
Sbjct  68    DIFSEARDSGLDIRYTTIADGFPLEFDRDQNVNEYWESILHDFPSRVDEFIGNLIESFDP  127

Query  2526  PTC--LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHL-DLLKENGHFGCKDCRK  2696
                  L+AD+ Y WP+ IA KYNLVNVSF+T PA V AI+ +  D L+ NGHF   D   
Sbjct  128   ELLPFLVADAIYPWPATIAKKYNLVNVSFWTGPAAVLAINYYFFDHLRANGHFPPTDDPL  187

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
              SIDYIPGVE+I  +DL  YL+ E +TT+ V+  + + FE+ KKAD ++ NT+QELE  T
Sbjct  188   YSIDYIPGVESISSKDLMPYLR-EADTTTIVHKVLLRVFEEVKKADFILHNTLQELEQHT  246

Query  2877  ISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             +S L +KQP YAIGP+ F     +    +SLL E DC KWL SKPP SVLY SFGS    
Sbjct  247   LSTLNQKQPTYAIGPVSFSPDCIKTRVSKSLLFEIDCSKWLGSKPPSSVLYVSFGSNVPT  306

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGM--AITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
              K+ I  + +GL+LSEV+FIWV+RP +  +I D  +    GF++ ++D+GL+VPWC Q A
Sbjct  307   NKQVIEAIAQGLLLSEVSFIWVIRPKIVRSIDDNKNVLPAGFEDNLKDKGLVVPWCDQNA  366

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V S+PAVGGF+THCGWNSILES+W  +P+ICYP++ DQPTNRKLVVD+WKIG+NLC  D 
Sbjct  367   VFSNPAVGGFLTHCGWNSILESMWYGIPLICYPIMYDQPTNRKLVVDDWKIGVNLC--DG  424

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
              S+   E+A K+K LM  ++SI +R  I   R  L +AL   GSS +N D+F++ ++ K 
Sbjct  425   VSVDGAEIALKIKQLMCEKTSIGIRNEIMKFRSVLHDALSEEGSSNRNFDQFIQDLRHKM  484

Query  3588  N  3590
             +
Sbjct  485   H  485



>ref|XP_006662391.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Oryza brachyantha]
Length=476

 Score =   461 bits (1187),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 314/472 (67%), Gaps = 17/472 (4%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             + HA+V+P P QGH+ PA+HL++ LA+RGF VTFVNTE +   I     G      DDIF
Sbjct  15    RPHAVVVPYPLQGHVIPAVHLALRLAARGFAVTFVNTESVHQQIASGGGGG-----DDIF  69

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLE--PPP  2528
               A      +RY  + DGFPLGFDR+ +   +M G+++V  AHVDEL+++L G       
Sbjct  70    AGA---AAGVRYELVGDGFPLGFDRSLNHDQYMEGVLHVLPAHVDELLRRLIGDADAAAA  126

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
             TCL+ D+F+ WP+  A K+ +  VSF+TEPAL+F +  H+DLL +NGHF CK+ RKD+I 
Sbjct  127   TCLVVDTFFVWPATFARKFGVPYVSFWTEPALIFTLYYHMDLLTKNGHFNCKEPRKDTIT  186

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             Y+PGV AIEPR+L  YLQ E +TT+ V+  ++K FE+A+ AD V+CNTV+ELEP TI+AL
Sbjct  187   YVPGVAAIEPRELMSYLQ-ETDTTTVVHRIIFKAFEEARAADYVVCNTVEELEPSTIAAL  245

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
               ++PFYA+GP+ P  F       S+  ESDC +WL ++PP      SFGS AH+T+  +
Sbjct  246   RAEKPFYAVGPILPAGFARSAVATSMWAESDCSQWLAAQPPAP----SFGSYAHVTRGEL  301

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
              E+ RG++ S   F+WV+RP +  +D+ D   +GF      RG++VPWC Q  V+SHPAV
Sbjct  302   HEIARGVLASGARFLWVMRPDIVSSDDPDPLPNGFAAAAAGRGVVVPWCCQVEVLSHPAV  361

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
             G F+THCGWNSILES+W  VPM+C+PL+ DQ TNR+LV  EW++G+ +      ++  +E
Sbjct  362   GAFLTHCGWNSILESVWAGVPMLCFPLLTDQFTNRRLVSREWRVGVPV--RVRGAVVADE  419

Query  3429  VASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             V ++++ +M+ E    LR+ +  +R  L+ A+   GSS ++ D+ V+++  +
Sbjct  420   VRARIEGVMRGEEGERLREQVSKMRSTLKAAVAPGGSSQRSFDELVDELMCR  471



>ref|XP_010669654.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   461 bits (1185),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 236/474 (50%), Positives = 316/474 (67%), Gaps = 8/474 (2%)
 Frame = +3

Query  2169  NQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD  2348
              QK HAI++ +P QGH+ P +HL+I LAS+GF++TF+NT+ I   I  +   T      D
Sbjct  15    KQKLHAILVVLPQQGHVIPFVHLAIKLASKGFSITFINTDHIHHKITLSN-ATVLEDGGD  73

Query  2349  IFTQARN--SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
             IF +AR   SGLDI Y TI+DG PL FDR+     +     Y F AH++  V K+    P
Sbjct  74    IFVEARKKYSGLDIEYVTITDGLPLEFDRSLYHDQWRGATTYCFPAHLELAVSKIVRSRP  133

Query  2523  -PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG-CKDCRK  2696
               P CL+ADS++ W S +ASK+ L +VSF+TE A+V  I  H  LLKENGH G     RK
Sbjct  134   LVPCCLVADSYFVWASKLASKFGLFHVSFWTENAMVLDIYFHRHLLKENGHIGPGSSVRK  193

Query  2697  DSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQT  2876
              SIDYIPG++++   DL  YLQ+E+ T        ++  +D ++A  ++ NTVQELE  T
Sbjct  194   GSIDYIPGIKSLNRTDLTSYLQEEDLTAFHPQYN-FQALDDTRRAHFILGNTVQELEADT  252

Query  2877  ISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLT  3056
             I+A+E   PFYAIGPLFP  FT+     SL  E DC  WLDSKPP SVLY SFGS AH++
Sbjct  253   ITAVEAHVPFYAIGPLFPPGFTKMPVATSLWAEFDCTLWLDSKPPSSVLYVSFGSYAHIS  312

Query  3057  KEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVIS  3236
             KE + E+  G+ LS VNF+WV+RP M  +D+ D   DGF++ VRDRG+IVPW  Q AV+S
Sbjct  313   KEELEEIANGIKLSGVNFLWVIRPDMVSSDDPDPLPDGFRDEVRDRGMIVPWTCQKAVLS  372

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             H A+ GF+THCGWNS LESIWC VP++C+PL+ DQ TNRKL+VD+WK+G NLC  + K +
Sbjct  373   HRAIRGFLTHCGWNSTLESIWCEVPLLCFPLLTDQFTNRKLIVDDWKVGCNLC--EVKPV  430

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              KEEV  K+K L+      EL K IK +++ L +A+   GSS +NVD+F++++K
Sbjct  431   KKEEVMRKIKDLISGTIGCELHKRIKGIKQMLHDAVTIEGSSEENVDRFIKELK  484



>ref|XP_008644820.1| PREDICTED: UDP-glycosyltransferase 86A1 [Zea mays]
 gb|AFW68687.1| hypothetical protein ZEAMMB73_327986 [Zea mays]
Length=494

 Score =   460 bits (1184),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 318/482 (66%), Gaps = 12/482 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA--  2336
              +  K HA+V+  P QGH+ P +HL++ LA+RGF VTFV+TE +     +A         
Sbjct  13    RHGGKPHAVVVAYPLQGHVIPVVHLALRLAARGFAVTFVSTEAVHDQTARALGVDPDGYD  72

Query  2337  PTDDIFTQARNSGL------DIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELV  2498
             P      +A+  G       D+ Y  +SDG P+GFDR+ +   FM  + +   AHV++L+
Sbjct  73    PFAAARARAQEEGPPPPPLGDVSYALVSDGLPVGFDRSLNHDDFMGALFHALPAHVEQLL  132

Query  2499  KKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
             +++  +EP  T L+AD+F+ WP+ +A +  +  VSF+TEPAL+F +  H+DLL +NGHF 
Sbjct  133   RRVV-VEPRATFLVADTFFVWPATLARRLGIAYVSFWTEPALIFNLYYHIDLLTQNGHFR  191

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
             C + RKD+I YIPGV AIEP +L  YLQ E +TTS V+  ++K F++A+ AD V+CNTV+
Sbjct  192   CNEPRKDTITYIPGVAAIEPSELMSYLQ-ETDTTSIVHRIIFKAFDEARGADYVLCNTVE  250

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFG  3038
             ELEP TI+AL   +PFYA+GP+ P  F       S+  ESDC +WLD++P GSVLY SFG
Sbjct  251   ELEPSTIAALRAYRPFYAVGPILPAGFARSAVATSMWAESDCSRWLDAQPVGSVLYISFG  310

Query  3039  SLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCH  3218
             S AH+TK+ + E+  G++ S   F+WV+RP +  +D+ D   +GF E    RGL+V WC 
Sbjct  311   SYAHVTKQELREIAGGVLASGARFLWVMRPDIVSSDDPDPLPEGFAEAAAGRGLVVQWCC  370

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q  V+SH AVG F+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LV  EW+ G+++  
Sbjct  371   QVEVLSHAAVGAFLTHCGWNSVLESVWAGVPMLCFPLLTDQLTNRRLVAREWRAGVSV--  428

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
              D  ++  +EV ++++ +M  E  ++LR+ +K +R  LE A+ S GSS  N D+FVE++K
Sbjct  429   GDRGAVRADEVRARIEAVMGGEDGLKLREQVKKLRGTLEAAVASGGSSRHNFDEFVEELK  488

Query  3579  AK  3584
              +
Sbjct  489   RR  490



>ref|XP_010686252.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=499

 Score =   459 bits (1182),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 232/478 (49%), Positives = 319/478 (67%), Gaps = 8/478 (2%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDI  2351
             +K HAI++ +P QGH+ P + L+I LAS+GF++TF+NT+ I   I  +   +     +DI
Sbjct  21    KKIHAILVGLPLQGHVIPFVQLAIKLASKGFSITFINTKHIHHQITSSN-ASAFDGGEDI  79

Query  2352  FTQAR--NSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             F +AR  ++GLDI Y TI+DG PL FDR+ +   ++   +Y   AH++  V K+    P 
Sbjct  80    FVEARRGSTGLDIEYMTITDGLPLEFDRSLNHDQWVGANIYCLQAHLEVAVCKIVTSRPS  139

Query  2526  -PTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCRKD  2699
                CL+ADS++ W S +ASK+ LV+VSF+TEPA+V  I  H  LLKENGH G     RKD
Sbjct  140   IRCCLVADSYFVWASKLASKFGLVHVSFWTEPAVVLDIYFHRHLLKENGHIGLGSSARKD  199

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
              I+YIPG+ +++  DL  YLQ+E+ TT       +   +D +KA  ++ NTVQELE  TI
Sbjct  200   IINYIPGISSLKRTDLTSYLQEEDLTTMHPQYN-FASLDDTRKAQFILSNTVQELEAHTI  258

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
             SA++   PFYAIGPLF   FT+     SL  ESDC  WLDSKPPGSVLY SFGS AH+ K
Sbjct  259   SAVQAHVPFYAIGPLFSPEFTKSPVTTSLWAESDCTLWLDSKPPGSVLYVSFGSYAHIGK  318

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
             E + E+  G+ LS VNF+WV+RP M  +D +D    GF++ V DRG+IV W  Q  V+SH
Sbjct  319   EELEEIANGIKLSGVNFLWVIRPDMVSSDHVDPLPTGFRDEVHDRGMIVTWTCQKEVLSH  378

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
              A+GGF+THCGWNS LESIWC +P++C+PL+ DQ TNRKL+VD+WKIG NLC  +++ ++
Sbjct  379   HAIGGFLTHCGWNSALESIWCEIPLLCFPLLTDQFTNRKLIVDDWKIGCNLC--EERPVT  436

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             KEEV  K K L+      ELR  IK ++K L+NA+ + GSS  NVD F++ +   F++
Sbjct  437   KEEVLEKTKDLISGSLGHELRDRIKGIKKVLQNAMMTEGSSNNNVDSFIKDLNIAFDK  494



>dbj|BAG80548.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=470

 Score =   457 bits (1176),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 227/475 (48%), Positives = 328/475 (69%), Gaps = 9/475 (2%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M  ++ K HAI++  P QGH+ P IHL+I LA +GFT+TF+NT+   + I +     +  
Sbjct  1     MDSSSPKPHAILVCYPLQGHVIPTIHLAIKLARKGFTITFINTQSTHTQITRK----SGD  56

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--A  2510
               +DIF+  R   LDIRY T+SDG P+ FDR+ +   FM  +++VFSAHV+E + K+  +
Sbjct  57    GEEDIFSSVRGQDLDIRYITVSDGLPVNFDRSLNHDQFMACLLHVFSAHVEEALLKIVQS  116

Query  2511  GLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC  2690
              ++PP +CLIADSF+ +P  +A KY L  ++F+TE ALVF +  HL LLK +GHF C   
Sbjct  117   KVDPPVSCLIADSFFVFPGKLAKKYGLRYIAFWTETALVFTLYYHLHLLKLHGHFDCIGM  176

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             R+D IDYIPGV++I+P+DL  Y+Q E +TTS  +  ++  F+D + AD ++CNTVQELEP
Sbjct  177   REDPIDYIPGVKSIKPKDLMSYVQ-ETDTTSVCHHIIFSAFQDVRNADFILCNTVQELEP  235

Query  2871  QTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             +TISAL+ ++PF+AIGP+FP  F       S+  E +C +WLD +   +VLY SFGS AH
Sbjct  236   ETISALQIEKPFFAIGPIFPPEFATSGVATSMCSEYECTQWLDMQQQANVLYVSFGSYAH  295

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
             +TK  ++E+  GL LS+V+F+WVLRP +  +D+ +   + F+  +  RGLIVPWC Q  V
Sbjct  296   ITKNDLIEIAYGLALSKVSFVWVLRPDIVSSDDPNPLPEDFKGEISGRGLIVPWCCQKQV  355

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             ++H A+GGF+THCGWNS+LE+IWC VP++C+PL+ DQ TNRKLVVD+WKIG+NLC  D  
Sbjct  356   LTHSAIGGFLTHCGWNSVLEAIWCGVPLLCFPLLTDQFTNRKLVVDDWKIGLNLC--DKN  413

Query  3411  SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
              +SK E++ K++ LM  E+S   R  ++  ++ L NA    GSS KN+D F+  +
Sbjct  414   PVSKFEISEKIQHLMFGEASDGYRNEMQKAKETLANASRGEGSSDKNLDSFISSV  468



>ref|XP_009792555.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Nicotiana sylvestris]
Length=585

 Score =   461 bits (1186),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 256/303 (84%), Gaps = 3/303 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TLEE+ S LS+CKKI+WIG +KF++SN  + G SKLAAM+  LSQ+NCD+
Sbjct  274   GWKPVDVGPNTLEEMISMLSRCKKILWIGAIKFAASNQESAGTSKLAAMLYNLSQKNCDL  333

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+ F G SS  T + +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY 
Sbjct  334   IVVGKQACETFVGKSSYVTVD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIYT  392

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLF F MA+ RKD+NFLG+E+N KLV RC+DHVSQS M N +F+AT
Sbjct  393   NTTLPLVVDVGSGNGLFPFRMAKMRKDWNFLGMEMNEKLVSRCIDHVSQSGMTNGYFIAT  452

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRM+Q+SLVEAIADLLAS GKVFLQ
Sbjct  453   NATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEYRWRMVQRSLVEAIADLLASDGKVFLQ  512

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EV +RMKEEF KYGKGKL  V +LD +  HQ GWLKENPFGIRSDWEQHV+DRG P
Sbjct  513   SDVKEVVVRMKEEFMKYGKGKLAVVHDLDDSTSHQDGWLKENPFGIRSDWEQHVIDRGSP  572

Query  1998  MYR  2006
             MYR
Sbjct  573   MYR  575


 Score =   275 bits (704),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 185/249 (74%), Gaps = 3/249 (1%)
 Frame = +1

Query  394   FGKVVMVRFDSTILPVDKKKLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALE  564
              GKVVMVR D TIL  ++KK    +    ST+KYL +A AK+IL+ SWS+  +S+ L LE
Sbjct  1     MGKVVMVRLDLTILLREQKKKQSPAGRVISTIKYLHKAGAKLILISSWSARADSQLLKLE  60

Query  565   AVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLS  744
              VAE+LSS L+++VIP +LGS    + +E     DILLLEN+SQ K + +NC +FA+ LS
Sbjct  61    RVAEFLSSELEMEVIPVELGSGFEQSQMEDGHNSDILLLENLSQFKQEQANCSEFARCLS  120

Query  745   FGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIG  924
              GVDIFVND+FS+ HKILAS VGI  FC A IAGFHF  G+SQL+KII+ +K+PY AIIG
Sbjct  121   SGVDIFVNDAFSQSHKILASNVGITSFCYASIAGFHFDEGMSQLKKIIKMNKRPYYAIIG  180

Query  925   GGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAK  1104
             G NL  KAAAL FLAS CD LVFVG+ AFQIMHAFGL VP++LVE+++L+ AH ++EA+K
Sbjct  181   GANLAGKAAALQFLASRCDGLVFVGDAAFQIMHAFGLAVPMELVEKESLEAAHMLIEASK  240

Query  1105  VGNLLILDP  1131
                + I+ P
Sbjct  241   ARGVQIVLP  249



>ref|XP_010678487.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   456 bits (1172),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 234/480 (49%), Positives = 321/480 (67%), Gaps = 19/480 (4%)
 Frame = +3

Query  2166  NNQKHHAIVLPMPYQGHINPAIHLSINLAS-RGFTVTFVNTELIDSLIIKAR-RGTTTAP  2339
             NNQ HHAI LP+  QGHINPA+H S  LAS + FT+TF+  E +   + +AR  G +T  
Sbjct  7     NNQNHHAIFLPLSLQGHINPAVHFSHKLASSKNFTITFLTFEFLHQQLTQARPDGCST--  64

Query  2340  TDDIFTQARNS--GLDIRYTTISDGFPLGFDRTTDAYGFMM-----GMMYVFSAHVDELV  2498
               DIF++AR+   GLDIRY  +SDG P+ FDRT     F+M     GM    +  V+E+V
Sbjct  65    --DIFSRARDGPDGLDIRYRAVSDGLPMEFDRTGQLEEFLMWYLDGGMFDQVAKGVEEIV  122

Query  2499  KKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG  2678
                    P    LI D+FY W S IA  + L   SF+TEPALVF +  H+ LLK++GHF 
Sbjct  123   ---LDSRPKVDVLIIDTFYPWASKIAKMFGLRLASFWTEPALVFNMYYHVHLLKQHGHFD  179

Query  2679  CKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
             C D RKD IDYIPGV++IEP +LP Y+Q ++ +T+ ++  +++ ++D + AD V+CNTVQ
Sbjct  180   CPDTRKDPIDYIPGVQSIEPHNLPSYIQDKDISTN-MHKLIFQAYQDVRSADFVLCNTVQ  238

Query  2859  ELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFG  3038
             ELE  TISAL+   PFY +GP+ P    E     SL  ES+C +WL SKP GSVLY SFG
Sbjct  239   ELESDTISALQAVMPFYTVGPIIPSRSLENVMSTSLWVESNCSEWLGSKPNGSVLYVSFG  298

Query  3039  SLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCH  3218
             SLA+ T + +ME+  GLM S V+F+WVLRP   +  +      GF+E +  RGL+VPW +
Sbjct  299   SLANFTNDDVMEIAYGLMESNVDFVWVLRPRTVLHGDDHVLPVGFEEGISGRGLVVPWTN  358

Query  3219  QPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCN  3398
             Q A++SHPAVGGF+THCGWNS+LESI   +PM+C+P+  DQ TNRKLVVD+WK+GINL N
Sbjct  359   QIAILSHPAVGGFLTHCGWNSVLESIQYEIPMLCFPVFTDQFTNRKLVVDDWKVGINLGN  418

Query  3399  DDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
               +K + + ++AS++K  M  ++   LR+ I  ++K L NAL ++GSS KN+D F+E++ 
Sbjct  419   --EKPLRRMQIASEIKKFMSKKTEDGLRENIIVLKKILGNALEADGSSSKNLDLFIEQLN  476



>ref|XP_010686253.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=496

 Score =   456 bits (1172),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 235/483 (49%), Positives = 316/483 (65%), Gaps = 18/483 (4%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT---  2342
             +K  AI++  P QGH+ P I L+I LAS+G ++TF+NTE I   I      TT+ PT   
Sbjct  18    KKPRAIIIAHPLQGHLIPTIQLAIKLASKGISITFINTENIHHQI------TTSNPTAID  71

Query  2343  ----DDIFTQARNS-GLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL  2507
                  DIF +ARNS GLDI Y T+SDG PL FDR+     ++   ++ F AHV+  V K+
Sbjct  72    TDGGGDIFIEARNSSGLDIDYMTVSDGLPLEFDRSLYHDQWVGATIHCFPAHVEVAVAKI  131

Query  2508  AGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFG-CK  2684
                +P   CLI DS+  W S +A K+ L +VSF+TE A+V     HL LLKENGH G   
Sbjct  132   VRSKPLTCCLIVDSYSVWASKVAKKFGLFHVSFWTEAAMVLDFYFHLHLLKENGHVGPGS  191

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
             + R D+IDYIPG+ +I+  DL  YLQ+E+ TT + +  +    ED K+AD ++ N V EL
Sbjct  192   NARDDTIDYIPGISSIKRSDLTSYLQEEDLTTMS-HQCILPSMEDTKQADFILGNNVHEL  250

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             E QTI A++   PFYAIGPLFP  FT+     SL  ES+C  WLDSK P SVLY SFGS 
Sbjct  251   EAQTIEAIQTTTPFYAIGPLFPPGFTKSPVASSLWAESNCIHWLDSKSPSSVLYISFGSY  310

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQP  3224
             AH++KE + E+  G+ LS VNF+WV+RP M  +D++D    GF+  V DRG+IV W  Q 
Sbjct  311   AHISKEELEEIANGIKLSGVNFLWVIRPDMVSSDDLDPLPIGFRNEVCDRGMIVTWTCQK  370

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              V+SH A+GGF+THCGWNS LESIWC +P++C+PL+ DQ TNRKL+VD+WKIG NLC  +
Sbjct  371   EVLSHHAIGGFLTHCGWNSALESIWCEIPLLCFPLLTDQFTNRKLIVDDWKIGCNLC--E  428

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             ++ ++KEEV  K K L+      ELR  IK ++K L+NA+ + GSS  NVD F++ +   
Sbjct  429   ERPVTKEEVLEKTKDLISGSLGHELRDRIKGIKKVLQNAMMTEGSSNNNVDSFIKDLNIA  488

Query  3585  FNQ  3593
             F++
Sbjct  489   FDK  491



>emb|CBI17168.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   451 bits (1159),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/480 (48%), Positives = 308/480 (64%), Gaps = 66/480 (14%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTA  2336
             M   +Q  HAI++  P QGH+ PA+HL+INLASRGFT+TFVNT  I     +A+     A
Sbjct  1     MASTHQNPHAILVAYPLQGHVIPAVHLAINLASRGFTITFVNTLSIHQQTSRAQ----GA  56

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-AG  2513
              +DDIF+ +R +GLDIRYTT+SDG P+GFDR+ +   FM  +++V SAHV+ELV+++ A 
Sbjct  57    GSDDIFSGSREAGLDIRYTTVSDGLPVGFDRSLNHDQFMAALLHVLSAHVEELVERVVAE  116

Query  2514  LEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
               PP +CLIAD+F+ WPS +A K+ L+ VSF+TEPALVF +  H+DLL+++GHF C + R
Sbjct  117   AAPPVSCLIADTFFVWPSALAKKFGLLYVSFWTEPALVFTLYYHMDLLRKHGHFDCSETR  176

Query  2694  KDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQ  2873
             KD IDYIPGVEAI PRD+  YLQ   +T++  +  +   F+DAK AD V+CNTV+ELE  
Sbjct  177   KDVIDYIPGVEAIHPRDMTSYLQA-TDTSTVCHQIISTAFQDAKGADFVLCNTVEELELH  235

Query  2874  TISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             TISAL+ K+  YA+GP+FP  FT+     SL  ESDC  WLD+KP GSVLY SFGS AH+
Sbjct  236   TISALQAKKKLYAVGPIFPPGFTKSIVATSLWAESDCTHWLDAKPKGSVLYVSFGSYAHI  295

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
                H                                                    PAV 
Sbjct  296   MLAH----------------------------------------------------PAV-  302

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKS  3413
                  GGF+THCGWNSILESIWC VP++C+PL+ DQ TNRKLVVD+WK+GIN+   D +S
Sbjct  303   -----GGFLTHCGWNSILESIWCKVPLLCFPLLTDQFTNRKLVVDDWKVGINI--SDGES  355

Query  3414  ISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQ  3593
             I++ EV+ K+  LM  +S  EL + +  V++ LENAL  +GSS KN+++F + +K +  +
Sbjct  356   IARGEVSEKINHLMGGKSGDELWERMDAVKQTLENALKPDGSSEKNMNRFKDDLKVRIQE  415



>ref|XP_009792521.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009792530.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009792537.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009792539.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009792546.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana sylvestris]
Length=684

 Score =   460 bits (1183),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 256/303 (84%), Gaps = 3/303 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TLEE+ S LS+CKKI+WIG +KF++SN  + G SKLAAM+  LSQ+NCD+
Sbjct  373   GWKPVDVGPNTLEEMISMLSRCKKILWIGAIKFAASNQESAGTSKLAAMLYNLSQKNCDL  432

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+ F G SS  T + +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY 
Sbjct  433   IVVGKQACETFVGKSSYVTVD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIYT  491

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLF F MA+ RKD+NFLG+E+N KLV RC+DHVSQS M N +F+AT
Sbjct  492   NTTLPLVVDVGSGNGLFPFRMAKMRKDWNFLGMEMNEKLVSRCIDHVSQSGMTNGYFIAT  551

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRM+Q+SLVEAIADLLAS GKVFLQ
Sbjct  552   NATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEYRWRMVQRSLVEAIADLLASDGKVFLQ  611

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EV +RMKEEF KYGKGKL  V +LD +  HQ GWLKENPFGIRSDWEQHV+DRG P
Sbjct  612   SDVKEVVVRMKEEFMKYGKGKLAVVHDLDDSTSHQDGWLKENPFGIRSDWEQHVIDRGSP  671

Query  1998  MYR  2006
             MYR
Sbjct  672   MYR  674


 Score =   306 bits (785),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 233/348 (67%), Gaps = 14/348 (4%)
 Frame = +1

Query  130   MSQILENFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRK---IKKFQRLQFS-SPVKSQ  297
             MS++L  F  + L R   F         SP+ + R +  K   ++  +R+QFS   +  +
Sbjct  1     MSRVLNFFLGYSLPRISDFHNGCTKFQDSPQIRSRLSYGKPSAVQNCKRVQFSPQALNLE  60

Query  298   LTAL-------DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKL  456
             L A        D+AEA    +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++KK 
Sbjct  61    LAAYADLHSLPDEAEARDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQKKK  120

Query  457   DPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS  627
                +    ST+KYL +A AK+IL+ SWS+  +S+ L LE VAE+LSS L+++VIP +LGS
Sbjct  121   QSPAGRVISTIKYLHKAGAKLILISSWSARADSQLLKLERVAEFLSSELEMEVIPVELGS  180

Query  628   SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAST  807
                 + +E     DILLLEN+SQ K + +NC +FA+ LS GVDIFVND+FS+ HKILAS 
Sbjct  181   GFEQSQMEDGHNSDILLLENLSQFKQEQANCSEFARCLSSGVDIFVNDAFSQSHKILASN  240

Query  808   VGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDAL  987
             VGI  FC A IAGFHF  G+SQL+KII+ +K+PY AIIGG NL  KAAAL FLAS CD L
Sbjct  241   VGITSFCYASIAGFHFDEGMSQLKKIIKMNKRPYYAIIGGANLAGKAAALQFLASRCDGL  300

Query  988   VFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             VFVG+ AFQIMHAFGL VP++LVE+++L+ AH ++EA+K   + I+ P
Sbjct  301   VFVGDAAFQIMHAFGLAVPMELVEKESLEAAHMLIEASKARGVQIVLP  348



>gb|EYU36650.1| hypothetical protein MIMGU_mgv1a004868mg [Erythranthe guttata]
Length=506

 Score =   452 bits (1162),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 318/506 (63%), Gaps = 36/506 (7%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD-  2348
              + HA+++   +QGHI P IHL+I LAS+G TVTFV TE +       R  T +A  DD 
Sbjct  4     NRGHAVMVSFLFQGHITPFIHLAIKLASKGCTVTFVQTEFL-----HHRISTASAAGDDE  58

Query  2349  ------IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLA  2510
                   IF  AR SGLDIRY TISDGFPL FDR  +   F   ++  F   VDE + ++ 
Sbjct  59    EREIPEIFLGARESGLDIRYATISDGFPLEFDREANFEEFWGSILRDFPGRVDEFLGRIT  118

Query  2511  GLEP-----PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHF  2675
               E      PP+ L+AD+ Y W S IA KYN+ +VSF+TE AL F+I  HLDLLK N HF
Sbjct  119   AAENCDGGVPPSFLVADTTYLWGSEIAHKYNMFSVSFWTEAALAFSIGYHLDLLKLNAHF  178

Query  2676  GC--KDCRKDS--IDYIPGVEAIEPRDLPLYLQQEN---NTTSAVYLTVYKGFEDAKKAD  2834
                  D   D   I Y+PG+E+I  RDL  YL+ +N   N  + +Y  +   +E  KKAD
Sbjct  179   PLVNNDDGGDGVVISYVPGIESISTRDLMSYLEGDNDPFNIPTVLYQNIIDAYEQVKKAD  238

Query  2835  IVICNTVQELEPQTISALEEKQPFYAIGP-----LFPQSFTEQTAFRSLLPESDCCKWLD  2999
              ++CNTVQELEP T+SAL ++QP YA+GP       P      T   SL PE DC KWLD
Sbjct  239   FILCNTVQELEPHTLSALNQEQPTYAVGPSNFSGTPPIITVSNTTTTSLWPEVDCQKWLD  298

Query  3000  SKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSE--VNFIWVLRPGMA-ITDEMDFSM--  3164
             SKP GSVLY SFGS      + I E+  GLMLS+  VNFIW+LR  +  IT + D     
Sbjct  299   SKPHGSVLYISFGSTIETNTQLIYEIAHGLMLSQQQVNFIWILRRNLVRITSDDDDDDLL  358

Query  3165  -DGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQ  3341
               GF++CV DRGL++PWC+Q  V+S P++G F+THCGWNS+LESIW  VPMIC+PL VDQ
Sbjct  359   PPGFEDCVGDRGLVIPWCNQSLVLSDPSIGCFLTHCGWNSVLESIWHGVPMICFPLSVDQ  418

Query  3342  PTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENA  3521
             PTNRKLVVD+WKIGINLC+   K IS+++VA K+  LM +  +  LR+ IK V   L  A
Sbjct  419   PTNRKLVVDDWKIGINLCDGQTKQISRQQVAQKIDRLMSSGMT-SLRREIKKVETILHRA  477

Query  3522  LGSNGSSVKNVDKFVEKIKAKFNQSS  3599
               ++GSS  N+D+F++ + AK N  S
Sbjct  478   WAADGSSNVNLDRFLQDLMAKTNSKS  503



>ref|XP_009616940.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X8 
[Nicotiana tomentosiformis]
 ref|XP_009616941.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X8 
[Nicotiana tomentosiformis]
Length=587

 Score =   454 bits (1167),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             K WKPVD+GP+TLEE+ S LS+CKKI+WIG +KF +SN  + G SKLAA++  LSQ+NCD
Sbjct  275   KSWKPVDVGPNTLEEMISVLSRCKKILWIGAIKFGASNQESAGTSKLAAILYNLSQKNCD  334

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             + +VGK AC+ F G SS   A+ +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY
Sbjct  335   LIVVGKQACETFVGKSSYVMAD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIY  393

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+A
Sbjct  394   ANTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIA  453

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFL
Sbjct  454   TNATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFL  513

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG 
Sbjct  514   QSDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGA  573

Query  1995  PMYRLCLSKSESS  2033
             PMYRL L KS  S
Sbjct  574   PMYRLLLLKSSPS  586


 Score =   272 bits (695),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 182/248 (73%), Gaps = 3/248 (1%)
 Frame = +1

Query  397   GKVVMVRFDSTILPVDKKKLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEA  567
             GKVVMVR D TIL  ++KK    +A   ST+KYL  A AK++L+ SWS   +S+ L LE 
Sbjct  2     GKVVMVRLDLTILLREQKKKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLER  61

Query  568   VAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSF  747
             VAE+LSS L+LKVIP +LGS    + +E     DILLLEN+SQ K + +NC +FA++LS 
Sbjct  62    VAEFLSSELELKVIPVELGSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSS  121

Query  748   GVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGG  927
             GVDIFVND+F + HKILAS VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG
Sbjct  122   GVDIFVNDAFFQSHKILASNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGG  181

Query  928   GNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKV  1107
              NL  KAAAL FLAS CD  +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK 
Sbjct  182   ANLAGKAAALQFLASRCDGFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKA  241

Query  1108  GNLLILDP  1131
               + I+ P
Sbjct  242   RGVKIVLP  249



>ref|XP_009616939.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X7 
[Nicotiana tomentosiformis]
Length=589

 Score =   454 bits (1167),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             K WKPVD+GP+TLEE+ S LS+CKKI+WIG +KF +SN  + G SKLAA++  LSQ+NCD
Sbjct  277   KSWKPVDVGPNTLEEMISVLSRCKKILWIGAIKFGASNQESAGTSKLAAILYNLSQKNCD  336

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             + +VGK AC+ F G SS   A+ +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY
Sbjct  337   LIVVGKQACETFVGKSSYVMAD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIY  395

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+A
Sbjct  396   ANTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIA  455

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFL
Sbjct  456   TNATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFL  515

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG 
Sbjct  516   QSDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGA  575

Query  1995  PMYRLCLSKSESS  2033
             PMYRL L KS  S
Sbjct  576   PMYRLLLLKSSPS  588


 Score =   261 bits (667),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 176/243 (72%), Gaps = 3/243 (1%)
 Frame = +1

Query  412   VRFDSTILPVDKKKLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYL  582
              R D TIL  ++KK    +A   ST+KYL  A AK++L+ SWS   +S+ L LE VAE+L
Sbjct  9     TRLDLTILLREQKKKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLERVAEFL  68

Query  583   SSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIF  762
             SS L+LKVIP +LGS    + +E     DILLLEN+SQ K + +NC +FA++LS GVDIF
Sbjct  69    SSELELKVIPVELGSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSSGVDIF  128

Query  763   VNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLID  942
             VND+F + HKILAS VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG NL  
Sbjct  129   VNDAFFQSHKILASNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAG  188

Query  943   KAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLI  1122
             KAAAL FLAS CD  +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK   + I
Sbjct  189   KAAALQFLASRCDGFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKARGVKI  248

Query  1123  LDP  1131
             + P
Sbjct  249   VLP  251



>ref|XP_009616937.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X5 
[Nicotiana tomentosiformis]
Length=626

 Score =   453 bits (1166),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             K WKPVD+GP+TLEE+ S LS+CKKI+WIG +KF +SN  + G SKLAA++  LSQ+NCD
Sbjct  314   KSWKPVDVGPNTLEEMISVLSRCKKILWIGAIKFGASNQESAGTSKLAAILYNLSQKNCD  373

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             + +VGK AC+ F G SS   A+ +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY
Sbjct  374   LIVVGKQACETFVGKSSYVMAD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIY  432

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+A
Sbjct  433   ANTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIA  492

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFL
Sbjct  493   TNATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFL  552

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG 
Sbjct  553   QSDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGA  612

Query  1995  PMYRLCLSKSESS  2033
             PMYRL L KS  S
Sbjct  613   PMYRLLLLKSSPS  625


 Score =   303 bits (777),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 201/276 (73%), Gaps = 3/276 (1%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSA---STVK  483
             +AEAC   +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++KK    +A   ST+K
Sbjct  13    QAEACDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQKKKHSSAARVISTIK  72

Query  484   YLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTE  663
             YL  A AK++L+ SWS   +S+ L LE VAE+LSS L+LKVIP +LGS    + +E    
Sbjct  73    YLHNAGAKLVLISSWSPKADSQLLKLERVAEFLSSELELKVIPVELGSGLEQSLMEDGHN  132

Query  664   LDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIA  843
              DILLLEN+SQ K + +NC +FA++LS GVDIFVND+F + HKILAS VGI  FC + IA
Sbjct  133   SDILLLENLSQFKQEQANCSEFARRLSSGVDIFVNDAFFQSHKILASNVGITSFCYSSIA  192

Query  844   GFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMH  1023
             GFHF  G+SQL+KII+ +K PY AIIGG NL  KAAAL FLAS CD  +FVG+ AFQIMH
Sbjct  193   GFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAGKAAALQFLASRCDGFIFVGDAAFQIMH  252

Query  1024  AFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             AFGLPVP++LVE+++L+ A  ++EAAK   + I+ P
Sbjct  253   AFGLPVPMELVEQESLEAADMLLEAAKARGVKIVLP  288



>gb|EYU34488.1| hypothetical protein MIMGU_mgv1a005552mg [Erythranthe guttata]
Length=479

 Score =   447 bits (1151),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 314/479 (66%), Gaps = 16/479 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD-DI  2351
             K H I++ +PYQGHINP + L++ LAS GF++TFV+ E +   + KA     T+ T+ D+
Sbjct  9     KSHVIMISVPYQGHINPFVSLALKLASNGFSITFVHFEFVHHKLSKALNSNNTSSTEVDL  68

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F++AR SGLD+RYTTI DGF   FDR      +   + +     +D+ V K    +P   
Sbjct  69    FSEARESGLDVRYTTIEDGFSSEFDRELHFEKYWESITFDLLGMIDKFVGKTIQSDPNSV  128

Query  2532  -CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
               L+AD  YAWP  IA KYNLVNVSF+TEPALVF++  H++LL+E GHF CK    + I+
Sbjct  129   HFLVADCVYAWPGAIADKYNLVNVSFWTEPALVFSLQYHMELLREKGHFPCKGNIDEEIN  188

Query  2709  YIPGVEAIEPRDLPLYLQQ-ENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
             YIPGVE+I  RD   YL++ E+        +V   FE  KKAD ++ NTV ELE QT+SA
Sbjct  189   YIPGVESISTRDFMPYLKKAESEYVPTRAASV--AFERVKKADFILHNTVYELESQTLSA  246

Query  2886  LEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
             L   QP YAIGP+           +S   E+DC  WLDSK PGSVLY SFGS    +K+ 
Sbjct  247   LSTYQPNYAIGPIN----------KSFWSETDCTNWLDSKSPGSVLYVSFGSFVPTSKQV  296

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPA  3245
             I EL  GL+LSEVNFIWV+RPG+  + + +    GF++ ++D+GLI+PWC+Q  V+S PA
Sbjct  297   IEELAYGLLLSEVNFIWVIRPGILGSADNNVLPFGFEDEIKDKGLIIPWCNQIKVLSDPA  356

Query  3246  VGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKE  3425
             VGGF+THCGWNS LES+WC VPMICYP+  DQP NRKLVVD+WKIGINLC +   S+ ++
Sbjct  357   VGGFLTHCGWNSTLESMWCGVPMICYPMDWDQPVNRKLVVDDWKIGINLC-EYGTSVDRK  415

Query  3426  EVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSSV  3602
             +VA K+K LM   +S  LR+   +V+  L+ A+  +G S  +  +F+  ++   +++++
Sbjct  416   KVAEKIKKLMSGNTSKSLRQEADNVKAILQKAVEIDGLSEGSFAQFINDLRKNLHETAL  474



>gb|EAY78678.1| hypothetical protein OsI_33780 [Oryza sativa Indica Group]
Length=505

 Score =   448 bits (1153),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/500 (42%), Positives = 319/500 (64%), Gaps = 20/500 (4%)
 Frame = +3

Query  2130  EEKLVSFRKMVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLII  2309
             EE   +     +   K HA+V+  P QGH+NPA+HL++ LA+RGF VTFV+TE +     
Sbjct  3     EEVAATAAAAADGGSKPHAVVVTYPLQGHVNPAVHLALRLAARGFAVTFVSTESVHEQTA  62

Query  2310  KARRGTTTAPTDDIFT-------------QARNSGLDIRYTTISDGFPLGFDRTTDAYGF  2450
             +A  G       D+F              +   + +D+RY  +SDG P+GFDR+ +   F
Sbjct  63    RAL-GVVDPSGYDVFAAARAAAAKGGGGGETVAAAMDVRYEVVSDGLPVGFDRSLNHDDF  121

Query  2451  MMGMMYVFSAHVDELVKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVF  2630
             M  +++ F AHV+ L+ ++  ++   T L+AD+F+ WP+ ++ K  +  VSF+TEPAL+F
Sbjct  122   MGSLLHAFGAHVEALLCRVV-VDAAATFLVADTFFVWPATLSKKLGIPYVSFWTEPALIF  180

Query  2631  AIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKG  2810
              +  H++LL E+GHF C + RKD+I Y+PGVEAIEP +L  YLQ + +TT+ V+  +++ 
Sbjct  181   NLYYHINLLTEHGHFRCNEPRKDTITYVPGVEAIEPGELMSYLQ-DTDTTTVVHRIIFRA  239

Query  2811  FEDAKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCK  2990
             FE+A+ AD V+CNTV+ELEP TI+AL  ++PFYA+GP+ P  F       S+  ESDC +
Sbjct  240   FEEARGADYVVCNTVEELEPSTIAALRRERPFYAVGPILPAGFARSAVATSMWAESDCSR  299

Query  2991  WLDSKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDG  3170
             WL ++PP SVLY SFGS AH+T+  + E+ RG++ S   F+WV+RP +  +D+ D   DG
Sbjct  300   WLAAQPPRSVLYVSFGSYAHVTRRELHEIARGVLASGARFLWVMRPDIVSSDDPDPLPDG  359

Query  3171  FQECVR--DRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQP  3344
             F        RG++VPWC Q  V++HPAV  F+THCGWNSILES W  VPM+C+PL+ DQ 
Sbjct  360   FAAAAAADGRGVVVPWCCQVEVLAHPAVAAFLTHCGWNSILESAWAGVPMLCFPLLTDQF  419

Query  3345  TNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENAL  3524
             TNR+LVV EW+ G+ +   D  ++   EV +K++ +M+ E    LR+ +  +R  L  A+
Sbjct  420   TNRRLVVREWRAGVAV--GDRGAVDAGEVRAKIEGVMRGEEGEVLREQVGKMRATLHAAV  477

Query  3525  GSNGSSVKNVDKFVEKIKAK  3584
                GSS +  D+ V+++K +
Sbjct  478   APGGSSRRGFDELVDELKRR  497



>ref|XP_006354360.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Solanum 
tuberosum]
Length=579

 Score =   451 bits (1159),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 255/312 (82%), Gaps = 3/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TLEE+ S LS+CKKI+WIG VKFSSS+  + GAS LAAM   LSQ+NCD+
Sbjct  268   GWKPVDVGPNTLEEMISVLSRCKKILWIGAVKFSSSHQVSAGASNLAAMFYNLSQKNCDL  327

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+   G SS  T   MI+NAS+VWEFLKGR L GLLALDRAYPFE++W  +Y 
Sbjct  328   IVVGKQACETILGKSSHVTVV-MIENASIVWEFLKGRKLHGLLALDRAYPFELNWDALYA  386

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLFL  MA+ RKD+NFLGLE N KLV+RCLDHVSQS M N +F+AT
Sbjct  387   NTTLPLVVDVGSGNGLFLTRMAKMRKDWNFLGLERNEKLVRRCLDHVSQSGMTNGYFIAT  446

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG LVLVSIQCPNPDFNK  HRWRM+Q+SLVEAIADL+A  GKVFLQ
Sbjct  447   NATSTFRSIVSSYPGDLVLVSIQCPNPDFNKTEHRWRMVQRSLVEAIADLVAPDGKVFLQ  506

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EVA+RMK+EF KYGKGKL V  +L+    HQ GWL ENPFGIRSDWEQHV++RG P
Sbjct  507   SDVKEVAVRMKKEFMKYGKGKLTVMHDLEDITSHQDGWLNENPFGIRSDWEQHVIERGAP  566

Query  1998  MYRLCLSKSESS  2033
             MYRL L KS  S
Sbjct  567   MYRLLLLKSSPS  578


 Score =   249 bits (637),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 181/261 (69%), Gaps = 4/261 (2%)
 Frame = +1

Query  409   MVRFDSTILPVDKKKLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEY  579
             MVR D TIL  + KK    +A   ST+KYL +A AK+IL+ +WS     + L LE VAE+
Sbjct  1     MVRLDLTILLREHKKQQSPAACIISTIKYLHKAGAKLILISNWSVRAGLQLLKLEYVAEF  60

Query  580   LSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDI  759
             LSS L+ KVIP + GS    + +E R + DILLLEN+S  K + +N  +F+++LS GVDI
Sbjct  61    LSSELEQKVIPVEFGSGFEQSLMEDRHKSDILLLENLSHFKQEQANSSEFSRRLSSGVDI  120

Query  760   FVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLI  939
             FVND+F + HKILAS VGI  FC A IAGFHF   +SQL+KII  +K+PY AI+ GGNL 
Sbjct  121   FVNDTFFQSHKILASNVGITGFCYASIAGFHFDEQMSQLKKIIEMNKRPYFAIV-GGNLA  179

Query  940   DKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLL  1119
              K AAL FLAS CD LVFVG+ AFQIMHAFGLPVP++LVE+++L+ AH +VEAAK   + 
Sbjct  180   GKTAALLFLASRCDGLVFVGDAAFQIMHAFGLPVPMELVEQESLEAAHVLVEAAKARGVQ  239

Query  1120  ILDPAHWRKFLAFFQNARKLY  1182
             I+ P  +     ++ +  K++
Sbjct  240   IILPKDFWCLNDYYPSQMKIF  260



>ref|XP_009616934.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Nicotiana tomentosiformis]
Length=684

 Score =   454 bits (1168),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 219/312 (70%), Positives = 259/312 (83%), Gaps = 3/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TLEE+ S LS+CKKI+WIG +KF +SN  + G SKLAA++  LSQ+NCD+
Sbjct  373   GWKPVDVGPNTLEEMISVLSRCKKILWIGAIKFGASNQESAGTSKLAAILYNLSQKNCDL  432

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+ F G SS   A+ +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY 
Sbjct  433   IVVGKQACETFVGKSSYVMAD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIYA  491

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+AT
Sbjct  492   NTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIAT  551

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFLQ
Sbjct  552   NATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFLQ  611

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG P
Sbjct  612   SDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGAP  671

Query  1998  MYRLCLSKSESS  2033
             MYRL L KS  S
Sbjct  672   MYRLLLLKSSPS  683


 Score =   308 bits (789),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 232/350 (66%), Gaps = 18/350 (5%)
 Frame = +1

Query  130   MSQILENFQTFLL-----FRNQCFL------VCRKNSLASPKHKLRRTCRKIK-KFQRLQ  273
             MS++L+ F  + L     F N C        +  ++S   P     ++C++++   + L 
Sbjct  1     MSRVLDFFLEYSLPRISDFHNGCTRFQDLQQISSRSSYGKPS--AVQSCKRVQFSLEALN  58

Query  274   FSSPVKSQLTAL-DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK  450
                   + L +L D+AEAC   +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++K
Sbjct  59    LEVADHADLHSLPDEAEACDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQK  118

Query  451   KLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKL  621
             K    +A   ST+KYL  A AK++L+ SWS   +S+ L LE VAE+LSS L+LKVIP +L
Sbjct  119   KKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLERVAEFLSSELELKVIPVEL  178

Query  622   GSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILA  801
             GS    + +E     DILLLEN+SQ K + +NC +FA++LS GVDIFVND+F + HKILA
Sbjct  179   GSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSSGVDIFVNDAFFQSHKILA  238

Query  802   STVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICD  981
             S VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG NL  KAAAL FLAS CD
Sbjct  239   SNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAGKAAALQFLASRCD  298

Query  982   ALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
               +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK   + I+ P
Sbjct  299   GFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKARGVKIVLP  348



>gb|AAP53972.1| UDP-glucoronosyl and UDP-glucosyl transferase family protein, 
expressed [Oryza sativa Japonica Group]
Length=503

 Score =   447 bits (1151),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 315/485 (65%), Gaps = 20/485 (4%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HA+V+  P QGH+NPA+HL++ LA+RGF VTFV+TE +     +A  G       D+F
Sbjct  16    KPHAVVVTYPLQGHVNPAVHLALQLAARGFAVTFVSTESVHEQTARAL-GVADPSGYDVF  74

Query  2355  T-------------QARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDEL  2495
                           +   + +D+RY  +SDG P+GFDR+ +   FM  +++ F AHV+ L
Sbjct  75    AAARAAAAKGGGGGETVAAAMDVRYEVVSDGLPVGFDRSLNHDDFMGSLLHAFGAHVEAL  134

Query  2496  VKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHF  2675
             ++++  ++   T L+AD+F+ WP+ ++ K  +  VSF+TEPAL+F +  H++LL E+GHF
Sbjct  135   LRRVV-VDAAATFLVADTFFVWPATLSKKLGIPYVSFWTEPALIFNLYYHINLLTEHGHF  193

Query  2676  GCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTV  2855
              C + RKD+I Y+PGVEAIEP +L  YLQ + +TT+ V+  +++ FE+A+ AD V+CNTV
Sbjct  194   RCNEPRKDTITYVPGVEAIEPGELMSYLQ-DTDTTTVVHRIIFRAFEEARGADYVVCNTV  252

Query  2856  QELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASF  3035
             +ELEP TI+AL  ++PFYA+GP+ P  F       S+  ESDC +WL ++PP SVLY SF
Sbjct  253   EELEPSTIAALRRERPFYAVGPILPAGFARSAVATSMWAESDCSRWLAAQPPRSVLYVSF  312

Query  3036  GSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVR--DRGLIVP  3209
             GS AH+T+  + E+ RG++ S   F+WV+RP +  +D+ D   DGF        RG++VP
Sbjct  313   GSYAHVTRRELHEIARGVLASGARFLWVMRPDIVSSDDPDPLPDGFAAAAAADGRGVVVP  372

Query  3210  WCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGIN  3389
             WC Q  V++HPAV  F+THCGWNSILES W  VPM+C+PL+ DQ TNR+LVV EW+ G+ 
Sbjct  373   WCCQVEVLAHPAVAAFLTHCGWNSILESAWAGVPMLCFPLLTDQFTNRRLVVREWRAGVA  432

Query  3390  LCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVE  3569
             +   D  ++   EV ++++ +M  E    LR+ +  +R  L  A+   GSS +  D+ V+
Sbjct  433   V--GDRGAVDAGEVRARIEGVMHGEEGEVLREQVGKMRATLHAAVAPGGSSRRGFDELVD  490

Query  3570  KIKAK  3584
             ++K +
Sbjct  491   ELKRR  495



>ref|XP_006833161.1| hypothetical protein AMTR_s00072p00130550 [Amborella trichopoda]
 gb|ERM98439.1| hypothetical protein AMTR_s00072p00130550 [Amborella trichopoda]
Length=607

 Score =   451 bits (1160),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 223/496 (45%), Positives = 324/496 (65%), Gaps = 19/496 (4%)
 Frame = +3

Query  2145  SFRKMVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRG  2324
             S R+ ++      A    + +  HI P++ L++ LAS+G T+TFVNTE + +  +KA   
Sbjct  106   SMRRSLKGRCSLSATCWKLEFGSHIIPSVQLALKLASKGLTITFVNTEAVHAQTVKAYNN  165

Query  2325  TTTA----------PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVF  2474
             + +            TDDIF  AR +GLDIRY  +SDG PL FDR+ +   FM  +++VF
Sbjct  166   SLSKTLNDSIDCSNSTDDIFFGAREAGLDIRYRVVSDGLPLEFDRSLNHNQFMFSLLHVF  225

Query  2475  SAHVDELVKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDL  2654
             SAHV+++++++A   PP +C+IAD+F+ W + +A K+ + ++SF+TEPALVF++  H  L
Sbjct  226   SAHVEKIIREVALDGPPISCIIADTFFVWVAPMAEKFGVPHISFWTEPALVFSLYHHAHL  285

Query  2655  LKENGHFGCK-DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKA  2831
             L+++GHF  +   RKD IDYIPG+ +I+P+D+P YLQ  ++T++ V+  +   F  AK+A
Sbjct  286   LRQHGHFDSEGKNRKDPIDYIPGIPSIDPKDIPSYLQV-SDTSTVVHQIILAAFNGAKRA  344

Query  2832  DIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPP  3011
             D V+ NTV+ELE  TI AL    PFYA+GP+ P  FTE +   SL PESDC  WLD+ P 
Sbjct  345   DWVLSNTVEELELHTIEALNNYFPFYAVGPILPPKFTENSISTSLWPESDCSSWLDTHPD  404

Query  3012  GSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRD  3191
              SV+Y SFGS AH++KE I E+  GLMLS  +F+WVLRP +  +DE +     FQE  R 
Sbjct  405   RSVIYISFGSYAHISKEEIQEIAEGLMLSGRSFVWVLRPDIVSSDEPEPLPKDFQERTRG  464

Query  3192  RGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDE  3371
             +GL+V WC Q  V+SH A+GGF+THCGWNSI+ES+WC VPM+  PL+ DQ TNRKL+VD+
Sbjct  465   QGLVVHWCRQREVLSHRAIGGFLTHCGWNSIMESVWCEVPMLGLPLLTDQFTNRKLIVDD  524

Query  3372  WKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKN  3551
             W +G++L     + + +EEV   ++ +   E     R+ +++VR  L  A+G  GSS  N
Sbjct  525   WGVGLDLM----RKLRREEVKENMERVFGEEG---FRERVREVRGVLARAIGEEGSSQAN  577

Query  3552  VDKFVEKIKAKFNQSS  3599
             +DKFV  +K K    S
Sbjct  578   LDKFVVDLKRKLGGPS  593



>ref|XP_009616931.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009616933.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Nicotiana tomentosiformis]
Length=686

 Score =   454 bits (1167),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             K WKPVD+GP+TLEE+ S LS+CKKI+WIG +KF +SN  + G SKLAA++  LSQ+NCD
Sbjct  374   KSWKPVDVGPNTLEEMISVLSRCKKILWIGAIKFGASNQESAGTSKLAAILYNLSQKNCD  433

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             + +VGK AC+ F G SS   A+ +I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY
Sbjct  434   LIVVGKQACETFVGKSSYVMAD-LIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIY  492

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+A
Sbjct  493   ANTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIA  552

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFL
Sbjct  553   TNATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFL  612

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG 
Sbjct  613   QSDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGA  672

Query  1995  PMYRLCLSKSESS  2033
             PMYRL L KS  S
Sbjct  673   PMYRLLLLKSSPS  685


 Score =   308 bits (789),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 232/350 (66%), Gaps = 18/350 (5%)
 Frame = +1

Query  130   MSQILENFQTFLL-----FRNQCFL------VCRKNSLASPKHKLRRTCRKIK-KFQRLQ  273
             MS++L+ F  + L     F N C        +  ++S   P     ++C++++   + L 
Sbjct  1     MSRVLDFFLEYSLPRISDFHNGCTRFQDLQQISSRSSYGKPS--AVQSCKRVQFSLEALN  58

Query  274   FSSPVKSQLTAL-DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK  450
                   + L +L D+AEAC   +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++K
Sbjct  59    LEVADHADLHSLPDEAEACDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQK  118

Query  451   KLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKL  621
             K    +A   ST+KYL  A AK++L+ SWS   +S+ L LE VAE+LSS L+LKVIP +L
Sbjct  119   KKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLERVAEFLSSELELKVIPVEL  178

Query  622   GSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILA  801
             GS    + +E     DILLLEN+SQ K + +NC +FA++LS GVDIFVND+F + HKILA
Sbjct  179   GSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSSGVDIFVNDAFFQSHKILA  238

Query  802   STVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICD  981
             S VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG NL  KAAAL FLAS CD
Sbjct  239   SNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAGKAAALQFLASRCD  298

Query  982   ALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
               +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK   + I+ P
Sbjct  299   GFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKARGVKIVLP  348



>emb|CBI32769.3| unnamed protein product [Vitis vinifera]
Length=581

 Score =   450 bits (1157),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/309 (70%), Positives = 248/309 (80%), Gaps = 2/309 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD GP  L+EI+S L+ CKKIIWIGPVKF   + +  GASKL +M+D L+Q NC++
Sbjct  269   GWIPVDPGPKALDEINSLLTGCKKIIWIGPVKFRLPSQDIYGASKLVSMLDRLTQSNCEI  328

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +++G MAC A    SS  +  NM++NASVVWEFLKGR LPGL+ALDRAYP E+DW   Y+
Sbjct  329   TVIGNMACKAVMKESSFVSVYNMVENASVVWEFLKGRKLPGLMALDRAYPVEIDWNAAYS  388

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
              P +PLVVDIGSGNGLFL  MA RR+D NFLGLEIN KLV+RCLD V Q  + N +F+AT
Sbjct  389   HPSQPLVVDIGSGNGLFLLAMAKRREDLNFLGLEINEKLVRRCLDCVHQYGIMNGYFIAT  448

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SLVEA+ADLLAS GKVFLQ
Sbjct  449   NATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEHRWRMLQRSLVEAVADLLASDGKVFLQ  508

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SDIE VA+RMKE F KYGKGKL  V N D     + GWLKENPFG+RSDWEQHV+DRG P
Sbjct  509   SDIEAVAVRMKEHFLKYGKGKLSVVHNEDCTETDRKGWLKENPFGVRSDWEQHVVDRGAP  568

Query  1998  MYRLCLSKS  2024
             MYRL LSKS
Sbjct  569   MYRLMLSKS  577


 Score =   260 bits (664),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 179/244 (73%), Gaps = 3/244 (1%)
 Frame = +1

Query  409   MVRFDSTIL---PVDKKKLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEY  579
             MVRFDS IL    +D K     + ST+KYL EA AK+IL+  W+  INSK L +E+VA++
Sbjct  1     MVRFDSAILLQKELDLKSQVTSAVSTIKYLFEAGAKIILLSDWNMKINSKLLVVESVADF  60

Query  580   LSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDI  759
             LSSVLQLKV P++  S+  ++ +E+  + DILLLEN+S+ K +++NC KFA+QLS  VDI
Sbjct  61    LSSVLQLKVAPSRCISNCSLSKMEELEKADILLLENLSEFKGELANCSKFAEQLSSVVDI  120

Query  760   FVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLI  939
             FVNDSFS  HKILASTVG+  FCSAC+AGFHF+  L QL+   + +KKP +AIIGGGNL 
Sbjct  121   FVNDSFSNSHKILASTVGVPRFCSACVAGFHFEESLCQLKMAAQINKKPCIAIIGGGNLF  180

Query  940   DKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLL  1119
             DKA+A+ +LAS CD LVFVG MAFQIMHA GL VP+ L+E   LK+A  IV+ A+   + 
Sbjct  181   DKASAVRYLASRCDGLVFVGMMAFQIMHALGLHVPLNLLEGGPLKEASNIVQLAQNRKIP  240

Query  1120  ILDP  1131
             IL P
Sbjct  241   ILYP  244



>gb|EYU34486.1| hypothetical protein MIMGU_mgv1a023861mg [Erythranthe guttata]
Length=477

 Score =   446 bits (1147),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 226/481 (47%), Positives = 318/481 (66%), Gaps = 20/481 (4%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAI++ +PYQGHINP + L++ LAS GF+VTFV+ E +   + KA     T    D+F
Sbjct  9     KSHAIMISLPYQGHINPFVSLALKLASNGFSVTFVHFEFVHQKLSKAIHSNNTEV--DLF  66

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT-  2531
             ++AR SGLDIRYTTI+DGFP  FDR      ++  + +   + +DE V K    +P    
Sbjct  67    SEARESGLDIRYTTITDGFPSEFDRELHFEEYLESITFDLPSIIDEFVGKTIESDPYSVH  126

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
              L++D+ YAW   I+ KYNL+NVS +T+PAL+F++  H++LL+E GHF  K    + I+Y
Sbjct  127   FLVSDTIYAWSGKISDKYNLINVSLWTQPALLFSLGYHMELLREKGHFPWKGNIAEEINY  186

Query  2712  IPGVEAIEPRDL-PLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             +PGV++I  RDL P + + E+             +   KKAD ++ NTV ELE QT+SAL
Sbjct  187   VPGVQSISTRDLMPYFTKAESE------------YIPTKKADFILHNTVYELESQTLSAL  234

Query  2889  EEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
              + QP YAIGP+ F ++       +S   ESDC  WLDSK PGSVLY SFGS     K+ 
Sbjct  235   SKYQPNYAIGPIRFSKNVPTNDVSKSFWSESDCTNWLDSKSPGSVLYVSFGSSVQTNKQV  294

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQE--CVRDRGLIVPWCHQPAVISH  3239
               E+  GL+LSEVNFIWV+RPG+  + + +    GF++   ++D+GLI+PWC Q  V+S+
Sbjct  295   TEEVAYGLLLSEVNFIWVIRPGILGSPDNNVLPFGFEDEINIKDKGLIIPWCDQIKVLSN  354

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             P +GGF+THCGWNS LES+WC VPMICYP+  DQPTNRKLVVD+WKIGINLC D   S+ 
Sbjct  355   PVIGGFLTHCGWNSTLESMWCGVPMICYPIDWDQPTNRKLVVDDWKIGINLC-DYGTSVD  413

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             +++VA K+K LM   SS  LR+   +V+  L+ A+  +GSS KN D+F+E ++ K ++++
Sbjct  414   RKQVAEKIKQLMSGNSSKSLRQEADNVKAILQKAVEIDGSSEKNFDRFIEDLRGKIHETA  473

Query  3600  V  3602
             +
Sbjct  474   L  474



>dbj|BAJ85107.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94593.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   443 bits (1140),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 326/483 (67%), Gaps = 11/483 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
                 K HA+V+  PYQGH+ PA HL++ LA+RGF VTFVNTE +      AR        
Sbjct  15    RRTTKPHAVVIAYPYQGHVIPAAHLALRLAARGFAVTFVNTESVHEQ--TARALGVDRHR  72

Query  2343  DDIFTQARNSG--LDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
              DIF  AR S   LD+RY  +SDGFPL FDR+ +   F  G ++V +AHV+EL++++  +
Sbjct  73    YDIFAGARASADALDVRYELVSDGFPLAFDRSLNHDQFKEGELHVLAAHVEELLRRVV-V  131

Query  2517  EPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDC--  2690
             +P  TCL+AD+F+ WP+ +A K  +  VSF+TEPAL+F +  H+DLL  +GHF       
Sbjct  132   DPASTCLVADTFFVWPATLARKLGIPYVSFWTEPALIFNLYYHMDLLAAHGHFNSSKGPP  191

Query  2691  RKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEP  2870
             RKD+I Y+PGV AIEP +L  YLQ + + TS V+  ++K F++A++AD V+CNTV+ELEP
Sbjct  192   RKDTITYVPGVPAIEPHELMSYLQ-DTDVTSVVHRIIFKAFDEARRADYVLCNTVEELEP  250

Query  2871  QTISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
              T++AL  ++PFYA+GP+ FP++  +     S+  ESDC +WLD++P GSVLY SFGS A
Sbjct  251   STVAALRAEKPFYAVGPIGFPRAGGDAGVATSMWAESDCSQWLDAQPAGSVLYISFGSYA  310

Query  3048  HLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPA  3227
             H+T++ + ++  G++ S   F+W +RP +  +D+ D   +GF      RGL+VPWC Q  
Sbjct  311   HVTRQELQDIAAGVVGSGARFLWAMRPDIVSSDDPDPLPEGFAAACAGRGLVVPWCCQVE  370

Query  3228  VISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDD  3407
             V++H A+GGF+THCGWNS+LES+W  VPM+C+PL+ DQ TNR+LVV EW++G+ +   D 
Sbjct  371   VLAHAALGGFLTHCGWNSVLESVWAGVPMLCFPLLTDQFTNRRLVVREWRVGVPI--GDR  428

Query  3408  KSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKF  3587
               +  +EVA++++ ++  E   +LR+A+K VR  L+ A+   GSS ++ D FV+++  + 
Sbjct  429   GKVFADEVAARIQGVISGEEGQQLRQALKKVRAKLKAAVAPGGSSQRSFDDFVDELTGRC  488

Query  3588  NQS  3596
              ++
Sbjct  489   GRT  491



>gb|EYU34487.1| hypothetical protein MIMGU_mgv1a005354mg [Erythranthe guttata]
Length=487

 Score =   441 bits (1134),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 312/480 (65%), Gaps = 10/480 (2%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAI++  PYQGHINP + L++ LAS GF++TFV+ E +   + KA          D+F
Sbjct  9     KSHAIMISAPYQGHINPFVSLALKLASNGFSITFVHFEFVHDKLSKALHSNNNEV--DLF  66

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT-  2531
             ++AR SGLDIRYTTI+DGFP  FDR      +   + + F + +DE V K    +P    
Sbjct  67    SEARESGLDIRYTTIADGFPSEFDRELHFEEYWESITFDFQSIIDEFVGKTIESDPYSVH  126

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
              L+AD+ Y WP  I+ KYNL+NVS +T+PALVF++  H++LL+E GHF       + I+Y
Sbjct  127   FLVADTIYVWPGKISDKYNLINVSLWTQPALVFSLGYHIELLREKGHFPWGGNIDEEINY  186

Query  2712  IPGVEAIEPRDL-PLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             IPGVE+I   DL P  ++ E+        +V   FE  KKAD ++ N V ELE QT+SAL
Sbjct  187   IPGVESISTSDLMPYLIKAESQILRTRICSV--AFEQVKKADFILHNNVYELESQTLSAL  244

Query  2889  EEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEH  3065
              + QP Y IGP+ F ++       +S   ESDC  WLDSK  GSVLY SFGS     K+ 
Sbjct  245   SKYQPNYTIGPVKFSKNIPTNDVSKSFWSESDCTNWLDSKSRGSVLYISFGSFVQTNKQV  304

Query  3066  IMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQE--CVRDRGLIVPWCHQPAVISH  3239
             I E+  GL+LSEVNFIWV+RPG+  + + +    GF +   ++D+GLI+PWC Q  V+S+
Sbjct  305   IEEVAYGLLLSEVNFIWVIRPGILGSPDSNVLPFGFVDEINIKDKGLIIPWCDQIKVLSN  364

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             PAVGGF+THCGWNS LES+WC VPMICYP+  DQPTNRKLVVD+WKIG+NLC D   S+ 
Sbjct  365   PAVGGFLTHCGWNSTLESMWCGVPMICYPIDWDQPTNRKLVVDDWKIGVNLC-DYGTSVD  423

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             +++VA K+K LM   SS  LR+   +V+  L  A+  +GSS +N  +F++ ++AK  +++
Sbjct  424   RKQVAEKIKQLMSGISSKSLRQEADNVKTILHKAVEIDGSSERNFAQFIKDLRAKLQETA  483



>ref|XP_008243986.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Prunus mume]
Length=653

 Score =   447 bits (1150),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 254/312 (81%), Gaps = 2/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD+GP++  E+ S LS+CKK+ WIGPVKF +SN   G AS+LA M++ LSQ NC++
Sbjct  343   GWVPVDIGPASFVEMKSMLSRCKKVTWIGPVKFRTSNCTKG-ASELAQMLNQLSQSNCNI  401

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC+A    S+S     MI++ASVVWEFLKGR LPG++ALDRAYPF++DW   Y+
Sbjct  402   TVVGNKACEAMVKESNSTFNFTMIKDASVVWEFLKGRKLPGVMALDRAYPFDIDWSDAYS  461

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNG+FL GMA+ RKD NFLGLEIN+KLVKRCLD V    ++N +F+AT
Sbjct  462   DPAQPLVVDIGSGNGMFLLGMAKTRKDLNFLGLEINKKLVKRCLDSVHWRGIRNGYFIAT  521

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSIISSYPG+LVLVSIQCPNPDFNKP HRW MLQ+SLVEA+ADLL + GKVFLQ
Sbjct  522   NATSTFRSIISSYPGKLVLVSIQCPNPDFNKPDHRWSMLQRSLVEAVADLLTANGKVFLQ  581

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE V++RMKE+F +YGKGKL V +    AI   GWLK+NPFG+RSDWEQHVL RGDPM
Sbjct  582   SDIEAVSLRMKEQFQRYGKGKLTVVHEQSFAITNSGWLKDNPFGVRSDWEQHVLARGDPM  641

Query  2001  YRLCLSKSESSE  2036
             YRL L KS ++E
Sbjct  642   YRLMLCKSTTTE  653


 Score =   282 bits (722),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 193/276 (70%), Gaps = 3/276 (1%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSASTVK  483
             K +A    E+   PH+Q L +FP++EL  KVV+VRFDST+L     ++ +  P++  T+K
Sbjct  43    KCKAFGGGEMDALPHLQALRKFPRKELVAKVVLVRFDSTLLLQEQGEEHRFQPNALFTIK  102

Query  484   YLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTE  663
             YL ++ AKV+LV  WS   N +    ++VAE+LSS+L+ KV+P +  S  +++  E   +
Sbjct  103   YLHQSGAKVVLVSDWSVKTNPRLFVAQSVAEFLSSLLEYKVVPVQCISQNVVSKREGFEK  162

Query  664   LDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIA  843
              DILLLEN+S+ + +V+NC KF+Q LS GVDIFVND FS  HKILAST G+A FC A +A
Sbjct  163   GDILLLENLSEFRGEVANCSKFSQALSSGVDIFVNDYFSRSHKILASTCGVAHFCYANLA  222

Query  844   GFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMH  1023
             GFHF+  LSQL +   ++ KP+VAIIGGGNL DKAAALH L S CD LVFVG M+FQIMH
Sbjct  223   GFHFEESLSQLRRATESNTKPHVAIIGGGNLFDKAAALHSLTSRCDGLVFVGMMSFQIMH  282

Query  1024  AFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             A GLPVP+ LVE   LK+A  IV+ A + N+ IL P
Sbjct  283   ALGLPVPLNLVEHGVLKEALDIVQVAHIRNVQILYP  318



>gb|AGA84057.1| UDP-glucosyltransferase isoform 1 [Picrorhiza kurrooa]
Length=473

 Score =   439 bits (1128),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 232/476 (49%), Positives = 310/476 (65%), Gaps = 12/476 (3%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             HAI++P    G + P   L I    +G TVTFVN + I  +I KA  G + +    +F++
Sbjct  4     HAIMIPTSL-GPL-PFFDLCIEACFKGITVTFVNFDFIQHMISKA--GNSNSGDVVLFSK  59

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             A+ SGLDIRY TISDG PL FDR  +   ++  ++  F A VDE ++K    +P     I
Sbjct  60    AQQSGLDIRYATISDGLPLEFDRNLNFEEWVQVLLTEFPARVDEFIEKTIKRDPSLISFI  119

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPG  2720
                 YAW + IA+KYNLV+V F+TEPALVF+++ H DLLKE+ H+ CKD  ++ I+Y+PG
Sbjct  120   VADTYAWQATIANKYNLVSVYFWTEPALVFSLNYHTDLLKEHAHYPCKDDIEEDINYLPG  179

Query  2721  VEAIEPRDLPLYLQQE--NNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             V++I  RD+  YL++   NN     Y+    G E  K  D V+ NTVQELEP+T+SAL E
Sbjct  180   VDSISTRDIMPYLKEIGINNYGVQSYV---NGIEAIKNVDFVLHNTVQELEPETLSALNE  236

Query  2895  KQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIM  3071
              Q    + PL F ++  + T   SL  ESDC +WL SKPPGSVLY SFGSL    K+ + 
Sbjct  237   IQSITPLVPLNFSKNLEKTTITNSLWSESDCTQWLGSKPPGSVLYVSFGSLVQTNKQVVE  296

Query  3072  ELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVG  3251
             E+  GL+LSEVNFIWV R G   +D+ D  ++GF++ ++DRGLI+PWC Q  V+S+PA+G
Sbjct  297   EIAHGLLLSEVNFIWVSRSGPVSSDDTDVLLNGFEDEIKDRGLIIPWCDQIMVLSNPAIG  356

Query  3252  GFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEV  3431
             GF+THCGWNSILESIWC VPMICYP+  DQPTNRKLVVD+WKIGI+LC  D   +++E V
Sbjct  357   GFLTHCGWNSILESIWCGVPMICYPVTFDQPTNRKLVVDDWKIGISLC--DGTLVNRENV  414

Query  3432  ASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAKFNQSS  3599
             A K++  M   SS  L++ I  V   L NA    GSS  N ++F+  +KAK N  S
Sbjct  415   AVKIRNFMHGTSSEGLKREITKVGAILCNATQIGGSSENNFEQFIRDLKAKINTGS  470



>ref|XP_004306252.1| PREDICTED: phosphoglycerate kinase-like [Fragaria vesca subsp. 
vesca]
Length=645

 Score =   443 bits (1139),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 254/312 (81%), Gaps = 2/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD+GP +L+EI+S L+KCKK+ WIGPVKF   +    GASK+A M++ LS+ + ++
Sbjct  335   GWVPVDIGPVSLDEINSILAKCKKVTWIGPVKFHMIS-RTKGASKVAQMLNQLSRGDMNI  393

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC+A    S S    NMI+NASVVWEFLKGR LPG++ALD AYPF++DWK  Y+
Sbjct  394   TVVGNMACEAMVKESDSIFHFNMIENASVVWEFLKGRKLPGIMALDMAYPFDIDWKAAYS  453

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNG+F+FGMA+ RKD NFLGLEIN+KLVKRCLD      ++N +F+AT
Sbjct  454   DPAQPLVVDIGSGNGMFVFGMAKTRKDLNFLGLEINKKLVKRCLDSTHWCGIRNGYFIAT  513

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG+LVLVSIQCPNPDFN+P HRWRMLQ+SLVEA+ADLL S GKVFLQ
Sbjct  514   NATSTFRSIVSSYPGKLVLVSIQCPNPDFNEPEHRWRMLQRSLVEAVADLLTSDGKVFLQ  573

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE V++RMKE+F  + KGKL + +  + A    GWLKENPFG+RSDWEQHVLDRGDPM
Sbjct  574   SDIEAVSVRMKEQFLTHSKGKLTIVHEQRYATDNEGWLKENPFGVRSDWEQHVLDRGDPM  633

Query  2001  YRLCLSKSESSE  2036
             YRL L KS SSE
Sbjct  634   YRLMLCKSASSE  645


 Score =   274 bits (701),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 183/268 (68%), Gaps = 3/268 (1%)
 Frame = +1

Query  328   YESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSASTVKYLCEARAK  507
             Y  EL   PH+QTL +FPKEEL  KVV+VRFDS +L  ++   +  +  T+KYL ++ AK
Sbjct  46    YGGELEALPHLQTLKKFPKEELVEKVVLVRFDSALLLQEQ---ESSAVFTIKYLQQSGAK  102

Query  508   VILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLEN  687
             V+LV  WS+  N K  A ++VA+ LSSV+  KV+P K  S  M +  E   + DI+LLEN
Sbjct  103   VVLVSDWSAKTNPKVFAAQSVADLLSSVIDYKVVPVKCISHNMASKREGFEKSDIVLLEN  162

Query  688   ISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGL  867
             ++  K +V+NC KFAQ LS GVDIFVND FS  HKILAST G+A FC AC+AGFHF+  L
Sbjct  163   LADFKGEVANCSKFAQVLSSGVDIFVNDYFSRSHKILASTCGVARFCYACLAGFHFEESL  222

Query  868   SQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPI  1047
               L ++  T  KPY AIIGG NL +KAAALH LAS CD LVFVG MAFQIMHA  + VP+
Sbjct  223   YHLRRLAETSTKPYAAIIGGSNLFNKAAALHTLASTCDGLVFVGMMAFQIMHALQVSVPL  282

Query  1048  KLVERKALKQAHAIVEAAKVGNLLILDP  1131
              LVE+  LK+A  I++ A   N+ IL P
Sbjct  283   NLVEQGTLKEALDIIQFAHNRNVQILYP  310



>gb|KEH25354.1| phosphoglycerate kinase [Medicago truncatula]
Length=684

 Score =   442 bits (1138),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 213/313 (68%), Positives = 250/313 (80%), Gaps = 8/313 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP+TL+EI S L+ CKKIIWIGPVKF+  + +  GASKLA ++  LSQ NC+ 
Sbjct  366   GWMPVDLGPATLDEIGSMLTICKKIIWIGPVKFADRSEHTNGASKLAKVLVKLSQGNCET  425

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC      +SS +  NM++NASVVWEFLKGR LPG+LALDRAYPF+++W  +Y+
Sbjct  426   TVVGTTACQLVRQETSSLSTINMVENASVVWEFLKGRKLPGVLALDRAYPFKINWNNVYS  485

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             D  + LVVDIGSGNGLFL  MA RRKD NFLGLE+N KLV RCLD + Q  +KN HF+AT
Sbjct  486   DATQSLVVDIGSGNGLFLLEMAKRRKDLNFLGLEMNEKLVLRCLDSIQQFDIKNGHFIAT  545

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ DLLASGGKVFLQ
Sbjct  546   NATSTFRSIVSSYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVDLLASGGKVFLQ  605

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SD+EEVAIRMKE+F +Y KGKL +EN       Q  WL ENPFGIRSDWE+HVL+RG PM
Sbjct  606   SDVEEVAIRMKEQFLRYCKGKLVLEN------GQTDWLDENPFGIRSDWEKHVLERGAPM  659

Query  2001  YRLCLSK-SESSE  2036
             YR+  SK SE SE
Sbjct  660   YRMMFSKLSEISE  672


 Score =   274 bits (700),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 187/270 (69%), Gaps = 6/270 (2%)
 Frame = +1

Query  334   SELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILP----VDKKKLDPHSASTVKYLCEAR  501
              EL   PH+QTL +FP+EELFGKVVMVRFDS IL       K + D ++  T+KYL EA 
Sbjct  74    GELNGIPHIQTLREFPREELFGKVVMVRFDSNILLKQECNQKNQSDFNALFTIKYLHEAG  133

Query  502   AKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLL  681
             AKVILV  W +  N+  L  ++VA+ LS +LQ++V+P +  S + ++ I    + +I LL
Sbjct  134   AKVILVSDWKT--NTSELRTKSVADLLSEILQIQVVPLQGVSCKKLSEITGLKKENIFLL  191

Query  682   ENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQL  861
             EN+  +KD+V+NC K+A++LS GVDIFVNDSFS  HK+LASTVG+   C AC+AGFHF+ 
Sbjct  192   ENLYNIKDEVANCLKYARELSSGVDIFVNDSFSNSHKVLASTVGVTRICYACVAGFHFEE  251

Query  862   GLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPV  1041
              L  ++ +   +KKPYVAIIGGGNL  KAA+  FLAS C   VFVG M+FQIM+A G+PV
Sbjct  252   KLRLMKNLAEANKKPYVAIIGGGNLAKKAASFRFLASRCQGFVFVGMMSFQIMNALGVPV  311

Query  1042  PIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             PI LV RKA  +A  IV  A+  N+ IL P
Sbjct  312   PIDLVVRKAFSEAQDIVRLARDNNVTILYP  341



>ref|XP_009398946.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   434 bits (1115),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 304/469 (65%), Gaps = 8/469 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E+  KHHAI +  P+QGH  PA + ++ +A+RGF VTFV TE       +   G  +   
Sbjct  5     EDIPKHHAIFVAAPFQGHFTPAANFAVKIAARGFIVTFVTTEAFHHQ--RTASGAVSVDG  62

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
              ++F  AR+ GLDIRY  +SDG P+ FDR      F     ++  AHV+EL++KL   E 
Sbjct  63    HEVFADARSMGLDIRYELVSDGLPVTFDRYMHRDQFSDAFYHLLPAHVEELMRKLLLAEN  122

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCRKD  2699
             P   LI+D+F  WPS +A K+ L  VSF+TEPALVFAI  H+ LL ENGHFG   + RKD
Sbjct  123   PIDVLISDTFAVWPSTLAKKFGLPYVSFWTEPALVFAIYYHMHLLVENGHFGSPTETRKD  182

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I YIPGV +IEP DL  +      +   +   V K FE+ K AD V+CNTVQELE + I
Sbjct  183   TITYIPGVPSIEPTDLVSFFHAPEASWR-LLRNVGKAFEEVKGADFVLCNTVQELEVEVI  241

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
              AL+++ PFYA+GP+ P S  E  A  SL PE DC +WL S PP SVLY SFGS+A ++K
Sbjct  242   GALQQEWPFYAVGPIGPDS-GEGGAATSLWPELDCSQWLHSMPPRSVLYISFGSIAPVSK  300

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSM-DGFQECVRDRGLIVPWCHQPAVIS  3236
                 E+  G++ S+  FIWV+RPG   T E    + +GF +  + RG++VPWC Q  V+ 
Sbjct  301   RDTDEIAYGVLDSKSRFIWVIRPGSGSTSEATPPLPEGFIDACKGRGMVVPWCRQKQVLQ  360

Query  3237  HPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSI  3416
             HPAVGGF+THCGWNSILES+WC VPM+C+PL  DQPTNRK+VV++ +IGI++ +  +  +
Sbjct  361   HPAVGGFLTHCGWNSILESMWCGVPMLCFPLFSDQPTNRKMVVEDLRIGIDVGSIGE--V  418

Query  3417  SKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKF  3563
             S+ EV+ ++  LM       LRK +++ ++ +++A+   GSS KN+++F
Sbjct  419   SRAEVSRRIDSLMGGGVGGALRKEMEEAQRAVKSAVTPTGSSSKNMEQF  467



>ref|XP_002519506.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF42920.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=678

 Score =   440 bits (1132),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L+EI++ L K KKIIWIGP KF  SN    GASKLA ++D LSQ  CDV
Sbjct  368   GWLPVDLGPMSLDEINTLLVKSKKIIWIGPPKFKFSNPCINGASKLAQVLDELSQPTCDV  427

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG +AC A    SSS  A ++I+NASVVW+F K RNLPG++ALDRAYPF++DW  +Y+
Sbjct  428   TVVGNLACKAVMVESSSLLAYDLIENASVVWDFFKRRNLPGVMALDRAYPFKIDWSAVYH  487

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIG GNG+FL GMARR KD NFLGLEIN+KLV+RCLD V QS + N HF+AT
Sbjct  488   DPAQPLVVDIGCGNGMFLLGMARRKKDLNFLGLEINKKLVRRCLDSVHQSGISNGHFIAT  547

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NAT+TFRSI+SSYPG LVLVSIQCPNPDFN P HRWRMLQ+SLVEA+ADLLA  GKVFLQ
Sbjct  548   NATTTFRSIVSSYPGELVLVSIQCPNPDFNDPEHRWRMLQRSLVEAVADLLAHDGKVFLQ  607

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDI+ VA+RMKE F KYG+G+L + N D+       WL+ENPFG+RSDWEQHV+D+G PM
Sbjct  608   SDIKTVAVRMKELFLKYGRGRLMLVN-DQFEATIRVWLEENPFGVRSDWEQHVIDQGRPM  666

Query  2001  YRLCLSKSESSE  2036
             YRL LSKS + E
Sbjct  667   YRLMLSKSTNGE  678


 Score =   276 bits (707),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 155/279 (56%), Positives = 191/279 (68%), Gaps = 8/279 (3%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS------  474
             +A  C E E  + P VQTL + PK+EL  KVVMVRFDS IL   K++LD  S S      
Sbjct  67    EANYCDEGESEVLPQVQTLREIPKKELAAKVVMVRFDSAILL--KEELDKSSQSVSNAIL  124

Query  475   TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEK  654
             T+KYL E+ +K+ILV  W   INSK L +E+ A+ LSS+LQL+V+     S+ +   +E 
Sbjct  125   TIKYLHESGSKIILVSDWKKKINSKLLDVESAADILSSILQLRVVALHCISTYLPMKMEA  184

Query  655   RTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSA  834
                 DI LLEN+S+ K++V+NC +FA+ LS GVDIFVNDSFS  HKILASTV +A FCSA
Sbjct  185   LRIADIFLLENLSEFKEEVANCLRFAELLSSGVDIFVNDSFSLSHKILASTVAVAHFCSA  244

Query  835   CIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQ  1014
              +AGFHF+  L QL+K   T+KKPY+AIIGGGNL DKAAAL FLAS CD LVFVG M+FQ
Sbjct  245   HVAGFHFEKSLFQLKKAGTTNKKPYIAIIGGGNLYDKAAALQFLASKCDGLVFVGMMSFQ  304

Query  1015  IMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             IMHA G  VP  L+E KA K A  I+  A   N+ IL P
Sbjct  305   IMHALGYSVPSSLIEPKAHKAALDIIHFAHKRNISILYP  343



>ref|XP_010107484.1| Phosphoglycerate kinase 1 [Morus notabilis]
 gb|EXC16166.1| Phosphoglycerate kinase 1 [Morus notabilis]
Length=683

 Score =   440 bits (1132),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 248/307 (81%), Gaps = 3/307 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD+GP +L+EI S L+KCKKIIWIGPVKF  S+    GASKLA +++ LSQR+CDV
Sbjct  372   GWLPVDIGPVSLDEIKSLLTKCKKIIWIGPVKFHKSSC-ISGASKLAQILNQLSQRDCDV  430

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VG MAC+A    SS  +  NM+ NASVVWEFLKGR LPG++ALDRAYPF++DW  +Y 
Sbjct  431   IVVGNMACEALIKESSCFSVSNMVYNASVVWEFLKGRKLPGVMALDRAYPFDIDWNTVYV  490

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNGLFL GM+ RRKD N+LGLEIN+ LV RCLD + +  ++N++F+ T
Sbjct  491   DPSKPLVVDIGSGNGLFLQGMSKRRKDLNYLGLEINKTLVTRCLDSIHRLGIRNLYFIMT  550

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS F S++SSYPG+L LVSIQCPNPDFN P HRWRMLQ+SLVEA+ +LLA  GKVFLQ
Sbjct  551   NATSAFHSLVSSYPGKLTLVSIQCPNPDFNNPEHRWRMLQRSLVEAVVELLAPNGKVFLQ  610

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE V++RMKEEF KYGKGKL V   +  A+   GWLKENPFG+RSDWEQHVLDRG PM
Sbjct  611   SDIEAVSMRMKEEFLKYGKGKLIVHE-ESNAMTSRGWLKENPFGVRSDWEQHVLDRGAPM  669

Query  2001  YRLCLSK  2021
             YRL LSK
Sbjct  670   YRLILSK  676


 Score =   292 bits (748),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 202/280 (72%), Gaps = 6/280 (2%)
 Frame = +1

Query  310   DKAEACYE--SELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS---  474
             +KA AC E  SE    P+VQTLG+FPK ELF KVV+VRFDSTIL   + +    SAS   
Sbjct  68    NKAFACNEEESESNALPYVQTLGKFPKGELFEKVVLVRFDSTILFGKEAEKISQSASNAL  127

Query  475   -TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIE  651
              T+KYL EA AK+ILV  WS    SKP A E+VA++LSSVL+ KV+P    S E     E
Sbjct  128   LTIKYLHEAGAKIILVSDWSVKNKSKPFASESVADFLSSVLKYKVVPVGCISPEKSLRTE  187

Query  652   KRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCS  831
                + DILLL+++S+ K++V+NC +F++ LS+ VDIFVNDSFS+ H+ILASTVG+  FC 
Sbjct  188   SFEKADILLLDSLSEFKEEVANCPEFSEALSYRVDIFVNDSFSQSHRILASTVGVTRFCY  247

Query  832   ACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAF  1011
             AC+AGFHF+  L+QL  I  ++++ YVAIIGGGNL+DKAAAL FLA  C+ LVFVG MAF
Sbjct  248   ACLAGFHFEESLNQLRNIKESEREHYVAIIGGGNLLDKAAALRFLACRCERLVFVGMMAF  307

Query  1012  QIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             QIMHA GL VP+ LVER +LKQA  IV+ A+  N+ +L P
Sbjct  308   QIMHALGLSVPLNLVERGSLKQALDIVQFAQSRNVELLYP  347



>ref|XP_010107480.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16162.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=467

 Score =   431 bits (1109),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 230/490 (47%), Positives = 316/490 (64%), Gaps = 37/490 (8%)
 Frame = +3

Query  2157  MVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTT-  2333
             M  NN K HAI+ P+PYQG++ P+I L++ LAS+GFT+TFVNTE I   II + +   + 
Sbjct  1     MENNNSKPHAIMFPLPYQGYVTPSIQLAMKLASKGFTITFVNTEFIHHQIITSSQPDYST  60

Query  2334  ----APTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVK  2501
                 +  DDIF +AR+ GLDIRY T++DGFP                     AHVDELV 
Sbjct  61    VDGGSGDDDIFDKARDLGLDIRYKTMTDGFP---------------------AHVDELVG  99

Query  2502  KLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC  2681
              L   +P  +CLIAD+FY W  +I+ KY LVN+SF+T+PALVF I  H+D L  +GHF  
Sbjct  100   NLVKSDPSVSCLIADTFYTWAPLISQKYKLVNISFWTQPALVFNIYYHMDFLITDGHFPP  159

Query  2682  KDCRKDS-IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQ  2858
             +   KD+ IDYIPGV+AIEP+DL  YLQ+ +      +  V+K   + K AD ++CNT+Q
Sbjct  160   QYNLKDTAIDYIPGVKAIEPKDLSSYLQETDKGPHEFFDKVFK---EVKSADFILCNTIQ  216

Query  2859  ELEPQTISALEEKQPFYAIGP--LFPQSFTEQ-TAFRSLLPESDCCKWLDSKPPGSVLYA  3029
             ELE  TI AL+EK+P +AI P  L P  F +  T   SL  + DC +WL++KP GS LY 
Sbjct  217   ELESDTIFALQEKKPIFAISPQVLSPFGFAKSSTVPTSLRAKFDCSQWLNTKPRGSGLYI  276

Query  3030  SFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVP  3209
             SFGS     K  I E+  G++ S +NF+WVL       +E      GF++ ++D+GLIVP
Sbjct  277   SFGSFISPKKCDIEEIAHGVLFSGMNFVWVLHHDAVSCEESCVLPFGFEDMIKDKGLIVP  336

Query  3210  WCHQPAVISHPAVGGFITHCGWNSILESIWCS-VPMICYPLIVDQPTNRKLVVDEWKIGI  3386
             WC+Q  V+SHP++GGF+THCGWNSILES+ CS VP++C+PL  DQ TNRKLVVD+W+IG+
Sbjct  337   WCNQVEVLSHPSIGGFLTHCGWNSILESLQCSGVPLLCFPLKGDQITNRKLVVDDWRIGL  396

Query  3387  NLCNDDDKSISKEEVASKVKFLMKAES-SIELRKAIKDVRKNLENALGSNGSSVKNVDKF  3563
             NLC  D K +++ E A K+K LM  +S   EL + +  VR+ + NA+  +GS  KN+ +F
Sbjct  397   NLC--DRKPLTRLEAADKIKCLMSGKSDGHELLEQVIKVRQTVGNAMAKDGSCEKNLHQF  454

Query  3564  VEKIKAKFNQ  3593
             +  +K K  +
Sbjct  455   IVDVKVKIGE  464



>ref|XP_010325972.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Solanum 
lycopersicum]
 ref|XP_010325973.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Solanum 
lycopersicum]
Length=579

 Score =   435 bits (1118),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TL E+ S LS+CKKI+WIG VKFSSS+  + GASKLAAM+  LSQ NCD+
Sbjct  268   GWKPVDVGPNTLGEMISVLSRCKKILWIGAVKFSSSHQESAGASKLAAMLYNLSQMNCDL  327

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+ F G S   TA+ MI+NAS+VWEFLKGR L GLLALDRAYPF+++W  +Y 
Sbjct  328   IVVGKQACETFIGRSRHVTAD-MIENASIVWEFLKGRKLHGLLALDRAYPFKLNWDALYA  386

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLFL  MA+ RKD+NFLGLE N KLV+RCLDHVSQS M N +F+AT
Sbjct  387   NTTLPLVVDVGSGNGLFLTRMAKMRKDWNFLGLERNEKLVRRCLDHVSQSGMTNGYFIAT  446

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFR I+SSYPG LVLVSIQCPNPDFN+  HRWRM+Q+SLVEAIADL+A  GKVFLQ
Sbjct  447   NATSTFRFIVSSYPGDLVLVSIQCPNPDFNRTEHRWRMVQRSLVEAIADLVAPDGKVFLQ  506

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EVA+RMK+EF  YGKGKL V  + +     Q GWL ENPFGIRSDWEQHV++RG P
Sbjct  507   SDVKEVAVRMKKEFMNYGKGKLTVMHDSEDITSQQDGWLNENPFGIRSDWEQHVIERGAP  566

Query  1998  MYR  2006
             MYR
Sbjct  567   MYR  569


 Score =   250 bits (638),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 175/244 (72%), Gaps = 4/244 (2%)
 Frame = +1

Query  409   MVRFDSTILPVDKKKLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEY  579
             MVR D TI+  ++KK    +A   ST+KYL +A AK++L+ SWS   +S+ L LE VAE 
Sbjct  1     MVRLDLTIVLREQKKQQSPAARVISTIKYLHKAGAKLVLLSSWSLRADSRLLKLEYVAEL  60

Query  580   LSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDI  759
             LSS L+LKVIP  LGS    +  E R +  ILLLEN+SQ K + +NC +FA++LS GVDI
Sbjct  61    LSSELELKVIPVDLGSGFEQSLREDRHKSSILLLENLSQFKQEQANCSEFARRLSSGVDI  120

Query  760   FVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLI  939
             FVN++F + HKILAS VGI  FC A IAGFHF   +SQL+KII  +K+PY AI+ GGNL 
Sbjct  121   FVNETFFQSHKILASNVGITGFCYASIAGFHFDEQMSQLKKIIEMNKRPYFAIV-GGNLA  179

Query  940   DKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLL  1119
              KA AL FLAS CD LVF+G  AFQIMHAFGLPVP++LVE+++L+ A  +VEAAK   + 
Sbjct  180   GKAVALLFLASRCDGLVFIGNAAFQIMHAFGLPVPMELVEQESLEAARVLVEAAKARGVQ  239

Query  1120  ILDP  1131
             I+ P
Sbjct  240   IILP  243



>ref|XP_007027389.1| Phosphoglycerate kinase isoform 2 [Theobroma cacao]
 gb|EOY07891.1| Phosphoglycerate kinase isoform 2 [Theobroma cacao]
Length=582

 Score =   435 bits (1118),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 246/313 (79%), Gaps = 2/313 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGPS+L+EI+S ++  KKIIWIGPVKF SS+   GG SKLA M+    Q  C++
Sbjct  270   GWVPVDLGPSSLDEINSLVTNSKKIIWIGPVKFRSSSPYTGGTSKLAQMLYKQCQCECEI  329

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +IVG  AC+     SSS ++ NM++NAS VWEFLKG+ LPG++ALDRAYPFE+DW   Y 
Sbjct  330   TIVGSTACEVIKNESSSVSSFNMLENASAVWEFLKGQKLPGVMALDRAYPFEIDWNVAYC  389

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP RPLVVDIGSGNGLF+ GM R RKD NFLGLEIN KLVKRCLD V QS + N +F+ T
Sbjct  390   DPSRPLVVDIGSGNGLFIMGMTRKRKDLNFLGLEINGKLVKRCLDSVHQSGITNGYFIET  449

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTF SI+SSYPG LVL+SI+CPNPDFNKP HRWRM+Q+SL+EA+ADLLAS GKVFLQ
Sbjct  450   NATSTFHSIVSSYPGELVLLSIECPNPDFNKPEHRWRMMQRSLIEAVADLLASKGKVFLQ  509

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+E VA+R+K+EF KYGKGK  V  +     I+   WLKENPFGI SDWEQHV+DRG P
Sbjct  510   SDVEAVAMRLKDEFLKYGKGKFHVMHDRYDLVINGNTWLKENPFGIHSDWEQHVIDRGAP  569

Query  1998  MYRLCLSKSESSE  2036
             MYRL LSK+   E
Sbjct  570   MYRLMLSKATGLE  582


 Score =   242 bits (617),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 168/245 (69%), Gaps = 4/245 (2%)
 Frame = +1

Query  409   MVRFDSTILPVDKKKLDPHSA----STVKYLCEARAKVILVGSWSSTINSKPLALEAVAE  576
             MVRFDSTI   +K      SA     T+K+L E+ AKVILV +WS+ IN K LA E VA+
Sbjct  1     MVRFDSTIFLGEKLDWSSQSALRALYTIKFLHESGAKVILVSAWSTKINPKLLAAEVVAD  60

Query  577   YLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVD  756
              LSSVL+LKV   +  S  M    +   + DILLLEN+S  K++ +NC KFA+ LS  VD
Sbjct  61    ILSSVLRLKVAALRCISCNMPLERKDLQKADILLLENLSNYKEEAANCSKFAELLSSEVD  120

Query  757   IFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNL  936
             IFVNDSF + HKILASTVG+A FC A +AGF F   L QL+K   T+KKPY+AIIGGGNL
Sbjct  121   IFVNDSFFQSHKILASTVGVARFCYASMAGFSFDESLCQLKKTATTNKKPYIAIIGGGNL  180

Query  937   IDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNL  1116
              +KAAAL FLAS CDALVFVG M+FQI+HA G  VP  LVE +A K A  IV+ A   N+
Sbjct  181   NNKAAALQFLASRCDALVFVGLMSFQIIHALGHSVPTNLVELEAQKAALDIVQFAHNKNV  240

Query  1117  LILDP  1131
             LIL P
Sbjct  241   LILYP  245



>ref|XP_007208305.1| hypothetical protein PRUPE_ppa003108mg [Prunus persica]
 gb|EMJ09504.1| hypothetical protein PRUPE_ppa003108mg [Prunus persica]
Length=602

 Score =   434 bits (1116),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 250/312 (80%), Gaps = 2/312 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD+GP++  E+   LS+CKK+ WIGPVKF +SN   G  S+LA M++ LSQ NC++
Sbjct  292   GWVPVDIGPASFVEMKFMLSRCKKVTWIGPVKFRTSNCTKGD-SELAQMLNQLSQSNCNI  350

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC+A    S+      MI++ASVVWEFLKGR LPG++ALDRAYPF++DW   Y+
Sbjct  351   TVVGNKACEAMVKESNFTFNFTMIKDASVVWEFLKGRKLPGVMALDRAYPFDIDWSDAYS  410

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNG+FL GMA+ RK  NFLGLEIN+KLVKRCLD V    ++N +F+AT
Sbjct  411   DPAQPLVVDIGSGNGMFLLGMAKTRKYLNFLGLEINKKLVKRCLDSVHWRGIRNGYFIAT  470

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSIISSYPG+LVLVSIQCPNPDFN+P HRW MLQ+SLVEA+ADLL + G+VFLQ
Sbjct  471   NATSTFRSIISSYPGKLVLVSIQCPNPDFNEPDHRWSMLQRSLVEAVADLLTANGRVFLQ  530

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE V++RMKE+F +YGKGKL V +    AI   GWLK+NPFG+RSDWEQHVL RGDPM
Sbjct  531   SDIEAVSLRMKEQFQRYGKGKLTVVHEQSFAITNSGWLKDNPFGVRSDWEQHVLARGDPM  590

Query  2001  YRLCLSKSESSE  2036
             YRL L KS ++E
Sbjct  591   YRLLLCKSTTTE  602


 Score =   281 bits (720),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 196/289 (68%), Gaps = 10/289 (3%)
 Frame = +1

Query  349   FPHVQTLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSASTVKYLCEARAKVILV  519
              PH+QTL +FP+EEL  KVV+VRFDST+L     ++++  P++  T+KYL ++ AKV+LV
Sbjct  4     LPHLQTLRKFPREELVAKVVLVRFDSTLLLREQGEEQRFQPNALFTIKYLHQSGAKVVLV  63

Query  520   GSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQL  699
               WS   N +    ++VAE+LSS+L+ KV+P +  S  +++  E   + DILLLEN+S  
Sbjct  64    SDWSVKTNPRLFVAQSVAEFLSSLLEYKVVPVQCISQNVVSKREGFEKGDILLLENLSAF  123

Query  700   KDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLE  879
             + +V+NC KF+Q LS GVDIFVND FS  HKILAST G+  FC A +AGFHF+  LSQL 
Sbjct  124   RGEVANCSKFSQALSSGVDIFVNDYFSRSHKILASTCGVTRFCYANLAGFHFEESLSQLR  183

Query  880   KIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVE  1059
             +   ++ KP+VAIIGGGNL DKAAALH L S CD LVFVG M+FQIMHA GLPVP+ LVE
Sbjct  184   RATESNTKPHVAIIGGGNLFDKAAALHSLTSRCDGLVFVGMMSFQIMHALGLPVPLNLVE  243

Query  1060  RKALKQAHAIVEAAKVGNLLILDPA-------HWRKFLAFFQNARKLYG  1185
                LK+A  IV+ A + N+ IL P        H  K L  F+  R L G
Sbjct  244   HGVLKEALDIVQVAHIRNVQILYPKDFWCKNDHLPKQLEIFRAHRILDG  292



>emb|CDP06766.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   436 bits (1122),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 253/309 (82%), Gaps = 6/309 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDAL-SQRNCD  1280
             GW+PVDLGP +LEEI+S +SKCKKI+WIGPV+F  S  +AG AS+L A+VD L SQ N +
Sbjct  375   GWQPVDLGPESLEEIASLVSKCKKILWIGPVRFGLSRSDAGEASRLGAVVDRLRSQNNLE  434

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
               +VGK+AC    G++ + +   +I+NAS VWEFLKGR+LPGL+ALDR+YPF++ W  +Y
Sbjct  435   TILVGKVACTTVLGSNLNYS---VIENASAVWEFLKGRSLPGLMALDRSYPFDIKWDGVY  491

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
             +DP RPLVVD+GSGNGLFLFGMA+ RKD NFLGLEIN KLV RCL+ V Q+ MKN +F+ 
Sbjct  492   DDPTRPLVVDVGSGNGLFLFGMAKKRKDLNFLGLEINGKLVNRCLERVLQTGMKNGYFIR  551

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNA STFRSIISSYPG LVLVSIQCPNPDFNKP HRW+M+Q+SL+EAIADLLA GGKVFL
Sbjct  552   TNAASTFRSIISSYPGELVLVSIQCPNPDFNKPEHRWKMVQRSLIEAIADLLALGGKVFL  611

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSDIE VAIRMK EF KYGKGK+ V +  + A+ +Q  WL ENPFG+RSDWEQHVLDRG 
Sbjct  612   QSDIEGVAIRMKSEFVKYGKGKIMVMDEPEDASCYQRQWLNENPFGVRSDWEQHVLDRGA  671

Query  1995  PMYRLCLSK  2021
              MYRL LSK
Sbjct  672   NMYRLLLSK  680


 Score =   285 bits (728),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 231/353 (65%), Gaps = 22/353 (6%)
 Frame = +1

Query  130   MSQILENFQT--FLLFRNQCFLVCRKNSLASPKHKLRRTCRKI-----KKFQRLQFSSPV  288
             M+Q L+ F++  +   RN  FL   +NS A   HK       +     +K++RL  S  V
Sbjct  1     MNQALDIFRSSGYYFSRNPVFLNSSRNSPAFLLHKQNFPLEHLAAPLFEKYRRLVCSKRV  60

Query  289   KS------QLTALD-KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL--PV  441
              S      +  +L  +AEAC  ++    PHVQTL +FPKEEL  KVVMVRFDS +L   +
Sbjct  61    NSKPFIPTESNSLRVEAEACDGADFSAVPHVQTLREFPKEELSEKVVMVRFDSRLLFQQL  120

Query  442   DKKKLDPHSA-STVKYLCEARAKVILVGSWSSTINS--KPLALEAVAEYLSSVLQLKVIP  612
              ++K+   +A ST+KYL EA AKVILV SW +   +  K +  E++A  LSSVLQ+KV+P
Sbjct  121   QERKIQCENAVSTIKYLHEAGAKVILVSSWDADAENTMKIVRAESIAGALSSVLQVKVVP  180

Query  613   TKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHK  792
              KL +  M +    + E +ILLLEN+ Q K++ +NC+ FA+ LS GVDIFVND+FS+ H+
Sbjct  181   VKLVTRHMHS---AKQESNILLLENLFQFKEEPANCKGFARLLSSGVDIFVNDAFSQSHR  237

Query  793   ILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLAS  972
             +LASTV I+ FC A IAGFHF+  LSQL+ I +T +KPYVAIIGGGNL++KAAAL  L  
Sbjct  238   VLASTVAISRFCYASIAGFHFEAVLSQLKNITKTSQKPYVAIIGGGNLVEKAAALRLLVC  297

Query  973   ICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             ICD LVFVG +AFQIMHA GLP+P+KLVE  A ++A  ++ + K     ++ P
Sbjct  298   ICDGLVFVGNIAFQIMHALGLPLPMKLVEHGATEEALTLINSMKSRRRAVIVP  350



>gb|EYU34480.1| hypothetical protein MIMGU_mgv1a004928mg [Erythranthe guttata]
Length=504

 Score =   430 bits (1105),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 234/498 (47%), Positives = 316/498 (63%), Gaps = 35/498 (7%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTD-DI  2351
             K HAI++ +PYQGHINP ++L++ LAS G +VTFV+ E +   + KARR     P + D+
Sbjct  9     KPHAIMISLPYQGHINPFVNLALKLASEGVSVTFVHLEFVHHKLSKARRQN---PNEFDL  65

Query  2352  FTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPT  2531
             F QAR SGLDI+YTTI DGFPL FDR      +    M  F A VDE + +     P   
Sbjct  66    FDQARESGLDIQYTTIGDGFPLEFDRDLHLMEYWESFMRDFPAIVDEFIAEKIRSHPVRY  125

Query  2532  CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDY  2711
              L++D+ Y W SI+A KY LVNVS +TEPALVF++  H  LL ENGHF CKD   + IDY
Sbjct  126   FLVSDTIYWWSSIVAEKYKLVNVSLWTEPALVFSLMYHSRLLSENGHFPCKDGIVEEIDY  185

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             +PGV  I  +DL  YL +E  + S +   +   FE+ K AD ++ NTVQ+LE +T+  L 
Sbjct  186   VPGVGKISTQDLMPYL-KEAESQSIITKLLSVAFENVKNADFLLHNTVQQLESETLLYLN  244

Query  2892  EKQPFYAIGPLFPQSFTEQTAF---------RSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             ++ P YAIGP+   +F+E  A           SL  ESDC KWL SKP GSVLY SFGSL
Sbjct  245   KQLPNYAIGPI---NFSESPAITNNKSVVSKTSLWSESDCTKWLGSKPHGSVLYVSFGSL  301

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMD---------GFQECV--RD  3191
                +K+ I E+  GL+LSEVNFIWV+R G+A      F  D         GF++ +  + 
Sbjct  302   VQTSKQVIEEVANGLLLSEVNFIWVVRLGIA-----GFGDDCGDNNVLPLGFEDEIKLKG  356

Query  3192  RGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDE  3371
             RGLI+PWC Q  V+S+PA+GGF+THCGWNS LES+WC VPMICYP+  DQ TNRKLVVD+
Sbjct  357   RGLIIPWCDQIRVLSNPAIGGFLTHCGWNSTLESMWCGVPMICYPIDWDQVTNRKLVVDD  416

Query  3372  WKIGINLCND--DDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSV  3545
             WKIG+NLC++  +  S+ +++V  K+K  M   +   L+     +++ LE A+  +GSS 
Sbjct  417   WKIGVNLCDNYGNKSSLDRKKVGEKIKQFMSEATWKSLKLEAVKIKQILEEAVEIDGSSE  476

Query  3546  KNVDKFVEKIKAKFNQSS  3599
              N   FV+ ++AK  +++
Sbjct  477   VNFGNFVKDLRAKIIETA  494



>ref|XP_010253975.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nelumbo nucifera]
Length=675

 Score =   435 bits (1119),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 204/310 (66%), Positives = 247/310 (80%), Gaps = 2/310 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             +GW PV LGP +L+EI+  LSKCKKI+WIGPVKF +S  +  GASKLA M+  L +  C 
Sbjct  367   EGWSPVGLGPVSLDEIACLLSKCKKILWIGPVKFQTSEEDTHGASKLAMMLTELGKDVCS  426

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             VS+VG  AC+     S   +  N+I+NASVVWEFLKGR LPG+ ALDRAYPF++DW  I 
Sbjct  427   VSVVGNAACNIIMKTSRCPSLYNIIENASVVWEFLKGRKLPGVTALDRAYPFDIDWDTIL  486

Query  1461  NDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              DP +PL+VDIGSGNGLF+ GMAR+ K FN+LGLEIN KLV+RCL+ V    +KNV+F+A
Sbjct  487   YDPTQPLIVDIGSGNGLFILGMARKQKQFNYLGLEINDKLVRRCLNSVRTYGLKNVYFIA  546

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+SSYPG+L+L S+QCPNPDFNKP HRWRMLQ+SL+EAIADLL S GKVFL
Sbjct  547   TNATSTFRSIVSSYPGKLILASVQCPNPDFNKPEHRWRMLQRSLIEAIADLLVSNGKVFL  606

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             QSDIE VA+RMKE+F  YGKGKL +   D   + QGGWL+ENPFG+ SDWE+HV+DRGDP
Sbjct  607   QSDIEAVALRMKEQFLIYGKGKLAIVE-DDMKVGQGGWLEENPFGVWSDWERHVIDRGDP  665

Query  1998  MYRLCLSKSE  2027
             MYRL +SK +
Sbjct  666   MYRLMISKVD  675


 Score =   273 bits (698),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 195/273 (71%), Gaps = 6/273 (2%)
 Frame = +1

Query  325   CYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSA-STVKYLC  492
             C   +L   PHV TL ++PKE+L GKVV+VRFDST+L   P+D K    + A  T+KYL 
Sbjct  73    CDGGQLDTIPHVLTLREYPKEKLSGKVVLVRFDSTLLLGEPLDLKISSVNEALFTIKYLY  132

Query  493   EARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDI  672
             +A AKV+LV +W+S  N   L+ ++VA+YLSS+LQLKV+PT   S  M + ++   E DI
Sbjct  133   DAGAKVLLVSNWNSPNNPMFLSAKSVADYLSSLLQLKVVPTNCISGYMQSRVQD--EADI  190

Query  673   LLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFH  852
             LL EN+S+ +++++NC  FA++LS GVDIFVND+FS+ HKILAS VG+  FC+A +AGF 
Sbjct  191   LLFENLSKFREELANCFVFAEKLSSGVDIFVNDAFSQSHKILASNVGVTRFCAASVAGFQ  250

Query  853   FQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFG  1032
             F+  L +L +   + + P VAIIGGGN++DKA ALHFLASICD LVFVG MAFQIMHA G
Sbjct  251   FEKDLFRLIEATMSKETPNVAIIGGGNILDKAPALHFLASICDGLVFVGLMAFQIMHALG  310

Query  1033  LPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
              PVP+ LVER   K +  I++ A+  N+ +L P
Sbjct  311   QPVPLNLVERSTTKDSLKIIQLAQTRNIPVLVP  343



>ref|XP_009405745.1| PREDICTED: UDP-glycosyltransferase 86A2-like [Musa acuminata 
subsp. malaccensis]
Length=479

 Score =   428 bits (1101),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 218/472 (46%), Positives = 306/472 (65%), Gaps = 9/472 (2%)
 Frame = +3

Query  2163  ENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPT  2342
             E   KHHA+ + +P+QGH  PA + ++ LA+RGF VTFV TE       +A  G  +   
Sbjct  5     EGITKHHALFVTVPFQGHFTPAANFAVKLAARGFIVTFVTTEGFHHQ--RAASGAVSVDG  62

Query  2343  DDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
              ++F  AR+ G+DIR   +SDG P+ FDRT     F     ++  +HV+EL++KL   EP
Sbjct  63    HEVFADARSMGMDIRSELVSDGLPVSFDRTLHRDQFSDAFYHLLPSHVEELMRKLLLAEP  122

Query  2523  PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGC-KDCRKD  2699
             P   LI+D+F  WPS +A K+ L  VSF+TE ALVFAI  H+ LL E GHFG   + RKD
Sbjct  123   PIDVLISDTFNVWPSTLAKKFGLPYVSFWTEAALVFAIYYHVHLLVEYGHFGSPTETRKD  182

Query  2700  SIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTI  2879
             +I YIPGV +IEP DL  +      +   V   V K FE+AK AD V+CNTVQELE + I
Sbjct  183   AIMYIPGVPSIEPTDLVSFFHSPEASWR-VLRNVGKAFEEAKGADFVLCNTVQELEAEVI  241

Query  2880  SALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
              AL++++PFYA+GP+ P S  E  A  SL PE DC +WL S PP SVLY SFGS+A ++K
Sbjct  242   GALQQERPFYAVGPIVPAS-GEGGAATSLWPELDCSQWLHSMPPRSVLYISFGSIARVSK  300

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
               + E+  G++ S+ +FIWV+RPG   ++      +GF +  + RG++VPWC Q  V+ H
Sbjct  301   RDMDEIAYGVLGSKFSFIWVIRPGSGSSEASPLP-EGFIDACKGRGMVVPWCRQKQVLLH  359

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             PAVGGF+THCGWNSILES+WC VPM+C+P+  DQPTNRKLVV++ +IGI++ +  +  + 
Sbjct  360   PAVGGFLTHCGWNSILESMWCGVPMLCFPVRADQPTNRKLVVEDLRIGIDVGSIGE--VR  417

Query  3420  KEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
               EV+ ++  LM  E    LRK ++  +K +++A+   GSS KN+++F   +
Sbjct  418   GAEVSRRIDSLM-GEVGGALRKEMEGAQKAVKSAVTPTGSSSKNLEQFTADL  468



>gb|KCW89397.1| hypothetical protein EUGRSUZ_A01689 [Eucalyptus grandis]
Length=579

 Score =   432 bits (1110),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 250/313 (80%), Gaps = 2/313 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             KGW PVD+GP TL+EI + L K KK  WIGPVKF S N +A GAS+LA ++ ALSQ +CD
Sbjct  268   KGWMPVDIGPRTLDEIKTLLKKSKKATWIGPVKFKSCNSSAIGASELACILYALSQDDCD  327

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             V+IVG +A       SSS  A ++I+NASV W+FLKGR LPG++ALDRAYPF++DWK +Y
Sbjct  328   VTIVGSVATKTITDESSSIPAFSVIENASVWWDFLKGRKLPGVMALDRAYPFDIDWKSVY  387

Query  1461  NDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
             ++P +PLVVDIGSGNGLFL GMA++ K  NFLGLEIN KLV+RCL  V Q   KN +F+A
Sbjct  388   SEPAQPLVVDIGSGNGLFLLGMAKKWKHLNFLGLEINEKLVRRCLIAVHQLDFKNGYFIA  447

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+S+YPG ++LVSIQCPNPDFNKP HRWRMLQKSLVEA+ADLL   GKVFL
Sbjct  448   TNATSTFRSIVSNYPGEVILVSIQCPNPDFNKPEHRWRMLQKSLVEAVADLLIPSGKVFL  507

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             QSDI+ VA+RMKE+F +YGKGKL +      + + GGWL+ENPFGIRSDWEQHVLDRG P
Sbjct  508   QSDIKAVAVRMKEQFLRYGKGKLSILQAQDTSTN-GGWLEENPFGIRSDWEQHVLDRGAP  566

Query  1998  MYRLCLSKSESSE  2036
             MYRL L KS + +
Sbjct  567   MYRLMLLKSNNVQ  579


 Score =   227 bits (578),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 173/247 (70%), Gaps = 9/247 (4%)
 Frame = +1

Query  409   MVRFDSTILPVDKK----KLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAE  576
             MVRFDS IL  + +    + + ++  T+KYL EARA+++LV  W+  INSK L L +VAE
Sbjct  1     MVRFDSAILLREDQDHTVQSNLYAHLTIKYLLEARARIVLVSDWNGGINSKFLDLLSVAE  60

Query  577   YLSSVLQLKVIPTKLGS--SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFG  750
             +LS VL + V+P+   S  S +   +EK T   +LLLEN+S+ K +V N  +FA+ LS G
Sbjct  61    HLSVVLGVNVVPSHCLSHYSPLTEALEKMT---VLLLENLSEFKGEVCNSLEFAETLSSG  117

Query  751   VDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGG  930
             VDIFVND FS+ HK+LASTVG+  FC + +AGFHF+  L +L+  +++DK+P++AIIGG 
Sbjct  118   VDIFVNDLFSQSHKVLASTVGVTRFCYSSVAGFHFEESLRKLKNALKSDKRPHIAIIGGT  177

Query  931   NLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVG  1110
             NL +KAAAL  LAS+CD LVFVG M+FQIMHA GL VP+  +E  A K+A  +V+ A+  
Sbjct  178   NLSNKAAALCSLASVCDGLVFVGMMSFQIMHALGLLVPLNHLELGATKEASELVQVAQDR  237

Query  1111  NLLILDP  1131
             N+ IL P
Sbjct  238   NIPILYP  244



>ref|XP_002323474.2| hypothetical protein POPTR_0016s09300g [Populus trichocarpa]
 gb|EEF05235.2| hypothetical protein POPTR_0016s09300g [Populus trichocarpa]
Length=688

 Score =   436 bits (1120),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 247/313 (79%), Gaps = 2/313 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L+E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  376   GWLPVDLGPRSLDELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNDLRQRNCDI  435

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++ G MAC A    S S    +MI+NASV+WEF KGR LPG++ALDRAYPFE+DWK  Y 
Sbjct  436   TVAGNMACQAMVMESKSVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFEIDWKSAYC  495

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  496   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  555

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NAT+TFRSI+SSYPG LVLVSIQCPNPDFN P HRWRMLQ+SL++A+ DLLA  GKVFLQ
Sbjct  556   NATTTFRSIVSSYPGELVLVSIQCPNPDFNNPEHRWRMLQRSLIKAVVDLLALDGKVFLQ  615

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+E VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQHV+DRGDP
Sbjct  616   SDLEAVALRMKELFLKIGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQHVIDRGDP  675

Query  1998  MYRLCLSKSESSE  2036
             MYRL LSKS   E
Sbjct  676   MYRLMLSKSSGIE  688


 Score =   296 bits (759),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 220/345 (64%), Gaps = 12/345 (3%)
 Frame = +1

Query  124   GTMSQILENFQTFLLFRNQC--FLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQ  297
             GT+S  L N  TF  F  +   FL  + +     K   R   R ++    LQ  S     
Sbjct  10    GTLS--LLNKLTFYAFPTKTSEFLHPKSSPYLGNKTAKRWRFRGVRSLS-LQGGSEAADH  66

Query  298   LTALDK--AEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSA  471
             + + +K     C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +
Sbjct  67    VKSSNKFKTNCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQS  126

Query  472   S-----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEM  636
                   T+KYL EA AK+ILV  W    NS+    E VA+ LSSV+Q +V+  K   S +
Sbjct  127   VSSAVFTIKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMLSSVIQHRVVTIKCDYSAV  186

Query  637   MAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGI  816
             +  +E   + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS+ HKILASTVGI
Sbjct  187   LLKMEVLKKADIFLLENLSEYKEEVANNSKFAELLSSGVDIFVNDSFSQSHKILASTVGI  246

Query  817   ACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFV  996
             A FCSACIAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKA+ALHFL S CD LVFV
Sbjct  247   ARFCSACIAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKASALHFLVSRCDGLVFV  306

Query  997   GEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             G M+FQIMHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  307   GMMSFQIMHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  351



>ref|XP_004246636.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325970.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Solanum 
lycopersicum]
 ref|XP_010325971.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Solanum 
lycopersicum]
Length=683

 Score =   434 bits (1117),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TL E+ S LS+CKKI+WIG VKFSSS+  + GASKLAAM+  LSQ NCD+
Sbjct  372   GWKPVDVGPNTLGEMISVLSRCKKILWIGAVKFSSSHQESAGASKLAAMLYNLSQMNCDL  431

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VGK AC+ F G S   TA+ MI+NAS+VWEFLKGR L GLLALDRAYPF+++W  +Y 
Sbjct  432   IVVGKQACETFIGRSRHVTAD-MIENASIVWEFLKGRKLHGLLALDRAYPFKLNWDALYA  490

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLFL  MA+ RKD+NFLGLE N KLV+RCLDHVSQS M N +F+AT
Sbjct  491   NTTLPLVVDVGSGNGLFLTRMAKMRKDWNFLGLERNEKLVRRCLDHVSQSGMTNGYFIAT  550

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFR I+SSYPG LVLVSIQCPNPDFN+  HRWRM+Q+SLVEAIADL+A  GKVFLQ
Sbjct  551   NATSTFRFIVSSYPGDLVLVSIQCPNPDFNRTEHRWRMVQRSLVEAIADLVAPDGKVFLQ  610

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EVA+RMK+EF  YGKGKL V  + +     Q GWL ENPFGIRSDWEQHV++RG P
Sbjct  611   SDVKEVAVRMKKEFMNYGKGKLTVMHDSEDITSQQDGWLNENPFGIRSDWEQHVIERGAP  670

Query  1998  MYR  2006
             MYR
Sbjct  671   MYR  673


 Score =   286 bits (733),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 225/348 (65%), Gaps = 15/348 (4%)
 Frame = +1

Query  130   MSQILENFQTFLL-----FRNQCF----LVCRKNSLASPKHKLRRTCRKIKKF-QRLQFS  279
             MS +LE F  + L     F N C     L   +  L+  K    R C+KI+   Q L   
Sbjct  1     MSYVLEFFLGYTLPRISNFHNGCTKFHDLQQIRLRLSYGKCSAVRKCKKIRFLRQALNLE  60

Query  280   SPVKSQLTAL-DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKL  456
                 + L +  ++AEAC      + P+VQT+  FP+EEL GKVVMVR D TI+  ++KK 
Sbjct  61    LIDHADLLSFPNEAEACDGRGTDILPYVQTVRNFPEEELIGKVVMVRLDLTIVLREQKKQ  120

Query  457   DPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS  627
                +A   ST+KYL +A AK++L+ SWS   +S+ L LE VAE LSS L+LKVIP  LGS
Sbjct  121   QSPAARVISTIKYLHKAGAKLVLLSSWSLRADSRLLKLEYVAELLSSELELKVIPVDLGS  180

Query  628   SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAST  807
                 +  E R +  ILLLEN+SQ K + +NC +FA++LS GVDIFVN++F + HKILAS 
Sbjct  181   GFEQSLREDRHKSSILLLENLSQFKQEQANCSEFARRLSSGVDIFVNETFFQSHKILASN  240

Query  808   VGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDAL  987
             VGI  FC A IAGFHF   +SQL+KII  +K+PY AI+ GGNL  KA AL FLAS CD L
Sbjct  241   VGITGFCYASIAGFHFDEQMSQLKKIIEMNKRPYFAIV-GGNLAGKAVALLFLASRCDGL  299

Query  988   VFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             VF+G  AFQIMHAFGLPVP++LVE+++L+ A  +VEAAK   + I+ P
Sbjct  300   VFIGNAAFQIMHAFGLPVPMELVEQESLEAARVLVEAAKARGVQIILP  347



>ref|XP_006593736.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X3 [Glycine max]
Length=592

 Score =   430 bits (1105),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 249/319 (78%), Gaps = 8/319 (3%)
 Frame = +3

Query  1071  QTSPCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAM  1250
             Q  P H     GW PVDLGP++LEEI S L+ CKKIIWIGPVKF+ S+    GASKL  +
Sbjct  275   QVFPSHE-ISDGWVPVDLGPASLEEICSMLTNCKKIIWIGPVKFTDSSKYTYGASKLTRI  333

Query  1251  VDALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAY  1430
             ++ LSQ +C++++VG MA        SS +  NM++NASV+WEFLKGR LPG++A+DR Y
Sbjct  334   LEQLSQNSCEITVVGTMASKLVRQEKSSLSLINMVENASVLWEFLKGRKLPGVMAVDRGY  393

Query  1431  PFEMDWKCIYNDPDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQ  1607
             PFE++W  IY+DP + LVVDIGSGNGLFL  MARRK D NFLGLEIN KLV RCLD + Q
Sbjct  394   PFEINWNSIYSDPAQSLVVDIGSGNGLFLLEMARRKQDLNFLGLEINEKLVLRCLDSIHQ  453

Query  1608  SVMKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIAD  1787
               +KN +F+ATNATSTF SI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ D
Sbjct  454   FGIKNGYFIATNATSTFHSIVSSYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVD  513

Query  1788  LLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDW  1967
             LLA  GK+FLQSD+E VAIRMKE+F +YGKGKL++E+       Q  WL+ENPFG+RSDW
Sbjct  514   LLAPNGKIFLQSDVEAVAIRMKEQFFRYGKGKLDLEH------GQSEWLEENPFGVRSDW  567

Query  1968  EQHVLDRGDPMYRLCLSKS  2024
             E+HVL+RG PMYR+  +KS
Sbjct  568   ERHVLERGAPMYRMMFTKS  586


 Score =   246 bits (627),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 173/254 (68%), Gaps = 6/254 (2%)
 Frame = +1

Query  382   KEELFGKVVMVRFDSTIL---PVDKKKLDPHSAS-TVKYLCEARAKVILVGSWSSTINSK  549
             +EELFGKV MVRFDS IL     DKK    ++A+ T+KYL EA A VILV  W+  +N+ 
Sbjct  9     REELFGKVAMVRFDSNILLRRECDKKNQSVYNATYTIKYLHEAGANVILVSDWN--MNTP  66

Query  550   PLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKF  729
                +E+VA+++S VLQ++V+P    S   ++      + +ILLLEN+S +K++V+N  +F
Sbjct  67    EFHIESVADFVSEVLQIQVVPLHGSSFNKLSKTNGLEKENILLLENLSNIKEEVANSLEF  126

Query  730   AQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPY  909
             A+ LS GVDIFVNDSFS  HK+LASTVG+  FC  CIAGFHF+  L  L+ +    +KPY
Sbjct  127   ARVLSSGVDIFVNDSFSNSHKVLASTVGVTRFCYVCIAGFHFEERLCLLKNLAEESRKPY  186

Query  910   VAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAI  1089
             VAI+GGGNL DKAA+  FLAS C   VFVG M+FQ+MHA G+ VP  LV+ KA  +A  I
Sbjct  187   VAILGGGNLYDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSVPRNLVDHKAFNEALDI  246

Query  1090  VEAAKVGNLLILDP  1131
             V  A+  N+ IL P
Sbjct  247   VRLARDRNVQILYP  260



>ref|XP_006593735.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Glycine max]
Length=596

 Score =   429 bits (1104),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 249/319 (78%), Gaps = 8/319 (3%)
 Frame = +3

Query  1071  QTSPCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAM  1250
             Q  P H     GW PVDLGP++LEEI S L+ CKKIIWIGPVKF+ S+    GASKL  +
Sbjct  279   QVFPSHE-ISDGWVPVDLGPASLEEICSMLTNCKKIIWIGPVKFTDSSKYTYGASKLTRI  337

Query  1251  VDALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAY  1430
             ++ LSQ +C++++VG MA        SS +  NM++NASV+WEFLKGR LPG++A+DR Y
Sbjct  338   LEQLSQNSCEITVVGTMASKLVRQEKSSLSLINMVENASVLWEFLKGRKLPGVMAVDRGY  397

Query  1431  PFEMDWKCIYNDPDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQ  1607
             PFE++W  IY+DP + LVVDIGSGNGLFL  MARRK D NFLGLEIN KLV RCLD + Q
Sbjct  398   PFEINWNSIYSDPAQSLVVDIGSGNGLFLLEMARRKQDLNFLGLEINEKLVLRCLDSIHQ  457

Query  1608  SVMKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIAD  1787
               +KN +F+ATNATSTF SI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ D
Sbjct  458   FGIKNGYFIATNATSTFHSIVSSYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVD  517

Query  1788  LLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDW  1967
             LLA  GK+FLQSD+E VAIRMKE+F +YGKGKL++E+       Q  WL+ENPFG+RSDW
Sbjct  518   LLAPNGKIFLQSDVEAVAIRMKEQFFRYGKGKLDLEH------GQSEWLEENPFGVRSDW  571

Query  1968  EQHVLDRGDPMYRLCLSKS  2024
             E+HVL+RG PMYR+  +KS
Sbjct  572   ERHVLERGAPMYRMMFTKS  590


 Score =   254 bits (649),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 178/260 (68%), Gaps = 6/260 (2%)
 Frame = +1

Query  364   TLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSAS-TVKYLCEARAKVILVGSWS  531
             T+ +FP+EELFGKV MVRFDS IL     DKK    ++A+ T+KYL EA A VILV  W+
Sbjct  7     TMREFPREELFGKVAMVRFDSNILLRRECDKKNQSVYNATYTIKYLHEAGANVILVSDWN  66

Query  532   STINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDV  711
               +N+    +E+VA+++S VLQ++V+P    S   ++      + +ILLLEN+S +K++V
Sbjct  67    --MNTPEFHIESVADFVSEVLQIQVVPLHGSSFNKLSKTNGLEKENILLLENLSNIKEEV  124

Query  712   SNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIR  891
             +N  +FA+ LS GVDIFVNDSFS  HK+LASTVG+  FC  CIAGFHF+  L  L+ +  
Sbjct  125   ANSLEFARVLSSGVDIFVNDSFSNSHKVLASTVGVTRFCYVCIAGFHFEERLCLLKNLAE  184

Query  892   TDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKAL  1071
               +KPYVAI+GGGNL DKAA+  FLAS C   VFVG M+FQ+MHA G+ VP  LV+ KA 
Sbjct  185   ESRKPYVAILGGGNLYDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSVPRNLVDHKAF  244

Query  1072  KQAHAIVEAAKVGNLLILDP  1131
              +A  IV  A+  N+ IL P
Sbjct  245   NEALDIVRLARDRNVQILYP  264



>ref|XP_011030204.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=687

 Score =   432 bits (1111),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 245/313 (78%), Gaps = 2/313 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  375   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  434

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  435   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  494

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  495   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  554

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NAT+TFRSI+SSYPG LVLVSIQCPNPDFN P HRWRMLQ+SL++A+ DLLA  GK+FLQ
Sbjct  555   NATTTFRSIVSSYPGELVLVSIQCPNPDFNNPEHRWRMLQRSLIKAVVDLLALDGKIFLQ  614

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQHV+DRGDP
Sbjct  615   SDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQHVIDRGDP  674

Query  1998  MYRLCLSKSESSE  2036
             MYRL LSKS   E
Sbjct  675   MYRLMLSKSSGIE  687


 Score =   297 bits (761),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 196/278 (71%), Gaps = 5/278 (2%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS-----T  477
             KA  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +      T
Sbjct  73    KANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQSVSSAVFT  132

Query  478   VKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKR  657
             +KYL EA AK+ILV  W    NS+    E VA+ +SSV+Q +V+  K   S ++  +E  
Sbjct  133   IKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMISSVIQHRVVTIKCDYSAVLLKMEVL  192

Query  658   TELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSAC  837
              + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS+ HKILASTVGIA FCSAC
Sbjct  193   KKADIFLLENLSECKEEVANNSKFAELLSLGVDIFVNDSFSQSHKILASTVGIARFCSAC  252

Query  838   IAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQI  1017
             IAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAALHFL S CD +VFVG M+FQI
Sbjct  253   IAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAALHFLVSRCDGVVFVGMMSFQI  312

Query  1018  MHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             MHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  313   MHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  350



>ref|XP_010050967.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X3 
[Eucalyptus grandis]
Length=683

 Score =   431 bits (1109),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/320 (66%), Positives = 253/320 (79%), Gaps = 3/320 (1%)
 Frame = +3

Query  1080  PCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDA  1259
             P H+   KGW PVD+GP TL+EI + L K KK  WIGPVKF S N +A GAS+LA ++ A
Sbjct  366   PAHA-LSKGWMPVDIGPRTLDEIKTLLKKSKKATWIGPVKFKSCNSSAIGASELACILYA  424

Query  1260  LSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFE  1439
             LSQ +CDV+IVG +A       SSS  A ++I+NASV W+FLKGR LPG++ALDRAYPF+
Sbjct  425   LSQDDCDVTIVGSVATKTITDESSSIPAFSVIENASVWWDFLKGRKLPGVMALDRAYPFD  484

Query  1440  MDWKCIYNDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVM  1616
             +DWK +Y++P +PLVVDIGSGNGLFL GMA++ K  NFLGLEIN KLV+RCL  V Q   
Sbjct  485   IDWKSVYSEPAQPLVVDIGSGNGLFLLGMAKKWKHLNFLGLEINEKLVRRCLIAVHQLDF  544

Query  1617  KNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             KN +F+ATNATSTFRSI+S+YPG ++LVSIQCPNPDFNKP HRWRMLQKSLVEA+ADLL 
Sbjct  545   KNGYFIATNATSTFRSIVSNYPGEVILVSIQCPNPDFNKPEHRWRMLQKSLVEAVADLLI  604

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQH  1976
               GKVFLQSDI+ VA+RMKE+F +YGKGKL +      + + GGWL+ENPFGIRSDWEQH
Sbjct  605   PSGKVFLQSDIKAVAVRMKEQFLRYGKGKLSILQAQDTSTN-GGWLEENPFGIRSDWEQH  663

Query  1977  VLDRGDPMYRLCLSKSESSE  2036
             VLDRG PMYRL L KS + +
Sbjct  664   VLDRGAPMYRLMLLKSNNVQ  683


 Score =   262 bits (669),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 217/349 (62%), Gaps = 17/349 (5%)
 Frame = +1

Query  127   TMSQILENFQTFLLFRNQCFLVCRKNSLASPKH--------KLRRTCRKIKKFQRLQFSS  282
             +MSQ+L      L F N      R      P+            R     + +++  FSS
Sbjct  3     SMSQLLHPLGATLFFSNARDPRSRILKWVPPESWSCVGRNAGFSRLLVAAQSYRQGNFSS  62

Query  283   PVKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK----  450
                ++ +A  KA      E    P++QTLG+FPKEEL  KVVMVRFDS IL  + +    
Sbjct  63    AGPNETSAKHKAFFRERRESDALPYIQTLGKFPKEELGDKVVMVRFDSAILLREDQDHTV  122

Query  451   KLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS-  627
             + + ++  T+KYL EARA+++LV  W+  INSK L L +VAE+LS VL + V+P+   S 
Sbjct  123   QSNLYAHLTIKYLLEARARIVLVSDWNGGINSKFLDLLSVAEHLSVVLGVNVVPSHCLSH  182

Query  628   -SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAS  804
              S +   +EK T   +LLLEN+S+ K +V N  +FA+ LS GVDIFVND FS+ HK+LAS
Sbjct  183   YSPLTEALEKMT---VLLLENLSEFKGEVCNSLEFAETLSSGVDIFVNDLFSQSHKVLAS  239

Query  805   TVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDA  984
             TVG+  FC + +AGFHF+  L +L+  +++DK+P++AIIGG NL +KAAAL  LAS+CD 
Sbjct  240   TVGVTRFCYSSVAGFHFEESLRKLKNALKSDKRPHIAIIGGTNLSNKAAALCSLASVCDG  299

Query  985   LVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             LVFVG M+FQIMHA GL VP+  +E  A K+A  +V+ A+  N+ IL P
Sbjct  300   LVFVGMMSFQIMHALGLLVPLNHLELGATKEASELVQVAQDRNIPILYP  348



>ref|XP_004516663.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004516664.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=668

 Score =   431 bits (1107),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 246/307 (80%), Gaps = 3/307 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L+EI S L+ CKKI+WIGPVKF  S+ +  GA KLA ++D LSQ NC+ 
Sbjct  363   GWVPVDLGPESLDEIDSMLTNCKKIVWIGPVKFGDSSEHTKGAFKLAKILDRLSQGNCET  422

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC+      SS ++ NMI+NASVVWEF KGR LPG++A+DRAYPFE++W  I++
Sbjct  423   TVVGTTACNLVRQEKSSLSSINMIENASVVWEFFKGRKLPGVMAVDRAYPFEINWNNIHS  482

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + LVVDIGSGNGLFL  MA RRK+ NFLGLE+N KLV RCLD + Q  +KN HF+AT
Sbjct  483   DPTQSLVVDIGSGNGLFLLEMAKRRKNLNFLGLEMNEKLVARCLDSIQQFGIKNGHFIAT  542

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+S+YPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ DLLA GGKVFLQ
Sbjct  543   NATSTFRSIVSTYPGVLVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVDLLAFGGKVFLQ  602

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SD++EVAIRMKE+F +YGKGK+ +E+       Q  WL ENPFG+RSDWE+HVL+RG PM
Sbjct  603   SDVKEVAIRMKEQFLRYGKGKIVLEH--GQFNDQSDWLDENPFGVRSDWEKHVLERGAPM  660

Query  2001  YRLCLSK  2021
             YR+  SK
Sbjct  661   YRIMFSK  667


 Score =   256 bits (653),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 181/269 (67%), Gaps = 6/269 (2%)
 Frame = +1

Query  337   ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL----PVDKKKLDPHSASTVKYLCEARA  504
             EL   PH+QTL +FP+EELF KVVMVRFDS +        K + D ++  T+KYL EA A
Sbjct  72    ELNGIPHIQTLREFPREELFQKVVMVRFDSKLFLKQEYNQKNQSDFNAMFTIKYLHEAGA  131

Query  505   KVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLE  684
             K++LV  W +  N+  L  E+VA++LS++LQ++V P +  S   +  I+   + +I LLE
Sbjct  132   KIVLVSDWKT--NTSELHTESVADFLSTILQMQVYPVQGISYNKLPEIKGLEKENIYLLE  189

Query  685   NISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLG  864
             N+  LKD+V+NC KFA+ LS GVDIFVNDSFS  HK+LASTVG+  FC A IAGFHF+  
Sbjct  190   NLYNLKDEVANCLKFARVLSSGVDIFVNDSFSNTHKVLASTVGVTRFCYASIAGFHFEEK  249

Query  865   LSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVP  1044
             L   + +    KKP+VAI+GGGNL +KAA+  FLAS C   VFVG M+FQIM A G+ VP
Sbjct  250   LCLAKNLEEASKKPFVAIMGGGNLAEKAASFRFLASRCQGFVFVGMMSFQIMQAVGVSVP  309

Query  1045  IKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             I+LV+RKA  +A  IV  A+   + I  P
Sbjct  310   IELVDRKAFSEALDIVRLARNNGVQISYP  338



>ref|XP_006352303.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 86A2-like 
[Solanum tuberosum]
Length=478

 Score =   421 bits (1083),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 219/456 (48%), Positives = 307/456 (67%), Gaps = 18/456 (4%)
 Frame = +3

Query  2226  AIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQAR-NSGLDIRYTTIS  2402
              IHL++ LA +GFT+TF+NTE     I +           DIF   + +  LDIRY T+S
Sbjct  33    TIHLAVKLAQKGFTITFINTESTHYQITQKNSNI------DIFYSVQGHQELDIRYMTVS  86

Query  2403  DGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL--AGLEPPPTCLIADSFYAWPSIIA  2576
             DG P+ FDR+ + + FM  +++VFSAHV+E + KL  + L+PP TCLIADSF+ +P  + 
Sbjct  87    DGLPVNFDRSLNHHQFMASLLHVFSAHVEEALVKLEESKLDPPVTCLIADSFFVFPGKLT  146

Query  2577  SKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEAIEPRDLPL-  2753
              KY L+ + F+TEPALVF +  HL LL  +GHFGC D R+D IDYIPGV++I+P+DL L 
Sbjct  147   KKYGLLYLYFWTEPALVFTLYYHLHLLMLHGHFGCIDMREDPIDYIPGVQSIKPKDLILM  206

Query  2754  -YLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFP  2930
              YLQ E +TT   +  ++  F D +  D ++C    EL+ + ISAL+ ++PFYAIGP+FP
Sbjct  207   SYLQ-ETDTTXMCHQIIFNAFNDVRNTDFILC---XELKYEIISALQIEKPFYAIGPIFP  262

Query  2931  QSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNF  3110
               FT+     S+  ESDC  WLD +   +VLY SFGS +H+TK  ++E+  GL LS+V+F
Sbjct  263   PEFTKSCVTTSMWFESDCTHWLDLQQHATVLYVSFGSYSHITKNDLVEIAYGLSLSKVSF  322

Query  3111  IWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILE  3290
             IW+LRP +  +D+ +     F+  +  RGL+VPWC Q  V++H A+GGF+ HCGWNSILE
Sbjct  323   IWLLRPDIVRSDDPNPLPKDFEGEICGRGLVVPWCCQKXVVTHSAIGGFLIHCGWNSILE  382

Query  3291  SIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESS  3470
             +IWC VP+ C+PL+ DQ TNRKLVVD+W IG+NLCN +   I+K E++ K+   M    S
Sbjct  383   AIWCEVPLFCFPLLTDQFTNRKLVVDDWNIGLNLCNKN--PITKVEISEKIHNFMYGNLS  440

Query  3471  IELRKAIKDVRKNLE-NALGSNGSSVKNVDKFVEKI  3575
              E R AIK+V+K LE NAL + GSS +N+D F+ ++
Sbjct  441   DECRNAIKEVKKTLENNALRAEGSSERNLDNFIGRV  476



>ref|XP_006593734.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Glycine max]
Length=674

 Score =   428 bits (1101),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 249/319 (78%), Gaps = 8/319 (3%)
 Frame = +3

Query  1071  QTSPCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAM  1250
             Q  P H     GW PVDLGP++LEEI S L+ CKKIIWIGPVKF+ S+    GASKL  +
Sbjct  357   QVFPSHE-ISDGWVPVDLGPASLEEICSMLTNCKKIIWIGPVKFTDSSKYTYGASKLTRI  415

Query  1251  VDALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAY  1430
             ++ LSQ +C++++VG MA        SS +  NM++NASV+WEFLKGR LPG++A+DR Y
Sbjct  416   LEQLSQNSCEITVVGTMASKLVRQEKSSLSLINMVENASVLWEFLKGRKLPGVMAVDRGY  475

Query  1431  PFEMDWKCIYNDPDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQ  1607
             PFE++W  IY+DP + LVVDIGSGNGLFL  MARRK D NFLGLEIN KLV RCLD + Q
Sbjct  476   PFEINWNSIYSDPAQSLVVDIGSGNGLFLLEMARRKQDLNFLGLEINEKLVLRCLDSIHQ  535

Query  1608  SVMKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIAD  1787
               +KN +F+ATNATSTF SI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ D
Sbjct  536   FGIKNGYFIATNATSTFHSIVSSYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVD  595

Query  1788  LLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDW  1967
             LLA  GK+FLQSD+E VAIRMKE+F +YGKGKL++E+       Q  WL+ENPFG+RSDW
Sbjct  596   LLAPNGKIFLQSDVEAVAIRMKEQFFRYGKGKLDLEH------GQSEWLEENPFGVRSDW  649

Query  1968  EQHVLDRGDPMYRLCLSKS  2024
             E+HVL+RG PMYR+  +KS
Sbjct  650   ERHVLERGAPMYRMMFTKS  668


 Score =   264 bits (674),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 184/270 (68%), Gaps = 6/270 (2%)
 Frame = +1

Query  334   SELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSAS-TVKYLCEAR  501
              EL   PH++TL +FP+EELFGKV MVRFDS IL     DKK    ++A+ T+KYL EA 
Sbjct  75    GELNGIPHIRTLREFPREELFGKVAMVRFDSNILLRRECDKKNQSVYNATYTIKYLHEAG  134

Query  502   AKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLL  681
             A VILV  W+  +N+    +E+VA+++S VLQ++V+P    S   ++      + +ILLL
Sbjct  135   ANVILVSDWN--MNTPEFHIESVADFVSEVLQIQVVPLHGSSFNKLSKTNGLEKENILLL  192

Query  682   ENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQL  861
             EN+S +K++V+N  +FA+ LS GVDIFVNDSFS  HK+LASTVG+  FC  CIAGFHF+ 
Sbjct  193   ENLSNIKEEVANSLEFARVLSSGVDIFVNDSFSNSHKVLASTVGVTRFCYVCIAGFHFEE  252

Query  862   GLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPV  1041
              L  L+ +    +KPYVAI+GGGNL DKAA+  FLAS C   VFVG M+FQ+MHA G+ V
Sbjct  253   RLCLLKNLAEESRKPYVAILGGGNLYDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSV  312

Query  1042  PIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             P  LV+ KA  +A  IV  A+  N+ IL P
Sbjct  313   PRNLVDHKAFNEALDIVRLARDRNVQILYP  342



>gb|KHN47674.1| Phosphoglycerate kinase [Glycine soja]
Length=674

 Score =   428 bits (1101),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 249/319 (78%), Gaps = 8/319 (3%)
 Frame = +3

Query  1071  QTSPCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAM  1250
             Q  P H     GW PVDLGP++LEEI S L+ CKKIIWIGPVKF+ S+    GASKL  +
Sbjct  357   QVFPSHE-ISDGWVPVDLGPASLEEICSMLTNCKKIIWIGPVKFTDSSKYTYGASKLTRI  415

Query  1251  VDALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAY  1430
             ++ LSQ +C++++VG MA        SS +  NM++NASV+WEFLKGR LPG++A+DR Y
Sbjct  416   LEQLSQNSCEITVVGTMASKLVRQEKSSLSLINMVENASVLWEFLKGRKLPGVMAVDRGY  475

Query  1431  PFEMDWKCIYNDPDRPLVVDIGSGNGLFLFGMARRK-DFNFLGLEINRKLVKRCLDHVSQ  1607
             PFE++W  IY+DP + LVVDIGSGNGLFL  MARRK D NFLGLEIN KLV RCLD + Q
Sbjct  476   PFEINWNSIYSDPAQSLVVDIGSGNGLFLLEMARRKQDLNFLGLEINEKLVLRCLDSIHQ  535

Query  1608  SVMKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIAD  1787
               +KN +F+ATNATSTF SI+SSYPG LVLVSIQCPNPDFNKP HRWRMLQ+SL+EA+ D
Sbjct  536   FGIKNGYFIATNATSTFHSIVSSYPGELVLVSIQCPNPDFNKPEHRWRMLQRSLIEAVVD  595

Query  1788  LLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDW  1967
             LLA  GK+FLQSD+E VAIRMKE+F +YGKGKL++E+       Q  WL+ENPFG+RSDW
Sbjct  596   LLAPNGKIFLQSDVEAVAIRMKEQFFRYGKGKLDLEHW------QSEWLEENPFGVRSDW  649

Query  1968  EQHVLDRGDPMYRLCLSKS  2024
             E+HVL+RG PMYR+  +KS
Sbjct  650   ERHVLERGAPMYRMMFTKS  668


 Score =   266 bits (679),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 185/270 (69%), Gaps = 6/270 (2%)
 Frame = +1

Query  334   SELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL---PVDKKKLDPHSAS-TVKYLCEAR  501
              EL   PH++TL +FP+EELFGKVVMVRFDS IL     DKK    ++A+ T+KYL EA 
Sbjct  75    GELNGIPHIRTLREFPREELFGKVVMVRFDSNILLRRECDKKNQSVYNATYTIKYLHEAG  134

Query  502   AKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLL  681
             A VILV  W+  +N+    +E+VA+++S VLQ++V+P    S   ++      + +ILLL
Sbjct  135   ANVILVSDWN--MNTPEFHIESVADFVSEVLQIQVVPLHGSSFNKLSKTNGLEKENILLL  192

Query  682   ENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQL  861
             EN+S +K++V+N  +FA+ LS GVDIFVNDSFS  HK+LASTVG+  FC  CIAGFHF+ 
Sbjct  193   ENLSNIKEEVANSLEFARVLSSGVDIFVNDSFSNSHKVLASTVGVTRFCYVCIAGFHFEE  252

Query  862   GLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPV  1041
              L  L+ +    +KPYVAI+GGGNL DKAA+  FLAS C   VFVG M+FQ+MHA G+ V
Sbjct  253   RLCLLKNLAEESRKPYVAILGGGNLYDKAASFQFLASRCQGFVFVGMMSFQVMHALGVSV  312

Query  1042  PIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             P  LV+ KA  +A  IV  A+  N+ IL P
Sbjct  313   PRNLVDHKAFNEALDIVRLARDRNVQILYP  342



>ref|XP_011030211.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X7 
[Populus euphratica]
 ref|XP_011030212.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X7 
[Populus euphratica]
Length=614

 Score =   425 bits (1093),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  294   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  353

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  354   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  413

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  414   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  473

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  474   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  533

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  534   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  593

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  594   HVIDRGDPMYRLMLSKSSGIE  614


 Score =   287 bits (734),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/266 (58%), Positives = 190/266 (71%), Gaps = 5/266 (2%)
 Frame = +1

Query  349   FPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS-----TVKYLCEARAKVI  513
             FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +      T+KYL EA AK+I
Sbjct  4     FPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQSVSSAVFTIKYLHEAGAKII  63

Query  514   LVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENIS  693
             LV  W    NS+    E VA+ +SSV+Q +V+  K   S ++  +E   + DI LLEN+S
Sbjct  64    LVSDWRKKTNSQLHDAETVADMISSVIQHRVVTIKCDYSAVLLKMEVLKKADIFLLENLS  123

Query  694   QLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQ  873
             + K++V+N  KFA+ LS GVDIFVNDSFS+ HKILASTVGIA FCSACIAGFHF+  L Q
Sbjct  124   ECKEEVANNSKFAELLSLGVDIFVNDSFSQSHKILASTVGIARFCSACIAGFHFEESLCQ  183

Query  874   LEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKL  1053
             L+K+ RT+K+PYVAIIGGGNL DKAAALHFL S CD +VFVG M+FQIMHA GL VP  L
Sbjct  184   LKKVARTNKRPYVAIIGGGNLYDKAAALHFLVSRCDGVVFVGMMSFQIMHALGLSVPSYL  243

Query  1054  VERKALKQAHAIVEAAKVGNLLILDP  1131
             VE  A K A  I++ A   N+ IL P
Sbjct  244   VEPGAYKAALDIIQIAHDRNIPILHP  269



>ref|XP_010050961.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Eucalyptus grandis]
Length=684

 Score =   427 bits (1097),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 253/321 (79%), Gaps = 4/321 (1%)
 Frame = +3

Query  1080  PCHS*GCKGWKPVDLGPSTLEEISSFLSKCK-KIIWIGPVKFSSSNLNAGGASKLAAMVD  1256
             P H+   KGW PVD+GP TL+EI + L K K K  WIGPVKF S N +A GAS+LA ++ 
Sbjct  366   PAHA-LSKGWMPVDIGPRTLDEIKTLLKKSKQKATWIGPVKFKSCNSSAIGASELACILY  424

Query  1257  ALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPF  1436
             ALSQ +CDV+IVG +A       SSS  A ++I+NASV W+FLKGR LPG++ALDRAYPF
Sbjct  425   ALSQDDCDVTIVGSVATKTITDESSSIPAFSVIENASVWWDFLKGRKLPGVMALDRAYPF  484

Query  1437  EMDWKCIYNDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSV  1613
             ++DWK +Y++P +PLVVDIGSGNGLFL GMA++ K  NFLGLEIN KLV+RCL  V Q  
Sbjct  485   DIDWKSVYSEPAQPLVVDIGSGNGLFLLGMAKKWKHLNFLGLEINEKLVRRCLIAVHQLD  544

Query  1614  MKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLL  1793
              KN +F+ATNATSTFRSI+S+YPG ++LVSIQCPNPDFNKP HRWRMLQKSLVEA+ADLL
Sbjct  545   FKNGYFIATNATSTFRSIVSNYPGEVILVSIQCPNPDFNKPEHRWRMLQKSLVEAVADLL  604

Query  1794  ASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQ  1973
                GKVFLQSDI+ VA+RMKE+F +YGKGKL +      + + GGWL+ENPFGIRSDWEQ
Sbjct  605   IPSGKVFLQSDIKAVAVRMKEQFLRYGKGKLSILQAQDTSTN-GGWLEENPFGIRSDWEQ  663

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HVLDRG PMYRL L KS + +
Sbjct  664   HVLDRGAPMYRLMLLKSNNVQ  684


 Score =   262 bits (669),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 217/349 (62%), Gaps = 17/349 (5%)
 Frame = +1

Query  127   TMSQILENFQTFLLFRNQCFLVCRKNSLASPKH--------KLRRTCRKIKKFQRLQFSS  282
             +MSQ+L      L F N      R      P+            R     + +++  FSS
Sbjct  3     SMSQLLHPLGATLFFSNARDPRSRILKWVPPESWSCVGRNAGFSRLLVAAQSYRQGNFSS  62

Query  283   PVKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK----  450
                ++ +A  KA      E    P++QTLG+FPKEEL  KVVMVRFDS IL  + +    
Sbjct  63    AGPNETSAKHKAFFRERRESDALPYIQTLGKFPKEELGDKVVMVRFDSAILLREDQDHTV  122

Query  451   KLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS-  627
             + + ++  T+KYL EARA+++LV  W+  INSK L L +VAE+LS VL + V+P+   S 
Sbjct  123   QSNLYAHLTIKYLLEARARIVLVSDWNGGINSKFLDLLSVAEHLSVVLGVNVVPSHCLSH  182

Query  628   -SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAS  804
              S +   +EK T   +LLLEN+S+ K +V N  +FA+ LS GVDIFVND FS+ HK+LAS
Sbjct  183   YSPLTEALEKMT---VLLLENLSEFKGEVCNSLEFAETLSSGVDIFVNDLFSQSHKVLAS  239

Query  805   TVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDA  984
             TVG+  FC + +AGFHF+  L +L+  +++DK+P++AIIGG NL +KAAAL  LAS+CD 
Sbjct  240   TVGVTRFCYSSVAGFHFEESLRKLKNALKSDKRPHIAIIGGTNLSNKAAALCSLASVCDG  299

Query  985   LVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             LVFVG M+FQIMHA GL VP+  +E  A K+A  +V+ A+  N+ IL P
Sbjct  300   LVFVGMMSFQIMHALGLLVPLNHLELGATKEASELVQVAQDRNIPILYP  348



>ref|XP_011030209.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X5 
[Populus euphratica]
Length=642

 Score =   425 bits (1093),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  322   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  381

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  382   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  441

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  442   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  501

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  502   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  561

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  562   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  621

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  622   HVIDRGDPMYRLMLSKSSGIE  642


 Score =   297 bits (760),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 196/278 (71%), Gaps = 5/278 (2%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS-----T  477
             KA  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +      T
Sbjct  20    KANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQSVSSAVFT  79

Query  478   VKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKR  657
             +KYL EA AK+ILV  W    NS+    E VA+ +SSV+Q +V+  K   S ++  +E  
Sbjct  80    IKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMISSVIQHRVVTIKCDYSAVLLKMEVL  139

Query  658   TELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSAC  837
              + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS+ HKILASTVGIA FCSAC
Sbjct  140   KKADIFLLENLSECKEEVANNSKFAELLSLGVDIFVNDSFSQSHKILASTVGIARFCSAC  199

Query  838   IAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQI  1017
             IAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAALHFL S CD +VFVG M+FQI
Sbjct  200   IAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAALHFLVSRCDGVVFVGMMSFQI  259

Query  1018  MHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             MHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  260   MHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  297



>ref|XP_011030207.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X4 
[Populus euphratica]
 ref|XP_011030208.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X4 
[Populus euphratica]
Length=643

 Score =   425 bits (1093),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  323   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  382

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  383   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  442

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  443   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  502

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  503   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  562

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  563   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  622

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  623   HVIDRGDPMYRLMLSKSSGIE  643


 Score =   296 bits (759),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 203/297 (68%), Gaps = 12/297 (4%)
 Frame = +1

Query  256   KFQRLQFSSPVKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL  435
             ++Q +  + P +       +A  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L
Sbjct  9     RYQEIWLTFPYR-------QANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNL  61

Query  436   PVDKKKLDPHSAS-----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQL  600
               ++++     +      T+KYL EA AK+ILV  W    NS+    E VA+ +SSV+Q 
Sbjct  62    LREEEQDQSSQSVSSAVFTIKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMISSVIQH  121

Query  601   KVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFS  780
             +V+  K   S ++  +E   + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS
Sbjct  122   RVVTIKCDYSAVLLKMEVLKKADIFLLENLSECKEEVANNSKFAELLSLGVDIFVNDSFS  181

Query  781   EVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALH  960
             + HKILASTVGIA FCSACIAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAALH
Sbjct  182   QSHKILASTVGIARFCSACIAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAALH  241

Query  961   FLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             FL S CD +VFVG M+FQIMHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  242   FLVSRCDGVVFVGMMSFQIMHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  298



>ref|XP_011030210.1| PREDICTED: phosphoglycerate kinase-like isoform X6 [Populus euphratica]
Length=617

 Score =   424 bits (1089),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  297   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  356

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  357   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  416

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  417   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  476

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  477   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  536

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  537   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  596

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  597   HVIDRGDPMYRLMLSKSSGIE  617


 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  778   SEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAAL  957
             S++H      VGIA FCSACIAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAAL
Sbjct  155   SQLHDAETVAVGIARFCSACIAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAAL  214

Query  958   HFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             HFL S CD +VFVG M+FQIMHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  215   HFLVSRCDGVVFVGMMSFQIMHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  272


 Score = 82.8 bits (203),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 5/92 (5%)
 Frame = +1

Query  313  KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS-----T  477
            KA  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +      T
Sbjct  73   KANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQSVSSAVFT  132

Query  478  VKYLCEARAKVILVGSWSSTINSKPLALEAVA  573
            +KYL EA AK+ILV  W    NS+    E VA
Sbjct  133  IKYLHEAGAKIILVSDWRKKTNSQLHDAETVA  164



>ref|XP_010050957.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Eucalyptus grandis]
Length=687

 Score =   426 bits (1095),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 210/324 (65%), Positives = 253/324 (78%), Gaps = 7/324 (2%)
 Frame = +3

Query  1080  PCHS*GCKGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDA  1259
             P H+   KGW PVD+GP TL+EI + L K KK  WIGPVKF S N +A GAS+LA ++ A
Sbjct  366   PAHA-LSKGWMPVDIGPRTLDEIKTLLKKSKKATWIGPVKFKSCNSSAIGASELACILYA  424

Query  1260  LSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFE  1439
             LSQ +CDV+IVG +A       SSS  A ++I+NASV W+FLKGR LPG++ALDRAYPF+
Sbjct  425   LSQDDCDVTIVGSVATKTITDESSSIPAFSVIENASVWWDFLKGRKLPGVMALDRAYPFD  484

Query  1440  MDWKCIYNDPDRPLVVDIGS----GNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVS  1604
             +DWK +Y++P +PLVVDIGS    GNGLFL GMA++ K  NFLGLEIN KLV+RCL  V 
Sbjct  485   IDWKSVYSEPAQPLVVDIGSASFSGNGLFLLGMAKKWKHLNFLGLEINEKLVRRCLIAVH  544

Query  1605  QSVMKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIA  1784
             Q   KN +F+ATNATSTFRSI+S+YPG ++LVSIQCPNPDFNKP HRWRMLQKSLVEA+A
Sbjct  545   QLDFKNGYFIATNATSTFRSIVSNYPGEVILVSIQCPNPDFNKPEHRWRMLQKSLVEAVA  604

Query  1785  DLLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSD  1964
             DLL   GKVFLQSDI+ VA+RMKE+F +YGKGKL +      + + GGWL+ENPFGIRSD
Sbjct  605   DLLIPSGKVFLQSDIKAVAVRMKEQFLRYGKGKLSILQAQDTSTN-GGWLEENPFGIRSD  663

Query  1965  WEQHVLDRGDPMYRLCLSKSESSE  2036
             WEQHVLDRG PMYRL L KS + +
Sbjct  664   WEQHVLDRGAPMYRLMLLKSNNVQ  687


 Score =   262 bits (670),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 217/349 (62%), Gaps = 17/349 (5%)
 Frame = +1

Query  127   TMSQILENFQTFLLFRNQCFLVCRKNSLASPKH--------KLRRTCRKIKKFQRLQFSS  282
             +MSQ+L      L F N      R      P+            R     + +++  FSS
Sbjct  3     SMSQLLHPLGATLFFSNARDPRSRILKWVPPESWSCVGRNAGFSRLLVAAQSYRQGNFSS  62

Query  283   PVKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK----  450
                ++ +A  KA      E    P++QTLG+FPKEEL  KVVMVRFDS IL  + +    
Sbjct  63    AGPNETSAKHKAFFRERRESDALPYIQTLGKFPKEELGDKVVMVRFDSAILLREDQDHTV  122

Query  451   KLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGS-  627
             + + ++  T+KYL EARA+++LV  W+  INSK L L +VAE+LS VL + V+P+   S 
Sbjct  123   QSNLYAHLTIKYLLEARARIVLVSDWNGGINSKFLDLLSVAEHLSVVLGVNVVPSHCLSH  182

Query  628   -SEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILAS  804
              S +   +EK T   +LLLEN+S+ K +V N  +FA+ LS GVDIFVND FS+ HK+LAS
Sbjct  183   YSPLTEALEKMT---VLLLENLSEFKGEVCNSLEFAETLSSGVDIFVNDLFSQSHKVLAS  239

Query  805   TVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDA  984
             TVG+  FC + +AGFHF+  L +L+  +++DK+P++AIIGG NL +KAAAL  LAS+CD 
Sbjct  240   TVGVTRFCYSSVAGFHFEESLRKLKNALKSDKRPHIAIIGGTNLSNKAAALCSLASVCDG  299

Query  985   LVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             LVFVG M+FQIMHA GL VP+  +E  A K+A  +V+ A+  N+ IL P
Sbjct  300   LVFVGMMSFQIMHALGLLVPLNHLELGATKEASELVQVAQDRNIPILYP  348



>ref|XP_011030206.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X3 
[Populus euphratica]
Length=665

 Score =   424 bits (1091),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  345   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  404

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  405   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  464

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  465   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  524

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  525   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  584

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  585   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  644

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  645   HVIDRGDPMYRLMLSKSSGIE  665


 Score =   296 bits (759),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 203/297 (68%), Gaps = 12/297 (4%)
 Frame = +1

Query  256   KFQRLQFSSPVKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTIL  435
             ++Q +  + P +       +A  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L
Sbjct  31    RYQEIWLTFPYR-------QANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNL  83

Query  436   PVDKKKLDPHSAS-----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQL  600
               ++++     +      T+KYL EA AK+ILV  W    NS+    E VA+ +SSV+Q 
Sbjct  84    LREEEQDQSSQSVSSAVFTIKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMISSVIQH  143

Query  601   KVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFS  780
             +V+  K   S ++  +E   + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS
Sbjct  144   RVVTIKCDYSAVLLKMEVLKKADIFLLENLSECKEEVANNSKFAELLSLGVDIFVNDSFS  203

Query  781   EVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALH  960
             + HKILASTVGIA FCSACIAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAALH
Sbjct  204   QSHKILASTVGIARFCSACIAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAALH  263

Query  961   FLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             FL S CD +VFVG M+FQIMHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  264   FLVSRCDGVVFVGMMSFQIMHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  320



>ref|XP_011030203.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=695

 Score =   425 bits (1093),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 245/321 (76%), Gaps = 10/321 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVDLGP +L E++S L KCKKI+WIGPVKF  S   A GASKLA  ++ L QRNCD+
Sbjct  375   GWLPVDLGPRSLNELNSLLVKCKKILWIGPVKFKFSGQCADGASKLAQALNELRQRNCDI  434

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG MAC A    S      +MI+NASV+WEF KGR LPG++ALDRAYPF +DWK  Y 
Sbjct  435   TVVGNMACQAMVMESKCVLVNDMIENASVLWEFFKGRKLPGVMALDRAYPFGIDWKSAYC  494

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +P +PLVVDIGSG+GLFL GMA RRKD NFLGLEIN KLV+RC+D V Q  ++N +F+ T
Sbjct  495   NPAQPLVVDIGSGSGLFLLGMARRRKDLNFLGLEINSKLVRRCMDSVHQYGIQNGYFIVT  554

Query  1641  NATSTFRSIISSYPGRLVLVSI--------QCPNPDFNKPGHRWRMLQKSLVEAIADLLA  1796
             NAT+TFRSI+SSYPG LVLVSI        QCPNPDFN P HRWRMLQ+SL++A+ DLLA
Sbjct  555   NATTTFRSIVSSYPGELVLVSIQDNLYHLVQCPNPDFNNPEHRWRMLQRSLIKAVVDLLA  614

Query  1797  SGGKVFLQSDIEEVAIRMKEEFSKYGKGKLEVENLD-KAAIHQGGWLKENPFGIRSDWEQ  1973
               GK+FLQSDIE VA+RMKE F K GKGKL + N    A ++ G WL+ENPFG+ SDWEQ
Sbjct  615   LDGKIFLQSDIEAVALRMKELFLKNGKGKLNLWNDQYHARMNLGEWLEENPFGVMSDWEQ  674

Query  1974  HVLDRGDPMYRLCLSKSESSE  2036
             HV+DRGDPMYRL LSKS   E
Sbjct  675   HVIDRGDPMYRLMLSKSSGIE  695


 Score =   297 bits (760),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 196/278 (71%), Gaps = 5/278 (2%)
 Frame = +1

Query  313   KAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS-----T  477
             KA  C E E+  FPHVQTL +FPKEEL GKVVMVRFDST L  ++++     +      T
Sbjct  73    KANCCDEGEMEPFPHVQTLRKFPKEELVGKVVMVRFDSTNLLREEEQDQSSQSVSSAVFT  132

Query  478   VKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKR  657
             +KYL EA AK+ILV  W    NS+    E VA+ +SSV+Q +V+  K   S ++  +E  
Sbjct  133   IKYLHEAGAKIILVSDWRKKTNSQLHDAETVADMISSVIQHRVVTIKCDYSAVLLKMEVL  192

Query  658   TELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSAC  837
              + DI LLEN+S+ K++V+N  KFA+ LS GVDIFVNDSFS+ HKILASTVGIA FCSAC
Sbjct  193   KKADIFLLENLSECKEEVANNSKFAELLSLGVDIFVNDSFSQSHKILASTVGIARFCSAC  252

Query  838   IAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQI  1017
             IAGFHF+  L QL+K+ RT+K+PYVAIIGGGNL DKAAALHFL S CD +VFVG M+FQI
Sbjct  253   IAGFHFEESLCQLKKVARTNKRPYVAIIGGGNLYDKAAALHFLVSRCDGVVFVGMMSFQI  312

Query  1018  MHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             MHA GL VP  LVE  A K A  I++ A   N+ IL P
Sbjct  313   MHALGLSVPSYLVEPGAYKAALDIIQIAHDRNIPILHP  350



>ref|XP_006493017.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X7 [Citrus sinensis]
Length=684

 Score =   423 bits (1087),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/308 (64%), Positives = 247/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW+PVD+GP ++EEI+S ++KCKK+IW+GPVKF  S+  + GASKL  M+  +SQ  C++
Sbjct  372   GWEPVDIGPRSVEEITSTITKCKKVIWVGPVKFRFSSQYSYGASKLTGMLCKVSQGTCNI  431

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF++DW   Y+
Sbjct  432   TVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPFDIDWSAAYH  491

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE+N KLV  C D +  S + N +F+AT
Sbjct  492   DPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLEVNGKLVTHCRDSLQLSGITNGYFIAT  551

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL   GKVFLQ
Sbjct  552   NATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLLVHDGKVFLQ  611

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWEQHV+DRG P
Sbjct  612   SDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWEQHVIDRGAP  671

Query  1998  MYRLCLSK  2021
             MYRL LSK
Sbjct  672   MYRLMLSK  679


 Score =   289 bits (740),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAR  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>gb|EYU34483.1| hypothetical protein MIMGU_mgv1a005954mg [Erythranthe guttata]
Length=463

 Score =   415 bits (1066),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 221/486 (45%), Positives = 300/486 (62%), Gaps = 40/486 (8%)
 Frame = +3

Query  2148  FRKMVENNQKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGT  2327
                M E+  K HAI++ +PYQGHINP   L++ LAS GF+VTFV+ E +   +       
Sbjct  14    LESMAESKYKPHAIMISVPYQGHINPFASLALKLASSGFSVTFVHYEFLHQKL-------  66

Query  2328  TTAPTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL  2507
                P  D+F++AR SGLDIRYTTI DGFP  FDR          +    S  +DE V K 
Sbjct  67    ---PKLDLFSEARESGLDIRYTTIKDGFPSEFDRGLHLEEHWESISLDRSGTIDEFVGKT  123

Query  2508  AGLEPPPT-CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCK  2684
                +P     LIAD+  AWP+IIA+KYNL+NVSF+T+PALVF+++ HLDLL+E GHF  K
Sbjct  124   IQSDPDSVHFLIADTITAWPAIIANKYNLINVSFWTQPALVFSMNYHLDLLREKGHFPWK  183

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQEL  2864
                 + IDYIPGVE++  RDL  YL +   + S +       FE  KKAD ++ NT    
Sbjct  184   GNTAEEIDYIPGVESLSTRDLIHYLTK-TESESVITRISSLAFERVKKADFILHNTN---  239

Query  2865  EPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
                                  P+S     A +S L ESDC  WL+SKP GSVLY SFG+L
Sbjct  240   --------------------LPKSI----ANKSFLSESDCTSWLESKPTGSVLYVSFGTL  275

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQP  3224
               + K+ I EL  GL+LSEVNFIWV+RPG+    + +    GF++ ++D+GLI+ WC Q 
Sbjct  276   VQINKQVIEELAYGLLLSEVNFIWVVRPGIVGFGDGNILPIGFEDKIKDKGLIIQWCDQV  335

Query  3225  AVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDD  3404
              V+S+PAVGGF+TH GWNS +ES+W  VPMI YP+  +QPTNRKLVVD+WKIGIN C D 
Sbjct  336   KVLSNPAVGGFLTHNGWNSTVESMWFGVPMISYPIDYEQPTNRKLVVDDWKIGINFC-DY  394

Query  3405  DKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
               S+ +++V  K+K LM   SS  LR+    V+  L+ A+  +GSS +N  +F+E ++AK
Sbjct  395   GTSVDRKQVVEKIKHLMNGNSSTSLRQEADKVKGILQKAVEIDGSSERNFAQFIEDLRAK  454

Query  3585  FNQSSV  3602
              +++++
Sbjct  455   IHETAL  460



>ref|XP_006428397.1| hypothetical protein CICLE_v10011216mg [Citrus clementina]
 ref|XP_006428398.1| hypothetical protein CICLE_v10011216mg [Citrus clementina]
 gb|ESR41637.1| hypothetical protein CICLE_v10011216mg [Citrus clementina]
 gb|ESR41638.1| hypothetical protein CICLE_v10011216mg [Citrus clementina]
Length=684

 Score =   422 bits (1086),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/308 (64%), Positives = 247/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW+PVD+GP ++EEI+S ++KCKK+IW+GPVKF  S+  + GASKL  M+  +SQ  C++
Sbjct  372   GWEPVDIGPRSVEEITSTITKCKKVIWVGPVKFRFSSQYSYGASKLTGMLCKVSQGTCNI  431

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF++DW   Y+
Sbjct  432   TVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPFDIDWSAAYH  491

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE+N KLV  C D +  S + N +F+AT
Sbjct  492   DPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLEVNGKLVTHCRDSLQLSGITNGYFIAT  551

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL   GKVFLQ
Sbjct  552   NATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLLVHDGKVFLQ  611

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWEQHV+DRG P
Sbjct  612   SDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWEQHVIDRGAP  671

Query  1998  MYRLCLSK  2021
             MYRL LSK
Sbjct  672   MYRLMLSK  679


 Score =   289 bits (740),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAP  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>ref|XP_011094620.1| PREDICTED: uncharacterized protein LOC105174272 isoform X4 [Sesamum 
indicum]
Length=480

 Score =   412 bits (1060),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 246/312 (79%), Gaps = 4/312 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             +GW+PVD+GP +L+E+    SKCKKIIWIGP +FSSS  + GG  +LA  +  LS  +CD
Sbjct  169   EGWQPVDIGPRSLQEMIYLASKCKKIIWIGPSRFSSSKQDKGGTLELAETLGNLS--SCD  226

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             ++ VGK+  +     S S + +N ++ A+VVWE LKGR LPGLLALDRAYP+++DW   Y
Sbjct  227   ITFVGKIEFEELLRKSKSFSNDNFVKTAAVVWEVLKGRKLPGLLALDRAYPYQVDWSVTY  286

Query  1461  NDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              DP RPLVVD+GSGNGLFL GMARR KD NFLGLEIN KLV RCL+ + +  + NVHF+A
Sbjct  287   GDPTRPLVVDVGSGNGLFLVGMARRRKDMNFLGLEINAKLVDRCLEDIHRLDLHNVHFIA  346

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRMLQ  LVEAIAD+L  GG+VFL
Sbjct  347   TNATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEYRWRMLQSPLVEAIADMLKFGGQVFL  406

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSDIE VA+RMK EF +YGKGKL + E+ +  A+++ GWL++NPFG+ SDWE+HVLDRGD
Sbjct  407   QSDIEAVALRMKNEFLEYGKGKLVLMEHSEDVAVNELGWLEKNPFGVPSDWERHVLDRGD  466

Query  1995  PMYRLCLSKSES  2030
              MYRL LSK ++
Sbjct  467   CMYRLLLSKVKT  478


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  919   IGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEA  1098
             IGGGNL DK AALH L S CD L+FVG MAFQIMHA G+PVP+K VE  ALK+A +IVE 
Sbjct  75    IGGGNLADKVAALHSLTSTCDGLIFVGSMAFQIMHALGVPVPMKFVELGALKEAVSIVET  134

Query  1099  AKVGNLLILDP  1131
             AK+ N+ ++ P
Sbjct  135   AKLRNIPLVVP  145



>ref|XP_010684063.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X6 
[Beta vulgaris subsp. vulgaris]
Length=501

 Score =   413 bits (1062),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  193   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  252

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  253   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  312

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  313   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  372

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  373   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  432

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  433   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  492

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  493   MYRLMLCK  500


 Score =   132 bits (333),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +1

Query  772   SFSEV---HKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLID  942
             SFS++   HKILASTVG+  FC AC+AGF+F+  L +L+ I+     P V ++GGGNL D
Sbjct  49    SFSKIYLTHKILASTVGVTQFCYACVAGFYFEECLIKLKTILECTHSPSVGVVGGGNLRD  108

Query  943   KAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLI  1122
             KAAAL  LAS CD LVFVG MA QIMHA G+PVP+ LVE++  K+A  IV+ A+  ++ I
Sbjct  109   KAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYLVEKEGAKEALEIVKYAESRSIPI  168

Query  1123  LDPA  1134
             L P+
Sbjct  169   LLPS  172



>ref|XP_010684062.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X5 
[Beta vulgaris subsp. vulgaris]
Length=599

 Score =   416 bits (1068),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  291   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  350

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  351   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  410

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  411   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  470

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  471   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  530

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  531   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  590

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  591   MYRLMLCK  598


 Score =   259 bits (662),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 187/267 (70%), Gaps = 8/267 (3%)
 Frame = +1

Query  352   PHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLD------PHSASTVKYLCEARAKVI  513
             P +QTL + P EEL  K+VMVRFDS+IL    +KLD       ++  T+KY+ EA AK+I
Sbjct  6     PSIQTLRRLPPEELSAKIVMVRFDSSILFY--QKLDQSISITSNAFFTIKYVFEAGAKII  63

Query  514   LVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENIS  693
             L+ SW+   N+K L+ EAVAE LSSVLQLKV+P K   +     +E   E D++LLEN+S
Sbjct  64    LISSWNVKCNAKILSEEAVAELLSSVLQLKVVPGKCNFAHQQPKVELFEEADVILLENLS  123

Query  694   QLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQ  873
             + K +++N  +FA++LS GVDIFVNDSFS  HKILASTVG+  FC AC+AGF+F+  L +
Sbjct  124   KYKQELANDSEFARKLSSGVDIFVNDSFSTAHKILASTVGVTQFCYACVAGFYFEECLIK  183

Query  874   LEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKL  1053
             L+ I+     P V ++GGGNL DKAAAL  LAS CD LVFVG MA QIMHA G+PVP+ L
Sbjct  184   LKTILECTHSPSVGVVGGGNLRDKAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYL  243

Query  1054  VERKALKQAHAIVEAAKVGNLLILDPA  1134
             VE++  K+A  IV+ A+  ++ IL P+
Sbjct  244   VEKEGAKEALEIVKYAESRSIPILLPS  270



>gb|EMS64309.1| UDP-glycosyltransferase 86A1 [Triticum urartu]
Length=374

 Score =   407 bits (1045),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/378 (49%), Positives = 270/378 (71%), Gaps = 4/378 (1%)
 Frame = +3

Query  2451  MMGMMYVFSAHVDELVKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVF  2630
             M G+++V  AHV+EL++++  L+P  TCL+AD+F+ WP+ +A    +  VSF+TEPAL+F
Sbjct  1     MEGVLHVLPAHVEELLRRVV-LDPASTCLVADTFFVWPATLARALGVPYVSFWTEPALIF  59

Query  2631  AIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKG  2810
             A+  H+DLL E+GHF CK+ RKD+I YIPGV AIEP +L  YLQ E +TTS V+  ++K 
Sbjct  60    ALYYHMDLLAEHGHFKCKEPRKDTITYIPGVPAIEPHELMSYLQ-ETDTTSVVHRIIFKA  118

Query  2811  FEDAKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCK  2990
             FE+A+ AD V+CNTV+ELEP TI+AL  ++PFYA+GP+FP  F   T   S+  ESDC  
Sbjct  119   FEEARGADYVLCNTVEELEPSTIAALRAEKPFYAVGPIFPAGFARSTVATSMWAESDCSH  178

Query  2991  WLDSKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDG  3170
             WLD +PPGSVLY SFGS AH+TK+ +  +  G++ S   F+WV+RP +  +D+ +   +G
Sbjct  179   WLDEQPPGSVLYISFGSYAHVTKQELHVIAGGVLASGTRFLWVMRPDIVSSDDPNPLPEG  238

Query  3171  FQECVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTN  3350
             F      RGL+VPWC Q  V+SH A+GGF+THCGWNS+LES+W  VPM+C+PL+ DQ TN
Sbjct  239   FMAASAGRGLVVPWCCQVEVLSHTALGGFLTHCGWNSVLESVWAGVPMLCFPLLTDQFTN  298

Query  3351  RKLVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGS  3530
             R+L+V EW++G+ +   D  ++ ++EV ++++ +M  +   ELR+A+K VR  LE A   
Sbjct  299   RRLIVREWRVGMPI--GDRGAVFEDEVRARIEGIMSGKEGEELREAVKKVRATLEAATAH  356

Query  3531  NGSSVKNVDKFVEKIKAK  3584
              GSS ++ D+FV+++  +
Sbjct  357   GGSSQQSFDEFVDELTRR  374



>gb|ABR17327.1| unknown [Picea sitchensis]
Length=491

 Score =   411 bits (1056),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 211/481 (44%), Positives = 304/481 (63%), Gaps = 20/481 (4%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIFTQ  2360
             H + +P+P QGHI P  + +  LA++G TVTFVNTE   + I KAR G      +D F+ 
Sbjct  15    HVVAVPLPVQGHITPMFNFAKKLAAKGVTVTFVNTEACYANITKARNG------EDPFSH  68

Query  2361  ARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTCLI  2540
             A++ GLDIR   ISDG PL FDR+ +A  F+         HV+EL+  L   EPP  C+I
Sbjct  69    AQSLGLDIRSAQISDGLPLEFDRSLNAEEFIESFETNMIPHVEELISHLKEEEPPVLCII  128

Query  2541  ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGH---FGCKDCRKDSIDY  2711
             ADSF+ W   +A KY + + SF+TE A+VF+I  H DLL ENGH      +D  ++ I+Y
Sbjct  129   ADSFFVWLDRVAKKYGISHASFWTEAAMVFSIYYHWDLLVENGHSPFVNKEDDHENLINY  188

Query  2712  IPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALE  2891
             IPG+  ++  DLP Y Q E + +S  +  +Y+ F+  + AD +I NTV++LE +TI+ L+
Sbjct  189   IPGLSDLKTTDLPSYFQ-ELDLSSRTHDILYEAFQSVRGADWIISNTVEDLESRTIAELQ  247

Query  2892  EKQPFYAIGPLFPQSFTE----QTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
               +PF+++GPL P +F E    +T+  ++ PESDC  WLDSKP  SV+Y SFGS AHL++
Sbjct  248   SIKPFWSVGPLLPSAFQEDLNKETSRTNMWPESDCTGWLDSKPENSVIYISFGSYAHLSR  307

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
               I E+  GL+ S+  FIWVLRP +  +   D   +GF E  +D+GL+V W  Q  V+SH
Sbjct  308   AQIEEVALGLLESKQPFIWVLRPDIIASGIHDILPEGFLEETKDKGLVVQWSSQLEVLSH  367

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK---  3410
             P+VGGF+THCGWNSILES+   VPM+ +PL  DQ TNR L+V+EW + ++L  +      
Sbjct  368   PSVGGFLTHCGWNSILESLSSGVPMLAFPLFTDQCTNRWLIVEEWGVAMDLAGNSGSFQN  427

Query  3411  ---SISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKA  3581
                 + +EE+A  +K  M  E   +LR  +K +R+ L+ A+  +G+S KN+D FVE ++A
Sbjct  428   YKPLVGREEIARTLKKFMGEEEGRKLRLKVKPIREVLKKAMLDSGTSNKNLDLFVEALRA  487

Query  3582  K  3584
             K
Sbjct  488   K  488



>ref|XP_010684058.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010684059.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010684060.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   415 bits (1067),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  320   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  379

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  380   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  439

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  440   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  499

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  500   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  559

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  560   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  619

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  620   MYRLMLCK  627


 Score =   259 bits (663),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 185/265 (70%), Gaps = 4/265 (2%)
 Frame = +1

Query  352   PHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK----KLDPHSASTVKYLCEARAKVILV  519
             P +QTL + P EEL  K+VMVRFDS+IL   K      +  ++  T+KY+ EA AK+IL+
Sbjct  35    PSIQTLRRLPPEELSAKIVMVRFDSSILFYQKLDQSISITSNAFFTIKYVFEAGAKIILI  94

Query  520   GSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQL  699
              SW+   N+K L+ EAVAE LSSVLQLKV+P K   +     +E   E D++LLEN+S+ 
Sbjct  95    SSWNVKCNAKILSEEAVAELLSSVLQLKVVPGKCNFAHQQPKVELFEEADVILLENLSKY  154

Query  700   KDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLE  879
             K +++N  +FA++LS GVDIFVNDSFS  HKILASTVG+  FC AC+AGF+F+  L +L+
Sbjct  155   KQELANDSEFARKLSSGVDIFVNDSFSTAHKILASTVGVTQFCYACVAGFYFEECLIKLK  214

Query  880   KIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVE  1059
              I+     P V ++GGGNL DKAAAL  LAS CD LVFVG MA QIMHA G+PVP+ LVE
Sbjct  215   TILECTHSPSVGVVGGGNLRDKAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYLVE  274

Query  1060  RKALKQAHAIVEAAKVGNLLILDPA  1134
             ++  K+A  IV+ A+  ++ IL P+
Sbjct  275   KEGAKEALEIVKYAESRSIPILLPS  299



>ref|XP_010684061.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=621

 Score =   415 bits (1066),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  313   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  372

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  373   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  432

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  433   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  492

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  493   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  552

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  553   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  612

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  613   MYRLMLCK  620


 Score =   259 bits (661),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 185/265 (70%), Gaps = 4/265 (2%)
 Frame = +1

Query  352   PHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK----KLDPHSASTVKYLCEARAKVILV  519
             P +QTL + P EEL  K+VMVRFDS+IL   K      +  ++  T+KY+ EA AK+IL+
Sbjct  28    PSIQTLRRLPPEELSAKIVMVRFDSSILFYQKLDQSISITSNAFFTIKYVFEAGAKIILI  87

Query  520   GSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQL  699
              SW+   N+K L+ EAVAE LSSVLQLKV+P K   +     +E   E D++LLEN+S+ 
Sbjct  88    SSWNVKCNAKILSEEAVAELLSSVLQLKVVPGKCNFAHQQPKVELFEEADVILLENLSKY  147

Query  700   KDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLE  879
             K +++N  +FA++LS GVDIFVNDSFS  HKILASTVG+  FC AC+AGF+F+  L +L+
Sbjct  148   KQELANDSEFARKLSSGVDIFVNDSFSTAHKILASTVGVTQFCYACVAGFYFEECLIKLK  207

Query  880   KIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVE  1059
              I+     P V ++GGGNL DKAAAL  LAS CD LVFVG MA QIMHA G+PVP+ LVE
Sbjct  208   TILECTHSPSVGVVGGGNLRDKAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYLVE  267

Query  1060  RKALKQAHAIVEAAKVGNLLILDPA  1134
             ++  K+A  IV+ A+  ++ IL P+
Sbjct  268   KEGAKEALEIVKYAESRSIPILLPS  292



>ref|XP_010684057.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=647

 Score =   415 bits (1067),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  339   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  398

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  399   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  458

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  459   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  518

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  519   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  578

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  579   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  638

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  639   MYRLMLCK  646


 Score =   237 bits (604),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 191/315 (61%), Gaps = 32/315 (10%)
 Frame = +1

Query  214   SPKHKLRRTCRK---IKKFQRLQFSSPVK--SQLTALDKAEACYESEL---RLFPHVQTL  369
             S K KL   C K      FQR   SS  +  S++++     +C    L   +  P +QTL
Sbjct  28    SSKPKLLIQCNKSILFANFQRNGLSSSWQGSSEVSSYVANCSCKAKVLGREQSVPSIQTL  87

Query  370   GQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSASTVKYLCEARAKVILVGSWSSTINSK  549
              + P EEL  K+VM                        Y+ EA AK+IL+ SW+   N+K
Sbjct  88    RRLPPEELSAKIVM------------------------YVFEAGAKIILISSWNVKCNAK  123

Query  550   PLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKF  729
              L+ EAVAE LSSVLQLKV+P K   +     +E   E D++LLEN+S+ K +++N  +F
Sbjct  124   ILSEEAVAELLSSVLQLKVVPGKCNFAHQQPKVELFEEADVILLENLSKYKQELANDSEF  183

Query  730   AQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPY  909
             A++LS GVDIFVNDSFS  HKILASTVG+  FC AC+AGF+F+  L +L+ I+     P 
Sbjct  184   ARKLSSGVDIFVNDSFSTAHKILASTVGVTQFCYACVAGFYFEECLIKLKTILECTHSPS  243

Query  910   VAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAI  1089
             V ++GGGNL DKAAAL  LAS CD LVFVG MA QIMHA G+PVP+ LVE++  K+A  I
Sbjct  244   VGVVGGGNLRDKAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYLVEKEGAKEALEI  303

Query  1090  VEAAKVGNLLILDPA  1134
             V+ A+  ++ IL P+
Sbjct  304   VKYAESRSIPILLPS  318



>ref|XP_006493018.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X8 [Citrus sinensis]
Length=683

 Score =   416 bits (1069),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 246/308 (80%), Gaps = 3/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW+PVD+GP ++EEI+S ++KCK +IW+GPVKF  S+  + GASKL  M+  +SQ  C++
Sbjct  372   GWEPVDIGPRSVEEITSTITKCK-VIWVGPVKFRFSSQYSYGASKLTGMLCKVSQGTCNI  430

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF++DW   Y+
Sbjct  431   TVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPFDIDWSAAYH  490

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE+N KLV  C D +  S + N +F+AT
Sbjct  491   DPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLEVNGKLVTHCRDSLQLSGITNGYFIAT  550

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL   GKVFLQ
Sbjct  551   NATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLLVHDGKVFLQ  610

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWEQHV+DRG P
Sbjct  611   SDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWEQHVIDRGAP  670

Query  1998  MYRLCLSK  2021
             MYRL LSK
Sbjct  671   MYRLMLSK  678


 Score =   289 bits (739),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAR  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>ref|XP_010684055.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=675

 Score =   416 bits (1068),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 245/308 (80%), Gaps = 2/308 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVDLGP++  EI++FLS+ KKIIWIGPVK   S+   GG S+L  ++D +SQ  C +
Sbjct  367   GWKPVDLGPNSFIEIATFLSRYKKIIWIGPVKVGQSDQKRGGESRLVHILDEVSQHGCHI  426

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +I+G MAC+A    S S+ A  M+++ASVVWE+LKGR+LPGLLALDRAY FE++W  IY 
Sbjct  427   TIIGHMACEAVREISRSSPAYCMVEHASVVWEYLKGRSLPGLLALDRAYTFEIEWNMIYP  486

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP + L VDIGSGNGLFL GMA  RKD NFLGLEIN+KLV RCL+   QS +KN+HF+AT
Sbjct  487   DPTQSLAVDIGSGNGLFLMGMANMRKDLNFLGLEINKKLVTRCLESADQSGLKNLHFIAT  546

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATS+F++I+SSYPG+LVLVSIQCPNP+FN+P HRWRM+Q+SLV+AI   LA GGKVFLQ
Sbjct  547   NATSSFQTIVSSYPGQLVLVSIQCPNPNFNQPEHRWRMVQRSLVQAIISELAPGGKVFLQ  606

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAI-HQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD+EEVA+RM ++F + GK KL+V   D   +   GGWL++NPFG+RSDWE HVL RGDP
Sbjct  607   SDVEEVAMRMCKQFLEKGKEKLDVVYDDMDMVPGPGGWLEDNPFGVRSDWESHVLARGDP  666

Query  1998  MYRLCLSK  2021
             MYRL L K
Sbjct  667   MYRLMLCK  674


 Score =   260 bits (665),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/319 (48%), Positives = 206/319 (65%), Gaps = 12/319 (4%)
 Frame = +1

Query  214   SPKHKLRRTCRK---IKKFQRLQFSSPVK--SQLTALDKAEACYESEL---RLFPHVQTL  369
             S K KL   C K      FQR   SS  +  S++++     +C    L   +  P +QTL
Sbjct  28    SSKPKLLIQCNKSILFANFQRNGLSSSWQGSSEVSSYVANCSCKAKVLGREQSVPSIQTL  87

Query  370   GQFPKEELFGKVVMVRFDSTILPVDKK----KLDPHSASTVKYLCEARAKVILVGSWSST  537
              + P EEL  K+VMVRFDS+IL   K      +  ++  T+KY+ EA AK+IL+ SW+  
Sbjct  88    RRLPPEELSAKIVMVRFDSSILFYQKLDQSISITSNAFFTIKYVFEAGAKIILISSWNVK  147

Query  538   INSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSN  717
              N+K L+ EAVAE LSSVLQLKV+P K   +     +E   E D++LLEN+S+ K +++N
Sbjct  148   CNAKILSEEAVAELLSSVLQLKVVPGKCNFAHQQPKVELFEEADVILLENLSKYKQELAN  207

Query  718   CQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTD  897
               +FA++LS GVDIFVNDSFS  HKILASTVG+  FC AC+AGF+F+  L +L+ I+   
Sbjct  208   DSEFARKLSSGVDIFVNDSFSTAHKILASTVGVTQFCYACVAGFYFEECLIKLKTILECT  267

Query  898   KKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQ  1077
               P V ++GGGNL DKAAAL  LAS CD LVFVG MA QIMHA G+PVP+ LVE++  K+
Sbjct  268   HSPSVGVVGGGNLRDKAAALRVLASKCDGLVFVGMMALQIMHAMGMPVPLYLVEKEGAKE  327

Query  1078  AHAIVEAAKVGNLLILDPA  1134
             A  IV+ A+  ++ IL P+
Sbjct  328   ALEIVKYAESRSIPILLPS  346



>ref|XP_008350374.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Malus domestica]
Length=398

 Score =   405 bits (1042),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 263/377 (70%), Gaps = 2/377 (1%)
 Frame = +3

Query  2457  GMMYVFSAHVDELVKKLAGLEPPPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAI  2636
             G ++VF AHVDELV  L   +P  TCLI D+F +W + IA+KYNL+++SF+TEPALVF I
Sbjct  20    GALHVFPAHVDELVGNLVQSDPSITCLIVDTFQSWSATIANKYNLIHISFWTEPALVFNI  79

Query  2637  DSHLDLLKENGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFE  2816
               HLDLL++NGHFG  D R+D IDYIP V+AIEP+DL  ++Q   +    +    YK F 
Sbjct  80    YYHLDLLQKNGHFGSHDNREDIIDYIPXVKAIEPKDLMSHIQ-STDLFCPMLRXFYKSFR  138

Query  2817  DAKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWL  2996
             + KKAD ++CNTVQELE +++SAL+ KQP Y IGP+ P + T+     +L+PE DC  WL
Sbjct  139   EVKKADFILCNTVQELEFESLSALQAKQPTYPIGPVXPDNLTKNIVATNLMPEFDCIHWL  198

Query  2997  DSKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQ  3176
               KP GSVL+ SFGS A +TK+   E+  GL+LS+VNFIWVLR      DE      GF+
Sbjct  199   HEKPHGSVLFISFGSYAQVTKDDFEEIAHGLLLSKVNFIWVLRSDTTGYDETYILPVGFE  258

Query  3177  ECVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRK  3356
             + ++DRGL+VPWC Q  V+SHPAVGGF+THCGWNSILES+ C VPM+C+PL+ DQ TNRK
Sbjct  259   DEIKDRGLMVPWCSQIEVLSHPAVGGFLTHCGWNSILESMRCGVPMLCFPLVADQITNRK  318

Query  3357  LVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNG  3536
             LVVD+W  G+NLC D  K + + EVA K+  L+  +S   L+K +    + LE+A+  NG
Sbjct  319   LVVDDWGXGLNLC-DRVKPVRRVEVAEKINRLICGKSGDGLQKKVMKXTQTLEDAVALNG  377

Query  3537  SSVKNVDKFVEKIKAKF  3587
             SS KN+ +F+  +K K 
Sbjct  378   SSQKNLSQFISNVKEKI  394



>ref|XP_011094615.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Sesamum indicum]
Length=689

 Score =   414 bits (1063),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 246/312 (79%), Gaps = 4/312 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             +GW+PVD+GP +L+E+    SKCKKIIWIGP +FSSS  + GG  +LA  +  LS  +CD
Sbjct  378   EGWQPVDIGPRSLQEMIYLASKCKKIIWIGPSRFSSSKQDKGGTLELAETLGNLS--SCD  435

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             ++ VGK+  +     S S + +N ++ A+VVWE LKGR LPGLLALDRAYP+++DW   Y
Sbjct  436   ITFVGKIEFEELLRKSKSFSNDNFVKTAAVVWEVLKGRKLPGLLALDRAYPYQVDWSVTY  495

Query  1461  NDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              DP RPLVVD+GSGNGLFL GMARR KD NFLGLEIN KLV RCL+ + +  + NVHF+A
Sbjct  496   GDPTRPLVVDVGSGNGLFLVGMARRRKDMNFLGLEINAKLVDRCLEDIHRLDLHNVHFIA  555

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRMLQ  LVEAIAD+L  GG+VFL
Sbjct  556   TNATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEYRWRMLQSPLVEAIADMLKFGGQVFL  615

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSDIE VA+RMK EF +YGKGKL + E+ +  A+++ GWL++NPFG+ SDWE+HVLDRGD
Sbjct  616   QSDIEAVALRMKNEFLEYGKGKLVLMEHSEDVAVNELGWLEKNPFGVPSDWERHVLDRGD  675

Query  1995  PMYRLCLSKSES  2030
              MYRL LSK ++
Sbjct  676   CMYRLLLSKVKT  687


 Score =   318 bits (816),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 235/353 (67%), Gaps = 19/353 (5%)
 Frame = +1

Query  130   MSQILENFQTFLLFRNQCFLVCRKNSLASPK-----HKLRRTCRKIKKFQRLQFSSPV--  288
             M+Q+L   Q  L F+N     C  +SL  P      H   RT  K K+   + FS PV  
Sbjct  2     MNQVLTFPQPKLYFKNSNSKTCAFDSLKFPPEKSCFHPRNRTALKRKECSVVLFSLPVSC  61

Query  289   ----KSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK--  450
                 +++ +  +K   C      +FPH+QTL  FPKE+LFGKVVMVRFDS +L   +K  
Sbjct  62    KVVDQAEHSLTEKDAVCGRGNFTVFPHIQTLRNFPKEKLFGKVVMVRFDSMVLLQGRKGH  121

Query  451   KLDPHSA-STVKYLCEARAKVILVGSWSSTINSKPLA-----LEAVAEYLSSVLQLKVIP  612
             +  P +A ST+KYL EA AKV+LVG W  TINS+  +     +E+VAE+LSSVL+L+V+P
Sbjct  122   QSPPANAFSTIKYLHEAGAKVVLVGGWRETINSRSSSEPCPSVESVAEFLSSVLELQVVP  181

Query  613   TKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHK  792
              K  S  M + + +    DILLL N+   K + +NC  FA++L+ GVDI VND+FSE HK
Sbjct  182   VKYVSVCMHSGVGESKRSDILLLANLFHYKGERANCSNFAKELASGVDIVVNDAFSESHK  241

Query  793   ILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLAS  972
             +LASTVGIA FC+A IAGF+F+ GL +L+KII+T +KPY+AIIGGGNL DK AALH L S
Sbjct  242   VLASTVGIASFCNAYIAGFYFEEGLHKLKKIIKTTEKPYMAIIGGGNLADKVAALHSLTS  301

Query  973   ICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
              CD L+FVG MAFQIMHA G+PVP+K VE  ALK+A +IVE AK+ N+ ++ P
Sbjct  302   TCDGLIFVGSMAFQIMHALGVPVPMKFVELGALKEAVSIVETAKLRNIPLVVP  354



>ref|XP_006493015.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X5 [Citrus sinensis]
Length=689

 Score =   411 bits (1056),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 245/317 (77%), Gaps = 11/317 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISS---------FLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVD  1256
             GW+PVD+GP ++EEI+S         FL   +K+IW+GPVKF  S+  + GASKL  M+ 
Sbjct  368   GWEPVDIGPRSVEEITSTITKYAMMYFLIMSQKVIWVGPVKFRFSSQYSYGASKLTGMLC  427

Query  1257  ALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPF  1436
              +SQ  C+++++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF
Sbjct  428   KVSQGTCNITVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPF  487

Query  1437  EMDWKCIYNDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSV  1613
             ++DW   Y+DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE+N KLV  C D +  S 
Sbjct  488   DIDWSAAYHDPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLEVNGKLVTHCRDSLQLSG  547

Query  1614  MKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLL  1793
             + N +F+ATNATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL
Sbjct  548   ITNGYFIATNATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLL  607

Query  1794  ASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWE  1970
                GKVFLQSDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWE
Sbjct  608   VHDGKVFLQSDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWE  667

Query  1971  QHVLDRGDPMYRLCLSK  2021
             QHV+DRG PMYRL LSK
Sbjct  668   QHVIDRGAPMYRLMLSK  684


 Score =   289 bits (739),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAR  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>ref|XP_006493011.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006493012.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X2 [Citrus sinensis]
 ref|XP_006493013.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X3 [Citrus sinensis]
 ref|XP_006493014.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X4 [Citrus sinensis]
Length=693

 Score =   410 bits (1055),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 245/317 (77%), Gaps = 11/317 (3%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISS---------FLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVD  1256
             GW+PVD+GP ++EEI+S         FL   +K+IW+GPVKF  S+  + GASKL  M+ 
Sbjct  372   GWEPVDIGPRSVEEITSTITKYAMMYFLIMSQKVIWVGPVKFRFSSQYSYGASKLTGMLC  431

Query  1257  ALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPF  1436
              +SQ  C+++++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF
Sbjct  432   KVSQGTCNITVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPF  491

Query  1437  EMDWKCIYNDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSV  1613
             ++DW   Y+DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE+N KLV  C D +  S 
Sbjct  492   DIDWSAAYHDPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLEVNGKLVTHCRDSLQLSG  551

Query  1614  MKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLL  1793
             + N +F+ATNATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL
Sbjct  552   ITNGYFIATNATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLL  611

Query  1794  ASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWE  1970
                GKVFLQSDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWE
Sbjct  612   VHDGKVFLQSDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWE  671

Query  1971  QHVLDRGDPMYRLCLSK  2021
             QHV+DRG PMYRL LSK
Sbjct  672   QHVIDRGAPMYRLMLSK  688


 Score =   289 bits (739),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAR  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>ref|XP_010653609.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Vitis vinifera]
Length=640

 Score =   407 bits (1047),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 210/370 (57%), Positives = 246/370 (66%), Gaps = 58/370 (16%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW PVD GP  L+EI+S L+ CKKIIWIGPVKF   + +  GASKL +M+D L+Q NC++
Sbjct  269   GWIPVDPGPKALDEINSLLTGCKKIIWIGPVKFRLPSQDIYGASKLVSMLDRLTQSNCEI  328

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             +++G MAC A    SS  +  NM++NASVVWEFLKGR LPGL+ALDRAYP E+DW   Y+
Sbjct  329   TVIGNMACKAVMKESSFVSVYNMVENASVVWEFLKGRKLPGLMALDRAYPVEIDWNAAYS  388

Query  1464  DPDRPLVVDIGSGNGLFLFGMA-RRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
              P +PLVVDIGSGNGLFL  MA RR+D NFLGLEIN KLV+RCLD V Q  + N +F+AT
Sbjct  389   HPSQPLVVDIGSGNGLFLLAMAKRREDLNFLGLEINEKLVRRCLDCVHQYGIMNGYFIAT  448

Query  1641  NATSTFRSIISS------------------------------------------------  1676
             NATSTFRSI+SS                                                
Sbjct  449   NATSTFRSIVSSYPGDLVLVSIQVVTISYKWSHFNYKFQVLGCTPSQSGQTCGSEAAMEM  508

Query  1677  --YPGRLVLVSI------QCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQSDIE  1832
               Y G L + S+       CPNPDFNKP HRWRMLQ+SLVEA+ADLLAS GKVFLQSDIE
Sbjct  509   VPYHGSLPVSSVFSPIMSVCPNPDFNKPEHRWRMLQRSLVEAVADLLASDGKVFLQSDIE  568

Query  1833  EVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPMYRL  2009
              VA+RMKE F KYGKGKL  V N D     + GWLKENPFG+RSDWEQHV+DRG PMYRL
Sbjct  569   AVAVRMKEHFLKYGKGKLSVVHNEDCTETDRKGWLKENPFGVRSDWEQHVVDRGAPMYRL  628

Query  2010  CLSKSESSEP  2039
              LSK+   +P
Sbjct  629   MLSKTGYCQP  638


 Score =   259 bits (663),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 179/244 (73%), Gaps = 3/244 (1%)
 Frame = +1

Query  409   MVRFDSTIL---PVDKKKLDPHSASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEY  579
             MVRFDS IL    +D K     + ST+KYL EA AK+IL+  W+  INSK L +E+VA++
Sbjct  1     MVRFDSAILLQKELDLKSQVTSAVSTIKYLFEAGAKIILLSDWNMKINSKLLVVESVADF  60

Query  580   LSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDI  759
             LSSVLQLKV P++  S+  ++ +E+  + DILLLEN+S+ K +++NC KFA+QLS  VDI
Sbjct  61    LSSVLQLKVAPSRCISNCSLSKMEELEKADILLLENLSEFKGELANCSKFAEQLSSVVDI  120

Query  760   FVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLI  939
             FVNDSFS  HKILASTVG+  FCSAC+AGFHF+  L QL+   + +KKP +AIIGGGNL 
Sbjct  121   FVNDSFSNSHKILASTVGVPRFCSACVAGFHFEESLCQLKMAAQINKKPCIAIIGGGNLF  180

Query  940   DKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLL  1119
             DKA+A+ +LAS CD LVFVG MAFQIMHA GL VP+ L+E   LK+A  IV+ A+   + 
Sbjct  181   DKASAVRYLASRCDGLVFVGMMAFQIMHALGLHVPLNLLEGGPLKEASNIVQLAQNRKIP  240

Query  1120  ILDP  1131
             IL P
Sbjct  241   ILYP  244



>gb|EPS73117.1| hypothetical protein M569_01639, partial [Genlisea aurea]
Length=474

 Score =   400 bits (1029),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 216/479 (45%), Positives = 302/479 (63%), Gaps = 20/479 (4%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HA++L + +QGH+ P  +L+I +AS+G TVT V  E I   + +A       P  D F
Sbjct  6     KLHAVMLSLGFQGHMTPFFNLAITVASKGITVTLVQLEHIRHQLSQAH-----GPLVDPF  60

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKL-AGLEPPP-  2528
               AR+SGLDIR TT+SDGF + FDR      +   ++  F  H+ E + +L  G + P  
Sbjct  61    AAARDSGLDIRCTTMSDGFDVDFDRQLRFVEYGEKLLDGFEEHLYEFLGELLVGFQSPDW  120

Query  2529  -TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
                L+AD+ YA  +  A K  + +VSF+TEPALVF +  H++LL+ENGH+ CKD  K+ I
Sbjct  121   VNFLVADTLYASATNAARKCGIPSVSFWTEPALVFHMVYHVELLRENGHYPCKDDLKEEI  180

Query  2706  DYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
              Y+PG+ +I   DL L   +E+  +  +   + K F+D + AD ++ NTVQELE   +S 
Sbjct  181   TYLPGISSINTEDL-LTALRESEASGIISRFLIKSFQDVRNADFILYNTVQELEESVLSV  239

Query  2886  LEEKQPFYAIGPLFPQSFTEQT-----AFRSLLPESDCCKWLDSKPPGSVLYASFGSLAH  3050
             L   QP YAIGP+   +F+E+        +SL   SDC  WLDSKPPGSVLY SFGS  +
Sbjct  240   LNRHQPGYAIGPI---NFSEKALSLNIEGKSLWSVSDCTGWLDSKPPGSVLYVSFGSYIN  296

Query  3051  LTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAV  3230
              +KE + EL  GL+L EVNF+W +R G+ I  E     DGF+E ++D+GLI+PW +Q  V
Sbjct  297   TSKELMDELAHGLLLGEVNFVWAVRTGILINGEAYSFPDGFEEKIKDKGLIIPWSNQLEV  356

Query  3231  ISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDK  3410
             +S+PAVGGF+TH GWNS +ESIW  VPMIC+P   DQP NRKLVVD+WKIGINL   +D 
Sbjct  357   LSNPAVGGFLTHNGWNSTVESIWYGVPMICFPFTFDQPVNRKLVVDDWKIGINLS--EDG  414

Query  3411  SISKEEVASKVKFLMKAES-SIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             S+ ++ VA K+  L   E  S  L+K +K+++  + +A    GSS +N DKF++ +K K
Sbjct  415   SLERKRVAEKINSLFYDEEISSSLKKRMKELKGIVHDAFQVGGSSRRNFDKFLQDLKKK  473



>ref|XP_007027388.1| Phosphoglycerate kinase, putative isoform 1 [Theobroma cacao]
 gb|EOY07890.1| Phosphoglycerate kinase, putative isoform 1 [Theobroma cacao]
Length=680

 Score =   405 bits (1040),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 246/371 (66%), Gaps = 60/371 (16%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCK-------------------------------------  1172
             GW PVDLGPS+L+EI+S ++  K                                     
Sbjct  310   GWVPVDLGPSSLDEINSLVTNSKVKRKLISRYHNMTCYFWLNRDLPSFEIVGTGFILRVY  369

Query  1173  -----KIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDVSIVGKMACDAFHGNSSSA  1337
                  KIIWIGPVKF SS+   GG SKLA M+    Q  C+++IVG  AC+     SSS 
Sbjct  370   YMSMWKIIWIGPVKFRSSSPYTGGTSKLAQMLYKQCQCECEITIVGSTACEVIKNESSSV  429

Query  1338  TAENMIQNASVVWEFLKGRNLPGLLALDR----------------AYPFEMDWKCIYNDP  1469
             ++ NM++NAS VWEFLKG+ LPG++ALDR                AYPFE+DW   Y DP
Sbjct  430   SSFNMLENASAVWEFLKGQKLPGVMALDRVYRLLCSVFTSPLCLIAYPFEIDWNVAYCDP  489

Query  1470  DRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATNA  1646
              RPLVVDIGSGNGLF+ GM R RKD NFLGLEIN KLVKRCLD V QS + N +F+ TNA
Sbjct  490   SRPLVVDIGSGNGLFIMGMTRKRKDLNFLGLEINGKLVKRCLDSVHQSGITNGYFIETNA  549

Query  1647  TSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQSD  1826
             TSTF SI+SSYPG LVL+SI+CPNPDFNKP HRWRM+Q+SL+EA+ADLLAS GKVFLQSD
Sbjct  550   TSTFHSIVSSYPGELVLLSIECPNPDFNKPEHRWRMMQRSLIEAVADLLASKGKVFLQSD  609

Query  1827  IEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPMY  2003
             +E VA+R+K+EF KYGKGK  V  +     I+   WLKENPFGI SDWEQHV+DRG PMY
Sbjct  610   VEAVAMRLKDEFLKYGKGKFHVMHDRYDLVINGNTWLKENPFGIHSDWEQHVIDRGAPMY  669

Query  2004  RLCLSKSESSE  2036
             RL LSK+   E
Sbjct  670   RLMLSKATGLE  680


 Score =   280 bits (717),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 190/280 (68%), Gaps = 4/280 (1%)
 Frame = +1

Query  304   ALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSA----  471
               + A  C   EL   PHVQTL +FP+EELF KVVMVRFDSTI   +K      SA    
Sbjct  6     TFENASLCDGVELEALPHVQTLREFPREELFAKVVMVRFDSTIFLGEKLDWSSQSALRAL  65

Query  472   STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIE  651
              T+K+L E+ AKVILV +WS+ IN K LA E VA+ LSSVL+LKV   +  S  M    +
Sbjct  66    YTIKFLHESGAKVILVSAWSTKINPKLLAAEVVADILSSVLRLKVAALRCISCNMPLERK  125

Query  652   KRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCS  831
                + DILLLEN+S  K++ +NC KFA+ LS  VDIFVNDSF + HKILASTVG+A FC 
Sbjct  126   DLQKADILLLENLSNYKEEAANCSKFAELLSSEVDIFVNDSFFQSHKILASTVGVARFCY  185

Query  832   ACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAF  1011
             A +AGF F   L QL+K   T+KKPY+AIIGGGNL +KAAAL FLAS CDALVFVG M+F
Sbjct  186   ASMAGFSFDESLCQLKKTATTNKKPYIAIIGGGNLNNKAAALQFLASRCDALVFVGLMSF  245

Query  1012  QIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             QI+HA G  VP  LVE +A K A  IV+ A   N+LIL P
Sbjct  246   QIIHALGHSVPTNLVELEAQKAALDIVQFAHNKNVLILYP  285



>ref|XP_006493016.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like isoform 
X6 [Citrus sinensis]
Length=689

 Score =   400 bits (1029),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 242/317 (76%), Gaps = 15/317 (5%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISS---------FLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVD  1256
             GW+PVD+GP ++EEI+S         FL   +K+IW+GPVKF  S+  + GASKL  M+ 
Sbjct  372   GWEPVDIGPRSVEEITSTITKYAMMYFLIMSQKVIWVGPVKFRFSSQYSYGASKLTGMLC  431

Query  1257  ALSQRNCDVSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPF  1436
              +SQ  C+++++G MAC A    SSS    NM+++ S VWEFLKGR LPG+ ALDRA+PF
Sbjct  432   KVSQGTCNITVIGSMACKAIAKVSSSIFGLNMVESGSAVWEFLKGRMLPGVSALDRAFPF  491

Query  1437  EMDWKCIYNDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSV  1613
             ++DW   Y+DP +PLVVDIGSGNGLFL GMAR RKD NFLGLE    LV  C D +  S 
Sbjct  492   DIDWSAAYHDPAQPLVVDIGSGNGLFLLGMARKRKDLNFLGLE----LVTHCRDSLQLSG  547

Query  1614  MKNVHFVATNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLL  1793
             + N +F+ATNATSTFRSI++SYPG+L+LVSIQCPNPDFN+P HRWRM+Q+SLVEA++DLL
Sbjct  548   ITNGYFIATNATSTFRSIVASYPGKLILVSIQCPNPDFNRPEHRWRMVQRSLVEAVSDLL  607

Query  1794  ASGGKVFLQSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWE  1970
                GKVFLQSDIEEV +RMK++F +YGKGKL  V++      +QGGWL ENPFG++SDWE
Sbjct  608   VHDGKVFLQSDIEEVMLRMKQQFLEYGKGKLVLVQDECDTKTNQGGWLGENPFGVQSDWE  667

Query  1971  QHVLDRGDPMYRLCLSK  2021
             QHV+DRG PMYRL LSK
Sbjct  668   QHVIDRGAPMYRLMLSK  684


 Score =   289 bits (739),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 217/343 (63%), Gaps = 30/343 (9%)
 Frame = +1

Query  148   NFQTFLLFRNQCFLVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEAC  327
             NF + LL R +     R +++  P H+            R+Q SSPV  ++   D  +  
Sbjct  20    NFPSKLLQRKRSCSFTRNDAVL-PDHR------------RVQSSSPVALKVAVADDVKKS  66

Query  328   YES---------ELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS--  474
                         E  + PH+QTL +FPK EL GKV +VRFDSTIL    ++LDP S S  
Sbjct  67    SNDTEDHIWDGIESDVLPHIQTLRRFPKVELAGKVALVRFDSTILL--NQELDPRSRSVF  124

Query  475   ----TVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMA  642
                 T+KYL E  AKVIL   WS+ INS  L+ E VA+  SS L+ +V+  K  S ++  
Sbjct  125   NALFTIKYLLEFGAKVILASDWSNKINSNVLSAEYVADVFSSALKYQVVTAKSLSYKISL  184

Query  643   WIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
              +    + DILLLEN+S+ K++V+NC KFAQ LS GVDIFVNDSFS  HKILASTVG+A 
Sbjct  185   DVGAFKKTDILLLENLSEFKEEVANCSKFAQLLSSGVDIFVNDSFSLSHKILASTVGVAR  244

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             FC AC+AGFHF+  L QL K+ + D+KPY AIIGGGNL +KAAALHFLAS CD L+FVG 
Sbjct  245   FCYACVAGFHFEESLFQLRKMAKLDEKPYAAIIGGGNLCNKAAALHFLASRCDGLIFVGL  304

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             M+FQIMHA GLPVP +LVE+ A   A  +++ A+  ++ IL P
Sbjct  305   MSFQIMHALGLPVPPELVEKGANDAASDLIQFARDKHITILYP  347



>ref|XP_008443576.1| PREDICTED: uncharacterized protein LOC103487132 [Cucumis melo]
Length=769

 Score =   401 bits (1031),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/292 (67%), Positives = 230/292 (79%), Gaps = 9/292 (3%)
 Frame = +3

Query  1170  KKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDVSIVGKMACDAFHGNSSSATAEN  1349
             +KIIWIGPVKFS S+ +A GAS+LA  +  L+QR+CD+++VG  AC A    SS+ +A N
Sbjct  481   QKIIWIGPVKFSDSSQSARGASRLARKLYDLAQRDCDITVVGTTACKAIMQESSTLSAYN  540

Query  1350  MIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYNDPDRPLVVDIGSGNGLFLFGMA  1529
             + +NASVVW+F KG+ LPG+LALDRAYP+E++W  ++ D   PLVVDIGSGNG+FL  MA
Sbjct  541   VFENASVVWDFFKGKQLPGVLALDRAYPYEINWDAVFCDTALPLVVDIGSGNGMFLLEMA  600

Query  1530  RR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATNATSTFRSIISSYPGRLVLVSI  1706
             RR KD NFLGLEIN KLVKRCL  V Q  MKN HF+ATNATSTFRSI+ SYPG LVLVSI
Sbjct  601   RRRKDHNFLGLEINEKLVKRCLHSVHQLEMKNGHFIATNATSTFRSIVCSYPGELVLVSI  660

Query  1707  QCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQSDIEEVAIRMKEEFSKYGKGKL  1886
             QCPNPDFNKP HRWRMLQ+SLVEA+ADLLAS GKVFLQSD+E VA+RM+E F  YGKGKL
Sbjct  661   QCPNPDFNKPEHRWRMLQRSLVEAVADLLASNGKVFLQSDVEAVALRMREAFLLYGKGKL  720

Query  1887  EVENLDKAAIHQGG--WLKENPFGIRSDWEQHVLDRGDPMYRLCLSKSESSE  2036
              V         Q G  WL ENPFG+RSDWEQHVLDRG PM+RL LS S +++
Sbjct  721   GVLQ------EQFGEEWLSENPFGVRSDWEQHVLDRGHPMFRLMLSNSTTNK  766


 Score =   282 bits (721),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 199/295 (67%), Gaps = 14/295 (5%)
 Frame = +1

Query  247   KIKKFQRLQFSSPVKSQ--------LTALDKAEACYESELRLFPHVQTLGQFPKEELFGK  402
             K  ++  +  S+P +S         + + D A + +   L   PHVQTLG+FP+EEL GK
Sbjct  66    KYDRYHTVLMSTPARSWGAVYCKNLVNSEDHASSWWN--LEAVPHVQTLGEFPREELAGK  123

Query  403   VVMVRFDSTILPVDKKKLDPHSAS----TVKYLCEARAKVILVGSWSSTINSKPLALEAV  570
             VVMVRFDST+L +++  L  +S      T+KYL +  AKVIL  +W++   ++ L +++V
Sbjct  124   VVMVRFDSTLLLLEEMDLRTNSMKNAVFTIKYLHKYGAKVILATNWNTNSAARHLDIKSV  183

Query  571   AEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFG  750
              +YLSSVLQLKV P K  S  MM   E   + DILLLEN+S  K++V+NC KF++ LS G
Sbjct  184   VDYLSSVLQLKVCPVKCSSYSMMLTEEGFEKADILLLENLSMFKEEVANCSKFSKMLSLG  243

Query  751   VDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGG  930
             VDIFVNDSFS+ H+ILASTVGI  FCS C+AGF+FQ  L QL+K   T ++PYVAIIGGG
Sbjct  244   VDIFVNDSFSQSHRILASTVGITRFCSTCLAGFNFQERLCQLKKAAETKRQPYVAIIGGG  303

Query  931   NLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVE  1095
             NL+DK AALH LAS C ALVFVG M+FQIM A GL V  +L+     K+A  +++
Sbjct  304   NLLDKLAALHVLASTCSALVFVGMMSFQIMQALGLSVSYRLMNHGVCKEAADLIQ  358



>ref|XP_011094616.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Sesamum indicum]
 ref|XP_011094618.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Sesamum indicum]
Length=677

 Score =   397 bits (1021),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 236/301 (78%), Gaps = 4/301 (1%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             +GW+PVD+GP +L+E+    SKCKKIIWIGP +FSSS  + GG  +LA  +  LS  +CD
Sbjct  378   EGWQPVDIGPRSLQEMIYLASKCKKIIWIGPSRFSSSKQDKGGTLELAETLGNLS--SCD  435

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
             ++ VGK+  +     S S + +N ++ A+VVWE LKGR LPGLLALDRAYP+++DW   Y
Sbjct  436   ITFVGKIEFEELLRKSKSFSNDNFVKTAAVVWEVLKGRKLPGLLALDRAYPYQVDWSVTY  495

Query  1461  NDPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              DP RPLVVD+GSGNGLFL GMARR KD NFLGLEIN KLV RCL+ + +  + NVHF+A
Sbjct  496   GDPTRPLVVDVGSGNGLFLVGMARRRKDMNFLGLEINAKLVDRCLEDIHRLDLHNVHFIA  555

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRMLQ  LVEAIAD+L  GG+VFL
Sbjct  556   TNATSTFRSIVSSYPGDLVLVSIQCPNPDFNKPEYRWRMLQSPLVEAIADMLKFGGQVFL  615

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSDIE VA+RMK EF +YGKGKL + E+ +  A+++ GWL++NPFG+ SDWE+HVLD  +
Sbjct  616   QSDIEAVALRMKNEFLEYGKGKLVLMEHSEDVAVNELGWLEKNPFGVPSDWERHVLDHSN  675

Query  1995  P  1997
             P
Sbjct  676   P  676


 Score =   319 bits (817),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 235/353 (67%), Gaps = 19/353 (5%)
 Frame = +1

Query  130   MSQILENFQTFLLFRNQCFLVCRKNSLASPK-----HKLRRTCRKIKKFQRLQFSSPV--  288
             M+Q+L   Q  L F+N     C  +SL  P      H   RT  K K+   + FS PV  
Sbjct  2     MNQVLTFPQPKLYFKNSNSKTCAFDSLKFPPEKSCFHPRNRTALKRKECSVVLFSLPVSC  61

Query  289   ----KSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK--  450
                 +++ +  +K   C      +FPH+QTL  FPKE+LFGKVVMVRFDS +L   +K  
Sbjct  62    KVVDQAEHSLTEKDAVCGRGNFTVFPHIQTLRNFPKEKLFGKVVMVRFDSMVLLQGRKGH  121

Query  451   KLDPHSA-STVKYLCEARAKVILVGSWSSTINSKPLA-----LEAVAEYLSSVLQLKVIP  612
             +  P +A ST+KYL EA AKV+LVG W  TINS+  +     +E+VAE+LSSVL+L+V+P
Sbjct  122   QSPPANAFSTIKYLHEAGAKVVLVGGWRETINSRSSSEPCPSVESVAEFLSSVLELQVVP  181

Query  613   TKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHK  792
              K  S  M + + +    DILLL N+   K + +NC  FA++L+ GVDI VND+FSE HK
Sbjct  182   VKYVSVCMHSGVGESKRSDILLLANLFHYKGERANCSNFAKELASGVDIVVNDAFSESHK  241

Query  793   ILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLAS  972
             +LASTVGIA FC+A IAGF+F+ GL +L+KII+T +KPY+AIIGGGNL DK AALH L S
Sbjct  242   VLASTVGIASFCNAYIAGFYFEEGLHKLKKIIKTTEKPYMAIIGGGNLADKVAALHSLTS  301

Query  973   ICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
              CD L+FVG MAFQIMHA G+PVP+K VE  ALK+A +IVE AK+ N+ ++ P
Sbjct  302   TCDGLIFVGSMAFQIMHALGVPVPMKFVELGALKEAVSIVETAKLRNIPLVVP  354



>gb|EPS68563.1| hypothetical protein M569_06205, partial [Genlisea aurea]
Length=463

 Score =   389 bits (1000),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 213/475 (45%), Positives = 300/475 (63%), Gaps = 20/475 (4%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HAIV   PYQGHINP ++L++ LAS+G T TFVN   +      A            F
Sbjct  1     KLHAIVFSPPYQGHINPIVNLALKLASKGITTTFVNFRHVHHHQTHAAAAADDHDP---F  57

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGM-MYVFSAHVDELVKKLAGLEPPP-  2528
             ++AR SGLD+RY T+SDGFPL FDR      ++  + ++   A  DELV ++A     P 
Sbjct  58    SRARASGLDVRYATMSDGFPLEFDRRLRLDEYLTRLYLHELPARADELVGRIAAEFGAPW  117

Query  2529  -TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSI  2705
                L+AD+ +     +A K+ +V VSF+ +PALVF++  HL+LLK N HF  KD  ++ I
Sbjct  118   INFLVADTAFFPVVDVARKFGIVAVSFWPQPALVFSLMYHLELLKANPHFPFKDEAEEEI  177

Query  2706  DYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISA  2885
              +IPG+ +I  +DL   L+ E+     +   V K FE+ KKAD V+ NTV+E+EP+ ++A
Sbjct  178   TFIPGISSINTKDLMQNLK-ESGARGVIPDIVSKAFEEVKKADFVLHNTVEEVEPEILAA  236

Query  2886  LEEKQPFYAIGPL--FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTK  3059
             L  +QP YA+GP+  F QS T     +SLLPE DC  WL SKPPG VLY SFGS    + 
Sbjct  237   LNRRQPNYAVGPVNFFEQSPTISPVSKSLLPEIDCTDWLKSKPPGRVLYVSFGSFVDGST  296

Query  3060  EHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISH  3239
             E ++E+  GL+LS V+F+W LRPG  + D+ D   D F   + +RGL++PWC+Q  V+S 
Sbjct  297   ELVVEIAHGLLLSGVHFVWSLRPGF-VRDDGD--ADPFSGELNERGLVIPWCNQIKVLSD  353

Query  3240  PAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSIS  3419
             PAVGGF+TH GWNS +ES+WC VPMICYP+  DQ  NRKLVV+EWK+G+NL   D KS+ 
Sbjct  354   PAVGGFLTHNGWNSTVESVWCGVPMICYPVYFDQLPNRKLVVEEWKVGLNLS--DGKSVD  411

Query  3420  KEEVASKVKFLM---KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKI  3575
             + +VA K++ L     AE+S  +R+    ++    +A+G  GSS +N ++FV+ +
Sbjct  412   RMQVAEKIRTLFSSSNAEAS-SIRRRASQLKNTFRDAVG--GSSERNFNRFVQDL  463



>gb|EPS66197.1| hypothetical protein M569_08579, partial [Genlisea aurea]
Length=608

 Score =   394 bits (1012),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/307 (62%), Positives = 231/307 (75%), Gaps = 3/307 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKP D+GP +L+E++S LS+CKK++WIGP+ F +S +   G  +LA  +D LS   C+V
Sbjct  299   GWKPTDIGPQSLKEMASCLSECKKVMWIGPLGFRTSEIVKDGIFQLAGSLDKLS--GCEV  356

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             + VGKM    F G S S +  N +  A+VVWE LKGR LPGL+ALDRAYPF +DW  +Y 
Sbjct  357   TFVGKMESTEFLGKSKSFSNCNFLPGATVVWEALKGRKLPGLMALDRAYPFHIDWNAVYA  416

Query  1464  DPDRPLVVDIGSGNGLFLFGMARRKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVATN  1643
             DP RPLVVDIGSGNGLFLF MARRKD NFLGLE+N KLV RCLD       +N+HF+AT+
Sbjct  417   DPLRPLVVDIGSGNGLFLFAMARRKDTNFLGLEMNEKLVDRCLDDARCHEFRNLHFLATD  476

Query  1644  ATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQS  1823
             ATSTF S++SSYPG L+L SIQCPNPDFNKP + WRML++SLVEAI D L  GGK+FLQS
Sbjct  477   ATSTFMSVVSSYPGELILASIQCPNPDFNKPEYCWRMLRRSLVEAIIDKLVIGGKIFLQS  536

Query  1824  DIEEVAIRMKEEFSKYGKGKLEV-ENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             DIE VAIRMKE+F ++ K  L + E+    A+   GWLKENPFG+ S WE+HVL RGDPM
Sbjct  537   DIEAVAIRMKEKFMEHSKTMLVILESHGDLAVDNQGWLKENPFGVPSSWEKHVLCRGDPM  596

Query  2001  YRLCLSK  2021
             YRL LSK
Sbjct  597   YRLLLSK  603


 Score =   224 bits (570),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 169/269 (63%), Gaps = 8/269 (3%)
 Frame = +1

Query  349   FPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKK---LDPHSASTVKYLCEARAKVILV  519
             FPHVQ L  FPK EL GKVVMVR DS I+    K+   L  ++ ST+ YL +A A+V+LV
Sbjct  6     FPHVQNLRSFPKSELLGKVVMVRMDSMIISRGMKEHQWLPDNAFSTIIYLQKAGARVVLV  65

Query  520   GSWSSTINSK-----PLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLE  684
              SW++   S        ++E VA +LS VL ++V+P K         ++      +LLL+
Sbjct  66    SSWNANAKSSFHSEASPSVETVAMFLSLVLGVEVVPVKFFRRSTFTELDHEKNQIVLLLD  125

Query  685   NISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLG  864
             N+   K++ +NC KFA++LS  VDI VND+FSE HK+LASTVG+A    A IAGF F+  
Sbjct  126   NLFSFKEERANCPKFARELSSAVDIIVNDAFSESHKVLASTVGVASHTYAYIAGFFFEEN  185

Query  865   LSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVP  1044
             L +++ II   ++PY+ I+ G NL  KAAALH L SICD L+FVG +AFQIMH   +P+P
Sbjct  186   LCKMKNIIDISERPYMTIVTGNNLDGKAAALHTLISICDGLIFVGTIAFQIMHILRIPIP  245

Query  1045  IKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             + LV    L  A  IVE AK  N+ ++ P
Sbjct  246   MNLVNPGELLMATEIVEHAKSRNIPLVLP  274



>ref|XP_011091588.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X2 [Sesamum 
indicum]
Length=495

 Score =   389 bits (1000),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 291/482 (60%), Gaps = 15/482 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTEL----IDSLIIKARRG--TTTA  2336
             K HAI++   +QGHI P  HL++ LAS+G TVT+V TE     + S    AR    +   
Sbjct  8     KLHAIMVQFLFQGHITPFSHLALALASKGCTVTYVQTEFQHYQMKSTAASARHDQLSNEE  67

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               D  F  AR SGLDIRYTTISDGFPL FDR  +   F   ++  F A VDELV K+   
Sbjct  68    AVDLFFPGARESGLDIRYTTISDGFPLDFDRDLNFLEFYESILRDFPARVDELVGKIVES  127

Query  2517  EPPPT-CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
             +   T  L+AD+ Y WP  IA+KYN+V V+F+T  AL  ++  H +LLKENG        
Sbjct  128   DRSLTPFLVADATYLWPPAIANKYNMVQVAFWTSTALHLSLGYHFELLKENGQLLLGGQD  187

Query  2694  KDSIDYIPGVEAIEPRDLPLY--LQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELE  2867
              D ID +PGV      D   Y    ++      VY  + K   + +KAD ++CNTV+ELE
Sbjct  188   MDHID-VPGVRRSNIEDFIKYDTTDEDPQVPIPVYENIMKARREIRKADFILCNTVEELE  246

Query  2868  PQTISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             P+ I  +++    YAIGP  F  +F + T+  SL  E+DC KWL+SKP GSVLY SFGSL
Sbjct  247   PEAILGIKQSLQTYAIGPTNFFANFNKVTSVSSLQFETDCTKWLNSKPVGSVLYISFGSL  306

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLR-PGMAITDEMDFSMDGFQECVRDRGLIVPWCHQ  3221
             A   K+ + E+  GL+++ VNFIWVL    +  +DE      GF     D+GLI+PWC Q
Sbjct  307   AQADKQLVWEIACGLLIARVNFIWVLSLEALNSSDETSALPPGFMADTEDKGLIIPWCDQ  366

Query  3222  PAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCND  3401
              AV+S  A+G F+THCGWNS+LESIW  VP+ICYP   DQP NR +VVD+WK+GINLC  
Sbjct  367   RAVLSSTAIGAFLTHCGWNSLLESIWYGVPVICYPFSTDQPFNRNMVVDDWKVGINLC--  424

Query  3402  DDKSISKEEVASKVKFLMKAESSIEL-RKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             +   +SKE VA  +  LM   +S  L ++ +K   K + +A+  +GSS +N+D F++ +K
Sbjct  425   EKGPVSKERVAETINSLMNGTASGNLIKQNMKKTSKIVHDAVEKDGSSTRNLDHFLKDLK  484

Query  3579  AK  3584
              K
Sbjct  485   TK  486



>gb|EYU34490.1| hypothetical protein MIMGU_mgv1a002752mg [Erythranthe guttata]
Length=641

 Score =   392 bits (1007),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 239/314 (76%), Gaps = 6/314 (2%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             +GW+PVD+GP +LEE+   +S CKKI+WIGP++FSSS  + G   KLA  V  LS  +C 
Sbjct  330   EGWQPVDIGPRSLEEMILLISGCKKIMWIGPLRFSSSKQDKGATFKLAEAVGTLS--SCT  387

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
              + VGKM  +   G S+  + +N++ +ASVVWE LKGRNLPGL+ALDRAYPF +DW   Y
Sbjct  388   TTYVGKMEFEKLQGKSTFFSNDNVLTSASVVWEVLKGRNLPGLVALDRAYPFTVDWGVSY  447

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
             +DP RPLVVDIGSGNGL LFGMAR RKD NFLGL++N  LV RCLD V Q  + NVHF+ 
Sbjct  448   SDPMRPLVVDIGSGNGLLLFGMARTRKDMNFLGLKMNANLVDRCLDDVRQLGICNVHFIT  507

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTFRSI+SSYPG LVLVSIQCPNPDFNKP +RWRMLQ+SLVEAI ++L  GG+VFL
Sbjct  508   TNATSTFRSIVSSYPGELVLVSIQCPNPDFNKPENRWRMLQRSLVEAITNMLIFGGQVFL  567

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLEVENLD---KAAIHQGGWLKENPFGIRSDWEQHVLDR  1988
             QSDI+ VA+RMK EF +YGKGKL +       +   +   WL ENPFG+ SDWE HVLDR
Sbjct  568   QSDIKAVAVRMKNEFIEYGKGKLVISEHSHDVENNNNNTEWLNENPFGVPSDWENHVLDR  627

Query  1989  GDPMYRLCLSKSES  2030
             G+PMYRL L+K ES
Sbjct  628   GNPMYRLLLTKVES  641


 Score =   264 bits (674),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 190/283 (67%), Gaps = 12/283 (4%)
 Frame = +1

Query  286   VKSQLTALDKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKKKLDPH  465
             V+S L        C   +   FPH+Q+L  FPKEELFGKVV+VRFD+ IL         +
Sbjct  35    VESGLVKKMHDPVCDGGQFTAFPHIQSLRNFPKEELFGKVVLVRFDAVILLHGNLSPPAN  94

Query  466   SASTVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAW  645
             + ST+KYL EA AKVILVGSW+    S     E+VA +LSS L ++V+P           
Sbjct  95    AFSTIKYLYEAGAKVILVGSWNENTGSN----ESVAGFLSSNLGIQVVPVHSD-------  143

Query  646   IEKRTELD-ILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIAC  822
             +E R +   ILLLEN+   K++ +NC KFA++L++GVDI VND+FSE HK+LASTVGIA 
Sbjct  144   VENRKKASSILLLENLFGFKEERANCSKFAKELAYGVDIIVNDAFSESHKVLASTVGIAR  203

Query  823   FCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGE  1002
             F  A IAGF+F+  L +L+KI  T +KPY AIIGGGN  DKA AL FL S CD ++FVG+
Sbjct  204   FSYAYIAGFYFEECLYKLKKITGTTEKPYFAIIGGGNFADKADALRFLVSKCDGVIFVGK  263

Query  1003  MAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
             MAFQI+HA G+ VP+KL+E  ALK+A +IVE AK  N+ ++ P
Sbjct  264   MAFQIIHALGVHVPMKLLELGALKEAVSIVEYAKSRNIPLVFP  306



>ref|XP_011091587.1| PREDICTED: UDP-glycosyltransferase 86A1-like isoform X1 [Sesamum 
indicum]
Length=537

 Score =   389 bits (998),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 216/482 (45%), Positives = 291/482 (60%), Gaps = 15/482 (3%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTEL----IDSLIIKARRG--TTTA  2336
             K HAI++   +QGHI P  HL++ LAS+G TVT+V TE     + S    AR    +   
Sbjct  50    KLHAIMVQFLFQGHITPFSHLALALASKGCTVTYVQTEFQHYQMKSTAASARHDQLSNEE  109

Query  2337  PTDDIFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGL  2516
               D  F  AR SGLDIRYTTISDGFPL FDR  +   F   ++  F A VDELV K+   
Sbjct  110   AVDLFFPGARESGLDIRYTTISDGFPLDFDRDLNFLEFYESILRDFPARVDELVGKIVES  169

Query  2517  EPPPT-CLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCR  2693
             +   T  L+AD+ Y WP  IA+KYN+V V+F+T  AL  ++  H +LLKENG        
Sbjct  170   DRSLTPFLVADATYLWPPAIANKYNMVQVAFWTSTALHLSLGYHFELLKENGQLLLGGQD  229

Query  2694  KDSIDYIPGVEAIEPRDLPLY--LQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELE  2867
              D ID +PGV      D   Y    ++      VY  + K   + +KAD ++CNTV+ELE
Sbjct  230   MDHID-VPGVRRSNIEDFIKYDTTDEDPQVPIPVYENIMKARREIRKADFILCNTVEELE  288

Query  2868  PQTISALEEKQPFYAIGPL-FPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSL  3044
             P+ I  +++    YAIGP  F  +F + T+  SL  E+DC KWL+SKP GSVLY SFGSL
Sbjct  289   PEAILGIKQSLQTYAIGPTNFFANFNKVTSVSSLQFETDCTKWLNSKPVGSVLYISFGSL  348

Query  3045  AHLTKEHIMELGRGLMLSEVNFIWVLR-PGMAITDEMDFSMDGFQECVRDRGLIVPWCHQ  3221
             A   K+ + E+  GL+++ VNFIWVL    +  +DE      GF     D+GLI+PWC Q
Sbjct  349   AQADKQLVWEIACGLLIARVNFIWVLSLEALNSSDETSALPPGFMADTEDKGLIIPWCDQ  408

Query  3222  PAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCND  3401
              AV+S  A+G F+THCGWNS+LESIW  VP+ICYP   DQP NR +VVD+WK+GINLC  
Sbjct  409   RAVLSSTAIGAFLTHCGWNSLLESIWYGVPVICYPFSTDQPFNRNMVVDDWKVGINLC--  466

Query  3402  DDKSISKEEVASKVKFLMKAESSIEL-RKAIKDVRKNLENALGSNGSSVKNVDKFVEKIK  3578
             +   +SKE VA  +  LM   +S  L ++ +K   K + +A+  +GSS +N+D F++ +K
Sbjct  467   EKGPVSKERVAETINSLMNGTASGNLIKQNMKKTSKIVHDAVEKDGSSTRNLDHFLKDLK  526

Query  3579  AK  3584
              K
Sbjct  527   TK  528



>ref|XP_010907027.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Elaeis guineensis]
Length=566

 Score =   388 bits (997),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 240/307 (78%), Gaps = 6/307 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW P+DLGP +L+E+SS LS CKKI+ IG +KF S   +  GAS+LA M+  +S  +CDV
Sbjct  263   GWTPIDLGPVSLKELSSLLSICKKILLIGSIKFDSVKEDTVGASELALMLQKISMTDCDV  322

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC+A  G S S T   M +NASVVWEFLKGR LPG+ ALD AYP ++DW   + 
Sbjct  323   TVVGNAACNAVAGTSCSITQYRMFKNASVVWEFLKGRILPGVAALDIAYPHDLDWNIAFP  382

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PL+VDIGSGNGLFL  MARR +++NFLGLEIN+KLV+RCL++V QS +KN +F++T
Sbjct  383   DPSKPLIVDIGSGNGLFLLKMARRWQNYNFLGLEINKKLVRRCLNNVLQSNIKNGYFIST  442

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG L+LV+IQCPNPDFN+  HRWRM+Q+ L+EAI DLL + GKVFLQ
Sbjct  443   NATSTFRSIVSSYPGYLILVTIQCPNPDFNREEHRWRMVQRMLIEAIVDLLITNGKVFLQ  502

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE VA RMKE+F  YGKG+L V+  DK      GW +ENPFGIRSDWEQHV+DRG PM
Sbjct  503   SDIEAVARRMKEQFIMYGKGRLVVDG-DKNM----GWREENPFGIRSDWEQHVIDRGAPM  557

Query  2001  YRLCLSK  2021
             +R+ L K
Sbjct  558   FRIMLRK  564


 Score =   169 bits (427),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 146/224 (65%), Gaps = 3/224 (1%)
 Frame = +1

Query  517   VGSWSST-INSKPLALEAV-AEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENI  690
              GSWSS  + S+   L +  +E+  +  Q+ +  TK    + ++ + K   +DILLL+N+
Sbjct  33    TGSWSSKQLQSRLGNLRSRRSEFRVTCWQV-LDSTKTCRVQEVSKMNKWENVDILLLDNL  91

Query  691   SQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLS  870
             ++ +++V+NC KF+++LS G  IFVND+FS  HKILASTVG+  FC A +AGF+F+  L 
Sbjct  92    TKFREEVANCSKFSEKLSSGATIFVNDAFSLSHKILASTVGVTRFCHASVAGFNFEEELL  151

Query  871   QLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIK  1050
             QL+KI +T ++PY+AIIGG N ++KA ALH LA  CD L F G++AFQIM+A GL VP  
Sbjct  152   QLKKISKTTRQPYLAIIGGSNFLEKANALHLLAYKCDGLYFFGKLAFQIMNALGLSVPGC  211

Query  1051  LVERKALKQAHAIVEAAKVGNLLILDPAHWRKFLAFFQNARKLY  1182
              VE+ A+ +A  +++ A    + I  P  +  F    Q+ R+++
Sbjct  212   FVEQDAVGEALKLIQHAHRRKISIYFPNDFWCFNNSKQDLREIF  255



>gb|EYU36656.1| hypothetical protein MIMGU_mgv11b024665mg [Erythranthe guttata]
Length=471

 Score =   382 bits (981),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 217/489 (44%), Positives = 282/489 (58%), Gaps = 69/489 (14%)
 Frame = +3

Query  2184  AIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDD-----  2348
              + +P  Y G  +  +  +    S G TVTFV TE +        R +T A  DD     
Sbjct  32    CVFIPYKYFGRKSIWLGTTTRWGSMGCTVTFVQTEFLH------HRISTAAAGDDEEREI  85

Query  2349  --IFTQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEP  2522
               I   AR SGLDIRY TISDGFPL FDR  +   F   ++  F   VDE + ++   E 
Sbjct  86    PEIILGARESGLDIRYATISDGFPLKFDREANFEEFWGSILRDFPGRVDEFLGRITAAEN  145

Query  2523  -----PPTCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKD  2687
                  PP+ L+AD+ Y W S IA KYN+ +VSF+TE AL F++  HLDLLK N HF    
Sbjct  146   CDGGVPPSFLVADTTYLWASEIAHKYNMFSVSFWTEAALAFSVGYHLDLLKLNAHF----  201

Query  2688  CRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELE  2867
                                 P+         + +Y  +   +E  KKAD ++CNTVQELE
Sbjct  202   --------------------PI-------VNNVLYQNIIDAYEQVKKADFILCNTVQELE  234

Query  2868  PQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLA  3047
             PQ +SAL +KQP YA+ P               +   DC KWLDSKP GSVLY SFGS  
Sbjct  235   PQALSALNQKQPTYAVAPP--------------ISPVDCQKWLDSKPHGSVLYISFGSTI  280

Query  3048  HLTKEHIMELGRGLMLSE--VNFIWVLRPGMA-ITDEMDFSMD--GFQECVRDRGLIVPW  3212
                 + I E+  GLMLS+  VNFIW+LR  +  IT + D  +   GF++CV DRGL++PW
Sbjct  281   ETNTQLIHEIAHGLMLSQQRVNFIWILRRNLVRITSDDDDDLLPPGFEDCVGDRGLVIPW  340

Query  3213  CHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINL  3392
             C+Q  V+S P +G F+THCGWNS+LESIW  VPMIC+PL VDQPTNRKLVVD+WKIGINL
Sbjct  341   CNQSLVLSDPRIGCFLTHCGWNSVLESIWHGVPMICFPLSVDQPTNRKLVVDDWKIGINL  400

Query  3393  CNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEK  3572
             C+D  K IS+++VA K+  LM +  +  LR+ IK V   L  A  ++GSS  N+D+F+  
Sbjct  401   CDDQTKQISRQQVAQKIDHLMSSGIT-SLRREIKKVETILHRAWAADGSSNGNLDRFLHD  459

Query  3573  IKAKFNQSS  3599
             +KAK +  S
Sbjct  460   LKAKTHSKS  468



>ref|XP_010907026.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Elaeis guineensis]
Length=677

 Score =   389 bits (998),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 240/307 (78%), Gaps = 6/307 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW P+DLGP +L+E+SS LS CKKI+ IG +KF S   +  GAS+LA M+  +S  +CDV
Sbjct  374   GWTPIDLGPVSLKELSSLLSICKKILLIGSIKFDSVKEDTVGASELALMLQKISMTDCDV  433

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG  AC+A  G S S T   M +NASVVWEFLKGR LPG+ ALD AYP ++DW   + 
Sbjct  434   TVVGNAACNAVAGTSCSITQYRMFKNASVVWEFLKGRILPGVAALDIAYPHDLDWNIAFP  493

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP +PL+VDIGSGNGLFL  MARR +++NFLGLEIN+KLV+RCL++V QS +KN +F++T
Sbjct  494   DPSKPLIVDIGSGNGLFLLKMARRWQNYNFLGLEINKKLVRRCLNNVLQSNIKNGYFIST  553

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG L+LV+IQCPNPDFN+  HRWRM+Q+ L+EAI DLL + GKVFLQ
Sbjct  554   NATSTFRSIVSSYPGYLILVTIQCPNPDFNREEHRWRMVQRMLIEAIVDLLITNGKVFLQ  613

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SDIE VA RMKE+F  YGKG+L V+  DK      GW +ENPFGIRSDWEQHV+DRG PM
Sbjct  614   SDIEAVARRMKEQFIMYGKGRLVVDG-DKNM----GWREENPFGIRSDWEQHVIDRGAPM  668

Query  2001  YRLCLSK  2021
             +R+ L K
Sbjct  669   FRIMLRK  675


 Score =   251 bits (640),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 214/338 (63%), Gaps = 18/338 (5%)
 Frame = +1

Query  187   LVCRKNSLASPKHKLRRTCRKIKKFQRLQFSSPVKSQLTALDKAEACYESELRLFPHVQT  366
             L  R  +L S + + R TC ++         S    ++  +DK     ES L  FPHVQT
Sbjct  41    LQSRLGNLRSRRSEFRVTCWQV-------LDSTKTCRVQEVDKDGDSDESNL--FPHVQT  91

Query  367   LGQFPKEELFGKVVMVRFDSTILPVDKKKLDPHSAS------TVKYLCEARAKVILVGSW  528
             L  FP E+++G+VV+VRFDST+L    + LD ++ S      T+KYL  A AKV+LV +W
Sbjct  92    LRNFPIEKIYGEVVIVRFDSTLL---LEALDSNNFSLDKSLFTIKYLFNAGAKVLLVSNW  148

Query  529   SSTINSKPLALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDD  708
                 +   L++E++A+ LSS+LQ+KV+P    S  M + + K   +DILLL+N+++ +++
Sbjct  149   GRPGDPMLLSVESLADRLSSLLQVKVVPANDVSGLMQSKMNKWENVDILLLDNLTKFREE  208

Query  709   VSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKII  888
             V+NC KF+++LS G  IFVND+FS  HKILASTVG+  FC A +AGF+F+  L QL+KI 
Sbjct  209   VANCSKFSEKLSSGATIFVNDAFSLSHKILASTVGVTRFCHASVAGFNFEEELLQLKKIS  268

Query  889   RTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKA  1068
             +T ++PY+AIIGG N ++KA ALH LA  CD L F G++AFQIM+A GL VP   VE+ A
Sbjct  269   KTTRQPYLAIIGGSNFLEKANALHLLAYKCDGLYFFGKLAFQIMNALGLSVPGCFVEQDA  328

Query  1069  LKQAHAIVEAAKVGNLLILDPAHWRKFLAFFQNARKLY  1182
             + +A  +++ A    + I  P  +  F    Q+ R+++
Sbjct  329   VGEALKLIQHAHRRKISIYFPNDFWCFNNSKQDLREIF  366



>gb|EMT03715.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=440

 Score =   378 bits (971),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 189/470 (40%), Positives = 278/470 (59%), Gaps = 50/470 (11%)
 Frame = +3

Query  2175  KHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARRGTTTAPTDDIF  2354
             K HA+V+  P QGH+ P  HL++ LA+RGF VT VNTE +      AR         D F
Sbjct  17    KPHAVVVVYPLQGHVIPVTHLALRLAARGFAVTLVNTEAVHDQ--TARALGVDPAGHDFF  74

Query  2355  TQARNSGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPPPTC  2534
                R SG+D+RY  +SDG P+GFDR+      M  +++  S HV+E++ ++  ++P  TC
Sbjct  75    AGTRASGMDVRYELVSDGLPVGFDRSLHHDELMSSLLHALSGHVEEVLGRVV-VDPAATC  133

Query  2535  LIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYI  2714
             L+AD+F+ WP+ +ASK+ +  VSF+TEPAL+F +  H+ LL  NGHFGC + RKD+I YI
Sbjct  134   LVADTFFVWPATLASKFGIAYVSFWTEPALIFNLYYHVHLLTNNGHFGCNEPRKDTITYI  193

Query  2715  PGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISALEE  2894
             PGV AIEP +L  YLQ E +TTS V+  ++K F++A+ AD V+CNTV+ELEP TI+AL  
Sbjct  194   PGVPAIEPHELMSYLQ-ETDTTSVVHRIIFKAFDEARGADYVLCNTVEELEPSTIAALRA  252

Query  2895  KQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIME  3074
             ++PFYA+GP+FP  F       S+  ESDC  WLD++PPGSVLY SFGS AH+TK+ + E
Sbjct  253   EKPFYAVGPIFPAGFARSAVATSMWAESDCSHWLDAQPPGSVLYISFGSYAHVTKQELHE  312

Query  3075  LGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGG  3254
             +  G++ S   F+WV+RP +  +DE                              P   G
Sbjct  313   IAGGVLASGARFLWVMRPDIVSSDE----------------------------PGPLPEG  344

Query  3255  FITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVA  3434
                  GW  +  +                 TNR+LVV EW++G+ +   D  ++  +EV 
Sbjct  345   VADASGWRGVAGAF----------------TNRRLVVREWRVGVPI--GDRGAVFADEVR  386

Query  3435  SKVKFLMKAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEKIKAK  3584
             ++++ +M  +   ELR+A+K +R  LE A    GSS ++ D+FV+++  +
Sbjct  387   ARIEGVMSGKEGEELREAVKKMRATLEAATSHGGSSQRSFDEFVDELTCR  436



>ref|XP_009616936.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like isoform 
X4 [Nicotiana tomentosiformis]
Length=641

 Score =   381 bits (979),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 226/312 (72%), Gaps = 46/312 (15%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKPVD+GP+TLEE+ S LS+CK                                     
Sbjct  373   GWKPVDVGPNTLEEMISVLSRCK-------------------------------------  395

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
                   AC+ F G SS   A ++I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY 
Sbjct  396   ------ACETFVGKSSYVMA-DLIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIYA  448

Query  1464  DPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+AT
Sbjct  449   NTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIAT  508

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFLQ
Sbjct  509   NATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFLQ  568

Query  1821  SDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDP  1997
             SD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG P
Sbjct  569   SDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGAP  628

Query  1998  MYRLCLSKSESS  2033
             MYRL L KS  S
Sbjct  629   MYRLLLLKSSPS  640


 Score =   308 bits (789),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 232/350 (66%), Gaps = 18/350 (5%)
 Frame = +1

Query  130   MSQILENFQTFLL-----FRNQCFL------VCRKNSLASPKHKLRRTCRKIK-KFQRLQ  273
             MS++L+ F  + L     F N C        +  ++S   P     ++C++++   + L 
Sbjct  1     MSRVLDFFLEYSLPRISDFHNGCTRFQDLQQISSRSSYGKPS--AVQSCKRVQFSLEALN  58

Query  274   FSSPVKSQLTAL-DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK  450
                   + L +L D+AEAC   +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++K
Sbjct  59    LEVADHADLHSLPDEAEACDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQK  118

Query  451   KLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKL  621
             K    +A   ST+KYL  A AK++L+ SWS   +S+ L LE VAE+LSS L+LKVIP +L
Sbjct  119   KKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLERVAEFLSSELELKVIPVEL  178

Query  622   GSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILA  801
             GS    + +E     DILLLEN+SQ K + +NC +FA++LS GVDIFVND+F + HKILA
Sbjct  179   GSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSSGVDIFVNDAFFQSHKILA  238

Query  802   STVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICD  981
             S VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG NL  KAAAL FLAS CD
Sbjct  239   SNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAGKAAALQFLASRCD  298

Query  982   ALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
               +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK   + I+ P
Sbjct  299   GFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKARGVKIVLP  348



>ref|XP_009616935.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like isoform 
X3 [Nicotiana tomentosiformis]
Length=643

 Score =   381 bits (979),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 226/313 (72%), Gaps = 46/313 (15%)
 Frame = +3

Query  1101  KGWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCD  1280
             K WKPVD+GP+TLEE+ S LS+CK                                    
Sbjct  374   KSWKPVDVGPNTLEEMISVLSRCK------------------------------------  397

Query  1281  VSIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIY  1460
                    AC+ F G SS   A ++I+NAS+VWEFLKGR L GLLALDRAYPFE++W  IY
Sbjct  398   -------ACETFVGKSSYVMA-DLIENASIVWEFLKGRKLHGLLALDRAYPFELNWDAIY  449

Query  1461  NDPDRPLVVDIGSGNGLFLFGMAR-RKDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVA  1637
              +   PLVVD+GSGNGLFLF MA+ RKD+NFLG+E N KLV RCLDHVSQS M N +F+A
Sbjct  450   ANTTLPLVVDVGSGNGLFLFRMAKMRKDWNFLGMENNEKLVSRCLDHVSQSGMTNGYFIA  509

Query  1638  TNATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFL  1817
             TNATSTF+SI+SSYPG LVLVSIQCPNPDFNK  +RWRM+++SLVEAIADLLAS GKVFL
Sbjct  510   TNATSTFQSIVSSYPGDLVLVSIQCPNPDFNKTEYRWRMVRRSLVEAIADLLASDGKVFL  569

Query  1818  QSDIEEVAIRMKEEFSKYGKGKLE-VENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGD  1994
             QSD++EVA+RMKEEF KYGKGKL  V +L+ +  HQ  WLKENPFGIRSDWEQHV+DRG 
Sbjct  570   QSDVKEVAVRMKEEFMKYGKGKLTVVHDLEDSTSHQDRWLKENPFGIRSDWEQHVIDRGA  629

Query  1995  PMYRLCLSKSESS  2033
             PMYRL L KS  S
Sbjct  630   PMYRLLLLKSSPS  642


 Score =   308 bits (790),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 173/350 (49%), Positives = 232/350 (66%), Gaps = 18/350 (5%)
 Frame = +1

Query  130   MSQILENFQTFLL-----FRNQCFL------VCRKNSLASPKHKLRRTCRKIK-KFQRLQ  273
             MS++L+ F  + L     F N C        +  ++S   P     ++C++++   + L 
Sbjct  1     MSRVLDFFLEYSLPRISDFHNGCTRFQDLQQISSRSSYGKPS--AVQSCKRVQFSLEALN  58

Query  274   FSSPVKSQLTAL-DKAEACYESELRLFPHVQTLGQFPKEELFGKVVMVRFDSTILPVDKK  450
                   + L +L D+AEAC   +  + PHVQTL  FP+EEL GKVVMVR D TIL  ++K
Sbjct  59    LEVADHADLHSLPDEAEACDGRDSDILPHVQTLRNFPEEELMGKVVMVRLDLTILLREQK  118

Query  451   KLDPHSA---STVKYLCEARAKVILVGSWSSTINSKPLALEAVAEYLSSVLQLKVIPTKL  621
             K    +A   ST+KYL  A AK++L+ SWS   +S+ L LE VAE+LSS L+LKVIP +L
Sbjct  119   KKHSSAARVISTIKYLHNAGAKLVLISSWSPKADSQLLKLERVAEFLSSELELKVIPVEL  178

Query  622   GSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILA  801
             GS    + +E     DILLLEN+SQ K + +NC +FA++LS GVDIFVND+F + HKILA
Sbjct  179   GSGLEQSLMEDGHNSDILLLENLSQFKQEQANCSEFARRLSSGVDIFVNDAFFQSHKILA  238

Query  802   STVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICD  981
             S VGI  FC + IAGFHF  G+SQL+KII+ +K PY AIIGG NL  KAAAL FLAS CD
Sbjct  239   SNVGITSFCYSSIAGFHFDEGMSQLKKIIKMNKWPYYAIIGGANLAGKAAALQFLASRCD  298

Query  982   ALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAKVGNLLILDP  1131
               +FVG+ AFQIMHAFGLPVP++LVE+++L+ A  ++EAAK   + I+ P
Sbjct  299   GFIFVGDAAFQIMHAFGLPVPMELVEQESLEAADMLLEAAKARGVKIVLP  348



>ref|XP_010107502.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
 gb|EXC16184.1| UDP-glycosyltransferase 86A1 [Morus notabilis]
Length=544

 Score =   377 bits (968),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 206/444 (46%), Positives = 278/444 (63%), Gaps = 47/444 (11%)
 Frame = +3

Query  2181  HAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELIDSLIIKARR-GTTTAPTDDIFT  2357
             HAIV+P+P QGH+ PA++L++ LAS GFT+TF+N E+I   I  +          +DIF 
Sbjct  11    HAIVMPVPLQGHVIPAVNLALKLASNGFTITFINNEIIRHKITTSHPPANFDGSENDIFC  70

Query  2358  QARNSGLDIRYTTISDGFPLGFDRTTDAYGFMM-GMMYVFSAHVDELVKKLA--GLEPPP  2528
              AR  GLDIR+ T+ DGFPL FDR  +   ++  G ++     +DELV  +     +PP 
Sbjct  71    GARECGLDIRHRTVGDGFPLSFDRLANDERYLEEGQLHAVPVLMDELVGDIVKEARDPPV  130

Query  2529  TCLIADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDSID  2708
             +CLIAD F+ WPS+IA KY+LV VSF+TEPALVF +  HLDLLK NGH+   D R+D+ID
Sbjct  131   SCLIADGFFTWPSMIAEKYDLVFVSFWTEPALVFTLYYHLDLLKTNGHYASHDNREDTID  190

Query  2709  YIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTISAL  2888
             YIPGV+AIEP+DLP YLQ E + ++ ++  +   F+D K+AD V+CNTV+ELE + ISAL
Sbjct  191   YIPGVKAIEPKDLPSYLQ-ETDVSTVMHRLIDVAFKDVKRADFVLCNTVEELESKPISAL  249

Query  2889  EEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASFGSLAHLTKEHI  3068
             +EKQPFYAIGPLFP   T+     SL PES+C +WL++KP GSVLY SFGS     K  I
Sbjct  250   QEKQPFYAIGPLFPSGLTKGVVPTSLRPESNCTQWLNTKPHGSVLYVSFGSFLTSRKSDI  309

Query  3069  MELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVISHPAV  3248
              E+  GL LS+VNFIWVLR  +   +E       F+E V+DRGL V W +Q  +      
Sbjct  310   DEIALGLALSKVNFIWVLRHDVVSYEEPYVLPIEFEE-VKDRGLTVTWTNQAEI------  362

Query  3249  GGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLCNDDDKSISKEE  3428
                                             TN+KL+VD+WKIG+NL   D K +++ +
Sbjct  363   --------------------------------TNKKLIVDDWKIGLNLS--DGKPLTRFD  388

Query  3429  VASKVKFLMKAESSIELR-KAIKD  3497
             VA+K+  LM  +SS EL+ + +KD
Sbjct  389   VAAKINRLMSGKSSAELKTETMKD  412


 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +3

Query  2664  NGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVI  2843
             NG     D R D IDYIPGV+AIE +DLP YLQ E + ++ ++  + + F+D +KAD ++
Sbjct  426   NGKHWPTDNRHDIIDYIPGVKAIESKDLPSYLQ-ETDVSTIMHRLIDEAFKDVEKADFIL  484

Query  2844  CNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVL  3023
             CNT++ELE + I AL+EKQPFYAIGPL P  FT+     SL PES+C +WL++K P S L
Sbjct  485   CNTIEELELEAILALQEKQPFYAIGPL-PSGFTKGIVPTSLRPESNCTQWLNTKGPFSSL  543



>ref|XP_006833177.1| hypothetical protein AMTR_s00072p00151180 [Amborella trichopoda]
 gb|ERM98455.1| hypothetical protein AMTR_s00072p00151180 [Amborella trichopoda]
Length=760

 Score =   375 bits (964),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 234/310 (75%), Gaps = 3/310 (1%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GWKP+DLGP +L +ISS LS+ KK++WIGPVK  +S     GAS+L   +       C +
Sbjct  450   GWKPIDLGPKSLTDISSLLSESKKVLWIGPVKLGTSQ-EKNGASRLVFTLGQACANGCLL  508

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
             ++VG+ AC A     +S + +   ++A+VVW+ LKG++LPG+ ALD+AYP+ ++W  IY+
Sbjct  509   TVVGRAACKAIKEVETSQSMQYCFKSAAVVWKILKGQSLPGVAALDQAYPYVLNWSSIYD  568

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP  PL+VDIGSGNGLFL  MAR     NFLGLEIN+KLV RCL+ V +  ++N HF++T
Sbjct  569   DPSGPLIVDIGSGNGLFLLRMARTWSSLNFLGLEINKKLVHRCLESVQKFGLRNGHFIST  628

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NAT+TFRSI+SSYPG L+LVS+QCP+PDFNK  HRWRMLQ++L+EAI DLL+  GKVFLQ
Sbjct  629   NATTTFRSIVSSYPGFLLLVSVQCPDPDFNKSDHRWRMLQRTLIEAITDLLSGEGKVFLQ  688

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQG-GWLKENPFGIRSDWEQHVLDRGDP  1997
             SDI+ VA RMK++F +YG+GKL V+       + G GWLK NPF ++SDWEQHV+DRGDP
Sbjct  689   SDIKSVATRMKQQFIRYGRGKLLVDVDGIGVEYDGEGWLKHNPFSVQSDWEQHVIDRGDP  748

Query  1998  MYRLCLSKSE  2027
             MYR+ L+K++
Sbjct  749   MYRVMLAKAD  758


 Score =   253 bits (645),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 200/309 (65%), Gaps = 7/309 (2%)
 Frame = +1

Query  220   KHKLRRTCRKIKKFQRLQFSSPVKSQLTALD-KAEACYESELRLFPHVQTLGQFPKEELF  396
             + + R +  ++K   R   + P+K+  T++D + E C  +E  +   VQ L  +PKE+LF
Sbjct  119   QRRTRSSLLRLKVRYRHMLTEPIKN--TSVDYEVELCNGAEKDIILPVQCLRNYPKEDLF  176

Query  397   GKVVMVRFDSTILPVDKKKLDPHSA----STVKYLCEARAKVILVGSWSSTINSKPLALE  564
             GK+VMVRFDST+L  + + L+  S     +++KYLC A AKV++V  W     S  L  +
Sbjct  177   GKIVMVRFDSTVLFKEGQMLELKSVHRAFASIKYLCNAGAKVVIVTDWGEPNGSTRLPTQ  236

Query  565   AVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTELDILLLENISQLKDDVSNCQKFAQQLS  744
             +VA+YLS  LQ+KV+        + +  +K    DILLLEN+S  K++V+NC  F+++LS
Sbjct  237   SVADYLSKFLQVKVLAADGIYGRVQSKQQKLETADILLLENLSVYKEEVANCPIFSEKLS  296

Query  745   FGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGLSQLEKIIRTDKKPYVAIIG  924
              G+DIFVND+FS+ H+ILASTVG+  F  A +AGFHF+  L +L K +   K+PY+A+IG
Sbjct  297   SGIDIFVNDAFSDSHRILASTVGVVRFAHASVAGFHFEEELLRLTKALEIIKRPYIAVIG  356

Query  925   GGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPIKLVERKALKQAHAIVEAAK  1104
             GGNL+DK++AL  LAS CD LVFVG MAFQ MHA GLPV   L+E  A  +A  ++  AK
Sbjct  357   GGNLMDKSSALCHLASHCDGLVFVGTMAFQFMHALGLPVSSGLLEVGAAAEALKLINLAK  416

Query  1105  VGNLLILDP  1131
               N+ IL P
Sbjct  417   ERNIPILIP  425



>ref|XP_009334676.1| PREDICTED: UDP-glycosyltransferase 86A1-like [Pyrus x bretschneideri]
Length=559

 Score =   364 bits (935),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/326 (55%), Positives = 230/326 (71%), Gaps = 2/326 (1%)
 Frame = +3

Query  2610  TEPALVFAIDSHLDLLKENGHFGCKDCRKDSIDYIPGVEAIEPRDLPLYLQQENNTTSAV  2789
             TEPALVF I  HLDLLK+NGHFG  D R+D IDYIPGV+AIEP+DL  +LQ   +  S +
Sbjct  232   TEPALVFNIYYHLDLLKKNGHFGSHDNREDIIDYIPGVKAIEPKDLMSHLQS-TDLFSPM  290

Query  2790  YLTVYKGFEDAKKADIVICNTVQELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLL  2969
               T YK F + K+AD ++CNTVQELE +++SAL+ KQP YAIGP+ P S T      +L+
Sbjct  291   LRTFYKSFREVKRADFILCNTVQELEFESLSALQAKQPTYAIGPVLPDSLTNNIVATNLM  350

Query  2970  PESDCCKWLDSKPPGSVLYASFGSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDE  3149
             PE DC  WL  KP GSVL+ SFGS A +TK+   E+  GL+LS+ NFIWVLRP     DE
Sbjct  351   PEFDCIHWLHKKPHGSVLFISFGSYAQVTKDDFEEIAHGLLLSKANFIWVLRPDTTGYDE  410

Query  3150  MDFSMDGFQECVRDRGLIVPWCHQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPL  3329
                   GF++ ++DRGL+VPWC Q  V+SHPAVGGF+THCGWNSILES+ C VPM+C+PL
Sbjct  411   TYILPVGFEDEIKDRGLMVPWCSQIEVLSHPAVGGFLTHCGWNSILESMRCGVPMLCFPL  470

Query  3330  IVDQPTNRKLVVDEWKIGINLCNDDDKSISKEEVASKVKFLMKAESSIELRKAIKDVRKN  3509
             + DQ TNRKLVVD+W +G+NLC D  K + + EVA K+  L+  +S   L+K +  V + 
Sbjct  471   VDDQITNRKLVVDDWGVGLNLC-DRVKPVRRVEVAEKINRLICGKSGDGLQKKVMKVTQT  529

Query  3510  LENALGSNGSSVKNVDKFVEKIKAKF  3587
             LE+A+  NGSS KN+ +F+  +K K 
Sbjct  530   LEDAVALNGSSQKNLSQFISNVKEKI  555



>ref|XP_010234765.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Brachypodium distachyon]
Length=659

 Score =   358 bits (920),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 224/307 (73%), Gaps = 6/307 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW+PVD+GPSTLE+ISS +   KKI+WIGP  +  +   + G ++L  ++D  SQ +CDV
Sbjct  357   GWRPVDIGPSTLEKISSLMPSYKKILWIGPTSYDLTKEISVGEAQLGQILDKASQNSCDV  416

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VG  AC A  G S  ++  +  +N S+VWEFLKGR LPG+ ALD++YP+++ W  +++
Sbjct  417   ILVGSAACKAVKGISDFSSQYSAFENGSIVWEFLKGRILPGIAALDKSYPYQIPWTDVFS  476

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP+ PL VDIGSGNGLFLF M+R  +  NFLGLE+N KLV RCL  ++ +  +N+HFV+T
Sbjct  477   DPEHPLFVDIGSGNGLFLFQMSRNWEGSNFLGLEMNEKLVTRCLQDLASAEKRNLHFVST  536

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSIISSYPG L +V+IQCPNPDFNK  +RWRM+++ LVEA+ADLL   GK+FLQ
Sbjct  537   NATSTFRSIISSYPGELTMVTIQCPNPDFNKEQNRWRMVRRMLVEAVADLLQINGKIFLQ  596

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SD+E V + MKE+F  +GKG+L V+  D      G    ENPFG+ SDWE HVL RGDPM
Sbjct  597   SDVESVLLGMKEQFISHGKGRLVVDRDDG-----GHGRMENPFGVASDWEGHVLARGDPM  651

Query  2001  YRLCLSK  2021
             YR  L K
Sbjct  652   YRTMLRK  658


 Score =   224 bits (572),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 174/269 (65%), Gaps = 12/269 (4%)
 Frame = +1

Query  355   HVQTLGQFPKEELFGKVVMVRFDSTIL--PVDKKKLD-PHSASTVKYLCEARAKVILVGS  525
             HVQTL  FP ++L G+VV+VR DS +L  P+    L    + ST+KYL +A  KV+LV S
Sbjct  63    HVQTLRNFPIDKLCGEVVLVRLDSVLLLNPLGSCNLSLKRTLSTIKYLHKAGGKVLLVTS  122

Query  526   WSSTINS-KPL--ALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTEL---DILLLEN  687
             W   + S  P+  + E+ A+Y+SS+LQ+ VIP   G   + ++  K+ EL   DI+L EN
Sbjct  123   WDPVLQSVNPVLKSTESFADYMSSLLQVNVIPMN-GVPCLTSF--KKEELAQNDIILFEN  179

Query  688   ISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLGL  867
             +   + + +NC  F+Q+L+ GV IFVNDSFS  HKI ASTVGI  FC A +AGFHF+  L
Sbjct  180   LLNFRGENANCNDFSQKLASGVGIFVNDSFSLSHKIRASTVGITRFCYASLAGFHFEEEL  239

Query  868   SQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVPI  1047
              QL K   T ++PY+AIIGG N + K  ALH LAS CD L FVG++AFQIM+  G+PVP 
Sbjct  240   MQLLKTTDTTRRPYIAIIGGSNFLRKTPALHLLASQCDGLFFVGKLAFQIMNGLGIPVPS  299

Query  1048  KLVERKALKQAHAIVEAAKVGNLLILDPA  1134
              L+ER A K+A  +++ A   N+ I  P 
Sbjct  300   CLIERNATKEALQLIQIAHNRNIPIYYPT  328



>ref|XP_010234764.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Brachypodium distachyon]
Length=689

 Score =   358 bits (919),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 224/307 (73%), Gaps = 6/307 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW+PVD+GPSTLE+ISS +   KKI+WIGP  +  +   + G ++L  ++D  SQ +CDV
Sbjct  387   GWRPVDIGPSTLEKISSLMPSYKKILWIGPTSYDLTKEISVGEAQLGQILDKASQNSCDV  446

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VG  AC A  G S  ++  +  +N S+VWEFLKGR LPG+ ALD++YP+++ W  +++
Sbjct  447   ILVGSAACKAVKGISDFSSQYSAFENGSIVWEFLKGRILPGIAALDKSYPYQIPWTDVFS  506

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             DP+ PL VDIGSGNGLFLF M+R  +  NFLGLE+N KLV RCL  ++ +  +N+HFV+T
Sbjct  507   DPEHPLFVDIGSGNGLFLFQMSRNWEGSNFLGLEMNEKLVTRCLQDLASAEKRNLHFVST  566

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSIISSYPG L +V+IQCPNPDFNK  +RWRM+++ LVEA+ADLL   GK+FLQ
Sbjct  567   NATSTFRSIISSYPGELTMVTIQCPNPDFNKEQNRWRMVRRMLVEAVADLLQINGKIFLQ  626

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SD+E V + MKE+F  +GKG+L V+  D      G    ENPFG+ SDWE HVL RGDPM
Sbjct  627   SDVESVLLGMKEQFISHGKGRLVVDRDDG-----GHGRMENPFGVASDWEGHVLARGDPM  681

Query  2001  YRLCLSK  2021
             YR  L K
Sbjct  682   YRTMLRK  688


 Score =   224 bits (572),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 175/271 (65%), Gaps = 12/271 (4%)
 Frame = +1

Query  349   FPHVQTLGQFPKEELFGKVVMVRFDSTIL--PVDKKKLD-PHSASTVKYLCEARAKVILV  519
             + HVQTL  FP ++L G+VV+VR DS +L  P+    L    + ST+KYL +A  KV+LV
Sbjct  91    YLHVQTLRNFPIDKLCGEVVLVRLDSVLLLNPLGSCNLSLKRTLSTIKYLHKAGGKVLLV  150

Query  520   GSWSSTINS-KPL--ALEAVAEYLSSVLQLKVIPTKLGSSEMMAWIEKRTEL---DILLL  681
              SW   + S  P+  + E+ A+Y+SS+LQ+ VIP   G   + ++  K+ EL   DI+L 
Sbjct  151   TSWDPVLQSVNPVLKSTESFADYMSSLLQVNVIPMN-GVPCLTSF--KKEELAQNDIILF  207

Query  682   ENISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQL  861
             EN+   + + +NC  F+Q+L+ GV IFVNDSFS  HKI ASTVGI  FC A +AGFHF+ 
Sbjct  208   ENLLNFRGENANCNDFSQKLASGVGIFVNDSFSLSHKIRASTVGITRFCYASLAGFHFEE  267

Query  862   GLSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPV  1041
              L QL K   T ++PY+AIIGG N + K  ALH LAS CD L FVG++AFQIM+  G+PV
Sbjct  268   ELMQLLKTTDTTRRPYIAIIGGSNFLRKTPALHLLASQCDGLFFVGKLAFQIMNGLGIPV  327

Query  1042  PIKLVERKALKQAHAIVEAAKVGNLLILDPA  1134
             P  L+ER A K+A  +++ A   N+ I  P 
Sbjct  328   PSCLIERNATKEALQLIQIAHNRNIPIYYPT  358



>gb|ABB47707.1| methyltransferase family protein, expressed [Oryza sativa Japonica 
Group]
Length=673

 Score =   355 bits (910),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 226/307 (74%), Gaps = 6/307 (2%)
 Frame = +3

Query  1104  GWKPVDLGPSTLEEISSFLSKCKKIIWIGPVKFSSSNLNAGGASKLAAMVDALSQRNCDV  1283
             GW P D+GPSTLE+ISS +   KK++WIGP  F  +   +GGA++L  ++D  S  +CDV
Sbjct  371   GWTPADIGPSTLEKISSLMPLYKKVLWIGPTCFDLTEEFSGGAAQLGRILDKASHDSCDV  430

Query  1284  SIVGKMACDAFHGNSSSATAENMIQNASVVWEFLKGRNLPGLLALDRAYPFEMDWKCIYN  1463
              +VG  AC A  G S S++     +NASVV EFLKG+ LPG+ ALD++YP+++ W  I++
Sbjct  431   ILVGSAACKAVKGISGSSSKYTTFKNASVVLEFLKGKILPGVAALDKSYPYQIPWNAIFS  490

Query  1464  DPDRPLVVDIGSGNGLFLFGMARR-KDFNFLGLEINRKLVKRCLDHVSQSVMKNVHFVAT  1640
             D  +PLVVDIGSGNGLFLF MAR  +  NFLGLE+N+KLV RCL  V+    +N++FV+T
Sbjct  491   DSSQPLVVDIGSGNGLFLFQMARDWEGSNFLGLEMNKKLVVRCLRDVASVDKRNLYFVST  550

Query  1641  NATSTFRSIISSYPGRLVLVSIQCPNPDFNKPGHRWRMLQKSLVEAIADLLASGGKVFLQ  1820
             NATSTFRSI+SSYPG+L LV+IQCPNPDFN+  +RWRM+++ LVEAIADLL   GKV+LQ
Sbjct  551   NATSTFRSIVSSYPGQLALVTIQCPNPDFNREQNRWRMVRRMLVEAIADLLQPNGKVYLQ  610

Query  1821  SDIEEVAIRMKEEFSKYGKGKLEVENLDKAAIHQGGWLKENPFGIRSDWEQHVLDRGDPM  2000
             SD+E V +RMKE+F  +GKG+L V++ D    HQ     +NPFG  SDWE+HVL RG PM
Sbjct  611   SDVESVLLRMKEQFMTHGKGQLVVDD-DGGGDHQ----MDNPFGAASDWERHVLARGAPM  665

Query  2001  YRLCLSK  2021
             YR  L K
Sbjct  666   YRTMLRK  672


 Score =   220 bits (561),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 174/270 (64%), Gaps = 14/270 (5%)
 Frame = +1

Query  355   HVQTLGQFPKEELFGKVVMVRFDSTIL--PVDKKKLD-PHSASTVKYLCEARAKVILVGS  525
             HVQ++  FP E+L  +VV+VR DS ++  P+    L    + ST+KYL +A AKV+LV S
Sbjct  80    HVQSVRDFPIEKLNAEVVLVRLDSELICNPLGSCSLSLERTVSTIKYLQKAGAKVLLVTS  139

Query  526   WSSTINS-KPL--ALEAVAEYLSSVLQLKVIPTK----LGSSEMMAWIEKRTELDILLLE  684
             W+  + S  P+  + E  A+Y+SS+LQ+KV+P      L S +   W++     DI+L E
Sbjct  140   WTPVLQSVYPVLKSTETFADYMSSLLQVKVVPVNGVPGLTSFKPEGWMQN----DIILFE  195

Query  685   NISQLKDDVSNCQKFAQQLSFGVDIFVNDSFSEVHKILASTVGIACFCSACIAGFHFQLG  864
             N+   K + +NC  F+Q+L+ G  IFVNDSFS  HK+LASTVGI  FC A +AGFHF+  
Sbjct  196   NLLNFKGENANCNDFSQKLASGAAIFVNDSFSLSHKMLASTVGITRFCHASLAGFHFEEE  255

Query  865   LSQLEKIIRTDKKPYVAIIGGGNLIDKAAALHFLASICDALVFVGEMAFQIMHAFGLPVP  1044
             L QL KI  T ++P++AIIGG N + KA AL+ LAS+CD L FVG+++ QIM+ FG+PVP
Sbjct  256   LMQLRKITDTTRRPFIAIIGGSNFLGKAPALNLLASLCDGLFFVGKLSLQIMNGFGIPVP  315

Query  1045  IKLVERKALKQAHAIVEAAKVGNLLILDPA  1134
                VE+ + K+   +++ A   N+ I  P 
Sbjct  316   SCFVEKNSTKEVLQLIQTAHNRNIPIYYPT  345



>gb|EPS60356.1| hypothetical protein M569_14447, partial [Genlisea aurea]
Length=404

 Score =   345 bits (885),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 180/411 (44%), Positives = 263/411 (64%), Gaps = 15/411 (4%)
 Frame = +3

Query  2172  QKHHAIVLPMPYQGHINPAIHLSINLASRGFTVTFVNTELID-SLIIKARRGTTTAPTDD  2348
             +K  A++ P P+QGH+ PA++L++ LAS GF++TFV  E +   L    ++GT+     D
Sbjct  3     KKLQALLFPAPHQGHLTPAVNLALKLASEGFSITFVVFEYLHRKLSAIHKQGTSEF---D  59

Query  2349  IFTQARN-SGLDIRYTTISDGFPLGFDRTTDAYGFMMGMMYVFSAHVDELVKKLAGLEPP  2525
             +F++A N SGL I YTTI+DG P  FDR      F   +M  F   VDE V +    +P 
Sbjct  60    LFSEAHNKSGLKIDYTTIADGLPDDFDREARLVEFYEYLMNEFQPLVDEFVGEKIRSDPD  119

Query  2526  PTCLI-ADSFYAWPSIIASKYNLVNVSFFTEPALVFAIDSHLDLLKENGHFGCKDCRKDS  2702
              T  I +D+   W +  A KYNL++VSF+T+P++V+++  H +LL+E+GH+  KD  ++ 
Sbjct  120   TTYFIVSDTILLWQAAAAEKYNLLHVSFWTQPSMVYSLGWHSELLREHGHYPLKDNIEED  179

Query  2703  IDYIPGVEAIEPRDLPLYLQQENNTTSAVYLTVYKGFEDAKKADIVICNTVQELEPQTIS  2882
             +DY+PG++++  RD   YL+  +      Y    + F+ +KKAD V+ NTVQELE   +S
Sbjct  180   VDYVPGIQSVNTRDFMPYLRPSH----PFYDLGARAFDLSKKADFVLHNTVQELESSILS  235

Query  2883  ALEEKQPFYAIGPLFPQSFTEQTAF---RSLLPESDCCKWLDSKPPGSVLYASFGSLAHL  3053
             AL + +P YAIG     ++ +       +SL  ESDC +WL+SK P SVLY SFGS+   
Sbjct  236   ALNKYKPNYAIG--LTNTYGDLVKIPTKKSLWAESDCTRWLESKAPSSVLYISFGSMVLA  293

Query  3054  TKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWCHQPAVI  3233
             + + I E+  G++LS+VNFIWV R G   +         F +  +DRGLIVPWC Q  V+
Sbjct  294   SDQVIEEIVHGVILSQVNFIWVTRHGDKGSPLNIILPAAFDDEFKDRGLIVPWCDQIKVL  353

Query  3234  SHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGI  3386
             S P+VG F+THCGWNS++ESIWC +PM+CYP+  DQPTN+KLVVD+WK+G+
Sbjct  354   SSPSVGAFLTHCGWNSVMESIWCGIPMLCYPVEADQPTNKKLVVDDWKVGL  404



>ref|XP_006296293.1| hypothetical protein CARUB_v10025463mg [Capsella rubella]
 gb|EOA29191.1| hypothetical protein CARUB_v10025463mg [Capsella rubella]
Length=320

 Score =   341 bits (875),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 232/305 (76%), Gaps = 8/305 (3%)
 Frame = +3

Query  2685  DCRKDSIDYIPGVEAIEPRDLPLYLQ---QENNTTSAVYLTVYKGFEDAKKADIVICNTV  2855
             D R+D IDY+PGV+AIEP+DL  YLQ   ++ +T + VY  ++K F+D K+AD V+CNTV
Sbjct  3     DNREDVIDYVPGVKAIEPKDLMSYLQVSDKDVDTNTVVYRILFKAFKDVKRADFVLCNTV  62

Query  2856  QELEPQTISALEEKQPFYAIGPLFPQSFTEQTAFRSLLPESDCCKWLDSKPPGSVLYASF  3035
             QELEP ++SAL+ KQP YAIGP+F   +T+     SL  ESDC +WL  +P GSVLY SF
Sbjct  63    QELEPDSLSALQAKQPVYAIGPVF---YTDSVVPTSLWAESDCTEWLKGRPTGSVLYVSF  119

Query  3036  GSLAHLTKEHIMELGRGLMLSEVNFIWVLRPGMAITDEMDFSMDGFQECVRDRGLIVPWC  3215
             GS AH+ K+ I+E+  GL+LS ++FIWVLRP +  +D  DF  +GF +  +DRGL+V WC
Sbjct  120   GSYAHVGKKEIVEIAHGLLLSGISFIWVLRPDIVGSDVPDFLPNGFVDQAQDRGLVVQWC  179

Query  3216  HQPAVISHPAVGGFITHCGWNSILESIWCSVPMICYPLIVDQPTNRKLVVDEWKIGINLC  3395
              Q  VIS+PAVGGF THCGWNSILES+WC +P++CYPL+ DQ TNRK+VVD+W+IGINLC
Sbjct  180   CQMEVISNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKIVVDDWRIGINLC  239

Query  3396  NDDDKSISKEEVASKVKFLM-KAESSIELRKAIKDVRKNLENALGSNGSSVKNVDKFVEK  3572
              +++K++++E+V++ V+ LM K E+S ELR  ++ V+++L++A+ + GSS ++ + FV +
Sbjct  240   -ENNKNVTREQVSANVRRLMIKGETSSELRGNVEKVKRHLKDAVTAVGSSERSFNSFVCE  298

Query  3573  IKAKF  3587
             ++++ 
Sbjct  299   VRSRI  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12766418282232