BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24848_g2_i1 len=1671 path=[1082:0-1065 7841:1066-1089
6198:1090-1670]

Length=1671
                                                                      Score     E

ref|XP_009619139.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    592   0.0      
ref|XP_009786591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    581   0.0      
ref|XP_009783339.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    581   0.0      
ref|XP_009603729.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    576   0.0      
ref|XP_009799016.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    577   0.0      
gb|AHA90802.1|  cinnamyl alcohol acyltransferase 1                      575   0.0      
ref|XP_009589974.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    575   0.0      
ref|XP_002270252.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    572   0.0      Vitis vinifera
ref|XP_006488699.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    568   0.0      
ref|XP_007023568.1|  HXXXD-type acyl-transferase family protein, ...    565   0.0      
gb|KDO67093.1|  hypothetical protein CISIN_1g011528mg                   565   0.0      
ref|XP_006425196.1|  hypothetical protein CICLE_v10028328mg             564   0.0      
ref|XP_002270251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    563   0.0      Vitis vinifera
ref|XP_002270079.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    557   0.0      Vitis vinifera
ref|XP_004232772.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    556   0.0      
ref|XP_002271221.2|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    556   0.0      Vitis vinifera
ref|XP_006347188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    556   0.0      
ref|XP_002270325.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    556   0.0      Vitis vinifera
emb|CAN61304.1|  hypothetical protein VITISV_040201                     550   0.0      Vitis vinifera
ref|XP_002270076.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    544   0.0      Vitis vinifera
ref|XP_002270539.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    543   0.0      Vitis vinifera
ref|XP_002269682.3|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    539   0.0      Vitis vinifera
ref|XP_007023566.1|  HXXXD-type acyl-transferase family protein, ...    537   0.0      
ref|XP_002270208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    533   0.0      Vitis vinifera
ref|XP_002519354.1|  Anthranilate N-benzoyltransferase protein, p...    531   0.0      Ricinus communis
ref|XP_009348540.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    531   0.0      
emb|CAN75148.1|  hypothetical protein VITISV_027192                     531   0.0      Vitis vinifera
ref|XP_010654977.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    531   0.0      
ref|XP_006343272.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    530   0.0      
ref|XP_008344964.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    529   2e-180   
ref|XP_011031277.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    530   2e-180   
ref|XP_009344995.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    525   4e-179   
ref|XP_002310897.2|  hypothetical protein POPTR_0007s15050g             526   8e-179   Populus trichocarpa [western balsam poplar]
ref|XP_010087075.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    523   7e-178   
ref|XP_006488633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    522   1e-177   
gb|KDO60230.1|  hypothetical protein CISIN_1g012180mg                   522   1e-177   
ref|XP_004242867.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    521   2e-177   
ref|XP_011087026.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    521   3e-177   
ref|XP_008245068.1|  PREDICTED: anthranilate N-benzoyltransferase...    520   4e-177   
ref|XP_008380698.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    520   5e-177   
ref|XP_007217230.1|  hypothetical protein PRUPE_ppa005452mg             520   6e-177   
ref|XP_003617368.1|  Acetyltransferase, putative                        518   8e-176   
ref|XP_004305788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    514   7e-175   
ref|XP_003530722.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    514   2e-174   
ref|XP_003617366.1|  Anthranilate N-benzoyltransferase protein          514   2e-174   
ref|XP_006343402.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    514   3e-174   
ref|XP_006424489.1|  hypothetical protein CICLE_v10028364mg             513   4e-174   
gb|KDP25022.1|  hypothetical protein JCGZ_22557                         511   2e-173   
ref|XP_004305786.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    510   3e-173   
ref|XP_006586058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    508   3e-172   
ref|XP_004491310.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    508   4e-172   
ref|XP_004305787.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    506   8e-172   
ref|XP_007146239.1|  hypothetical protein PHAVU_006G023900g             507   1e-171   
gb|AHA90803.1|  cinnamyl alcohol acyltransferase 2                      506   2e-171   
emb|CBI18361.3|  unnamed protein product                                503   4e-171   
ref|XP_010040471.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    506   4e-171   
ref|XP_010034102.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    504   2e-170   
ref|XP_008228085.1|  PREDICTED: anthranilate N-benzoyltransferase...    503   4e-170   
ref|XP_003553148.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    501   2e-169   
gb|KHM99656.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    498   2e-168   
gb|KEH33677.1|  HXXXD-type acyl-transferase family protein              498   2e-168   
ref|XP_007146240.1|  hypothetical protein PHAVU_006G024000g             498   6e-168   
ref|XP_004303785.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    496   1e-167   
ref|XP_010058993.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    497   2e-167   
gb|KEH33678.1|  HXXXD-type acyl-transferase family protein              496   2e-167   
gb|KHN13176.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    496   3e-167   
emb|CDO99661.1|  unnamed protein product                                494   3e-167   
ref|XP_010058994.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    497   3e-167   
gb|EYU33936.1|  hypothetical protein MIMGU_mgv1a005884mg                494   9e-167   
ref|XP_002532044.1|  Anthranilate N-benzoyltransferase protein, p...    492   3e-166   Ricinus communis
ref|XP_010030883.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    492   2e-165   
ref|XP_011094024.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    489   4e-165   
gb|KCW54004.1|  hypothetical protein EUGRSUZ_J03198                     489   2e-164   
ref|XP_010040470.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    488   3e-164   
ref|XP_010251800.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    487   4e-164   
ref|XP_010034103.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    489   6e-164   
gb|KCW56804.1|  hypothetical protein EUGRSUZ_I02472                     487   1e-163   
ref|XP_010058984.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    484   1e-162   
ref|XP_003545151.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    481   1e-161   
gb|KHN11990.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    480   2e-161   
gb|KDP35222.1|  hypothetical protein JCGZ_09381                         480   4e-161   
ref|XP_010040766.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    477   7e-160   
ref|XP_003617373.1|  Taxadien-5-alpha-ol O-acetyltransferase            476   1e-159   
ref|XP_010539596.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    475   2e-159   
gb|KFK22998.1|  hypothetical protein AALP_AAs66525U000100               471   9e-158   
ref|XP_010539595.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    468   1e-156   
gb|ABG75942.1|  coniferyl alcohol acyltransferase                       467   2e-156   Petunia x hybrida [garden petunia]
gb|KFK42277.1|  hypothetical protein AALP_AA2G235000                    465   1e-155   
ref|XP_008778760.1|  PREDICTED: rosmarinate synthase-like               464   4e-155   
ref|XP_003519535.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    462   2e-154   
ref|NP_174567.1|  HXXXD-type acyl-transferase-like protein              462   2e-154   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38347.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    462   3e-154   
ref|XP_006301720.1|  hypothetical protein CARUB_v10022178mg             459   5e-153   
ref|XP_010429767.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    458   6e-153   
ref|XP_010417515.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    457   3e-152   
ref|XP_009104555.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    454   2e-151   
ref|XP_008795534.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    454   3e-151   
ref|XP_009106615.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    453   8e-151   
ref|XP_008783080.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    452   1e-150   
emb|CDX88496.1|  BnaC06g39400D                                          451   4e-150   
ref|XP_010472736.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    451   4e-150   
ref|XP_010472737.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    451   8e-150   
ref|NP_178020.1|  HXXXD-type acyl-transferase                           449   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343401.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    445   8e-149   
gb|KFK42268.1|  hypothetical protein AALP_AA2G233500                    446   9e-149   
ref|XP_002889224.1|  hypothetical protein ARALYDRAFT_316796             450   4e-148   
gb|EYU25783.1|  hypothetical protein MIMGU_mgv1a006078mg                446   6e-148   
ref|XP_009408072.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    445   8e-148   
gb|AAC17079.1|  Contains similarity to C2-HC type zinc finger pro...    449   9e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389934.1|  hypothetical protein EUTSA_v10018518mg             444   2e-147   
ref|XP_010938319.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    439   3e-145   
ref|XP_009609794.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    435   3e-145   
ref|XP_009385887.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    435   5e-144   
ref|XP_010928753.1|  PREDICTED: rosmarinate synthase                    426   2e-140   
ref|XP_002891015.1|  transferase family protein                         421   2e-138   
ref|XP_010041079.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    420   5e-138   
gb|KCW74067.1|  hypothetical protein EUGRSUZ_E02701                     418   2e-137   
ref|XP_009126112.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    413   3e-135   
gb|KDP25023.1|  hypothetical protein JCGZ_22558                         411   8e-135   
dbj|BAB09608.1|  unnamed protein product                                412   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197145.2|  HXXXD-type acyl-transferase-like protein              412   2e-134   Arabidopsis thaliana [mouse-ear cress]
gb|KCW44660.1|  hypothetical protein EUGRSUZ_L01809                     409   5e-134   
emb|CDP14267.1|  unnamed protein product                                406   3e-133   
ref|XP_010552395.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    399   1e-129   
emb|CDY57949.1|  BnaA07g38470D                                          392   7e-128   
ref|XP_010248256.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    382   2e-124   
ref|XP_010535222.1|  PREDICTED: agmatine coumaroyltransferase-1-like    377   4e-121   
gb|KHG25192.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    367   4e-119   
ref|XP_004978226.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    361   4e-115   
emb|CDX79279.1|  BnaC06g20240D                                          348   1e-111   
ref|XP_002447065.1|  hypothetical protein SORBIDRAFT_06g027990          350   2e-110   Sorghum bicolor [broomcorn]
ref|XP_008668908.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    347   1e-109   
tpg|DAA36101.1|  TPA: hypothetical protein ZEAMMB73_105025              349   2e-109   
gb|EMT19167.1|  Anthranilate N-benzoyltransferase protein 3             328   2e-102   
ref|NP_001053821.1|  Os04g0609300                                       324   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150771.1|  transferase                                        321   1e-99    Zea mays [maize]
ref|XP_003581633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    315   3e-97    
emb|CDY38115.1|  BnaC02g06580D                                          306   1e-95    
ref|XP_002447068.1|  hypothetical protein SORBIDRAFT_06g028020          311   1e-95    Sorghum bicolor [broomcorn]
gb|EMT02774.1|  Anthranilate N-benzoyltransferase protein 1             308   8e-95    
ref|XP_003581632.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    306   8e-94    
gb|ACU24086.1|  unknown                                                 295   2e-91    Glycine max [soybeans]
gb|KCW74058.1|  hypothetical protein EUGRSUZ_E02684                     293   8e-91    
ref|XP_004976754.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    298   9e-91    
emb|CBI33414.3|  unnamed protein product                                289   3e-88    
ref|XP_008245067.1|  PREDICTED: anthranilate N-benzoyltransferase...    287   5e-88    
ref|XP_006851033.1|  hypothetical protein AMTR_s00025p00227780          286   5e-88    
emb|CBI33412.3|  unnamed protein product                                284   2e-86    
ref|NP_001053822.1|  Os04g0609500                                       285   9e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603648.1|  PREDICTED: anthranilate N-benzoyltransferase...    282   1e-84    
gb|KFK22997.1|  hypothetical protein AALP_AAs66525U000100               273   7e-84    
ref|XP_009766130.1|  PREDICTED: anthranilate N-benzoyltransferase...    280   8e-84    
gb|KHM99654.1|  Anthranilate N-benzoyltransferase protein 1             274   3e-83    
ref|XP_006355150.1|  PREDICTED: anthranilate N-benzoyltransferase...    275   5e-82    
emb|CBI33422.3|  unnamed protein product                                260   3e-79    
emb|CBI33404.3|  unnamed protein product                                256   1e-77    
ref|XP_010654997.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   6e-77    
gb|EAZ31931.1|  hypothetical protein OsJ_16103                          262   7e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EMS59417.1|  Anthranilate N-benzoyltransferase protein 3             258   1e-76    
emb|CDP19817.1|  unnamed protein product                                259   4e-76    
emb|CBI33409.3|  unnamed protein product                                252   6e-76    
ref|XP_008778761.1|  PREDICTED: anthranilate N-benzoyltransferase...    251   4e-75    
ref|XP_010113024.1|  Omega-hydroxypalmitate O-feruloyl transferase      256   8e-75    
ref|XP_010244192.1|  PREDICTED: anthranilate N-benzoyltransferase...    255   8e-74    
gb|ACU18592.1|  unknown                                                 253   1e-73    Glycine max [soybeans]
ref|XP_011070203.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   2e-73    
ref|XP_003519086.1|  PREDICTED: anthranilate N-benzoyltransferase...    253   2e-73    
gb|KDP28072.1|  hypothetical protein JCGZ_19480                         252   3e-73    
ref|XP_006368253.1|  transferase family protein                         251   4e-73    
ref|XP_006471640.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    251   9e-73    
ref|XP_004148999.1|  PREDICTED: anthranilate N-benzoyltransferase...    250   1e-72    
emb|CDY38112.1|  BnaC02g06610D                                          248   1e-72    
ref|XP_007040904.1|  HXXXD-type acyl-transferase family protein         249   2e-72    
ref|XP_011018370.1|  PREDICTED: anthranilate N-benzoyltransferase...    249   3e-72    
ref|XP_007145597.1|  hypothetical protein PHAVU_007G252100g             249   4e-72    
emb|CBI18360.3|  unnamed protein product                                244   1e-71    
ref|XP_008380661.1|  PREDICTED: anthranilate N-benzoyltransferase...    248   1e-71    
ref|XP_010943006.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    248   2e-71    
ref|XP_008451859.1|  PREDICTED: anthranilate N-benzoyltransferase...    247   3e-71    
ref|XP_008238079.1|  PREDICTED: anthranilate N-benzoyltransferase...    246   4e-71    
ref|XP_006303518.1|  hypothetical protein CARUB_v10010922mg             246   5e-71    
ref|XP_007210153.1|  hypothetical protein PRUPE_ppa023735mg             245   1e-70    
ref|XP_003612550.1|  Omega-hydroxypalmitate O-feruloyl transferase      245   1e-70    
ref|XP_009374636.1|  PREDICTED: anthranilate N-benzoyltransferase...    245   2e-70    
ref|XP_004512355.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    244   3e-70    
ref|XP_010478899.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   3e-69    
ref|XP_002891141.1|  transferase family protein                         241   3e-69    
ref|XP_006471642.1|  PREDICTED: anthranilate N-benzoyltransferase...    241   6e-69    
emb|CDY12305.1|  BnaA09g25050D                                          239   1e-68    
ref|XP_004166659.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    240   1e-68    
emb|CBI18364.3|  unnamed protein product                                234   3e-68    
ref|XP_006432873.1|  hypothetical protein CICLE_v10003717mg             238   4e-68    
emb|CDY62304.1|  BnaA09g54240D                                          238   4e-68    
ref|XP_002274239.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    238   5e-68    Vitis vinifera
emb|CAN76941.1|  hypothetical protein VITISV_042905                     238   7e-68    Vitis vinifera
ref|XP_004243072.2|  PREDICTED: uncharacterized protein LOC101253393    230   1e-67    
ref|XP_009114984.1|  PREDICTED: anthranilate N-benzoyltransferase...    237   1e-67    
ref|XP_006415323.1|  hypothetical protein EUTSA_v10009746mg             237   1e-67    
ref|XP_010918051.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    237   2e-67    
ref|XP_004301771.1|  PREDICTED: anthranilate N-benzoyltransferase...    237   2e-67    
ref|NP_174434.1|  HXXXD-type acyl-transferase-like protein              235   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519084.1|  PREDICTED: anthranilate N-benzoyltransferase...    235   5e-67    
ref|XP_010499698.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   7e-67    
ref|XP_008228082.1|  PREDICTED: uncharacterized protein LOC103327529    223   7e-66    
emb|CBI33421.3|  unnamed protein product                                228   8e-66    
ref|XP_010056138.1|  PREDICTED: anthranilate N-benzoyltransferase...    232   1e-65    
emb|CAN83973.1|  hypothetical protein VITISV_018429                     230   2e-65    Vitis vinifera
gb|KFK44930.1|  hypothetical protein AALP_AA1G321300                    230   4e-65    
gb|EEE61652.1|  hypothetical protein OsJ_16104                          228   1e-64    Oryza sativa Japonica Group [Japonica rice]
emb|CBI33415.3|  unnamed protein product                                214   4e-61    
emb|CBI33403.3|  unnamed protein product                                213   2e-60    
emb|CBI33419.3|  unnamed protein product                                212   2e-60    
ref|XP_008800447.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    215   2e-59    
ref|XP_006432870.1|  hypothetical protein CICLE_v10003778mg             201   1e-54    
gb|EPS71697.1|  hypothetical protein M569_03062                         196   2e-52    
ref|XP_002519902.1|  transferase, putative                              191   5e-51    Ricinus communis
emb|CBI29221.3|  unnamed protein product                                192   5e-51    
ref|XP_010555967.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    185   1e-50    
ref|XP_006851032.1|  hypothetical protein AMTR_s00025p00227680          171   2e-46    
gb|EMT01890.1|  hypothetical protein F775_20351                         176   3e-46    
ref|XP_010942972.1|  PREDICTED: agmatine coumaroyltransferase-2-like    179   5e-46    
ref|XP_002873775.1|  predicted protein                                  175   8e-46    
ref|XP_008808376.1|  PREDICTED: agmatine coumaroyltransferase-2-like    173   4e-44    
gb|KCW74060.1|  hypothetical protein EUGRSUZ_E02688                     161   2e-42    
gb|KCW74065.1|  hypothetical protein EUGRSUZ_E02699                     161   2e-42    
ref|XP_009391475.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    168   2e-42    
gb|EMT15648.1|  Anthranilate N-benzoyltransferase protein 1             167   8e-42    
dbj|BAA92405.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    164   5e-41    Oryza sativa Japonica Group [Japonica rice]
gb|EAY73387.1|  hypothetical protein OsI_01269                          164   2e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_004971568.1|  PREDICTED: anthranilate N-benzoyltransferase...    161   7e-40    
gb|KCW74064.1|  hypothetical protein EUGRSUZ_E02693                     152   2e-39    
ref|XP_008361799.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    150   7e-39    
ref|NP_001042650.2|  Os01g0261600                                       155   4e-38    Oryza sativa Japonica Group [Japonica rice]
gb|AFW55789.1|  agmatine coumaroyltransferase                           155   6e-38    
ref|NP_001146980.1|  LOC100280589                                       155   9e-38    Zea mays [maize]
ref|XP_006655791.1|  PREDICTED: agmatine coumaroyltransferase-2-like    154   2e-37    
gb|KHN23945.1|  Anthranilate N-benzoyltransferase protein 1             148   2e-37    
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    153   3e-37    
dbj|BAJ95580.1|  predicted protein                                      153   4e-37    
gb|KHG25194.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    144   7e-37    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    150   2e-36    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   4e-36    
ref|XP_010023888.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    148   1e-35    
ref|XP_010023890.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    148   1e-35    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                148   2e-35    
ref|XP_004966759.1|  PREDICTED: anthranilate N-benzoyltransferase...    148   2e-35    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   2e-35    
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   2e-35    
ref|XP_010031397.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    147   2e-35    
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   2e-35    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   2e-35    
gb|AFS68800.1|  hydroxycinnamoyl transferase                            147   3e-35    
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   3e-35    
gb|EAY73389.1|  hypothetical protein OsI_01271                          147   5e-35    Oryza sativa Indica Group [Indian rice]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         146   5e-35    
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    146   6e-35    
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         146   7e-35    
ref|XP_010023889.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    145   7e-35    
ref|XP_004967783.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    146   8e-35    
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    145   9e-35    
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    145   1e-34    
ref|XP_010463047.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    144   1e-34    
gb|ACF85647.1|  unknown                                                 145   1e-34    Zea mays [maize]
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    145   2e-34    
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   2e-34    
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   2e-34    
dbj|BAJ96756.1|  predicted protein                                      145   3e-34    
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    144   3e-34    
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   3e-34    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             144   3e-34    
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    144   4e-34    
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   4e-34    
emb|CBI83579.1|  hydroxycinnamoyl transferase                           143   4e-34    
emb|CDO98242.1|  unnamed protein product                                143   5e-34    
gb|KDO46398.1|  hypothetical protein CISIN_1g039950mg                   138   5e-34    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    143   5e-34    Coffea arabica [arabica coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    143   7e-34    Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      143   7e-34    
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    143   8e-34    Coffea canephora [robusta coffee]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           142   8e-34    
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    143   8e-34    
ref|NP_001146851.1|  agmatine coumaroyltransferase                      143   1e-33    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    142   1e-33    
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   1e-33    
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    142   1e-33    
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    142   1e-33    
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   1e-33    
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   1e-33    
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             142   1e-33    
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            142   1e-33    
ref|XP_010023895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    141   2e-33    
emb|CDY11732.1|  BnaC06g13400D                                          142   2e-33    
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    141   2e-33    
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    141   2e-33    
ref|XP_010023896.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    141   2e-33    
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    142   2e-33    
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    141   2e-33    
ref|XP_010247719.1|  PREDICTED: agmatine coumaroyltransferase-2-like    141   2e-33    
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    142   2e-33    
emb|CDY22880.1|  BnaA01g18180D                                          141   3e-33    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             141   3e-33    
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    141   3e-33    
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       141   3e-33    
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   3e-33    
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    140   4e-33    
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    140   4e-33    
ref|XP_006851034.1|  hypothetical protein AMTR_s00025p00228010          135   4e-33    
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   140   5e-33    
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    140   6e-33    
ref|XP_006653749.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   6e-33    
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    140   7e-33    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    139   8e-33    
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    140   8e-33    
emb|CDY44162.1|  BnaC01g22120D                                          139   8e-33    
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   8e-33    
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    139   9e-33    
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    140   9e-33    
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   1e-32    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            139   1e-32    
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    140   1e-32    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   1e-32    
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     140   1e-32    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    140   1e-32    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             139   1e-32    
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    139   1e-32    
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   2e-32    
ref|XP_010031392.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    139   2e-32    
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    139   2e-32    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    139   2e-32    
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    139   2e-32    
dbj|BAJ87867.1|  predicted protein                                      138   2e-32    
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             138   2e-32    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    138   2e-32    
emb|CDY31956.1|  BnaA07g00390D                                          138   2e-32    
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    138   3e-32    
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             138   3e-32    
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             138   3e-32    
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    138   3e-32    
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   4e-32    
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    137   4e-32    
emb|CDY05770.1|  BnaC07g00330D                                          137   4e-32    
ref|XP_002870657.1|  transferase family protein                         137   5e-32    
dbj|BAK03783.1|  predicted protein                                      138   5e-32    
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    137   5e-32    
gb|ADG46003.1|  hydroxycinnamoyl transferase                            137   6e-32    
emb|CDM83195.1|  unnamed protein product                                137   6e-32    
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         137   8e-32    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    137   8e-32    
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    137   8e-32    
gb|KCW74068.1|  hypothetical protein EUGRSUZ_E02702                     130   9e-32    
emb|CDX67482.1|  BnaA07g15220D                                          137   9e-32    
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       137   9e-32    
gb|KCW60297.1|  hypothetical protein EUGRSUZ_H03012                     136   1e-31    
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg             137   1e-31    
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase         136   1e-31    
gb|AEO00530.1|  hydroxycinnamoyl transferase                            135   1e-31    
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    137   1e-31    
gb|EAY99655.1|  hypothetical protein OsI_21633                          136   1e-31    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   1e-31    
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase         136   1e-31    
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    136   1e-31    
ref|XP_006368492.1|  transferase family protein                         136   2e-31    
ref|XP_003562118.1|  PREDICTED: anthranilate N-benzoyltransferase...    137   2e-31    
ref|NP_001174603.1|  Os06g0150550                                       136   2e-31    
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   2e-31    
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   2e-31    
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             135   2e-31    
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   2e-31    
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    135   2e-31    
ref|NP_001130649.1|  transferase isoform 1                              135   3e-31    
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    135   3e-31    
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    135   4e-31    
ref|XP_002894568.1|  transferase family protein                         135   4e-31    
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             135   4e-31    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    135   4e-31    
gb|AFW75530.1|  hypothetical protein ZEAMMB73_669200                    135   4e-31    
ref|XP_003575891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    135   4e-31    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          135   4e-31    
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg             135   5e-31    
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    134   5e-31    
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   5e-31    
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   5e-31    
ref|XP_003561102.1|  PREDICTED: rosmarinate synthase-like               135   6e-31    
emb|CDY48963.1|  BnaA04g10770D                                          134   6e-31    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    134   6e-31    
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       134   6e-31    
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    134   6e-31    
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    134   6e-31    
ref|XP_010026785.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    134   7e-31    
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    134   8e-31    
gb|ACG29622.1|  transferase                                             134   8e-31    
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    134   9e-31    
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    134   9e-31    
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    134   9e-31    
ref|XP_010248407.1|  PREDICTED: agmatine coumaroyltransferase-2-like    134   1e-30    
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                    134   1e-30    
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    133   1e-30    
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    133   1e-30    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    133   1e-30    
gb|KCW50679.1|  hypothetical protein EUGRSUZ_J00365                     133   1e-30    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    133   1e-30    
ref|XP_010068232.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    134   1e-30    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    133   1e-30    
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   1e-30    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    134   2e-30    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             133   2e-30    
ref|XP_010031398.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    133   2e-30    
emb|CAN82918.1|  hypothetical protein VITISV_023290                     132   2e-30    
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-30    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   2e-30    
ref|XP_010026821.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    132   2e-30    
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             132   2e-30    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    132   3e-30    
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             132   3e-30    
ref|XP_010068233.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    133   3e-30    
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    132   3e-30    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    132   4e-30    
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   5e-30    
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830          131   5e-30    
ref|XP_010023900.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    131   6e-30    
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   6e-30    
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   6e-30    
ref|XP_008374212.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    131   6e-30    
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    131   7e-30    
ref|XP_010065637.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    131   7e-30    
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   7e-30    
gb|EAY99714.1|  hypothetical protein OsI_21696                          131   8e-30    
ref|XP_010023898.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    131   8e-30    
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   8e-30    
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    131   9e-30    
gb|KCW63211.1|  hypothetical protein EUGRSUZ_G00829                     131   1e-29    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   1e-29    
dbj|BAJ86050.1|  predicted protein                                      131   1e-29    
ref|XP_001785388.1|  predicted protein                                  130   1e-29    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    130   1e-29    
ref|XP_009375174.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    130   2e-29    
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    130   2e-29    
ref|XP_010031390.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    130   2e-29    
ref|NP_001275190.1|  feruloyl transferase                               130   2e-29    
ref|XP_010023884.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    130   2e-29    
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    130   2e-29    
ref|XP_009611199.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    130   2e-29    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    130   2e-29    
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    130   2e-29    
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             129   2e-29    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   2e-29    
ref|XP_010065636.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    129   2e-29    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                129   3e-29    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   3e-29    
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   3e-29    
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             129   3e-29    
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   3e-29    
dbj|BAJ89730.1|  predicted protein                                      129   3e-29    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   3e-29    
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   4e-29    
gb|ABR17170.1|  unknown                                                 129   4e-29    
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    129   4e-29    
ref|XP_004297519.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    129   4e-29    
gb|KCW63206.1|  hypothetical protein EUGRSUZ_G00822                     129   5e-29    
dbj|BAJ91746.1|  predicted protein                                      129   5e-29    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          128   5e-29    
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   5e-29    
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   6e-29    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    129   6e-29    
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    129   6e-29    
emb|CDP07005.1|  unnamed protein product                                128   6e-29    
emb|CDY68497.1|  BnaCnng59260D                                          128   6e-29    
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   6e-29    
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    128   6e-29    
ref|XP_010023883.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    128   7e-29    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    128   7e-29    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           128   7e-29    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   7e-29    
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   7e-29    
ref|XP_004962590.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    128   8e-29    
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    128   9e-29    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    128   9e-29    
ref|XP_010068209.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    127   1e-28    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           127   1e-28    
dbj|BAF49305.1|  putative acyltransferase                               127   1e-28    
gb|EYU36999.1|  hypothetical protein MIMGU_mgv1a024237mg                127   1e-28    
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    127   1e-28    
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    127   1e-28    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   1e-28    
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   1e-28    
ref|XP_002437844.1|  hypothetical protein SORBIDRAFT_10g003600          130   1e-28    
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 127   1e-28    
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           127   1e-28    
ref|XP_006436888.1|  hypothetical protein CICLE_v10031592mg             127   1e-28    
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          127   2e-28    
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   2e-28    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             127   2e-28    
gb|KDP32472.1|  hypothetical protein JCGZ_13397                         127   2e-28    
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    127   2e-28    
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   2e-28    
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             127   2e-28    
ref|XP_006471641.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    123   2e-28    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   2e-28    
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   2e-28    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          127   2e-28    



>ref|XP_009619139.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/473 (64%), Positives = 371/473 (78%), Gaps = 17/473 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             + +  NF V ++K EVVAA LP+QE H+LP SNLDLLLPP+DVGV FCYQ P +    TT
Sbjct  6     ITTKRNFIVKMSKTEVVAAVLPIQE-HWLPLSNLDLLLPPLDVGVIFCYQNPISV---TT  61

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
             T E    FG M+  LKA+L+E LVS+YA AGE+ QNLAGEPE++CNN GV+F +AFADVE
Sbjct  62    TLE----FGSMIKILKASLAETLVSYYAFAGEIVQNLAGEPEVLCNNSGVNFTEAFADVE  117

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N Y PD+S+EGKLVPKKK GVL+VQ T+L CGGIVV   FDHRVADAYSAN+FLVS
Sbjct  118   LKEINFYDPDESIEGKLVPKKKYGVLAVQVTQLTCGGIVVGCTFDHRVADAYSANLFLVS  177

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE-----EPKISR  769
             WSE+AQ+K L+QLP FRRSFLFPRRP +YD S+D +YVPI++L P   E     +  ISR
Sbjct  178   WSELAQSKPLTQLPSFRRSFLFPRRPGYYDNSIDGLYVPITTLPPSIPETLNTNDQAISR  237

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG-KSRRNFKNFKLGI  946
             IY V  E+I  LQS AN        H  R+KLE+F AFLWKT+A G K   N KNF+ GI
Sbjct  238   IYYVTGEKISHLQSLANSDQKSTKFH--RSKLESFSAFLWKTIACGIKETSNSKNFRFGI  295

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGRTRLS GD+N+ K L+GYFGNVLS PF  K I+EL+EKPL+WVA+AVHEF+E+A+T
Sbjct  296   VVDGRTRLSNGDDNQEKSLKGYFGNVLSIPFGNKKIEELKEKPLSWVANAVHEFIEKAVT  355

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
              +HFLGLIDWVEAHRPEPA+ K++    DG A+VVSSGQ+FP R+I+FGWG+P F SYHF
Sbjct  356   REHFLGLIDWVEAHRPEPAVAKIYATDDDGPAVVVSSGQQFPAREINFGWGEPVFWSYHF  415

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             PW G+SGYVMPMPSP GNGDWI+YMHL K ++ELIE  ASHVF+P T+++LN 
Sbjct  416   PWAGKSGYVMPMPSPTGNGDWIIYMHLMKWQLELIEASASHVFEPLTANYLNL  468



>ref|XP_009786591.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=474

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/481 (63%), Positives = 378/481 (79%), Gaps = 21/481 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +FNV V K EVVAA+LP+QE H+LP SNLDLLLPP+DVGVFFCYQ P  +     
Sbjct  1     MGAKRDFNVKVIKTEVVAASLPMQE-HWLPQSNLDLLLPPMDVGVFFCYQNPIISGMPQY  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
             +       G MV  LK +L+E LVS+YA AGE+ QNLAGEPE++CNN GV+F +A+AD+E
Sbjct  60    SS------GSMVKVLKVSLAETLVSYYAFAGELVQNLAGEPEILCNNAGVNFTEAWADIE  113

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++NLY PD+S+EGKLVPKKK GVL++QAT+LKCGGIVVA  FDHRVADAYS NMFLVS
Sbjct  114   LKEINLYNPDESIEGKLVPKKKHGVLAIQATQLKCGGIVVACTFDHRVADAYSTNMFLVS  173

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYD-LSLDNMYVPISSLQPEAV-------EEPK  760
             W+EIAQ+K LSQLP FRRSFL PRRP+HYD L +D+MY+PISSL+ E         +E  
Sbjct  174   WAEIAQSKPLSQLPSFRRSFLSPRRPSHYDPLVIDSMYIPISSLKQETRAVTNIDDDEQV  233

Query  761   ISRIYCVAAEQIRELQSQANHYSADEL--KHPRRTKLEAFCAFLWKTVASG---KSRRNF  925
             ISRIY V AE+I  LQS AN+ + D +  K  R TKLE F AFLWKT+A+G    S  N+
Sbjct  234   ISRIYYVKAEEISRLQSLANNCNNDMISTKFHRFTKLETFSAFLWKTIANGMGENSTPNY  293

Query  926   KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
             +NF+ GIVV+GR+RLS G E +AK L+GYFGNVLS PF EK +++L+EKPL+WVA+AVHE
Sbjct  294   ENFRFGIVVNGRSRLSDGVEEQAKVLKGYFGNVLSIPFGEKKVEKLKEKPLSWVANAVHE  353

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKP  1282
             FLE A T +HFLGLI+WVE HRPEPA+ +++    D  A+VVSSGQ+FPV KI+FGWG+P
Sbjct  354   FLEPAKTKEHFLGLINWVEDHRPEPALARIYATNEDAVAVVVSSGQQFPVGKIEFGWGEP  413

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              FGSYHFPW G++GYVMPMPSPKGNGDW+VYMH+ K ++EL+E  AS+VFKP T+D+LN 
Sbjct  414   VFGSYHFPWEGKAGYVMPMPSPKGNGDWVVYMHMLKWQLELVEASASNVFKPLTADYLNL  473

Query  1463  N  1465
             N
Sbjct  474   N  474



>ref|XP_009783339.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=469

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 370/473 (78%), Gaps = 17/473 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             + +  NFNV ++K+EVVAA LP+QE H+LP SNLDLLLPP+DVGV FCYQ P + + +  
Sbjct  6     ITTKRNFNVKMSKSEVVAAVLPIQE-HWLPLSNLDLLLPPLDVGVIFCYQNPISVTTKLE  64

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                    FG MV  LK++L+E LV +YA AGE+ QNL GEPE++CNN GV+F +AFADVE
Sbjct  65    -------FGSMVRILKSSLAETLVIYYAFAGEIVQNLGGEPEVLCNNSGVNFTEAFADVE  117

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ +N Y PD+S+EGKLVPKKK GVL+VQ T+LKCGG+VV   FDHRVADAYSAN+FLVS
Sbjct  118   LKDINFYNPDESIEGKLVPKKKHGVLAVQVTQLKCGGLVVGCTFDHRVADAYSANLFLVS  177

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL---QPEAV--EEPKISR  769
             WSE+AQ+K LSQLP FRRSFLFPRRP +YD S+D +YVPI +L   +PE +   +  ISR
Sbjct  178   WSELAQSKPLSQLPSFRRSFLFPRRPGYYDDSIDGLYVPIPTLPSVKPETLNPNDLAISR  237

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG-KSRRNFKNFKLGI  946
             IY +  E++  LQ+ AN     +    +R+KLE+F A+LWKT+A G K   N KNF+ GI
Sbjct  238   IYYITGEKMGHLQALANR--DQKSTKFQRSKLESFSAYLWKTIACGSKETSNSKNFRFGI  295

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGR RLS GD+N+ K L+GYFGNVLS PF  K I+EL+EKPL+WVA+++HEF+E+A+T
Sbjct  296   VVDGRARLSNGDDNQEKLLKGYFGNVLSIPFGNKKIEELKEKPLSWVANSIHEFIEKAVT  355

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
              +HFLGLIDWVEAHRPE A+ K++    DG A+VVSSGQ+FP R+IDFGWG+P F SYHF
Sbjct  356   REHFLGLIDWVEAHRPEQAVAKIYATDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHF  415

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             PW G+SGYVMPMPSPKGNGDWIVYMHL K ++ELIET ASHV KP T+++LN 
Sbjct  416   PWAGKSGYVMPMPSPKGNGDWIVYMHLMKWQLELIETSASHVVKPVTANYLNL  468



>ref|XP_009603729.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/473 (62%), Positives = 368/473 (78%), Gaps = 17/473 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             + +  NFN+ ++  E+VAA LP+QE H+LP SNLDLLLPP+DVGV FCYQ   + + +  
Sbjct  6     ITTKRNFNLKMSNTELVAAVLPIQE-HWLPLSNLDLLLPPLDVGVIFCYQNLISVTTKLE  64

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                    FG  V  LKA+L+E LVS+YA AGE+ QNLAGEPE++CNN GV+F +AFADVE
Sbjct  65    -------FGSTVRILKASLAETLVSYYAFAGEIVQNLAGEPEVLCNNSGVNFTEAFADVE  117

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N Y PD+S+EG LVPKKK GVL+VQ T+LKCGG+VV   FDHRVADAYSAN+FLVS
Sbjct  118   LKEINFYNPDESIEGNLVPKKKHGVLAVQVTQLKCGGLVVGCAFDHRVADAYSANLFLVS  177

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISS---LQPEAV--EEPKISR  769
             WSE+AQ+K L+QLP FR+SFLFPR P +YD S+D +YVPI +   ++PE +   +  ISR
Sbjct  178   WSELAQSKPLTQLPSFRKSFLFPRHPGYYDDSIDGLYVPIPTIPLIKPETLNPNDQAISR  237

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG-KSRRNFKNFKLGI  946
             IY V  E+I  LQS AN     +    +R+KLE+F AFLWKT+A G K   N KNF+ GI
Sbjct  238   IYYVTGEKINHLQSLANR--DQKSTKFQRSKLESFSAFLWKTIACGIKETSNSKNFRFGI  295

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             +VDGRTRLS GD+N+ K L+GYFGNVLS PF  K I+EL+EK L+WVA+A+HE +E+A+T
Sbjct  296   IVDGRTRLSNGDDNQEKLLKGYFGNVLSIPFGNKKIEELKEKSLSWVANAIHEIIEKAVT  355

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
              +HFLGLIDWVEAHRPEPA+ K++    DG A+VVSSGQ+FP R+IDFGWG+P F SYHF
Sbjct  356   REHFLGLIDWVEAHRPEPAVTKIYATDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHF  415

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             PW G+SGYVMPMPSPKGNGDWI+YMHL K ++ELIET ASHVFKP T+++LN 
Sbjct  416   PWAGKSGYVMPMPSPKGNGDWIIYMHLMKWQLELIETSASHVFKPVTANYLNL  468



>ref|XP_009799016.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=514

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/480 (63%), Positives = 377/480 (79%), Gaps = 21/480 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +   FNV V K EVVAA+LP+QE H+LP SNLDLLLPP+DVGVFFCYQ P  +     
Sbjct  41    MGTKRGFNVKVIKTEVVAASLPMQE-HWLPQSNLDLLLPPMDVGVFFCYQNPIISGMPKY  99

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
             +      FG MV  LK +L+E LVS+YA AGE+ QNLAGEPE++CNN GV+F +A+AD+E
Sbjct  100   S------FGSMVKVLKVSLAETLVSYYAFAGELVQNLAGEPEILCNNAGVNFTEAWADIE  153

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++NLY PD+S+EGKLVPKK  GVL+VQAT+LKCGGIVVA  FDHRVADAYS NMFLVS
Sbjct  154   LKEINLYNPDESIEGKLVPKKNHGVLAVQATQLKCGGIVVACTFDHRVADAYSTNMFLVS  213

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYD-LSLDNMYVPISSLQPEAV-------EEPK  760
             W+EIAQ+K LSQLP FRRSFL PRRP+HYD L +D+MY+PIS+L+ E         +E  
Sbjct  214   WAEIAQSKPLSQLPSFRRSFLSPRRPSHYDPLVIDSMYIPISALKQETRAVTNIDDDEQV  273

Query  761   ISRIYCVAAEQIRELQSQANHYSADEL--KHPRRTKLEAFCAFLWKTVASG---KSRRNF  925
             ISRIY V AE+I  LQS AN+ + D +  K  R TKLE F AFLWKT+A+G    S RN+
Sbjct  274   ISRIYYVKAEEISRLQSLANNCNNDMISTKFHRFTKLETFSAFLWKTIANGMGENSTRNY  333

Query  926   KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
             +NF+ GIVV+GR+RLS G E +AK L+GYFGNVLS PF EK +++L+EKPL+WVA+AVHE
Sbjct  334   ENFRFGIVVNGRSRLSDGVEEQAKVLKGYFGNVLSTPFGEKKVEKLKEKPLSWVANAVHE  393

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKP  1282
             FLE A T +HFLGLI+WVE HRPEPA+ +++    D  A+VVSSGQ+FPV KI+FGWG+P
Sbjct  394   FLEPAKTKEHFLGLINWVEDHRPEPALARIYATNEDAVAVVVSSGQQFPVGKIEFGWGEP  453

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              FGSYHFPW G++GYVMPMPSPKGNGDW+VYMH+ K ++EL++  A+++FKP T+D+LN 
Sbjct  454   VFGSYHFPWEGKAGYVMPMPSPKGNGDWVVYMHMLKWQLELVDASAANMFKPLTADYLNL  513



>gb|AHA90802.1| cinnamyl alcohol acyltransferase 1 [Larrea tridentata]
Length=463

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 352/474 (74%), Gaps = 20/474 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +   F V+V+K EVVAA LP+QE H+LP SNLDL+LPPVDVGVFFCY+KP + S    
Sbjct  1     MGAGGEFKVTVSKKEVVAAVLPMQE-HWLPLSNLDLILPPVDVGVFFCYKKPISPSTG--  57

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   TF  MVN LK AL++ALVSFYA  GEV  N  GEPEL+CNNRG DFV+A+AD+E
Sbjct  58    ---EPLTFAAMVNALKKALAQALVSFYAFGGEVVLNTVGEPELLCNNRGADFVEAYADIE  114

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  LNLY PD+SVEGKLVPKKK GV +VQAT+LKCGG+VVA  FDHR+ADAYS NMFLVS
Sbjct  115   LENLNLYNPDESVEGKLVPKKKHGVFAVQATQLKCGGLVVACTFDHRIADAYSTNMFLVS  174

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL----QPEAVEEPKISRI  772
             W+EIAQ+K     P FRRS L PRRP   D +LD+MYVPI++L    +PE  ++  ISRI
Sbjct  175   WAEIAQSKPSYYRPSFRRSLLNPRRPGFIDPALDDMYVPINTLPPPKEPEQTDDHLISRI  234

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF--KLGI  946
             Y V +EQ+  LQ  A+          +RTKLE+F A+LWK VA   S+   +N   K+GI
Sbjct  235   YYVTSEQLNLLQGLASSSGC------KRTKLESFSAYLWKMVAKYASKNYPRNVITKMGI  288

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGRTRL  GDE KAK +  YFGNVLS PF  K + EL EKPL+WVA  VH+FL+ A+T
Sbjct  289   VVDGRTRLGDGDEKKAKMMSKYFGNVLSIPFGGKKMHELTEKPLSWVADEVHDFLDVAVT  348

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVEAHRP PA+ K++     DG   VVSSGQRFPV KIDFGWGKP FGSYH
Sbjct  349   KEHFLGLIDWVEAHRPVPALAKIYCQGTEDGPGFVVSSGQRFPVGKIDFGWGKPGFGSYH  408

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPWGG SGYVMPMPSP GNGDWIVYMHL K ++ELIET A+ VF+P TSD+LNF
Sbjct  409   FPWGGDSGYVMPMPSPSGNGDWIVYMHLSKGQLELIETEAAAVFRPLTSDYLNF  462



>ref|XP_009589974.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/480 (63%), Positives = 375/480 (78%), Gaps = 21/480 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +FNV+V K EVVAA+LP+QE H+LP SNLDLLLPP+DVGVFFCYQ P  +     
Sbjct  1     MGAKRDFNVNVIKTEVVAASLPMQE-HWLPQSNLDLLLPPMDVGVFFCYQNPIISGLPKY  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
             +      FG M+  LK +L+E LVS+YA AGE+ QNLAGEPE++CNN GV+F +A+ADVE
Sbjct  60    S------FGSMIKVLKVSLAETLVSYYAFAGELVQNLAGEPEILCNNAGVNFTEAWADVE  113

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++NLY PD+S+EGKLVPKKK GVL+VQAT LKCGGIVVA  FDHRVADAYS N+FLVS
Sbjct  114   LKEINLYNPDESIEGKLVPKKKHGVLAVQATHLKCGGIVVACTFDHRVADAYSTNLFLVS  173

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYD-LSLDNMYVPISSLQPEAV-------EEPK  760
             W+EIAQ+K LSQLP FRRSFLFPRRP++YD L +D+MY+PIS+L+ E          +  
Sbjct  174   WAEIAQSKPLSQLPSFRRSFLFPRRPSYYDPLVIDSMYIPISALKQETRAVTNIDDNDQV  233

Query  761   ISRIYCVAAEQIRELQSQANHYSADEL--KHPRRTKLEAFCAFLWKTVASGKSRRN---F  925
             ISRIY V AE I  LQS AN  + D +  K  R TKLE F AFLWKT+A+G  + +   +
Sbjct  234   ISRIYYVKAEDIIRLQSLANSCNNDMISTKFHRFTKLETFSAFLWKTIANGMEKNSTPYY  293

Query  926   KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
             +NF  GIVV+GR+RLS GD+ +AK L+GYFGNVLS PF EK +++L+EKPL+WVA AVHE
Sbjct  294   ENFMFGIVVNGRSRLSDGDKEQAKVLKGYFGNVLSIPFGEKKVEKLKEKPLSWVARAVHE  353

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKP  1282
             FLE A T +HFLGLI+WVE HRPEPA+ +++    D  A+VVSSGQ+FPV KIDFGWG+P
Sbjct  354   FLEHAETKEHFLGLINWVEDHRPEPALARIYATNEDAPAVVVSSGQQFPVGKIDFGWGEP  413

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              FGSYHFPW G++GYVMPMPSPKGNGDW+VYMH+ K ++EL+E  AS+VFKP T+D+LN 
Sbjct  414   VFGSYHFPWEGKAGYVMPMPSPKGNGDWVVYMHMLKWQLELVEASASNVFKPLTADYLNL  473



>ref|XP_002270252.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=461

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/470 (63%), Positives = 353/470 (75%), Gaps = 24/470 (5%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             +F V+V++ EVVAA LPVQE ++LP SNLDLLLPPVDVGVFFCY+KP           H 
Sbjct  5     DFTVTVSRKEVVAAVLPVQE-YWLPTSNLDLLLPPVDVGVFFCYKKP-----------HD  52

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
              TFG M+  LK AL++ALVS+Y  AGEV  N AGEPEL+CNNRGVDF++A+ADV+L+ LN
Sbjct  53    LTFGSMIGVLKEALAQALVSYYPFAGEVLSNSAGEPELLCNNRGVDFMEAYADVQLQNLN  112

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYSANMFLVSW+E+A
Sbjct  113   LYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMA  172

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVAA  787
             Q+K LS LP FRRS L PRRP  YD SLDNMYVP+S+L P    +P     I+R+Y V  
Sbjct  173   QSKPLSVLPSFRRSLLNPRRPGSYDPSLDNMYVPMSALPPPKAPQPGDDLLINRLYYVTG  232

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQS A   S       +RTKLE+  AFLWK VA      N   K  ++G VVDGR
Sbjct  233   EQLSLLQSLATSKS----NSCKRTKLESLSAFLWKMVAKSAVTENANQKVCRMGTVVDGR  288

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RLS GDE KA  L  YFGNVLS PF +KTI EL+EKPL+WVA A+ E+LE A+T +HFL
Sbjct  289   KRLSSGDEVKAAMLASYFGNVLSIPFGKKTINELKEKPLSWVADAIREYLEGAVTKEHFL  348

Query  1142  GLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEPA+ K+++    DG A VVSSGQRFPV ++DFGWG PA GSYHFPWGG
Sbjct  349   GLIDWVEAHRPEPALAKIYNSGSRDGPAFVVSSGQRFPVSRVDFGWGMPALGSYHFPWGG  408

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             ++GYVMPMPSP  +GDW+VYMHL   ++E IET A+H+F+P  S++LN +
Sbjct  409   EAGYVMPMPSPVRDGDWVVYMHLSVGQIEWIETQAAHIFRPLNSEYLNLS  458



>ref|XP_006488699.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=482

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 359/489 (73%), Gaps = 36/489 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K EVVAA LP+QE H+LP SNLDLLLP +DVGVFFCY+KPAAA+    
Sbjct  1     MVAKGDFTVTVSKKEVVAAVLPLQE-HWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNIN  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                 +  FG MV+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  60    ---KSFGFGSMVDVLKKAMAEALVSYYALAGEVVYNDVGEPELLCNNRGVDFVEAYANVE  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LNLY PDD++EGKLV KKK GVLSVQATELKCGGIVVA  FDHR+ADAYS +MFLVS
Sbjct  117   LKDLNLYNPDDTIEGKLVAKKKNGVLSVQATELKCGGIVVACTFDHRIADAYSTDMFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----------EAVEE  754
             W+EIAQ+K +S +P FRRS L PRRP   D   DNMYVPIS+L P          EA   
Sbjct  177   WAEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISTLPPPPPPPHNNPQEANCN  236

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF  934
               +SRIY + +EQ+ ELQ  A   S     + RRTKLE+F AFLWK VA   +       
Sbjct  237   KLVSRIYYIKSEQLNELQLLATTGS-----NGRRTKLESFSAFLWKMVAR-SANDGMMIT  290

Query  935   KLGIVVDGRTRLSI----GDENKAKF--------LQGYFGNVLSFPFEEKTIKELREKPL  1078
             K+GIVVDGRTRLSI    GD N            +  YFGN LS PF  + +KEL EKPL
Sbjct  291   KMGIVVDGRTRLSISSNKGDHNNNNVNKSISCMAMGSYFGNALSIPFGGQNVKELVEKPL  350

Query  1079  NWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFP  1249
             +WVA+ VH+FLE A+T DHFLGLIDWVEAHRP+PA+ K++ C    DG A VVSSGQRFP
Sbjct  351   SWVATQVHDFLENAVTKDHFLGLIDWVEAHRPDPALAKIY-CTPSSDGPAFVVSSGQRFP  409

Query  1250  VRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHV  1429
             V K+DFGWGKPAFGSYHFPWGG +GYVMPMPSP GN DW++YMHL +++++LIET AS+V
Sbjct  410   VSKVDFGWGKPAFGSYHFPWGGDAGYVMPMPSPAGNSDWVIYMHLSEKQLDLIETQASNV  469

Query  1430  FKPFTSDHL  1456
             FKP T D+L
Sbjct  470   FKPMTFDYL  478



>ref|XP_007023568.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY26190.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=463

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/476 (61%), Positives = 359/476 (75%), Gaps = 25/476 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  ++ V+V+K EVVAA LP+QE H+LP SNLDLLLP VDVGVFFCY+K         
Sbjct  1     MGAERDYTVTVSKKEVVAAVLPLQE-HWLPFSNLDLLLPAVDVGVFFCYKKAVGVG----  55

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                 A +FG MV+ LK A+++ALVS+YA A EV  N  GEPEL+CNNRGVDF++A+ADVE
Sbjct  56    ---DAMSFGSMVSVLKKAMAQALVSYYAFASEVVPNTVGEPELVCNNRGVDFIEAYADVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             LR L+L+ PD+S+EGKLVPKKKQGVLSVQATEL+CGG+VVA  FDHR+ADAYSANMFLVS
Sbjct  113   LRNLDLHNPDESIEGKLVPKKKQGVLSVQATELRCGGLVVACTFDHRIADAYSANMFLVS  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----EAVEEPKISRI  772
             W+E+A++K +S +P FRRS L PRRP   D SLD+MY+PISSL P        +  ISRI
Sbjct  173   WAEMARSKSISVVPSFRRSLLNPRRPGRIDPSLDDMYMPISSLPPPKQHHQATDQLISRI  232

Query  773   YCVAAEQIRELQSQA--NHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF-KLG  943
             Y +AAEQ+ ELQS A  N Y        +RTK+E+F AFLWK VA   ++ +     K+G
Sbjct  233   YYIAAEQLNELQSLACSNGY--------KRTKIESFSAFLWKMVALVAAKDDDSEVTKMG  284

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             IVVDGR RL  GD+++A  +  YFGNVLS P+  + + EL E+PL+WVA+ VH FL++A+
Sbjct  285   IVVDGRGRLGEGDKDRASLMSCYFGNVLSIPYGSQRVNELIERPLSWVANQVHNFLDQAV  344

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T +HFLGLIDWVEAHRPEPA+ K++     DG A VVSSGQRFPV K+DFGWG P FGSY
Sbjct  345   TKEHFLGLIDWVEAHRPEPALAKIYSNGSDDGPAFVVSSGQRFPVSKVDFGWGCPVFGSY  404

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             HFPWGG +GYVMPMPSP   GDW+VYMHL K +++LIET ASHVF+P T D+L+F+
Sbjct  405   HFPWGGDAGYVMPMPSPAREGDWVVYMHLFKRQLDLIETEASHVFRPLTFDYLDFS  460



>gb|KDO67093.1| hypothetical protein CISIN_1g011528mg [Citrus sinensis]
Length=483

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/490 (62%), Positives = 360/490 (73%), Gaps = 37/490 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K EVVAA LP+QE H+LP SNLDLLLP +DVGVFFCY+KPAAA+    
Sbjct  1     MVAKGDFTVTVSKKEVVAAVLPLQE-HWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNIN  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                 +  FG MV+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  60    ---KSFGFGSMVDVLKKAMAEALVSYYALAGEVVYNDVGEPELLCNNRGVDFVEAYANVE  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQ-GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             L+ LNLY PDD++EGKLV KKK+ GVLSVQATELKCGGIVVA  FDHR+ADAYS +MFLV
Sbjct  117   LKDLNLYNPDDTIEGKLVAKKKKNGVLSVQATELKCGGIVVACTFDHRIADAYSTDMFLV  176

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----------EAVE  751
             SW+EIAQ+K +S +P FRRS L PRRP   D   DNMYVPIS+L P          EA  
Sbjct  177   SWAEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISTLPPPPPPPHNNPQEANC  236

Query  752   EPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN  931
                +SRIY + +EQ+ ELQ  A   S     + RRTKLE+F AFLWK VA   +      
Sbjct  237   NKLVSRIYYIKSEQLNELQLLATTGS-----NGRRTKLESFSAFLWKMVAR-SANDGMMI  290

Query  932   FKLGIVVDGRTRLSI----GDENKAKF--------LQGYFGNVLSFPFEEKTIKELREKP  1075
              K+GIVVDGRTRLSI    GD N            +  YFGNVLS PF  + +KEL EKP
Sbjct  291   TKMGIVVDGRTRLSISSNKGDHNNNNVNKSISCMAMGSYFGNVLSIPFGGQNVKELVEKP  350

Query  1076  LNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRF  1246
             L+WVA+ VH FLE A+T DHFLGLIDWVEAH+P+PA+ K++ C    DG A VVSSGQRF
Sbjct  351   LSWVATQVHNFLENAVTKDHFLGLIDWVEAHKPDPALAKIY-CTPSSDGPAFVVSSGQRF  409

Query  1247  PVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASH  1426
             PV K+DFGWGKPAFGSYHFPWGG +GYVMPMPSP GNGDW+VYMHL +++V+LIET AS+
Sbjct  410   PVSKVDFGWGKPAFGSYHFPWGGDAGYVMPMPSPAGNGDWVVYMHLSEKQVDLIETQASN  469

Query  1427  VFKPFTSDHL  1456
             VFKP   D+L
Sbjct  470   VFKPMAFDYL  479



>ref|XP_006425196.1| hypothetical protein CICLE_v10028328mg [Citrus clementina]
 gb|ESR38436.1| hypothetical protein CICLE_v10028328mg [Citrus clementina]
Length=482

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 355/489 (73%), Gaps = 36/489 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K EVVAA LP+QE H+LP SNLDLLLP +DVGVFFCY+KPAAA+    
Sbjct  1     MVAKGDFTVTVSKKEVVAAVLPLQE-HWLPQSNLDLLLPAIDVGVFFCYKKPAAAADNIN  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                 +  FG MV+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  60    ---KSFGFGSMVDVLKKAMAEALVSYYALAGEVVYNDVGEPELLCNNRGVDFVEAYANVE  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LNLY PDD++EGKLV KKK GVLSVQATELKCGGIVVA  FDHR+ADAYS +MFLVS
Sbjct  117   LKDLNLYNPDDTIEGKLVAKKKNGVLSVQATELKCGGIVVACTFDHRIADAYSTDMFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----------EAVEE  754
             W+EIAQ+K +S +P FRRS L PRRP   D   DNMYVPISSL P          EA   
Sbjct  177   WAEIAQSKPISVMPSFRRSMLNPRRPLCIDHEFDNMYVPISSLPPPPPPPHNNPQEANCN  236

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF  934
               +SRIY + +EQ+ ELQ  A   S       RRTKLE+F AFLWK VA   +       
Sbjct  237   KLVSRIYYIKSEQLNELQLLATTGSTG-----RRTKLESFSAFLWKMVAR-SANDGMMIS  290

Query  935   KLGIVVDGRTRLSIGDENKAKF------------LQGYFGNVLSFPFEEKTIKELREKPL  1078
             K+GIVVDGRTRLSI                    +  YFGNVLS PF  + +KEL EKPL
Sbjct  291   KMGIVVDGRTRLSISSNKGDNNNNNFNKSISCMAMGSYFGNVLSIPFGGQNVKELVEKPL  350

Query  1079  NWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFP  1249
             +WVA+ VH FLE A+T DHFLGLIDWVEAH+P+PA+ K++ C    DG A VVSSGQRFP
Sbjct  351   SWVATQVHNFLENAVTKDHFLGLIDWVEAHKPDPALAKIY-CTPSSDGHAFVVSSGQRFP  409

Query  1250  VRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHV  1429
             V K+DFGWGKPAFGSYHFPWGG +GYVMPMPSP GNGDW+VYMHL +++V+LIET AS+V
Sbjct  410   VSKVDFGWGKPAFGSYHFPWGGDAGYVMPMPSPAGNGDWVVYMHLSEKQVDLIETQASNV  469

Query  1430  FKPFTSDHL  1456
             FKP   D+L
Sbjct  470   FKPMAFDYL  478



>ref|XP_002270251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=471

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/474 (62%), Positives = 352/474 (74%), Gaps = 18/474 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M    +F V+V++ EVVAAALPVQE ++LP SNLDLLLPPVDVGVFFCY+KP   S    
Sbjct  1     MGGGGDFMVTVSRKEVVAAALPVQE-YWLPQSNLDLLLPPVDVGVFFCYKKPHG-SGNGG  58

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              E     FG MV  +K AL++ALVS+YA AGEV  N  GEPEL+CNNRGVDF +A+ADV+
Sbjct  59    DE---LRFGSMVRVVKEALAQALVSYYAFAGEVVSNSVGEPELLCNNRGVDFTEAYADVQ  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LNLY PDDS+EGKLVPKKK GVLSVQ TELKCGG VV   FDHR+ADAYSAN+F+VS
Sbjct  116   LQDLNLYNPDDSIEGKLVPKKKNGVLSVQVTELKCGGAVVGCTFDHRIADAYSANLFIVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRI  772
             W+E+AQ+K LS +P FRRS L PRRP  Y  SLD MYVPIS+L P    +P     ISR+
Sbjct  176   WAEMAQSKPLSVIPSFRRSLLNPRRPGSYHPSLDEMYVPISALPPPKAPQPGAEHLISRL  235

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGI  946
             Y V+AEQ+  LQ+ A   S+  ++  +RTKLE+  AFLWK +A      N   K  K+GI
Sbjct  236   YYVSAEQLSLLQTLA---SSGGIR--KRTKLESLSAFLWKMIAKSAVMENANKKICKMGI  290

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGR RLS GDE+K   +  YFGNVLS PF EK I +L+E+PL+WVA AVH+FLE A+T
Sbjct  291   VVDGRGRLSSGDEDKTALMATYFGNVLSIPFGEKIICDLKEQPLSWVADAVHDFLERAVT  350

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVE HRPEPA+ K++     DG A VVSSGQRFP  K+DFGWG+PA GSYH
Sbjct  351   KEHFLGLIDWVETHRPEPALAKIYCSGSSDGPAFVVSSGQRFPASKVDFGWGRPALGSYH  410

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPWGG +GYVMPMPSP  +GDW+VYMHL   ++ELIE   +H+F+P TSD+L  
Sbjct  411   FPWGGDAGYVMPMPSPARDGDWVVYMHLLNGQIELIENQGAHIFRPLTSDYLKL  464



>ref|XP_002270079.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=461

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/470 (62%), Positives = 355/470 (76%), Gaps = 24/470 (5%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             +F V+V++ EVVAA LPVQE ++LP SNLDLLLPPVDVGVFFCY+KP           H 
Sbjct  5     DFTVTVSRKEVVAAVLPVQE-YWLPLSNLDLLLPPVDVGVFFCYKKP-----------HD  52

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
              TFG M+  LK AL++ALVS+Y   GEV  N AGEPEL+CNNRGVDF++A+ADV+L+ LN
Sbjct  53    LTFGSMIGVLKEALAQALVSYYPFGGEVLSNSAGEPELLCNNRGVDFMEAYADVQLQNLN  112

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYSANMFLVSW+E+A
Sbjct  113   LYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMA  172

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL----QPEAVEEPKISRIYCVAA  787
             Q+K LS LP FRRS L  RRP  YD SLD+MYVP+S+L     P++ ++  I+R+Y V A
Sbjct  173   QSKPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMSALPPPKAPQSGDDLLINRLYYVTA  232

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQS A   S+      +RTKLE+  AFLWK VA      N   K  ++G VVDGR
Sbjct  233   EQLSLLQSLATSKSSS----CKRTKLESLSAFLWKMVAKSAVTENANQKICRMGTVVDGR  288

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RLS GDE KA  +  YFGNVLS PF +KTI EL+EKPL+WVA A+HE+LE A+T +HFL
Sbjct  289   KRLSSGDEVKAAMMASYFGNVLSIPFGKKTINELKEKPLSWVADAIHEYLEGAVTKEHFL  348

Query  1142  GLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEPA+ K++     DG A VVSSGQRFP  ++DFGWG PA GSYHFPWGG
Sbjct  349   GLIDWVEAHRPEPALAKIYSSGSRDGPAFVVSSGQRFPASRVDFGWGMPALGSYHFPWGG  408

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             ++GYVMPMPSP  +GDW+VYMHL   +VE IET A+H+F+P +S++LN +
Sbjct  409   EAGYVMPMPSPVRDGDWVVYMHLSVGQVEWIETEAAHIFRPLSSEYLNLS  458



>ref|XP_004232772.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=458

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/472 (63%), Positives = 362/472 (77%), Gaps = 21/472 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +FNV + K EVVAA LP+QE H+L  SNLDLLLPPVDVGVF CYQ P  +   + 
Sbjct  1     MGAKKDFNVKLIKTEVVAAMLPMQE-HWLSQSNLDLLLPPVDVGVFLCYQNPIISGILSK  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +F  MVN LK +L E LVS+YA AGE+ QNLAGEPE++CNN GVDF++++ADVE
Sbjct  60    N----WSFDSMVNVLKVSLGETLVSYYAFAGELIQNLAGEPEILCNNAGVDFIESWADVE  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N + PD+S+EGKLVPKKK GVL+VQ TELKCGG+VV   FDHRVADAYS NMFLVS
Sbjct  116   LKEINFHNPDESIEGKLVPKKKHGVLAVQVTELKCGGVVVGCTFDHRVADAYSFNMFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE-----EPKISR  769
             W+E+AQ+K LSQLP FRRSFL PR P+ YD  +D MY+PIS+L+ E        +  ISR
Sbjct  176   WAELAQSKPLSQLPSFRRSFLTPRCPSFYDPIIDTMYLPISALKQETANIDHDADEIISR  235

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIV  949
             IY V AE+IR LQS AN        +   TKLEAF AFLWKT+AS  + +    F+LGIV
Sbjct  236   IYYVKAEEIRRLQSLAN------CNNTTFTKLEAFSAFLWKTIASDTNNK----FRLGIV  285

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             V+GR+RLS GDE +AK L+GYFGNVLS PF EK ++EL+EK L+WVASAVHEFLE  +T 
Sbjct  286   VNGRSRLSNGDEEQAKILEGYFGNVLSIPFGEKKVEELKEKSLSWVASAVHEFLEHVVTR  345

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             +HFLGLI+WVE HRPEPA+ +++    D  ALVVSSGQ+FPVRKI+FGWG+  FGSYHFP
Sbjct  346   EHFLGLINWVENHRPEPALARIYATNEDTPALVVSSGQQFPVRKIEFGWGEAVFGSYHFP  405

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             W G+SGYVMPMPSPKGNGDWIVYMH+ K +++LIE  AS+VFKP T+D+L+ 
Sbjct  406   WEGKSGYVMPMPSPKGNGDWIVYMHMLKGQIDLIEAIASNVFKPLTADYLSL  457



>ref|XP_002271221.2| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase 
[Vitis vinifera]
Length=461

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/470 (62%), Positives = 355/470 (76%), Gaps = 24/470 (5%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             +F V+V++ EVVAA LPVQE ++LP SNLDLLLPPVDVGVFFCY+KP           H 
Sbjct  5     DFTVTVSRKEVVAAVLPVQE-YWLPLSNLDLLLPPVDVGVFFCYKKP-----------HD  52

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
              TFG M+  LK AL++ALVS+Y   GEV  N AGEPEL+CNNRGVDF++A+ADV+L+ LN
Sbjct  53    LTFGSMIGVLKEALAQALVSYYPFGGEVLSNSAGEPELLCNNRGVDFMEAYADVQLQNLN  112

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYSANMFLVSW+E+A
Sbjct  113   LYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMA  172

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL----QPEAVEEPKISRIYCVAA  787
             Q+K LS LP FRRS L  RRP  YD SLD+MYVP+S+L     P++ ++  I+R+Y V A
Sbjct  173   QSKPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMSTLPPPKAPQSGDDLLINRLYXVTA  232

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQS A   S+      +RTKLE+  AFLWK VA      N   K  ++G VVDGR
Sbjct  233   EQLSLLQSLATSKSSS----CKRTKLESLSAFLWKMVAKSAVTENANQKICRMGTVVDGR  288

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RLS GDE KA  +  YFGNVLS PF +KTI EL+EKPL+WVA A+HE+LE A+T +HFL
Sbjct  289   KRLSSGDEVKAAMMASYFGNVLSIPFGKKTINELKEKPLSWVADAIHEYLEGAVTKEHFL  348

Query  1142  GLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEPA+ K++     DG A VVSSGQRFP  ++DFGWG PA GSYHFPWGG
Sbjct  349   GLIDWVEAHRPEPALAKIYSSGSRDGPAFVVSSGQRFPGSRVDFGWGMPALGSYHFPWGG  408

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             ++GYVMPMPSP  +GDW+VYMHL   ++E IET A+H+F+P +S++LN +
Sbjct  409   EAGYVMPMPSPVRDGDWVVYMHLSVGQIEWIETEAAHIFRPLSSEYLNLS  458



>ref|XP_006347188.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=457

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/471 (62%), Positives = 356/471 (76%), Gaps = 20/471 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V + K EVVAA LP+QE H+L  SNLDLLLPPVDVGV  CYQ P  +     
Sbjct  1     MGAKKDFKVKLIKTEVVAAMLPMQE-HWLSQSNLDLLLPPVDVGVLLCYQNPITSGILPK  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +F  MVN LK +L E LVS+YA+AGE+ QNLAGEPE++CNN GV+F++A+ADVE
Sbjct  60    I----WSFDSMVNILKVSLGETLVSYYAIAGELVQNLAGEPEILCNNAGVNFIEAWADVE  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N Y PD+S+E KLVPKKK GVL+VQ TELKCGG+VV   FDHRVADAYS NMFLVS
Sbjct  116   LKEINFYNPDESIEAKLVPKKKHGVLAVQVTELKCGGVVVGCTFDHRVADAYSFNMFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAH-YDLSLDNMYVPISSLQPEAVE---EPKISRI  772
             W+E+A +K LSQLP F+RSFL PRRPA  YD  +D MY+PIS+L+ E      +  ISRI
Sbjct  176   WAELALSKPLSQLPSFQRSFLSPRRPASFYDPVIDTMYLPISALKQETTNIDHDQVISRI  235

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y V AE+IR LQS AN        + + TKLE F AFLWKT+A   +    KNF+LGIVV
Sbjct  236   YYVKAEEIRRLQSLAN------CNNTKFTKLETFSAFLWKTIAIDTN----KNFRLGIVV  285

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             +GR+RLS GDE +AK L+GYFGNVLS PF EK ++EL+EK L+ VA AVHEFLE A+  +
Sbjct  286   NGRSRLSDGDEEQAKILKGYFGNVLSIPFGEKRVEELKEKSLSCVARAVHEFLERAVNKE  345

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDC-VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             HFLGLI+WVE HRPEPA+ +++    D  ALVVSSGQ+FPVRKI+FGWG+  FGSYHFPW
Sbjct  346   HFLGLINWVENHRPEPALARIYATDEDTPALVVSSGQQFPVRKIEFGWGEAVFGSYHFPW  405

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              G+SGYVMPM SPKGNGDWIVYMH+ K +++L+E  AS+VFKP T+D+LN 
Sbjct  406   EGKSGYVMPMLSPKGNGDWIVYMHMLKGQIDLVEAIASNVFKPLTADYLNL  456



>ref|XP_002270325.2| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=467

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/474 (62%), Positives = 349/474 (74%), Gaps = 16/474 (3%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M    +F V++TK EVV A LP+QE H+LP SNLDLLLPPVDV VFFCY+ P     Q+ 
Sbjct  1     MGGGGDFTVTLTKKEVVEAMLPMQE-HWLPLSNLDLLLPPVDVSVFFCYKNP---HDQSV  56

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                H  +FG MV  LK A+S+ALVS+YA +GEV  N AGEPEL+CNNRGVDF++A ADV 
Sbjct  57    NGRHGFSFGSMVGALKIAMSQALVSYYAFSGEVVSNSAGEPELLCNNRGVDFMEAHADVR  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  LNLY PD S+EGKLVPKK+ GVLSVQ TELKC G+VVA  FDHR+ADAYSANMFLVS
Sbjct  117   LENLNLYNPDVSIEGKLVPKKENGVLSVQVTELKCSGVVVACTFDHRIADAYSANMFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRI  772
             W+E+AQ+K LS  P FRRS L  RRP  YD S DNMYVPIS+L P    +P     +SR+
Sbjct  177   WAEMAQSKPLSVTPAFRRSLLNTRRPGSYDPSFDNMYVPISALPPSKAPQPSADPLMSRL  236

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGK--SRRNFKNFKLGI  946
             Y V AEQ+  LQ  A   S+      +RTKLE+  AFLWK VA        N K  K+GI
Sbjct  237   YYVTAEQLSLLQMLATSKSSS----CKRTKLESLSAFLWKMVAKSADLDDDNKKICKMGI  292

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGR RLS GDE+KA  +  YFGNVLS PF EK I EL+EKPL+WV  AVHE+LE A+T
Sbjct  293   VVDGRRRLSSGDEDKAAAMANYFGNVLSVPFGEKIIDELKEKPLSWVGDAVHEYLEGAVT  352

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVEAHRPEPA+ K++     DG A VVSSGQRFPV K++FGWG+PA GSYH
Sbjct  353   REHFLGLIDWVEAHRPEPAVAKIYCSGSNDGPAFVVSSGQRFPVSKVNFGWGRPALGSYH  412

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPWGG++GYVMPMPSP  +GDW+VY+HL K ++ELIET A+HVF+P T ++L  
Sbjct  413   FPWGGEAGYVMPMPSPVRDGDWVVYVHLLKGQIELIETEAAHVFRPLTPEYLKL  466



>emb|CAN61304.1| hypothetical protein VITISV_040201 [Vitis vinifera]
Length=467

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 349/474 (74%), Gaps = 16/474 (3%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M    +F V++TK EVV A LP+QE H+LP SNLDLLLPPVDV VFFCY+ P     Q+ 
Sbjct  1     MGGGGDFTVTLTKKEVVEAMLPMQE-HWLPLSNLDLLLPPVDVSVFFCYKNP---HDQSV  56

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                H  +FG MV  LK A+S+ALVS+YA +GEV  N AGEPEL+CNNRGVDF++A ADV 
Sbjct  57    NGRHGFSFGSMVGALKIAMSQALVSYYAFSGEVVSNSAGEPELLCNNRGVDFMEAHADVR  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  LNLY PD S+EGKLVPKK+ GVLSVQ TELKC G+VVA  FDHR+ADAYSANMFLVS
Sbjct  117   LENLNLYNPDVSIEGKLVPKKENGVLSVQVTELKCSGVVVACTFDHRIADAYSANMFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRI  772
             W+E+AQ+K LS  P F RS L  RRP  YD S D+MYVPIS+L P    +P     +SR+
Sbjct  177   WAEMAQSKPLSVTPSFLRSLLNTRRPGSYDPSFDDMYVPISALPPSKAPQPSADPLMSRL  236

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGK--SRRNFKNFKLGI  946
             Y V AEQ+  LQ  A   S+      +RTKLE+  AFLWK VA        N K  K+GI
Sbjct  237   YYVTAEQLSLLQMLATSKSSS----CKRTKLESLSAFLWKMVAKSADLDDDNKKICKMGI  292

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGR RLS GDE+KA  +  YFGNVLS PF EK I EL+EKPL+WV  AVHE+LE A+T
Sbjct  293   VVDGRRRLSSGDEDKAAAMANYFGNVLSVPFGEKIIDELKEKPLSWVGDAVHEYLEGAVT  352

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVEAHRPEPA+ K++     DG A VVSSGQRFPV K++FGWG+PA GSYH
Sbjct  353   REHFLGLIDWVEAHRPEPAVAKIYCSGSNDGPAFVVSSGQRFPVSKVNFGWGRPALGSYH  412

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPWGG++GYVMPMPSP  +GDW+VY+HL K++++LIET A+HVF+P T ++L  
Sbjct  413   FPWGGEAGYVMPMPSPVRDGDWVVYVHLLKDQIDLIETEAAHVFRPLTPEYLKL  466



>ref|XP_002270076.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=470

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/469 (61%), Positives = 346/469 (74%), Gaps = 17/469 (4%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+VT+ E+VAA +P+QE H+LP SNLDLLLPP+DV +FFCY+KP     Q        
Sbjct  8     FTVTVTRKELVAAEVPMQE-HWLPLSNLDLLLPPIDVSMFFCYKKPH----QNANGGDDF  62

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             TFG M   L+ AL++ALVS+YA AGEV  N  GEPEL+CNN+GVDF +A+AD +L  L+L
Sbjct  63    TFGSMAGVLRKALAQALVSYYAFAGEVVSNSVGEPELLCNNQGVDFTEAYADAKLHDLSL  122

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PDDS+EGKLVPKK+ GVL VQ TELKCGG+VV   FDHR+ADAYSANMFLVSW+E+A 
Sbjct  123   YNPDDSIEGKLVPKKQHGVLCVQVTELKCGGVVVGCTFDHRIADAYSANMFLVSWAEMAL  182

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----ISRIYCVAA  787
              K LS +P FRRS L  RRP  YD SLD MYV IS+L P    +P      ISRIY V A
Sbjct  183   CKPLSVVPSFRRSLLNIRRPGSYDPSLDEMYVLISALPPPRAPQPGGADPFISRIYYVTA  242

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF--KLGIVVDGR  961
             EQ+  LQ+ A+       K   RTKLE+F AFLWK VA+     N      K+GIVVDGR
Sbjct  243   EQLSLLQTLASISKGSSYK---RTKLESFSAFLWKMVAASAVMENDNKMICKMGIVVDGR  299

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RLS GDE+K+  +  YFGNVLS PF EK I EL+EKPL+WVA AVHE+LE A+T +HFL
Sbjct  300   RRLSSGDEDKSAVMASYFGNVLSIPFGEKMIDELKEKPLSWVADAVHEYLEGAVTKEHFL  359

Query  1142  GLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEPA+ +++     DG ALVVSSGQRF V K+DFGWG+PA GS+HFPWGG
Sbjct  360   GLIDWVEAHRPEPALARIYCSGSSDGPALVVSSGQRFAVSKVDFGWGRPALGSFHFPWGG  419

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             ++GYVMPMPSP  +GDW+VYMHL K ++E IET A+HVF+P TS++LN 
Sbjct  420   EAGYVMPMPSPARDGDWVVYMHLLKGQIEFIETEAAHVFRPVTSEYLNL  468



>ref|XP_002270539.2| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=468

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/475 (60%), Positives = 349/475 (73%), Gaps = 21/475 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +S   F V+V + EVVAA LP+Q+ H+LP SNLDLLLPP++VGVFFCY+KP  +++    
Sbjct  3     SSGGEFMVTVRRKEVVAAMLPMQK-HWLPLSNLDLLLPPINVGVFFCYKKPRGSASGGDD  61

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  TFG MV  LK A+++ALV +YA AGEV  N  GE EL+CNNRGVDF++A+ADV+L
Sbjct  62    ----FTFGSMVRVLKEAMAQALVPYYAFAGEVLSNSLGEAELLCNNRGVDFLEAYADVKL  117

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             + LNLY PD+S+EGKL P +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW
Sbjct  118   QDLNLYNPDESIEGKLAPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSW  177

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIY  775
             +E+AQ+K LS +P FRRS L PR P  Y  SLD+MYVPIS+L P  V +P     ISR+Y
Sbjct  178   AEMAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPISALPPPKVPQPGADPLISRLY  237

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIV  949
              V AE++  LQ+ A   S+      +RTKLE+  AFLWK VA      N   K  K+ +V
Sbjct  238   YVTAEKLSLLQTLATSKSSSY----KRTKLESLSAFLWKMVAKSAHMENANQKICKMSVV  293

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VDGR RLS GDE++   +  YFGNVLSFPF EKT+ +L+EKPL+WV   VH+FLE A+T 
Sbjct  294   VDGRKRLSSGDEDRTTAMASYFGNVLSFPFGEKTVNDLKEKPLSWVGDEVHDFLEAAMTK  353

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+DFGWGKPA GSY
Sbjct  354   EHFLGLIDWVEAHRPEPA--ALNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGKPALGSY  411

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HFPWG + GYVMPMPSP  + DW+VYMHL K ++ELIET A+H+F+P T+DHLN 
Sbjct  412   HFPWGAEVGYVMPMPSPTVDDDWVVYMHLLKAQIELIETEAAHIFRPLTADHLNL  466



>ref|XP_002269682.3| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=470

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/475 (59%), Positives = 346/475 (73%), Gaps = 21/475 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +S   F V++ + EVVAA LP+Q+ H+LP SNLDLLLPP+DV VFFCY+KP  +++    
Sbjct  3     SSGGEFMVTMRRKEVVAAMLPMQK-HWLPLSNLDLLLPPIDVAVFFCYKKPRGSASGGDD  61

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  TFG MV  LK A+++ALV +YA AGE+  N  GE EL+CNNRGVDF++A+ADV+L
Sbjct  62    ----FTFGSMVRVLKEAMAQALVPYYAFAGEILSNSLGEAELLCNNRGVDFLEAYADVKL  117

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             + LNLY PD+S+EGKL P +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW
Sbjct  118   QDLNLYNPDESIEGKLAPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSW  177

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIY  775
             +E+AQ+K LS +P FRRS L PR P  Y LSLD+MYVPIS+L P  V +P     ISR+Y
Sbjct  178   AEMAQSKPLSVIPSFRRSLLNPRHPGSYALSLDHMYVPISALPPPKVPQPGADPLISRLY  237

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIV  949
              V AE++  LQ+ A   S+      +RTKLE+  AFLWK VA      N   K  K+ +V
Sbjct  238   YVTAEKLSLLQTLATSKSSSY----KRTKLESLSAFLWKIVAKSAHMENANQKICKMSVV  293

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VDGR RLS GDE+    +  YFGNVLSFPF EK + +L+EKPL+WV   VH+FLE A+T 
Sbjct  294   VDGRKRLSSGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEAAMTK  353

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+DFGWGKPA GSY
Sbjct  354   EHFLGLIDWVEAHRPEPA--ALNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGKPALGSY  411

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HFPWG + GYVMPMPSP  +GDW+VYMHL K ++ELIET A+ +F P T+DHLN 
Sbjct  412   HFPWGAEVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADHLNL  466



>ref|XP_007023566.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY26188.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=458

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 353/471 (75%), Gaps = 27/471 (6%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             ++  +F +SV K EVVAAALP QE H+LP +NLDLLLP +DVG+FFCY+KP         
Sbjct  3     SAKGDFMLSVGKKEVVAAALPFQE-HWLPLTNLDLLLPALDVGLFFCYKKPT--------  53

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  +FG MV+ LK AL++AL+S+YA AGEV  N  GEPEL+CNNRGVDF++A+AD+EL
Sbjct  54    ----MSFGSMVSVLKKALAQALLSYYAFAGEVVTNALGEPELLCNNRGVDFIEAYADIEL  109

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               LNL+ P++S+EGK VP+KK GV+S+QATELKCGGI+VA  FDHR+ADAYS NMFLVSW
Sbjct  110   ENLNLHNPEESIEGKFVPEKKHGVISIQATELKCGGIMVACSFDHRMADAYSTNMFLVSW  169

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL-QPEAVEEPK---ISRIY  775
             +EIA++K  S  P FRRS L PRRP  +D SLD MYVPI SL  PE   EP    ISRIY
Sbjct  170   AEIARSKPGSVAPSFRRSLLNPRRPGRFDPSLDEMYVPIPSLPPPEEFHEPTDHLISRIY  229

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVD  955
              V A+++ ELQS A   S+D  K   RTKLE+F AFLWK VA+  ++   K  K+GIVVD
Sbjct  230   YVTADKLNELQSLA---SSDGHK---RTKLESFSAFLWKMVATVAAKDGDKISKMGIVVD  283

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR+RL  GD++KA  +  +FGNVLS P+  +T+ EL EKP++WVA  VH+FL+ A   +H
Sbjct  284   GRSRLGEGDQDKATLMGSHFGNVLSIPYGSQTVGELVEKPVSWVAKQVHDFLKPAADEEH  343

Query  1136  FLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             FLGLIDWVEAHRPEPA+ +V+ CV   DG ALVVSSGQRFPV K+DFGWG P FGSYHFP
Sbjct  344   FLGLIDWVEAHRPEPAMTRVY-CVGKDDGPALVVSSGQRFPVSKVDFGWGSPTFGSYHFP  402

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WGG  GYVMPMPSP G+GDW+VYM L K ++ELIE  A++VF+P T D+L 
Sbjct  403   WGGLCGYVMPMPSPAGDGDWVVYMLLLKGQLELIEKEAANVFRPVTFDYLT  453



>ref|XP_002270208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=466

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 346/475 (73%), Gaps = 18/475 (4%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M S  +F V+VT+ ++VAA LP+ E ++LP SNLDLLLPP+DV VF CY+KP     ++ 
Sbjct  1     MGSGGDFTVTVTRKDIVAAVLPILE-YWLPLSNLDLLLPPLDVSVFLCYKKPH----ESV  55

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   TFG MV  LK A+++ALV +YA  GEV  N  GEPEL+CNN GVDF++A+ADV+
Sbjct  56    NGGENFTFGSMVRVLKEAMAQALVPYYAFGGEVLSNSLGEPELLCNNHGVDFLEAYADVK  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ L+LY PD+S+EGKLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYS NMFLVS
Sbjct  116   LKDLDLYNPDESIEGKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSTNMFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE----EPKISRI  772
             W+EIAQ K LS +P FRRS L PR P  YD S+DNMY+P S+L P   +    +P ISR+
Sbjct  176   WAEIAQCKPLSVIPSFRRSLLNPRHPGSYDPSIDNMYIPYSALPPPRAQQRQADPLISRL  235

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKS---RRNFKNFKLG  943
             + V AEQI  LQ+ A    +      RRTKLE+  AFLWK VA   +     N +  K+G
Sbjct  236   FYVMAEQIILLQTLAISKGSSY----RRTKLESLTAFLWKMVAKSAAVVGNSNKQICKMG  291

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             IVVDGR RLSIGDE+K   +  Y GNVLS    EKTI EL+EKPL+WVA AVH++LE A 
Sbjct  292   IVVDGRQRLSIGDEDKETAMASYIGNVLSIAIGEKTIHELKEKPLSWVADAVHDYLEGAA  351

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T + FLGLIDWVEAHRPEPA+ K++     D  A V+SSGQRFPV K+DFGWG+PA GSY
Sbjct  352   TKELFLGLIDWVEAHRPEPALTKIYCSSSSDEPAFVMSSGQRFPVSKVDFGWGRPALGSY  411

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HFPWGG++GYVMPMPSP  +GDW+VYMHL K +++LIE  A+H+F+P  S++L  
Sbjct  412   HFPWGGETGYVMPMPSPARDGDWVVYMHLLKGQMDLIEKEAAHIFRPLASEYLKL  466



>ref|XP_002519354.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF43218.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=462

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/469 (60%), Positives = 336/469 (72%), Gaps = 24/469 (5%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N  F V++ K EVVAA LP+QE H+L  SNLDLLLPPVDVGVFFCY+KP           
Sbjct  9     NGVFRVTIKKKEVVAAVLPMQE-HWLSLSNLDLLLPPVDVGVFFCYRKPLIGD-------  60

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                +FG MV  LK A+++ LVS+YA +GE+  N  GEPE+ICNNRGVDF++A AD EL +
Sbjct  61    --QSFGSMVTVLKKAMAQVLVSYYAFSGEIVGNSIGEPEIICNNRGVDFIEASADTELEQ  118

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LNLY PD S+EGKLVPKKK GVL+VQATELKCGG+VV   FDHR+ADAYSANMFLVSW+E
Sbjct  119   LNLYNPDQSIEGKLVPKKKNGVLAVQATELKCGGVVVGCTFDHRIADAYSANMFLVSWAE  178

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVAAEQ  793
              A++K +S +P FRRS L PRR A  D  LDNMYVPIS LQP    +  ISRIY V ++Q
Sbjct  179   TARSKAISMVPSFRRSLLHPRRLACLDPFLDNMYVPISKLQPTKEADHLISRIYYVKSDQ  238

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN----FKLGIVVDGR  961
             + +LQ  A+          +RTKLE+F AFLW+ +A    R          K+GIVVDGR
Sbjct  239   LNQLQKLASSTDC------KRTKLESFSAFLWQLIAKSTKRGQASGKAWVSKMGIVVDGR  292

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RL+I  +     +  YFGNVLS P+  K + EL E  L+WVA+ VH+FLE A+T +HFL
Sbjct  293   RRLNI--DPLTTQMDAYFGNVLSIPYGGKRVDELTENSLSWVANEVHDFLESAVTKEHFL  350

Query  1142  GLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEP + K++     DG A VVSSGQRFP+ K+DFGWG P FGSYHFPWGG
Sbjct  351   GLIDWVEAHRPEPGLAKIYSSGSDDGPAFVVSSGQRFPISKVDFGWGVPIFGSYHFPWGG  410

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPSP GNGDWIVYMHL KE+VELIE  A+H F+P T D+LN 
Sbjct  411   SAGYVMPMPSPIGNGDWIVYMHLLKEQVELIEIEAAHFFRPVTCDYLNL  459



>ref|XP_009348540.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=466

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/471 (59%), Positives = 344/471 (73%), Gaps = 30/471 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+++K EVVAAA+P+QE H+LP SNLDLLLPP+DVGVFFCY             + + 
Sbjct  6     FKVTMSKQEVVAAAMPLQE-HWLPLSNLDLLLPPLDVGVFFCYNN-----------KQSM  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +FG MV  LK A+++ALV+FYA +GEV  N  GEPE++CNNRGVDF +AFADVEL++LNL
Sbjct  54    SFGSMVGVLKKAMAQALVTFYAFSGEVVPNSVGEPEILCNNRGVDFAEAFADVELKELNL  113

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+EGKLVP K QG+L+VQATELKCGGIVVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  114   YDPDESIEGKLVPNKNQGILAVQATELKCGGIVVACTFDHRIADAYSTNMFLVSWAEMAQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV------EEPKISRIYCVA  784
             +K L+  P FRRS L PRRP H D SL+NMYVP+++L P +        +  ISRIY V 
Sbjct  174   SKSLTIHPTFRRSLLNPRRPGHIDPSLNNMYVPVTALPPPSKGSTTDDHDHLISRIYYVT  233

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR--RNFKNFKLGIVVDG  958
             AEQ++  +  A           +RTKLE FCAFLWK VA  ++   R  K  K+GIVVDG
Sbjct  234   AEQLKNFKDLATSNGC------KRTKLECFCAFLWKMVAKSETSNDRAQKICKMGIVVDG  287

Query  959   RTRLSIGD--ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             R RL   +   + +  +  YFGNVLS PF  + +++L +KPLNWVA  VH FLE A+T +
Sbjct  288   RRRLRDRNYQNDHSTLMATYFGNVLSIPFGGEKVEDLTKKPLNWVAEEVHNFLECAVTKE  347

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             HFLGLIDWVEAHRP P + K++ C   +G A VVSSGQRFPV K+DFGWG P FGSYHFP
Sbjct  348   HFLGLIDWVEAHRPVPGLAKIYGCGSDEGPAFVVSSGQRFPVSKVDFGWGSPVFGSYHFP  407

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WGG +GYVMPMPSP GNGDWIVYMH+ K ++ELIE  A+HV KP T D+L+
Sbjct  408   WGGNAGYVMPMPSPVGNGDWIVYMHMLKGQIELIEKEAAHVLKPLTFDYLD  458



>emb|CAN75148.1| hypothetical protein VITISV_027192 [Vitis vinifera]
Length=470

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 344/475 (72%), Gaps = 21/475 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +S   F V++ + EVVAA LP+Q+ H+LP SNLDLLLPP+DV VFFCY+KP  +++    
Sbjct  3     SSGGEFMVTMRRKEVVAAMLPMQK-HWLPLSNLDLLLPPIDVAVFFCYKKPRGSASGGXD  61

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  TFG MV  LK A+++ALV +YA AGE+  N  GE EL+CNNRGVD ++A+ADV+L
Sbjct  62    ----FTFGSMVRVLKEAMAQALVPYYAFAGEILSNSLGEAELLCNNRGVDXLEAYADVKL  117

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             + LNLY PD+S+EGKL P +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW
Sbjct  118   QDLNLYNPDESIEGKLAPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSW  177

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIY  775
             +E+AQ+K LS +P FRRS L PR P  Y  SLD+MYVPIS+L P  V +P     ISR+Y
Sbjct  178   AEMAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPISALPPPKVPQPGADPLISRLY  237

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIV  949
              V AE++  LQ+ A   S+      +RTKLE+  AFLWK VA      N   K  K+ +V
Sbjct  238   YVTAEKLSLLQTLATSKSSSY----KRTKLESLSAFLWKMVAKSAHMENANQKICKMSVV  293

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VDGR RLS GDE+    +  YFGNVLSFPF EK + +L+EKPL+WV   VH+FLE A+T 
Sbjct  294   VDGRKRLSCGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEAAMTK  353

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+DFGWG+PA GSY
Sbjct  354   EHFLGLIDWVEAHRPEPAT--LNMCCNGNSDGPGFMVSSGQRFPVTKVDFGWGRPALGSY  411

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HFPWG + GYVMPMPSP  +GDW+VYMHL K ++ELIET A+ +F P T+DHLN 
Sbjct  412   HFPWGEEVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADHLNL  466



>ref|XP_010654977.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=470

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/475 (59%), Positives = 344/475 (72%), Gaps = 21/475 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +S   F V++ + EVVAA LP+Q+ H+LP SNLDLLLPP+DV VFFCY+KP  +++    
Sbjct  3     SSGGEFMVTMRRKEVVAAMLPMQK-HWLPLSNLDLLLPPIDVAVFFCYKKPRGSASGGDD  61

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  TFG MV  LK A+++ALV +YA AGE+  N  GE EL+CNNRGVDF+ A+ADV+L
Sbjct  62    ----FTFGSMVRVLKEAMAQALVPYYAFAGEILSNSLGEAELLCNNRGVDFLDAYADVKL  117

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             + LNLY PD+S+EGKLVP +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW
Sbjct  118   QDLNLYNPDESIEGKLVPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSW  177

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIY  775
             +E+AQ+K LS +P FRRS L PR P  Y  SLD+MYVPIS+L P  V +P     ISR+Y
Sbjct  178   AEMAQSKPLSVIPSFRRSLLNPRHPGSYAPSLDHMYVPISALPPPKVPQPGADPLISRLY  237

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIV  949
              V AE++  LQ+ A   S+      +RTKLE+  AFLWK VA      N   K  K+ +V
Sbjct  238   YVTAEKLSLLQTLATSKSSSY----KRTKLESLSAFLWKIVAKSAHMENANQKICKMSVV  293

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VDGR RLS GDE+    +  YFGNVLSFPF EK + +L+EKPL+WV   VH+FLE A+T 
Sbjct  294   VDGRKRLSSGDEDMTTAMASYFGNVLSFPFGEKIVNDLKEKPLSWVGDEVHDFLEAAMTK  353

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+DFGWG+PA GSY
Sbjct  354   EHFLGLIDWVEAHRPEPA--TLNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGRPALGSY  411

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HFPWG + GYVMPMPSP  +GDW+VYMHL K ++ELIET A+ +F P T+D LN 
Sbjct  412   HFPWGEEVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLTADRLNL  466



>ref|XP_006343272.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=463

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/467 (57%), Positives = 345/467 (74%), Gaps = 16/467 (3%)
 Frame = +2

Query  95    VTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGW  274
             ++  E++  ++P+ +   LP SN+  +LPP++V V FCY  P   S +         F  
Sbjct  1     MSSKELLYISIPLSDTS-LPLSNVSFILPPLEVRVMFCYLNPIIVSEKININ---FEFNS  56

Query  275   MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
             +V  LK +L+E LVS+YA +GE+ +N AGEPEL+CNN GV F++AF DVEL+++N Y PD
Sbjct  57    IVKILKTSLAETLVSYYAFSGEIVENSAGEPELLCNNGGVSFIEAFGDVELKEINFYNPD  116

Query  455   DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
             +S+EGK VPKKK GVL++Q T+LKCGGI++   FDHRVADAYSAN+FLVSWSE+AQ K L
Sbjct  117   ESIEGKFVPKKKHGVLAIQVTQLKCGGIILGCTFDHRVADAYSANLFLVSWSELAQCKPL  176

Query  635   SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE-----EPKISRIYCVAAEQIR  799
             SQLP FRRS LFPR P +Y+ S+D++YVPIS+L P   E     +  ISRIY V  ++I 
Sbjct  177   SQLPSFRRSSLFPRHPGYYEDSIDDLYVPISTLPPMKSEILNPNDQVISRIYYVTGDKIE  236

Query  800   ELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG--KSRRNFKNFKLGIVVDGRTRL-  970
              LQS AN +    +K  +R+KLE+F AFLWKT+A G  K    F NF+ GIVVDGRTRL 
Sbjct  237   HLQSLANCHDQKGMKS-QRSKLESFSAFLWKTIACGINKETSGFNNFRFGIVVDGRTRLI  295

Query  971   --SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
               ++ D N+ K L+GYFGNVLS PF EK +++L+EK LNWVA+ VHEFL+ A T +HFLG
Sbjct  296   STNVDDYNQDKSLKGYFGNVLSIPFGEKKVEDLKEKSLNWVANVVHEFLDIAKTQEHFLG  355

Query  1145  LIDWVEAHRPEPAIPKVHDCV-DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS  1321
             LIDWVEAHRPEP++ K++    DG A+VVSSGQ FP +KI+FGWG+P F SYHFPW G++
Sbjct  356   LIDWVEAHRPEPSMAKIYAMNGDGPAVVVSSGQHFPAKKINFGWGQPVFWSYHFPWAGKA  415

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GYVMPMPSPKGNGDWIVYMHL K ++ELIE   S+VF+P T+++LN 
Sbjct  416   GYVMPMPSPKGNGDWIVYMHLLKWQMELIEASPSNVFEPVTANYLNL  462



>ref|XP_008344964.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=458

 Score =   529 bits (1362),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 282/475 (59%), Positives = 344/475 (72%), Gaps = 30/475 (6%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             + + F V+++K EVVAAALP+QE H+LP SNLDLLLPPVDVGVFFCY+            
Sbjct  2     ARAEFKVTMSKQEVVAAALPLQE-HWLPLSNLDLLLPPVDVGVFFCYKN-----------  49

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
             + + +FG MV  LK A+++AL++FYA +GEV  N  GEPE++CNNRGVDF +AFADVEL+
Sbjct  50    KQSMSFGSMVGVLKKAMAQALMTFYAFSGEVVPNSVGEPEILCNNRGVDFAEAFADVELK  109

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
             +LNLY PD+S+EGKLVP KK GVL+VQAT LKCGGIVVA  FDHR+ADAYS NMFLVSW+
Sbjct  110   ELNLYDPDESIEGKLVPNKKHGVLAVQATLLKCGGIVVACTFDHRIADAYSTNMFLVSWA  169

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK------ISRI  772
             E+AQ+K L+  P FRRS L PRRP H D SL+NMYVP+++L P +           ISRI
Sbjct  170   EMAQSKSLTIQPTFRRSLLNPRRPGHIDPSLNNMYVPLTALPPPSKGSTTDDHDHLISRI  229

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR--RNFKNFKLGI  946
             Y V +EQ+  LQ  A           +RTKLE+FCAFLWK VA  ++   R  K  K+GI
Sbjct  230   YYVTSEQLENLQDLATSNGC------KRTKLESFCAFLWKMVAKSETSNDRAQKLCKMGI  283

Query  947   VVDGRTRLSIGD--ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             VVDGR RLS G+   +    +  YFGNVLS PF  + +++L EKPLNWVA  VH FLE A
Sbjct  284   VVDGRARLSEGNYQNDHPTLMATYFGNVLSIPFGGEKVEDLTEKPLNWVAEEVHNFLECA  343

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
             +T +HFLGLIDWVEAHRP P + K++     +G A VVSSGQRFP  K+DFGWG P FGS
Sbjct  344   VTKEHFLGLIDWVEAHRPVPGLAKIYSSGSDEGPAFVVSSGQRFPASKMDFGWGSPVFGS  403

Query  1295  YHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             YHFPWGG +GYVMPMPSP GNGDWIVYMH+ K +VELIE  A+ V KP T D+L+
Sbjct  404   YHFPWGGNAGYVMPMPSPVGNGDWIVYMHMLKGQVELIEKEAADVLKPLTFDYLS  458



>ref|XP_011031277.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Populus euphratica]
Length=492

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/486 (58%), Positives = 353/486 (73%), Gaps = 30/486 (6%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A+   F+V+VT+ EVVAA LP+ E H+LP SNLDLLLPP+DVGVFFCY++P +++   ++
Sbjct  11    AAGRMFSVTVTEKEVVAAVLPMHE-HWLPLSNLDLLLPPLDVGVFFCYKRPTSSTLTISS  69

Query  248   EEHATT---FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD  418
                AT    F  MV  LK A+++ LVS+YA AGEV  N  GEPEL+CNNRGVDF +A AD
Sbjct  70    SSPATNSYNFRSMVGVLKKAMAQVLVSYYAFAGEVVANSVGEPELLCNNRGVDFFEAVAD  129

Query  419   VELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFL  598
             +EL  LNLY PDDS+EGKLVP+KK GVL+VQAT+LKCGG+VVA  FDHR+ADAYSANMFL
Sbjct  130   IELMDLNLYNPDDSIEGKLVPRKKDGVLAVQATQLKCGGLVVACTFDHRIADAYSANMFL  189

Query  599   VSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----IS  766
             VSW+E AQ+K +S LP FRRS L PRRP+  D SLDNMYVP+S+L P     P     +S
Sbjct  190   VSWAETAQSKPISLLPSFRRSLLNPRRPSCVDASLDNMYVPVSTLSPPKEPAPDADQLVS  249

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-----SGKSRRNFKN  931
             RIY V A+ + +LQS A+       K  RRTK+E+F  FLW+ VA           N  N
Sbjct  250   RIYYVKADDLNQLQSLASS------KGNRRTKMESFSGFLWQLVAKYCAIKDDDDDNISN  303

Query  932   F-----KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASA  1096
                   K+GIVVDGRTRLS  D  +   ++ YFGNVLS P+  KT++EL E PL+WVA+ 
Sbjct  304   ACKKISKMGIVVDGRTRLS-SDLERGDVMEAYFGNVLSIPYGSKTVRELIENPLSWVANE  362

Query  1097  VHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC----VDGAALVVSSGQRFPVRKID  1264
             VH+FLE A++ +HFLGLIDWVEA RPEPA+ K++ C     DG ALVVSSGQRFPV K+D
Sbjct  363   VHDFLENAVSKEHFLGLIDWVEARRPEPAVAKIY-CGGGDNDGPALVVSSGQRFPVSKVD  421

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWG P FGSYHFPWGG +GYVMP+P+P GNGDW+VYMHL + ++E IET AS+  +P T
Sbjct  422   FGWGVPLFGSYHFPWGGTAGYVMPLPNPAGNGDWMVYMHLLRGQLEFIETEASNFLRPLT  481

Query  1445  SDHLNF  1462
              ++L +
Sbjct  482   CNYLRY  487



>ref|XP_009344995.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Pyrus x bretschneideri]
Length=458

 Score =   525 bits (1353),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 345/473 (73%), Gaps = 34/473 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+++  EVVA ALP+QE ++LP SNLDLLLPP+DVGVFFCY+            + + 
Sbjct  6     FKVTMSNQEVVAGALPLQE-YWLPLSNLDLLLPPLDVGVFFCYKN-----------KQSM  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +FG MV  LK A+++ALV+FYAL+GEV  N  GEPE++CNNRGVDF +AFAD+EL++LN 
Sbjct  54    SFGSMVGVLKKAMAQALVTFYALSGEVVTNSDGEPEILCNNRGVDFTEAFADIELKELNF  113

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD S+EGKLVPKKK GVL+VQ TEL CGG+VVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  114   YDPDQSIEGKLVPKKKHGVLAVQVTELNCGGVVVACTFDHRIADAYSTNMFLVSWAEMAQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV------EEPKISRIYCVA  784
             +K L+  P FRRS L PRRP H D SL++MYVPI++L   +        +  ISRIY + 
Sbjct  174   SKSLTIQPTFRRSLLNPRRPGHIDPSLNDMYVPITALPLPSKGLTTDDHDHLISRIYYIT  233

Query  785   AEQIRELQSQA--NHYSADELKHPRRTKLEAFCAFLWKTVASGKSR--RNFKNFKLGIVV  952
             +EQ+  LQ+ A  N Y        +RTKLE+FCAFLWK VA   +   R  K  K+GIVV
Sbjct  234   SEQLENLQALATSNGY--------KRTKLESFCAFLWKMVAKCDTSNDRAQKLCKMGIVV  285

Query  953   DGRTRLSIGD--ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             DGRTRLS G+   + A  +  YFGNVLS PF  + I++L EKPL+WVA  VH+FLE A+T
Sbjct  286   DGRTRLSEGNYQNDHATLMAAYFGNVLSIPFGGENIEDLTEKPLSWVAKEVHDFLECAVT  345

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVEAHRP P + K++D    +G A VVSSGQRFP  K+DFGWG P FGSYH
Sbjct  346   KEHFLGLIDWVEAHRPVPYLTKIYDSGSNEGPAFVVSSGQRFPSSKVDFGWGSPVFGSYH  405

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             FPWGG +GYVM MPSP GNGDWIVYMH+ K +VEL+E  A+HV +P T D+LN
Sbjct  406   FPWGGSAGYVMAMPSPVGNGDWIVYMHMMKGQVELMEKEAAHVLRPLTFDYLN  458



>ref|XP_002310897.2| hypothetical protein POPTR_0007s15050g [Populus trichocarpa]
 gb|EEE91347.2| hypothetical protein POPTR_0007s15050g [Populus trichocarpa]
Length=494

 Score =   526 bits (1355),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 349/481 (73%), Gaps = 32/481 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+VT+ EVVAA LP+ E H+LP SNLDLLLPP+DVGVFFCY++P +++   ++   AT
Sbjct  15    FSVTVTEKEVVAAVLPLHE-HWLPLSNLDLLLPPLDVGVFFCYKRPTSSTLTISSSSPAT  73

Query  263   T---FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                 F  MV  LK A+++ LVS+YA AGEV  N  GEPEL+CNNRGVDF +A AD+EL  
Sbjct  74    NSYNFRSMVGVLKKAMAQVLVSYYAFAGEVVANSVGEPELLCNNRGVDFFEAVADIELMD  133

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LNLY PDDS+EGKLVP+KK GVL+VQAT+LKCGG+VVA  FDHR+ADAYSANMFLVSW+E
Sbjct  134   LNLYNPDDSIEGKLVPRKKNGVLAVQATQLKCGGLVVACTFDHRIADAYSANMFLVSWAE  193

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCV  781
              AQ+K +S LP FRRS L PRRP+  D SLDNMYVP+S+L P     P     +SRIY V
Sbjct  194   TAQSKPISLLPSFRRSLLNPRRPSCVDASLDNMYVPVSTLSPPKEPAPDADQLVSRIYYV  253

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS-------GKSRRNFKNF--  934
              A+ + +LQS A+       K  +RTK+E+F  FLW+ VA             N  N   
Sbjct  254   KADDLNQLQSLASS------KGNKRTKMESFSGFLWQLVAKYCAIKDDDDDDDNINNACK  307

Query  935   ---KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
                K+GIVVDGRTRLS  D  +   ++ YFGNVLS P+  KT++EL E PL+WVA+ VH+
Sbjct  308   KISKMGIVVDGRTRLS-SDLERGDVMEAYFGNVLSIPYGGKTVRELIENPLSWVANEVHD  366

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC----VDGAALVVSSGQRFPVRKIDFGW  1273
             FLE A+T +HFLGLIDWVEA RPEPA+ K++ C     DG A VVSSGQRFPV K+DFGW
Sbjct  367   FLENAVTKEHFLGLIDWVEARRPEPAVAKIY-CGGGDSDGPAFVVSSGQRFPVSKVDFGW  425

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             G P FGSYHFPWGG +GYVMPMP+P GNGDW+VYMHL + ++E IET AS+  +P T ++
Sbjct  426   GVPLFGSYHFPWGGTAGYVMPMPNPAGNGDWMVYMHLFRGQLEFIETEASNFLRPLTCNY  485

Query  1454  L  1456
             L
Sbjct  486   L  486



>ref|XP_010087075.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB26130.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=476

 Score =   523 bits (1347),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 290/489 (59%), Positives = 344/489 (70%), Gaps = 51/489 (10%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCY--QKPAAASAQTTTEE  253
             +F V V K +VVA+ALP+QE H+LP SNLDLLLP +DVGVFFCY   KP           
Sbjct  8     SFTVRVNKKDVVASALPLQE-HWLPLSNLDLLLPLLDVGVFFCYGVSKP-----------  55

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
               T+F  MV  LK AL++ALVSFYA AGEV  N  GEPEL+CNNRGVDF++AFADVEL  
Sbjct  56    --TSFASMVGVLKKALAQALVSFYAFAGEVVHNPDGEPELLCNNRGVDFIEAFADVELCH  113

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LNLY PDD VEGKLVP KK GVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLVSW+ 
Sbjct  114   LNLYNPDDCVEGKLVPAKKHGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVSWAN  173

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----EAVEEPKISRIYCV  781
             ++Q+K  S LP FRRS L PRRP  +  SLD+MYVP+S+L P     +  +  ISRIY V
Sbjct  174   MSQSKPFSLLPSFRRSLLNPRRPGLFHPSLDDMYVPVSALPPPKDSPSAADHLISRIYYV  233

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF-KNFKLGIVVDG  958
              AEQ+  LQ+  N+         +RTKLE+F AFLWK VA G +     K  K+GIVVDG
Sbjct  234   KAEQLERLQALCNN---------KRTKLESFSAFLWKMVAEGAALDGSEKVCKMGIVVDG  284

Query  959   RTRLS--IGDE-----------------NKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
             R RLS  + DE                  ++  ++ YFGNVLS PF  K ++EL EKPL 
Sbjct  285   RRRLSSTVDDEVEEDNGSADKGINVIRSARSALMESYFGNVLSIPFGGKKVEELVEKPLG  344

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVR  1255
             WVA  VHEFLE A+T +HFLGLIDWVEA RP P + +++     DG A VVSSGQRFPV 
Sbjct  345   WVAGEVHEFLEGAVTKEHFLGLIDWVEARRPVPGLARIYCRGSEDGPAFVVSSGQRFPVS  404

Query  1256  KIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFK  1435
             KIDFGWGKP FGSYHFPW G +GYVMPMPSP GNGDW+VYMH+ K+++E+IE  ASHVF+
Sbjct  405   KIDFGWGKPVFGSYHFPWRGDAGYVMPMPSPAGNGDWVVYMHMPKKQLEVIEKEASHVFR  464

Query  1436  PFTSDHLNF  1462
             PF  ++LN 
Sbjct  465   PFKFEYLNI  473



>ref|XP_006488633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=471

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 296/484 (61%), Positives = 356/484 (74%), Gaps = 37/484 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K +VVAA LP+QE H+LP SNLDLLLP +D GVFFCY+KP AA     
Sbjct  1     MVAEGDFIVTVSKKDVVAAVLPLQE-HWLPLSNLDLLLPAIDFGVFFCYKKPTAADF---  56

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +FG  V+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  57    -----GSFGSTVDVLKKAMAEALVSYYALAGEVVYNYDGEPELLCNNRGVDFVEAYAEVE  111

Query  425   LRKLNLYKPDDSVEGKLVPKKKQ-GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             LR LNLY PD+S+EGKL+PKKK+ G+LSVQATELKCGGIVVA   DHR+ADAYS NMFLV
Sbjct  112   LRDLNLYNPDESIEGKLLPKKKKNGLLSVQATELKCGGIVVACTLDHRIADAYSTNMFLV  171

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ---------PEAVEE  754
             SW+EIAQ+K +S LP FRRS L PRRP   D + D+MY+PISSL           EA   
Sbjct  172   SWAEIAQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGN  231

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-SGKSR--RNF  925
               ISRIY + +EQ+ ELQ  A   S+DE K   RTKLE+F A+LWK VA SG        
Sbjct  232   NLISRIYYIKSEQLNELQLLA---SSDECK---RTKLESFSAYLWKMVALSGNDNDGSGT  285

Query  926   KNFKLGIVVDGRTRLSI--GDE-NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASA  1096
             +  K+G+VVDGRTRLS   GD  NK+  +  YFGNVLS PF  + + EL EKPL+WVA  
Sbjct  286   RISKMGVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKR  345

Query  1097  VHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKID  1264
             VH+FLE A+T DHFLGLIDWVEAHRP+PAI K+  C     DG A VVSSGQRFPV K+D
Sbjct  346   VHDFLENAVTKDHFLGLIDWVEAHRPDPAISKI--CATGSKDGPAFVVSSGQRFPVSKVD  403

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWGKP FGSYHFPWG  +GYVMPMPSP  N DW+VYMHL +++++LIET AS+VF+P T
Sbjct  404   FGWGKPVFGSYHFPWGSDAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFEPLT  463

Query  1445  SDHL  1456
              ++L
Sbjct  464   FNYL  467



>gb|KDO60230.1| hypothetical protein CISIN_1g012180mg [Citrus sinensis]
Length=469

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 296/484 (61%), Positives = 356/484 (74%), Gaps = 37/484 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K +VVAA LP+QE H+LP SNLDLLLP +D GVFFCY+KP AA     
Sbjct  1     MVAEGDFIVTVSKKDVVAAVLPLQE-HWLPLSNLDLLLPAIDFGVFFCYKKPTAADF---  56

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +FG  V+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  57    -----GSFGSTVDVLKKAMAEALVSYYALAGEVVYNYDGEPELLCNNRGVDFVEAYAEVE  111

Query  425   LRKLNLYKPDDSVEGKLVPKKKQ-GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             LR LNLY PD+S+EGKL+PKKK+ G+LSVQATELKCGGIVVA   DHR+ADAYS NMFLV
Sbjct  112   LRDLNLYNPDESIEGKLLPKKKKNGLLSVQATELKCGGIVVACTLDHRIADAYSTNMFLV  171

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ---------PEAVEE  754
             SW+EIAQ+K +S LP FRRS L PRRP   D + D+MY+PISSL           EA   
Sbjct  172   SWAEIAQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGN  231

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-SGKSR--RNF  925
               ISRIY + +EQ+ ELQ  A   S+DE K   RTKLE+F A+LWK VA SG        
Sbjct  232   NLISRIYYIKSEQLNELQLLA---SSDECK---RTKLESFSAYLWKMVALSGNDNDGSGT  285

Query  926   KNFKLGIVVDGRTRLSI--GDE-NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASA  1096
             +  K+G+VVDGRTRLS   GD  NK+  +  YFGNVLS PF  + + EL EKPL+WVA  
Sbjct  286   RISKMGVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKR  345

Query  1097  VHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKID  1264
             VH+FLE A+T DHFLGLIDWVEAHRP+PAI K+  C     DG A VVSSGQRFPV K+D
Sbjct  346   VHDFLENAVTKDHFLGLIDWVEAHRPDPAISKI--CATGSKDGPAFVVSSGQRFPVSKVD  403

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWGKP FGSYHFPWG  +GYVMPMPSP  N DW+VYMHL +++++LIET AS+VF+P T
Sbjct  404   FGWGKPVFGSYHFPWGSDAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFEPLT  463

Query  1445  SDHL  1456
              ++L
Sbjct  464   FNYL  467



>ref|XP_004242867.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum lycopersicum]
Length=468

 Score =   521 bits (1343),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 353/474 (74%), Gaps = 15/474 (3%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M S  NFNV V K+EVVAA LP+QE H+LP SNLDLLLPP++VGV FCY  P   S +  
Sbjct  1     MNSKKNFNVKVHKSEVVAAVLPMQE-HWLPLSNLDLLLPPLEVGVMFCYLNPIIVSEKIN  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                    F  +V  LK +L+E LVS+YA +G++ +N AGE E++CNN GV F++AF  VE
Sbjct  60    MN---LEFNSIVKILKTSLAETLVSYYAFSGDIVENSAGELEILCNNGGVSFIEAFGAVE  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N Y PD+S+EGK VPKKK GVL++Q T+LKCGGI+V   FDHRVADAYSAN+FLVS
Sbjct  117   LKEINFYNPDESIEGKFVPKKKHGVLAIQVTQLKCGGIIVGCTFDHRVADAYSANLFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE-----EPKISR  769
             WSE+AQ+K LSQLP FRRS  FPR P +YD S+D++YVP+S+L P   E     +  ISR
Sbjct  177   WSELAQSKPLSQLPSFRRSSFFPRHPGYYDDSIDDLYVPLSTLPPMKSEILNPNDQVISR  236

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG--KSRRNFKNFKLG  943
             IY V   +I  LQS AN +  D+    +R+KLE+F AFLWKT+A G  K    F NF+ G
Sbjct  237   IYYVTGGKIEHLQSLANCHD-DQKGTSQRSKLESFSAFLWKTIACGINKETWGFNNFRFG  295

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             I+VDGRTRL I + +K+  L+GYFGNVLS PF EK ++E++EK LNWVA+ +HEFL+ A 
Sbjct  296   IMVDGRTRLIINNVDKS--LKGYFGNVLSIPFGEKKVEEVKEKSLNWVANVIHEFLDIAK  353

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDCV-DGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
             T +HFLGL DWVEAHRP+P++ K++    DG A+VVSSGQ FP +KI+FGWG+PAF SYH
Sbjct  354   TQEHFLGLTDWVEAHRPKPSMAKIYAMNGDGPAVVVSSGQHFPAKKINFGWGEPAFWSYH  413

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPW G++GYVMPMPSPKGNGDWIVYMHL K ++ELIE     VFKP T+++LN 
Sbjct  414   FPWAGKAGYVMPMPSPKGNGDWIVYMHLLKWQIELIEASPYEVFKPVTANYLNL  467



>ref|XP_011087026.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   521 bits (1342),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 263/431 (61%), Positives = 322/431 (75%), Gaps = 20/431 (5%)
 Frame = +2

Query  194   GVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPEL  373
             GVFFCY                 ++G MV  LK AL++ LVS+YA AG + +N AGEPEL
Sbjct  51    GVFFCYD---------NKHNMGLSYGHMVGILKKALAQTLVSYYAFAGRLVKNAAGEPEL  101

Query  374   ICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVK  553
             +CNN GVDFV+AFADVEL+ +NLY PD+SVEGKLVP++K+GVL+VQAT+LKCGG+VVA  
Sbjct  102   LCNNCGVDFVEAFADVELKDINLYNPDESVEGKLVPERKRGVLAVQATQLKCGGLVVACT  161

Query  554   FDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL  733
             F H VADAYSANMFLVSW+E+AQ K +SQ P FRRS L PRRP  Y+LS++NMYVP+S++
Sbjct  162   FAHLVADAYSANMFLVSWAEMAQFKPVSQPPSFRRSLLLPRRPGRYELSVENMYVPMSAI  221

Query  734   QPEAVEEPK-------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK  892
              P   +EP+       ISRIY + A+ + ELQ+ AN    +  K  +RTKLE+FC FLWK
Sbjct  222   PPPE-DEPEDAQPAAVISRIYYIKADVVNELQALANLDKNNTSKGNKRTKLESFCGFLWK  280

Query  893   TVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREK  1072
              + SG         +LGIVVDGR+RL  GDE++AK +  YFGNVLS PF EK I+EL+EK
Sbjct  281   MIVSGNDSAGDNCCRLGIVVDGRSRLIDGDESEAKLMASYFGNVLSIPFGEKKIEELKEK  340

Query  1073  PLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC---VDGAALVVSSGQR  1243
             PLNWVA+ VHEFL+ A+T +HFLGLIDWVE HRPE  + K++      +  A+VVSSGQ 
Sbjct  341   PLNWVANEVHEFLQSAMTKEHFLGLIDWVEEHRPEVGLSKIYAAKVTKEEPAVVVSSGQC  400

Query  1244  FPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYAS  1423
             FPVRK+DFGWG P FGSYHFPWGG+SGYVMPMPSPKGNGDWIVYMHL K ++ELIET A+
Sbjct  401   FPVRKMDFGWGIPVFGSYHFPWGGKSGYVMPMPSPKGNGDWIVYMHLLKGQLELIETNAA  460

Query  1424  HVFKPFTSDHL  1456
             HVF P T D+L
Sbjct  461   HVFSPLTCDYL  471



>ref|XP_008245068.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Prunus 
mume]
Length=460

 Score =   520 bits (1340),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 278/471 (59%), Positives = 342/471 (73%), Gaps = 30/471 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+V+K EVVAAALP+QE H+LP SNLDL LPPVDVGVFFCY+            E   
Sbjct  6     FKVTVSKQEVVAAALPLQE-HWLPLSNLDLPLPPVDVGVFFCYKN-----------EQRM  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +F  MV  L+ A+++ALV+FYA +GEV  N  GEPE++CNNRGVDF +AFADVEL+ LNL
Sbjct  54    SFWSMVGVLRKAMAQALVTFYAFSGEVVPNSVGEPEIMCNNRGVDFFEAFADVELKDLNL  113

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+EGKLVPKKK GVL+VQATELKCGG+VVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  114   YDPDESIEGKLVPKKKHGVLAVQATELKCGGMVVACSFDHRIADAYSTNMFLVSWAEMAQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-----EAVEEPKISRIYCVAA  787
             +K LS LP FRRS L PRRP H D SL++MYVPI++L P     +  ++  ISRIY V  
Sbjct  174   SKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVPITALPPPKNDTDVDQDHLISRIYYVTV  233

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQ+ A           +RTKLE+FCAFLWK VA   ++  +  K  K+GIVVDGR
Sbjct  234   EQLDNLQALACSNGF------KRTKLESFCAFLWKMVAKSDTKIGYAQKLCKMGIVVDGR  287

Query  962   TRLSIGD---ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             TRLS  +    ++A  +  YFGNVLS PF  + +++L EK LNWVA  VH+FL+ ALT +
Sbjct  288   TRLSERENYRSHQASHMATYFGNVLSIPFGGEKVEDLVEKSLNWVADEVHDFLKCALTEE  347

Query  1133  HFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             HFLGLIDWVE H+P PA+ K++     +G A VVSSG RFPV K+DF WG P FGSYHF 
Sbjct  348   HFLGLIDWVEVHKPVPALAKIYYSGSEEGPAFVVSSGLRFPVSKVDFRWGLPVFGSYHFS  407

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WGG +GYVMPMPSP   GDWIVYMH+ K ++ELIE  A+HVF+  T D+L+
Sbjct  408   WGGNAGYVMPMPSPARKGDWIVYMHIFKGQLELIEKEAAHVFRRLTFDYLS  458



>ref|XP_008380698.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Malus domestica]
 ref|XP_008348468.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=458

 Score =   520 bits (1339),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 343/473 (73%), Gaps = 34/473 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+++  EVVAAALP+QE ++LP SNLDLLLPP+DVGVFFCY+            + + 
Sbjct  6     FKVTMSNQEVVAAALPLQE-YWLPLSNLDLLLPPLDVGVFFCYKN-----------KQSM  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +FG MV  LK A+++ALV+FYA +GEV  N  GEPE++C+NRGVDF +AFAD+EL++LN 
Sbjct  54    SFGSMVGVLKKAMAQALVTFYAFSGEVVPNSDGEPEILCHNRGVDFTEAFADIELKELNF  113

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD SVEGKLVPKKK GVL+VQ TEL CGG+VVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  114   YDPDQSVEGKLVPKKKHGVLAVQVTELNCGGVVVACTFDHRIADAYSTNMFLVSWAEMAQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK------ISRIYCVA  784
             +K L+  P  RRS L PRRP H D SL++MYVP+++L P +           ISRIY + 
Sbjct  174   SKSLTIQPTXRRSLLNPRRPGHIDXSLNDMYVPVTALPPPSKGRTTDDHDHLISRIYYIT  233

Query  785   AEQIRELQSQA--NHYSADELKHPRRTKLEAFCAFLWKTVASGKSR--RNFKNFKLGIVV  952
             +EQ+  LQ+ A  N Y        +RTKLE+FCAFLWK VA   +   R  K  K+GIVV
Sbjct  234   SEQLENLQALATSNGY--------KRTKLESFCAFLWKMVAKSDTSNDRAQKLCKMGIVV  285

Query  953   DGRTRLSIGD--ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             DGR RLS G+   + A  +  YFGNVLS PF  + I++L EKPL+WVA  VH+FLE A+T
Sbjct  286   DGRXRLSEGNYQNDHATXMAAYFGNVLSIPFGGENIEDLTEKPLSWVAEEVHDFLECAVT  345

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFLGLIDWVE+HRP P + K++     +G A VVSSGQRFP  K+DFGWG P FGSYH
Sbjct  346   KEHFLGLIDWVESHRPVPGLAKIYYSGSXEGPAFVVSSGQRFPSSKVDFGWGSPVFGSYH  405

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             FPWGG +GYVMPMPSP GNGDWIVYMH+ K ++EL+E  A+HV +P T D+LN
Sbjct  406   FPWGGSAGYVMPMPSPVGNGDWIVYMHMMKGQMELMEKEAAHVLRPLTFDYLN  458



>ref|XP_007217230.1| hypothetical protein PRUPE_ppa005452mg [Prunus persica]
 gb|EMJ18429.1| hypothetical protein PRUPE_ppa005452mg [Prunus persica]
Length=460

 Score =   520 bits (1339),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 283/471 (60%), Positives = 351/471 (75%), Gaps = 30/471 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+++K EVVAAALP+QE H+LP SNLDLLLPPVDVGVFFCY+            E + 
Sbjct  6     FKVTMSKQEVVAAALPLQE-HWLPLSNLDLLLPPVDVGVFFCYKN-----------EQSM  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +F  MV  L+ A+++ALV+FYA +GEV QN  GEP ++CNNRGVDF +AFADVEL+ LNL
Sbjct  54    SFWSMVGVLRKAMAQALVTFYAFSGEVVQNSVGEPAILCNNRGVDFFEAFADVELKDLNL  113

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+EGKLVPKKK GVL+VQATELKCGG+VVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  114   YDPDESIEGKLVPKKKHGVLAVQATELKCGGMVVACSFDHRIADAYSTNMFLVSWAEMAQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-----EAVEEPKISRIYCVAA  787
             +K LS LP FRRS L PRRP H D SL++MYVPI++L P     +  ++  ISRIY V A
Sbjct  174   SKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVPITALPPPKNDTDVNQDHLISRIYYVTA  233

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQ+ A   S++  K   RTKLE+FCAFLWK VA   ++     K  K+GIVVDGR
Sbjct  234   EQLDNLQALA---SSNGFK---RTKLESFCAFLWKMVAKSDTKIGCAKKLCKMGIVVDGR  287

Query  962   TRLS-IGD--ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             TRLS  G+   ++A  +  YFGNVLS PF  + +++L EK LNWVA  VH+FL+ A+T +
Sbjct  288   TRLSERGNYRSHQASHMATYFGNVLSIPFGGEKVEDLVEKSLNWVADEVHDFLKCAVTKE  347

Query  1133  HFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             HFLGLIDWVE H+P PA+ K++     +G A VVSSGQRFPV ++DFGWG P FGSYHFP
Sbjct  348   HFLGLIDWVEVHKPVPALAKIYCSGSEEGPAFVVSSGQRFPVSEVDFGWGLPVFGSYHFP  407

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WGG +GYVMPMPSP   GDWIVYMH+ K ++ELIE  A+HVF+  T D+L+
Sbjct  408   WGGNAGYVMPMPSPARKGDWIVYMHIFKGQLELIEKAAAHVFRRLTFDYLS  458



>ref|XP_003617368.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AET00327.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=471

 Score =   518 bits (1333),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 337/475 (71%), Gaps = 30/475 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V VT  E+VAAALP+QE H+LP SNLDL+LPPVDVGVFFCY+ P      TT   H+ 
Sbjct  8     FTVKVTNKEIVAAALPMQE-HWLPLSNLDLILPPVDVGVFFCYKNPII----TTATHHS-  61

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                 +V  LK +L+EALVS+YA AGEV  N  GEPEL+CNNRGVDFV+AFADVEL+ LNL
Sbjct  62    ----IVGCLKNSLTEALVSYYAFAGEVMTNSMGEPELLCNNRGVDFVEAFADVELQSLNL  117

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD++VEGKLVPKKK GVL+VQAT +KCGG+VVA  FDHR+ADAYSANMFLVSW+EIA+
Sbjct  118   YNPDETVEGKLVPKKKHGVLAVQATWMKCGGLVVACTFDHRIADAYSANMFLVSWAEIAR  177

Query  623   AKQLSQL-----PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------EAVEEPKISR  769
                   L     PCFRRS L PRRP     S+ +MYVPIS L P      +   +P ISR
Sbjct  178   PNDNKSLIPTTQPCFRRSLLTPRRPPSIHPSIYDMYVPISDLPPPPEPESDIKTDPIISR  237

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF--KLG  943
             IY V ++++  +QS AN  S +     +R+KLE+F AFLWK VA   S  N +N   K+G
Sbjct  238   IYYVTSKELNNMQSLAN--SNNNGGSSKRSKLESFSAFLWKMVAEAASINN-ENIVAKMG  294

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             +VVDGR RLS GD+NK + +  YFGNVLS P+  +  +EL + PL WVA  VHEFLE A+
Sbjct  295   LVVDGRKRLSNGDKNKEELMNSYFGNVLSIPYGGRLAEELVDNPLCWVADRVHEFLEAAV  354

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
             T +HFLGLIDWVE HRP P + +++       +G   VVSSGQRFP  K+DFGWGKP FG
Sbjct  355   TEEHFLGLIDWVEEHRPVPGLARIYCGSTGGEEGPTFVVSSGQRFPESKVDFGWGKPVFG  414

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             SYHFPWGG +GYVMPMPSPK NGDW++YMHL K  +  +E  A H F+P + D+L
Sbjct  415   SYHFPWGGSAGYVMPMPSPKRNGDWLLYMHLPKGHLHFMEAQAPHFFRPISWDYL  469



>ref|XP_004305788.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   514 bits (1325),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 341/475 (72%), Gaps = 32/475 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    F VS  K EVVAAALP+QE H+LP SNLDLLLPPVDVGVFFCY+   + S    
Sbjct  1     MAGGREFKVSTRKQEVVAAALPLQE-HWLPLSNLDLLLPPVDVGVFFCYKNHNSPSVTAA  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                        V  LK AL++ALV++YA +GEV  N  GEPE++CNNRGVDF +AFADVE
Sbjct  60    R----------VGVLKKALAQALVTYYAFSGEVVANSVGEPEILCNNRGVDFTEAFADVE  109

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++LNL+ PD+S+EGKLVP KK GVL+VQATELKCGG+VVA  FDHR+ADAYS NM L+S
Sbjct  110   LKELNLHNPDESIEGKLVPNKKHGVLAVQATELKCGGMVVACTFDHRIADAYSTNMLLIS  169

Query  605   WSEIAQAKQ--LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------EAVEEPK  760
             W+++A +K    +++P FRRS L PRRP     SL++MYVP++SL P         E+  
Sbjct  170   WAKMANSKSPLTNKVPSFRRSLLNPRRPGQIHPSLNDMYVPVTSLPPPPKMETNGHEDHL  229

Query  761   ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF-K  937
             ISRIY VAAEQ+ +LQ+ A+          +R+KLE+FCAFLWK VA  ++  + K   K
Sbjct  230   ISRIYYVAAEQLIKLQALASSNGC------KRSKLESFCAFLWKMVAGSETGNDVKKLCK  283

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEE  1117
             +GIVVDGR+RL+ G++     +  Y GNVLS PF  K I+EL EK LNWVA  VHEFLE 
Sbjct  284   MGIVVDGRSRLADGND----LMSSYVGNVLSIPFGGKKIQELNEKSLNWVADEVHEFLEC  339

Query  1118  ALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
             A+T +HFLGLIDWVEAHRP P + K++     +G A VVSSGQRFPV K+DFGWG P FG
Sbjct  340   AVTKEHFLGLIDWVEAHRPVPGLAKIYCNGSKEGPAFVVSSGQRFPVSKVDFGWGAPVFG  399

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             SYHFPWGG SGYVMPMPSP GNGDW+VYMH+ K ++++IE  A HVFKP T  +L
Sbjct  400   SYHFPWGGSSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKKAGHVFKPLTIGYL  454



>ref|XP_003530722.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=475

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 281/477 (59%), Positives = 342/477 (72%), Gaps = 18/477 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQT-T  244
             A N  F+V+VT  EVVAA +P+QE H+LP SNLDLLLPP+DVGVFFCY+ P   S     
Sbjct  3     AENGGFSVNVTNEEVVAAVVPMQE-HWLPLSNLDLLLPPIDVGVFFCYKNPMLTSTTLGD  61

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
             T  +  TF  M+ +LK AL++AL+S+YA AGEV  N  GEPE++CNNRGVDFV+A ADVE
Sbjct  62    TCTNKITFESMLGSLKKALAQALISYYAFAGEVVPNNVGEPEVLCNNRGVDFVEAVADVE  121

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LN Y PDD++EGK VPKKK GVL+VQAT LKCGGIV+A  FDHR+ADAYSANMFL+S
Sbjct  122   LKCLNFYNPDDTIEGKFVPKKKNGVLTVQATSLKCGGIVLACIFDHRIADAYSANMFLIS  181

Query  605   WSEIAQ---AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAVEEPKISRI  772
             W+EIAQ       +  PCFRRS L PRRP+    SL +MY+PIS +  P+A   P +SRI
Sbjct  182   WAEIAQPTKPTTTTTTPCFRRSLLSPRRPSSIPRSLYDMYLPISKITPPQATTAPLLSRI  241

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN----FKL  940
             Y V AEQ+ ++QS     + +  K   RTK E F AFLWK VA   SR N K      K+
Sbjct  242   YYVTAEQLEKMQSLVVMTNENNTK---RTKFECFSAFLWKIVAQAASRGNKKGKKVIAKM  298

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             GIVVDGR RL  GD+ K   +  YFGNVLS PF  K ++EL EKPL  VA AVHEFL  A
Sbjct  299   GIVVDGRKRLCDGDKEKEALMGCYFGNVLSIPFGGKEVEELMEKPLGLVAEAVHEFLAVA  358

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGWGKPAF  1288
              T +HFLGLIDWVEAHRPEP + K++       +G + VVSSGQR    K+DFGWG+  F
Sbjct  359   -TKEHFLGLIDWVEAHRPEPGVAKIYCGGGSGDEGPSFVVSSGQRLMEGKMDFGWGEVVF  417

Query  1289  GSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             GS+HFPWGGQ+GYVMPMPSP GNGDW+VYMHL KE++E++E+ AS VF+P + D+LN
Sbjct  418   GSFHFPWGGQAGYVMPMPSPLGNGDWVVYMHLAKEQLEVLESEASDVFRPISWDYLN  474



>ref|XP_003617366.1| Anthranilate N-benzoyltransferase protein [Medicago truncatula]
 gb|AET00325.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=471

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 335/475 (71%), Gaps = 30/475 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V VT  E+VAAALP+QE H+LP SNLDL+LPPVDVGVFFCY+ P      TT   H+ 
Sbjct  8     FTVKVTNKEIVAAALPMQE-HWLPLSNLDLILPPVDVGVFFCYKNPII----TTATHHS-  61

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                 +V  LK +L+EALVS+YA AGEV  N  GEPEL+CNNRGVDFV+AFADVEL+ LNL
Sbjct  62    ----IVGCLKNSLTEALVSYYAFAGEVMTNSMGEPELLCNNRGVDFVEAFADVELQSLNL  117

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD++VEGKLVPKKK GVL+ Q T +KCGG+VVA  FDHR+ADAYSANMFLVSW+EIA+
Sbjct  118   YNPDETVEGKLVPKKKHGVLAAQTTWMKCGGLVVACTFDHRIADAYSANMFLVSWAEIAR  177

Query  623   AKQLSQL-----PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------EAVEEPKISR  769
                   L     PCFRRS + PRRP     SL +MYVPIS + P      +   +P ISR
Sbjct  178   PNNNKSLIPTMQPCFRRSLMTPRRPPSIHPSLYDMYVPISDMPPPPQLESDQKTDPIISR  237

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF--KLG  943
             IY V ++++  +QS AN  S +     +R+KLE+F AFLWK VA   S  N +N   K+G
Sbjct  238   IYYVTSKELNNMQSLAN--SNNNGGSSKRSKLESFSAFLWKMVAEAASINN-ENIVAKMG  294

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             +VVDGR RLS GD+NK + +  YFGNVLS P+  +  +EL + PL WVA  VHEFLE A+
Sbjct  295   LVVDGRKRLSNGDKNKEELMNSYFGNVLSIPYGGRLAEELVDNPLCWVADRVHEFLEAAV  354

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
             T +HFLGLIDWVE HRP P + +++       +G   VVSSGQRFP  K+DFGWGKP FG
Sbjct  355   TEEHFLGLIDWVEEHRPVPGLARIYCGSTGGEEGPTFVVSSGQRFPESKVDFGWGKPVFG  414

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             SYHFPWGG +GYVMPMPSPK NGDW++YMHL K  +  +E  A H F+P + D+L
Sbjct  415   SYHFPWGGSAGYVMPMPSPKRNGDWLLYMHLPKGHLHFMEVQAPHFFRPVSWDYL  469



>ref|XP_006343402.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Solanum tuberosum]
Length=474

 Score =   514 bits (1323),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 276/477 (58%), Positives = 349/477 (73%), Gaps = 15/477 (3%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M    +FNV V K+EVVAA LP+QE H+LP SNLDLLLPP++V V FCY  P   S +  
Sbjct  1     MNPKKDFNVKVIKSEVVAAVLPMQE-HWLPLSNLDLLLPPLEVRVMFCYLNPIIVSEKIN  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                    F  +V  LK +L+E LVS+YA +GE+ +N AGEPEL+CNN  V F++AF DVE
Sbjct  60    IN---LEFNSIVKILKTSLAETLVSYYAFSGEIVENSAGEPELLCNNGSVSFIEAFGDVE  116

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+++N Y PD+S+  K VPKKK GVL++QAT LKCGGI+V   FDHRVADAYSAN+FLVS
Sbjct  117   LKEINFYNPDESIGRKFVPKKKHGVLAIQATRLKCGGIIVGCTFDHRVADAYSANLFLVS  176

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE-----EPKISR  769
              SE+ Q K LSQLP FRRS LFPR P +YD S++++YVPIS+L P   E     +  ISR
Sbjct  177   LSELVQCKLLSQLPSFRRSSLFPRHPGYYDDSINDLYVPISTLPPTKPEILNPNDQVISR  236

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG--KSRRNFKNFKLG  943
             IY V  ++I  LQS  N +     K+ +R+KLE+F AFLWKT+A G  K    F NF+ G
Sbjct  237   IYYVTGDKIEHLQSLTNCHDQKSTKYSQRSKLESFSAFLWKTIACGINKETSGFSNFRFG  296

Query  944   IVVDGRTRLSIGD---ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLE  1114
             +VVDGRTRL   D    N+ K L+GYFGN+LS PF EK ++EL+EK LNWVA+ +HEFL+
Sbjct  297   LVVDGRTRLISNDVDVNNQDKSLKGYFGNILSIPFGEKKVEELKEKSLNWVANVIHEFLD  356

Query  1115  EALTGDHFLGLIDWVEAHRPEPAIPKVHDCV-DGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
              A T +HFLG+IDWVEAHRP+P+I K++    DG+A+VVSS + FP +KI+FGWG+PAF 
Sbjct  357   IAKTQEHFLGMIDWVEAHRPKPSIAKIYAMNGDGSAVVVSSRKHFPAKKINFGWGQPAFW  416

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             SYHFPW G++GYVMPMPSPKGNGDWIV MHL K ++ELIE   SHVF+P T+++LN 
Sbjct  417   SYHFPWDGKAGYVMPMPSPKGNGDWIVNMHLLKWQMELIEASPSHVFEPITANYLNL  473



>ref|XP_006424489.1| hypothetical protein CICLE_v10028364mg [Citrus clementina]
 gb|ESR37729.1| hypothetical protein CICLE_v10028364mg [Citrus clementina]
Length=469

 Score =   513 bits (1321),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 293/484 (61%), Positives = 353/484 (73%), Gaps = 37/484 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V+V+K +VVAA LP+QE H+LP SNLDLLLP +D GVFFCY+KP AA     
Sbjct  1     MVAEGDFIVTVSKKDVVAAVLPLQE-HWLPLSNLDLLLPAIDFGVFFCYKKPTAADF---  56

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +FG  V+ LK A++EALVS+YALAGEV  N  GEPEL+CNNRGVDFV+A+A+VE
Sbjct  57    -----GSFGSTVDVLKKAMAEALVSYYALAGEVVYNYDGEPELLCNNRGVDFVEAYAEVE  111

Query  425   LRKLNLYKPDDSVEGKLVPKKKQ-GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             LR LNLY PD+S+EGKL+PKKK+ G+LSVQATELKCGGIVVA   DHR+ADAYS NMFLV
Sbjct  112   LRDLNLYNPDESIEGKLLPKKKKNGLLSVQATELKCGGIVVACTLDHRIADAYSTNMFLV  171

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ---------PEAVEE  754
             SW+ IAQ+K +S LP FRRS L PRRP   D + D+MY+PISSL           EA   
Sbjct  172   SWAGIAQSKPMSVLPSFRRSILNPRRPLCIDHAFDDMYLPISSLPPPPPPNNTPEEANGN  231

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-SGKSR--RNF  925
               ISRIY + +EQ+ ELQ  A   S+DE K   RTKLE+F A+LWK VA SG        
Sbjct  232   NLISRIYYIKSEQLNELQLLA---SSDECK---RTKLESFSAYLWKMVALSGNDNDGSGT  285

Query  926   KNFKLGIVVDGRTRLSI--GDE-NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASA  1096
             +  K+G+VVDGRTRLS   GD  NK+  +  YFGNVLS PF  + + EL EKPL+WVA  
Sbjct  286   RISKMGVVVDGRTRLSSSKGDHVNKSISMDSYFGNVLSVPFGGQKVNELIEKPLSWVAKR  345

Query  1097  VHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKID  1264
             VH+FLE A+T DHFLGLIDWVEA RP+PAI K+  C     DG A VVSSGQRFPV K+D
Sbjct  346   VHDFLENAVTKDHFLGLIDWVEARRPDPAISKI--CATGSKDGPAFVVSSGQRFPVSKVD  403

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWGKP FGSYHFPWG  +GYVMPMPSP  N DW+VYMHL +++++LIET AS+VF+  T
Sbjct  404   FGWGKPVFGSYHFPWGSDAGYVMPMPSPAHNSDWVVYMHLSEKQLDLIETQASNVFERLT  463

Query  1445  SDHL  1456
              ++L
Sbjct  464   FNYL  467



>gb|KDP25022.1| hypothetical protein JCGZ_22557 [Jatropha curcas]
Length=453

 Score =   511 bits (1315),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 280/467 (60%), Positives = 335/467 (72%), Gaps = 32/467 (7%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
              F VSV K EVVAA LP+QE H+LP SNLDLLLPPVDVGVFFCY+ P  +          
Sbjct  9     TFTVSVAKKEVVAAVLPLQE-HWLPLSNLDLLLPPVDVGVFFCYRNPLIS----------  57

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
               FG MV +LK AL++ LVS+YA AGEV  N AGEPE++C+NRGVDF +AFAD+EL+ LN
Sbjct  58    MNFGSMVGSLKKALAQVLVSYYAFAGEVVANSAGEPEILCSNRGVDFYEAFADIELQHLN  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD S+E KLVPKK+ GVL+VQAT+LKCGGIV+   FDHR+ADAYSANMF+VSW+E+A
Sbjct  118   LYNPDQSIEAKLVPKKEDGVLAVQATKLKCGGIVLGCTFDHRIADAYSANMFVVSWAEMA  177

Query  620   QAKQLSQ--LPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCV  781
             Q+K +S   +P FRRS L PRRPA    SLD+MYVPIS LQP    +      ISRIY V
Sbjct  178   QSKAISDSVVPSFRRSLLNPRRPACIHPSLDDMYVPISKLQPPKDSDSDDDHLISRIYYV  237

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGR  961
              A+ + +LQS A+          +RTKLE+F A LW+ VA        K  K+GIVVDGR
Sbjct  238   KADSLNKLQSLASSIGC------QRTKLESFSALLWQLVAKSAKNGMAKVSKMGIVVDGR  291

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
             TRL  GD      +  YFGNVLS P+ +K I EL   PL+WVA+ VH+FLE A T +HFL
Sbjct  292   TRL--GDT-----MDSYFGNVLSIPYGKKKIDELIANPLSWVANEVHDFLESAATKEHFL  344

Query  1142  GLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             GLIDWVEAHRPEPA+ K++     DG A VVSSGQRFPV K+DFGWG P FGSYHFPWGG
Sbjct  345   GLIDWVEAHRPEPALAKIYGSGSDDGPAFVVSSGQRFPVSKVDFGWGAPFFGSYHFPWGG  404

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
              +GYVMPMPSP  NGDWIVYMHL K ++ LIE  +S++F+P T  +L
Sbjct  405   NAGYVMPMPSPLCNGDWIVYMHLLKTQIHLIEAESSNLFQPLTCVYL  451



>ref|XP_004305786.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   510 bits (1314),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 280/468 (60%), Positives = 343/468 (73%), Gaps = 32/468 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+  K EVVAAALP+QE H+LP SNLDLLLPPVDVGVFFCY+   + SA       A 
Sbjct  8     FEVTTRKQEVVAAALPLQE-HWLPLSNLDLLLPPVDVGVFFCYKNHTSPSAA------AA  60

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              FG     LK AL++ALV++YA +GEV  N  GEPE++CNNRGV FV+AFADVEL++LNL
Sbjct  61    RFG----VLKKALTQALVAYYAFSGEVVTNSFGEPEILCNNRGVGFVEAFADVELKELNL  116

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+EGK VP KK+GVL+VQATELKCGG+VVA  FDHRVADAYSANMFLVSW+++A 
Sbjct  117   YNPDESIEGKFVPNKKRGVLAVQATELKCGGMVVACTFDHRVADAYSANMFLVSWAKMAN  176

Query  623   AKQ--LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV-----EEPKISRIYCV  781
             +K      +P FRRS L PRRP     SL++MYVP++SL P  +     E+   +RIY V
Sbjct  177   SKSPVPEDVPSFRRSLLNPRRPCQIHPSLNDMYVPVTSLPPPKMETNDHEDQLANRIYYV  236

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF-KLGIVVDG  958
              AEQ+ +LQ+ A+          +R+KLE+FCAFLWK VA  ++  + +   K+GIVVDG
Sbjct  237   KAEQLIKLQALASSNGC------KRSKLESFCAFLWKMVAGSETGNDVEKLCKMGIVVDG  290

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R+RL+  DENK   +  YFGNVLS PF  K I+EL EK LNWVA  VHEFLE A+T +HF
Sbjct  291   RSRLA--DENK---MASYFGNVLSIPFGGKVIQELNEKSLNWVADEVHEFLECAVTKEHF  345

Query  1139  LGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             LGLIDWVEAHRP P + K++     +G A VVSSGQRFPV ++DFGWG P FGSYHFPWG
Sbjct  346   LGLIDWVEAHRPVPGLAKIYCSGSEEGPAFVVSSGQRFPVSEVDFGWGAPLFGSYHFPWG  405

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             G SGYVMPMPSP GNGDW+VYMH+ K ++++IE    HVFKP T D+L
Sbjct  406   GSSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKEGGHVFKPLTYDYL  453



>ref|XP_006586058.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=478

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 336/482 (70%), Gaps = 31/482 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQT-TTE  250
             N NF+V+VT  EVVAA +P+QE ++LP SNLDLLLPP+DVGVFFCY+ P   S     + 
Sbjct  5     NGNFSVNVTNEEVVAAVVPMQE-YWLPLSNLDLLLPPLDVGVFFCYKNPMLKSTTLGNSG  63

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
              +  TFG MV +LK AL++ LVS+Y  AGEV  N  GEPE++CNNRGVDFV+A ADVEL+
Sbjct  64    TNKMTFGSMVRSLKNALAQTLVSYYVFAGEVVPNNMGEPEVLCNNRGVDFVEAEADVELK  123

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LN Y PDD++EGK V KKK GVL+VQAT LKCGGI+VA  FDHRVADAYS NMFLVSW+
Sbjct  124   CLNFYNPDDTIEGKFVTKKKNGVLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWA  183

Query  611   EIAQ------------AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL--QPEAV  748
             ++AQ            A   S+ PCFRRS L PRRP     SL +MY PIS L   P   
Sbjct  184   DMAQPTKPNNTLVVTVAPTASRHPCFRRSLLSPRRPGSIHPSLHHMYTPISELPPPPSIA  243

Query  749   EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNF  925
                 +SRIY V AEQ+  +Q  A            RTKLE F AFLWK VA   S+ +N 
Sbjct  244   SAALLSRIYYVTAEQLHLMQVFA----------ATRTKLECFSAFLWKMVARAASKEKNG  293

Query  926   KNF--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAV  1099
             K    K+GIVVDGR RL  GD+     ++ YFGNVLS PF  K ++EL E+PL ++A AV
Sbjct  294   KRVVAKMGIVVDGRKRLGNGDKESEAMMESYFGNVLSIPFGGKPVEELVEEPLGFLAEAV  353

Query  1100  HEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGW  1273
             HEFL  A T +HFLGLIDWVEAHRP P I K++  +  DG A VVSSGQRFP  K+DFGW
Sbjct  354   HEFLAAATTEEHFLGLIDWVEAHRPVPGITKIYCNNADDGPAFVVSSGQRFPEDKVDFGW  413

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             GK  F SYHFPWGG++GYVMPMPSP  NGDWIVYMHL K+++E+IE+ A+HVFKP T D+
Sbjct  414   GKVVFASYHFPWGGETGYVMPMPSPLRNGDWIVYMHLAKKQLEIIESEAAHVFKPLTWDY  473

Query  1454  LN  1459
             LN
Sbjct  474   LN  475



>ref|XP_004491310.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=477

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 274/483 (57%), Positives = 336/483 (70%), Gaps = 36/483 (7%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N  F V+VT  EVV+A LP+QE H+LP SNLDL+LPPVDVGVFFCY KP  + + T    
Sbjct  7     NDQFTVNVTNEEVVSAMLPMQE-HWLPLSNLDLILPPVDVGVFFCYNKPMISISTTHN--  63

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                    +V  LK +L+++LVS+YA  GEV  N  GEPEL+CNNRGVDFV+A ADV+L+ 
Sbjct  64    -------IVGCLKNSLAQSLVSYYAFGGEVVTNSIGEPELLCNNRGVDFVEAVADVDLQS  116

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LNLY PD+++EGKLVPKKK GVL+VQ T ++CGG+VVA  FDHR+ADAYS NMFLVSW+E
Sbjct  117   LNLYNPDETIEGKLVPKKKHGVLAVQVTWMRCGGLVVACTFDHRIADAYSTNMFLVSWAE  176

Query  614   IAQAKQL----SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-------  760
             IA+        +  PCFRRS L PRRP+    SL +MYVPI+ L P    +PK       
Sbjct  177   IARPNNKPMSPTTQPCFRRSLLTPRRPSSIHPSLYDMYVPITDLPPPP--DPKFKSDIQT  234

Query  761   ---ISRIYCVAAEQIRELQSQA--NHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF  925
                ISRIY V  EQ+  +QS A  N  + D L+    +KLE+F AFLWK VA   S  N 
Sbjct  235   DQIISRIYYVTNEQLNNMQSLANSNKTNLDPLQQ-LHSKLESFSAFLWKMVAEAASIDN-  292

Query  926   KNF--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAV  1099
             KN   K+GIVVDGR RLS GD+NK + +  YFGNV+S P+  ++ +EL EKPLNWVA  V
Sbjct  293   KNVIAKIGIVVDGRKRLSNGDKNKEEIMSSYFGNVISIPYGGRSTEELVEKPLNWVADQV  352

Query  1100  HEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDF  1267
             HEFLE  +T +HFLGLIDWVE HRP P + +++       +G   VVSSGQRFP  KIDF
Sbjct  353   HEFLETTMTEEHFLGLIDWVEEHRPIPGLARIYCGSTSGEEGPTFVVSSGQRFPESKIDF  412

Query  1268  GWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS  1447
             GWGKP FGSYHFPWGG +GYVMPMPSPK NGDW++YMHL K  +  +E +A H FKP + 
Sbjct  413   GWGKPLFGSYHFPWGGDAGYVMPMPSPKRNGDWLLYMHLPKGYLHFMEFHAPHFFKPMSW  472

Query  1448  DHL  1456
             D+L
Sbjct  473   DYL  475



>ref|XP_004305787.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   506 bits (1304),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 274/474 (58%), Positives = 342/474 (72%), Gaps = 31/474 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    F VS  K EVVAAALP+QE H+LP SNLDLLLPPVDVGVFFCY+  ++ S   +
Sbjct  1     MAGGREFKVSTRKQEVVAAALPLQE-HWLPLSNLDLLLPPVDVGVFFCYKNHSSPSVAAS  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                        V  LK  L++ALV++YA +GEV  N  GEPE++CNNRGVDF +AFADVE
Sbjct  60    R----------VGVLKKGLAQALVTYYAFSGEVVANSVGEPEILCNNRGVDFTEAFADVE  109

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++LNL+ PD+S+EGKLVP KK G+L+VQATELKCGG+VVA  FDHR+ADAYSANMFLVS
Sbjct  110   LKELNLHNPDESIEGKLVPNKKHGILAVQATELKCGGMVVACTFDHRIADAYSANMFLVS  169

Query  605   WSEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV------EEPKI  763
             W+++A +K  L+ +P FRRSFL PRRP     SL+++YVP++SL P         E+  +
Sbjct  170   WAKMANSKSPLTMVPSFRRSFLNPRRPGKIHPSLNDLYVPVTSLPPPPKMETNDHEDRLL  229

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF-KNFKL  940
             SRIY V AEQ+ +LQ+ A+          +R+KL +F AFLWK VA  ++  +  ++ K+
Sbjct  230   SRIYYVKAEQLIKLQALASSSGC------KRSKLVSFSAFLWKMVAGSETGNDVERSCKM  283

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             GI+VDGR+RL+  DEN    +  YFGNVLS PF  K I+EL EK LNWVA  VHEFLE A
Sbjct  284   GIIVDGRSRLA--DEN--DLMASYFGNVLSIPFGGKKIQELNEKSLNWVADEVHEFLESA  339

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
              T +HFLGLIDWVEAHRP P + K++     +G A VVSSGQRFPV ++DFGWG P FGS
Sbjct  340   ATKEHFLGLIDWVEAHRPVPGLAKIYCNGSEEGPAFVVSSGQRFPVSEVDFGWGAPLFGS  399

Query  1295  YHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             YHFPWGG SGYVMPMPSP GNGDW+VYMH+ K ++++I     HVFKP T D+L
Sbjct  400   YHFPWGGSSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIGKEGGHVFKPLTFDYL  453



>ref|XP_007146239.1| hypothetical protein PHAVU_006G023900g [Phaseolus vulgaris]
 gb|ESW18233.1| hypothetical protein PHAVU_006G023900g [Phaseolus vulgaris]
Length=475

 Score =   507 bits (1306),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 276/474 (58%), Positives = 332/474 (70%), Gaps = 18/474 (4%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A N +F V VT  EVVAA LP+QE H LP SNLDLLLPPVDVGVF CYQKP   S  TT 
Sbjct  3     AENGDFPVYVTSEEVVAAVLPMQE-HRLPLSNLDLLLPPVDVGVFLCYQKPILTST-TTM  60

Query  248   EEHAT---TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD  418
             E+  T   TFG MV +LK AL++ L+S+Y  AGEV  N   EPE++CNNRGVDFV+A AD
Sbjct  61    EDCGTNKMTFGSMVGSLKKALAQTLISYYVFAGEVVLNNMDEPEVLCNNRGVDFVEAEAD  120

Query  419   VELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFL  598
             VEL+ LN Y PD S+EGK VP KK GVL+VQAT LKCGGIVVA  FDHR+AD YSANMFL
Sbjct  121   VELKNLNFYNPDQSIEGKFVPNKKNGVLAVQATSLKCGGIVVACSFDHRIADGYSANMFL  180

Query  599   VSWSEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAVEEPKISRI  772
              SW+E+AQ  K  +  PCF RS L PRRP     SL  MY PIS L  PE +  P  SRI
Sbjct  181   TSWAEMAQPTKPTTMSPCFLRSLLSPRRPCSIPHSLHQMYTPISKLTPPETITTPHFSRI  240

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNFKNF--KLG  943
             Y V A+++  +Q+  +   +      +RTKLE F A LWK VA   SR R  K    ++G
Sbjct  241   YYVTAQKLHSMQALVSGNGS------KRTKLECFSALLWKMVARAASRERRGKRVVARMG  294

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             +VVDGR RL   ++ K   +  YFGNV+S PF EK ++EL EKPL +VA AVHEFLEEA+
Sbjct  295   VVVDGRRRLCQSEKVKEALMGCYFGNVVSIPFGEKVVEELMEKPLGFVADAVHEFLEEAM  354

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T +HFLGL+DWVEAHRPE  + +++     +G + VVS GQRF   K+DFGWGK  FGS+
Sbjct  355   TEEHFLGLVDWVEAHRPESGVARIYSDGSSEGGSFVVSCGQRFLEGKMDFGWGKVVFGSF  414

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             HFPWGG++GYVMPM SP GNGDW+VYMHL KE++E+IE  A  VF+P T D+LN
Sbjct  415   HFPWGGEAGYVMPMKSPLGNGDWVVYMHLTKEQLEVIECEAGDVFRPITWDYLN  468



>gb|AHA90803.1| cinnamyl alcohol acyltransferase 2 [Larrea tridentata]
Length=463

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 270/469 (58%), Positives = 338/469 (72%), Gaps = 22/469 (5%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F + V+K EVV   LP+QE  +LP SNLDLLLPPV+VG+FFCY+ P +A           
Sbjct  8     FKMCVSKKEVVTPVLPMQE-QWLPLSNLDLLLPPVNVGLFFCYRNPNSA-----LTGKKL  61

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             T   MV++LK AL++ALVS+YA AGE+  N  GEP L+CN +GVDF +AFADVEL++L+L
Sbjct  62    TLANMVSSLKRALAQALVSYYAFAGELVLNSVGEPMLLCNEKGVDFTEAFADVELQELSL  121

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+EGKLVP++K GVL+VQ T+LKCGG+VV   FDHR+ADAYSANMFLVSW+EI+Q
Sbjct  122   YNPDESIEGKLVPERKHGVLAVQVTQLKCGGLVVGCTFDHRIADAYSANMFLVSWAEISQ  181

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVAAE  790
              +     P FRRS L PRRP   D SL++MYVPI++L     E+      +SRIY V +E
Sbjct  182   FQPTLFQPSFRRSLLDPRRPILIDPSLNDMYVPINTLSSAKEEDSDVDHLVSRIYYVTSE  241

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN--FKLGIVVDGRT  964
             QI  +QS A+          +RTKLE+F AFLWK +A    + + +N   +LGIVVDGRT
Sbjct  242   QINLMQSIASSSGI------KRTKLESFSAFLWKMIAKHAMQSDARNTRTRLGIVVDGRT  295

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             RL  G+E K K +  YFGNV+S PF    + EL EKPLN VA  VH+ L+ A+T +HFLG
Sbjct  296   RLGNGNEEKTKLMATYFGNVISIPFGSMKVTELIEKPLNCVADEVHDILDVAMTKEHFLG  355

Query  1145  LIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             LIDWVEAH+P PA+ K++ CV   DG   VVSSG RFPV K+DF WGKPAFGSYHFPW G
Sbjct  356   LIDWVEAHKPTPALAKIY-CVGFEDGPGFVVSSGLRFPVEKVDFRWGKPAFGSYHFPWRG  414

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              SGYVMPMPSPKGNGDWIVYMHL +E++E IE+ A  VF+P TS++L+ 
Sbjct  415   NSGYVMPMPSPKGNGDWIVYMHLSREQLEFIESEAPAVFRPLTSNYLDL  463



>emb|CBI18361.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   503 bits (1294),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 245/405 (60%), Positives = 300/405 (74%), Gaps = 13/405 (3%)
 Frame = +2

Query  275   MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
             MV  LK A+++ALV +YA  GEV  N  GEPEL+CNN GVDF++A+ADV+L+ L+LY PD
Sbjct  1     MVRVLKEAMAQALVPYYAFGGEVLSNSLGEPELLCNNHGVDFLEAYADVKLKDLDLYNPD  60

Query  455   DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
             +S+EGKLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYS NMFLVSW+EIAQ K L
Sbjct  61    ESIEGKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSTNMFLVSWAEIAQCKPL  120

Query  635   SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE----EPKISRIYCVAAEQIRE  802
             S +P FRRS L PR P  YD S+DNMY+P S+L P   +    +P ISR++ V AEQI  
Sbjct  121   SVIPSFRRSLLNPRHPGSYDPSIDNMYIPYSALPPPRAQQRQADPLISRLFYVMAEQIIL  180

Query  803   LQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKS---RRNFKNFKLGIVVDGRTRLS  973
             LQ+ A    +      RRTKLE+  AFLWK VA   +     N +  K+GIVVDGR RLS
Sbjct  181   LQTLAISKGSSY----RRTKLESLTAFLWKMVAKSAAVVGNSNKQICKMGIVVDGRQRLS  236

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
             IGDE+K   +  Y GNVLS    EKTI EL+EKPL+WVA AVH++LE A T + FLGLID
Sbjct  237   IGDEDKETAMASYIGNVLSIAIGEKTIHELKEKPLSWVADAVHDYLEGAATKELFLGLID  296

Query  1154  WVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGY  1327
             WVEAHRPEPA+ K++     D  A V+SSGQRFPV K+DFGWG+PA GSYHFPWGG++GY
Sbjct  297   WVEAHRPEPALTKIYCSSSSDEPAFVMSSGQRFPVSKVDFGWGRPALGSYHFPWGGETGY  356

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             VMPMPSP  +GDW+VYMHL K +++LIE  A+H+F+P  S++L  
Sbjct  357   VMPMPSPARDGDWVVYMHLLKGQMDLIEKEAAHIFRPLASEYLKL  401



>ref|XP_010040471.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45195.1| hypothetical protein EUGRSUZ_L01181 [Eucalyptus grandis]
Length=487

 Score =   506 bits (1303),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 280/494 (57%), Positives = 343/494 (69%), Gaps = 44/494 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V   K EVVAAALP+QE  +LP SNLDLLLPP++VGVFFCY  P      TTT
Sbjct  6     GAGGEFAVKWGKKEVVAAALPMQE-LWLPLSNLDLLLPPLEVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LKAAL++ALVS+YALAGEV QNL GEPEL+CNNRGVDF++AFAD+EL
Sbjct  59    ASPRLGYGSMVGILKAALAQALVSYYALAGEVVQNLVGEPELLCNNRGVDFIEAFADIEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PD+++EGKLVP+KKQGVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W
Sbjct  119   RHLNLYNPDETIEGKLVPEKKQGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFW  178

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--------  760
             +E A+ A  +S  P FRRS L PRRP   D SLD+MY+P+++L P   ++ K        
Sbjct  179   AETARSAAPISLPPSFRRSLLNPRRPLCVDPSLDSMYIPVTALPPPPQQKQKADEEQETT  238

Query  761   --------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                     +SR+Y V A ++ ELQ +A    ++      R+KLEAF AFLWK VA   S 
Sbjct  239   TSRDDDCLVSRMYYVTAAKLSELQQRACSSGSN------RSKLEAFSAFLWKMVAESSSV  292

Query  917   RNFKNFK----LGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N  + K    +GIVVDGR RL S   ++K   +  YFGNVLS PF EK   E+ EKPL+
Sbjct  293   ANNDDNKMMSRMGIVVDGRCRLMSRAVDDKPTPMASYFGNVLSIPFGEKRAMEVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDG--------AALVVSSG  1237
             WVA AVHEF+E   T +HFL LIDWVE HRP PA+ +++ C  G         A VVSSG
Sbjct  353   WVAEAVHEFVERGATREHFLDLIDWVEEHRPVPAVARIY-CKPGIEEEEEGSTAFVVSSG  411

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV ++DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  IE++
Sbjct  412   QRFPVTEMDFGWGKPVVGSYHFPWGGEAGYVMPMPSPLSNGDWVVYLHLSRSQVAFIESH  471

Query  1418  ASHVFKPFTSDHLN  1459
             A  +F+P T  +LN
Sbjct  472   APTLFRPLTPRYLN  485



>ref|XP_010034102.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW54003.1| hypothetical protein EUGRSUZ_J03197 [Eucalyptus grandis]
Length=487

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 279/494 (56%), Positives = 341/494 (69%), Gaps = 44/494 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V   K EVVAAALP+QE  +LP SNLDLLLPP++VGVFFCY  P      TTT
Sbjct  6     GAGGEFAVKWGKKEVVAAALPMQE-LWLPLSNLDLLLPPLEVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LKAAL++ALVS+YALAGEV QN  GEPEL+CNNRGVDF++AFAD+EL
Sbjct  59    ASQRLGYGSMVGILKAALAQALVSYYALAGEVVQNSVGEPELLCNNRGVDFIEAFADIEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PD+++EGKLVP KKQGVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W
Sbjct  119   RHLNLYNPDETIEGKLVPAKKQGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFW  178

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--------  760
             +E A+ A  +S  P FRRS L PRRP   D SLD+MY+P+++L P   ++ K        
Sbjct  179   AETARSAAPISLPPSFRRSLLNPRRPLCVDPSLDSMYIPVTALPPPPQQKQKADEEQETT  238

Query  761   --------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                     +SR+Y V A ++ ELQ +A    ++      R+KLEAF AFLWK VA   S 
Sbjct  239   TSRDDDCLVSRMYYVTAAKLSELQQRACSSGSN------RSKLEAFSAFLWKMVAESSSV  292

Query  917   RNFKNFK----LGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N  + K    +GIVVDGR RL S   ++K   +  YFGNVLS PF EK   E+ EKPL+
Sbjct  293   ANNDDNKMMSRMGIVVDGRCRLMSRAVDDKPTPMASYFGNVLSIPFGEKRAMEVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDG--------AALVVSSG  1237
             WVA AVHEF+E   T +HFL LIDWVE HRP PA+ +++ C  G         A VVSSG
Sbjct  353   WVAEAVHEFVERGATREHFLDLIDWVEEHRPVPAVARIY-CKPGIEEEEEGSTAFVVSSG  411

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV ++DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  IE++
Sbjct  412   QRFPVTEMDFGWGKPVVGSYHFPWGGEAGYVMPMPSPLSNGDWVVYLHLSRSQVAFIESH  471

Query  1418  ASHVFKPFTSDHLN  1459
             A  +F+P T  +LN
Sbjct  472   APTLFRPLTPRYLN  485



>ref|XP_008228085.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Prunus 
mume]
Length=458

 Score =   503 bits (1294),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 277/471 (59%), Positives = 338/471 (72%), Gaps = 32/471 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+V+K EVVAAA    + H LP SNLDLLLPPVDVGVFFCY+            E   
Sbjct  6     FKVTVSKQEVVAAAFCPLQDHCLPLSNLDLLLPPVDVGVFFCYKN-----------EQRM  54

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             +F  MV  L+ A+++ALV+FYA +GEV QN  GEPE++CNNRGVDF +AFADVEL+ LNL
Sbjct  55    SFWSMVGVLRKAMAQALVTFYAFSGEVMQNSVGEPEIMCNNRGVDFFEAFADVELKDLNL  114

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
               PD+S   KLVPKKK+GVL+VQATELKCGG+VVA  FDHR+ADAYS NMFLVSW+E+AQ
Sbjct  115   DDPDES---KLVPKKKRGVLAVQATELKCGGMVVACSFDHRIADAYSTNMFLVSWAEMAQ  171

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-----EAVEEPKISRIYCVAA  787
             +K LS LP FRRS L PRRP H D SL++MYVPI++L P     +  ++  ISRIY V A
Sbjct  172   SKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVPITALPPPKNDTDVDQDHLISRIYYVTA  231

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
             EQ+  LQ+ A           +RTKLE+FCAFLWK VA   ++  +  K  K+GIVVDGR
Sbjct  232   EQLDNLQALACSNGF------KRTKLESFCAFLWKMVAKSDTKIGYAQKLCKMGIVVDGR  285

Query  962   TRLSIG---DENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             TRL        ++A  +  YFGNVLS PF  +  ++L EK LNWVA  VH+FL+ A+T +
Sbjct  286   TRLDKQGNYQSHQASHMATYFGNVLSVPFGGEKTEDLVEKSLNWVAEEVHDFLKCAVTKE  345

Query  1133  HFLGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             HFLGLIDWVEAHRP PA+ K++     +G A VVSSGQRFPV K+DFGWG P FGSYHFP
Sbjct  346   HFLGLIDWVEAHRPVPALAKIYSSGSEEGPAFVVSSGQRFPVSKVDFGWGLPVFGSYHFP  405

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WGG +GYVMPMPSP   GDWIVYM + K ++ELIE  A+HVF+  TSD+L+
Sbjct  406   WGGNAGYVMPMPSPARKGDWIVYMRIFKGQLELIEKEAAHVFRRLTSDYLS  456



>ref|XP_003553148.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Glycine max]
Length=472

 Score =   501 bits (1290),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 277/480 (58%), Positives = 333/480 (69%), Gaps = 31/480 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N +F+V+VT  EVVAA +P+QE H+LP SNLDLLLPPVDVGVFFCY+ P + +      +
Sbjct  5     NGDFSVNVTNEEVVAAVVPMQE-HWLPLSNLDLLLPPVDVGVFFCYKNPISTTLGDNGNK  63

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                TFG MV TLK AL+ AL+S+Y  AGEV  N  GEPE++CNNRGVDFV+A ADVEL+ 
Sbjct  64    --MTFGSMVGTLKKALARALISYYVFAGEVVPNNMGEPEVLCNNRGVDFVEAVADVELKC  121

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LN Y PDD++EG+ VPKKK GVL+VQAT LKCGGI+VA  FDHRVADAYS NMFLVSW+E
Sbjct  122   LNFYNPDDTIEGRFVPKKKNGVLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAE  181

Query  614   IAQAKQLSQL-----------PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
             +AQ  + +             PCFRRS L PRRP     SL +MY PIS   P       
Sbjct  182   MAQPTKPNNAVTAAAATAYRHPCFRRSLLSPRRPGSIHPSLHHMYTPISEFPPPPASAAT  241

Query  761   --ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNFKN  931
               +SRIY V AEQ+  +Q  A            RTKLE F AFLWK VA   S+  N K 
Sbjct  242   ALLSRIYYVKAEQLHRMQFLA----------ATRTKLECFSAFLWKMVALAASKEENGKR  291

Query  932   F--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
                K+GIVVDGR RL  GD+     ++ YFGNVLS PF+ K ++EL EKPL +VA AVHE
Sbjct  292   VVAKMGIVVDGRKRLGNGDKESEAMMECYFGNVLSIPFDGKPVQELVEKPLGFVAEAVHE  351

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGK  1279
             FL  A T +HFLGLIDWVE HRP P + K++  +  +G A VVSSGQRFP  K+DFGWGK
Sbjct  352   FLMAAATEEHFLGLIDWVEDHRPVPGVAKIYYSNTKEGPAFVVSSGQRFPEDKVDFGWGK  411

Query  1280  PAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
               F SYHFPW G++GYVMPMPSP  NGDW+VYMHL K+++E+IE+ A+HVFKP T D+LN
Sbjct  412   VVFASYHFPWAGEAGYVMPMPSPLENGDWVVYMHLAKKQLEIIESEAAHVFKPLTWDYLN  471



>gb|KHM99656.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=473

 Score =   498 bits (1283),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 278/482 (58%), Positives = 333/482 (69%), Gaps = 36/482 (7%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQT-TTE  250
             N NF+V+VT  EVVAA +P+QE ++LP SNLDLLLPP+DVGVFFCY+ P   S     + 
Sbjct  5     NENFSVNVTNEEVVAAVVPMQE-YWLPLSNLDLLLPPLDVGVFFCYKNPMLKSTTLGNSG  63

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
              +  TFG MV +LK AL++ LVS+Y  AGEV  N  GEPE++CNNRGVDFV+A ADVEL+
Sbjct  64    TNKMTFGSMVRSLKNALAQTLVSYYVFAGEVVPNNMGEPEVLCNNRGVDFVEAEADVELK  123

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LN Y PDD++EGK V KKK GVL+VQAT LKCGGI+VA  FDHRVADAYS NMFLVSW+
Sbjct  124   CLNFYNPDDTIEGKFVTKKKNGVLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWA  183

Query  611   EIAQ------------AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL--QPEAV  748
             ++AQ            A   S+ PCFRRS L PRRP     SL +MY PIS L   P   
Sbjct  184   DMAQPTKPNNTLVVTVAPTASRHPCFRRSLLSPRRPGSIHPSLHHMYTPISELPPPPSTA  243

Query  749   EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNF  925
                 +SRIY V AEQ+  +Q  A            RTKLE F AFLWK VA   S+ +N 
Sbjct  244   SAALLSRIYYVTAEQLHLMQVFA----------ATRTKLECFSAFLWKMVARAASKEKNG  293

Query  926   KNF--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAV  1099
             K    K+GIVVDGR RL  GD+     ++ YFGNVLS PF  K ++EL E+PL ++A AV
Sbjct  294   KRVVAKMGIVVDGRKRLGNGDKESEAMMESYFGNVLSIPFGGKPVEELVEEPLGFLAEAV  353

Query  1100  HEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGW  1273
             H     A T +HFLGLIDWVEAHRP P I K++  +  DG A VVSSGQRFP  K+DFGW
Sbjct  354   H-----ATTEEHFLGLIDWVEAHRPVPGITKIYCNNADDGPAFVVSSGQRFPEDKVDFGW  408

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             GK  F SYHFPWGG++GYVMPMPSP  NGDWIVYMHL K+++E+IE+ A+HVFKP T D+
Sbjct  409   GKVVFASYHFPWGGETGYVMPMPSPSRNGDWIVYMHLAKKQLEIIESEAAHVFKPLTWDY  468

Query  1454  LN  1459
             LN
Sbjct  469   LN  470



>gb|KEH33677.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=474

 Score =   498 bits (1283),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 338/480 (70%), Gaps = 24/480 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             + +  NF VSVT  EVV A LP++E H LP SNLDLLLP +DVGVFFCY+ P   S  TT
Sbjct  3     IGNGDNFIVSVTNEEVVTAVLPIKE-HCLPLSNLDLLLPALDVGVFFCYKNPMLLSTSTT  61

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   TF  MV +LK AL++ LVS+YA AGEV  N  GEPE++CNNRGVDFV+A ADVE
Sbjct  62    ----LLTFDSMVVSLKKALAKVLVSYYAFAGEVVSNSVGEPEILCNNRGVDFVEAVADVE  117

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LN Y PD+SVEGK VPKKK GVL++QAT L CGGIVVA  FDHR+ADAYS NMFLVS
Sbjct  118   LQCLNFYNPDESVEGKFVPKKKHGVLAIQATSLNCGGIVVACTFDHRIADAYSTNMFLVS  177

Query  605   WSEIAQAKQ-----LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--I  763
             W+E+A   +     ++  PCFRRS L PR P     SLD+MY+PIS L P +    K  +
Sbjct  178   WAEMAHPTKSKSITMTNEPCFRRSLLNPRHPGSIHPSLDDMYIPISELSPPSATTAKSLL  237

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN--FK  937
             SRIY V +E++  LQS A+ ++ +    P  TKLE+F A+LWK VA+  +R   K    K
Sbjct  238   SRIYFVTSEELYRLQSLAD-WTNNGTTKP--TKLESFSAYLWKLVANSATRGGSKMGIAK  294

Query  938   LGIVVDGRTRL----SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
             +GIVVDGR RL    S GD  +A  +  YFGNVLS PF  K+++EL +KPL WV   V E
Sbjct  295   MGIVVDGRRRLGNDSSDGDGREA-MMTHYFGNVLSIPFGGKSVEELIDKPLGWVVDKVRE  353

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGK  1279
             F+  A T +HFLGLIDWVEAHRP P + K++  D  +G A VVSSGQRFP  K+DFGWGK
Sbjct  354   FVSVATTEEHFLGLIDWVEAHRPVPGLTKIYCGDPNEGPAFVVSSGQRFPEDKVDFGWGK  413

Query  1280  PAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
               F SYHFPWGG++GYVMPMPSP  NGDWIVYMHL KE++E+IE+ A HVFKP T D+LN
Sbjct  414   VVFASYHFPWGGETGYVMPMPSPLRNGDWIVYMHLSKEQLEIIESEADHVFKPLTWDYLN  473



>ref|XP_007146240.1| hypothetical protein PHAVU_006G024000g [Phaseolus vulgaris]
 gb|ESW18234.1| hypothetical protein PHAVU_006G024000g [Phaseolus vulgaris]
Length=474

 Score =   498 bits (1281),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 330/482 (68%), Gaps = 29/482 (6%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A N +F+V VT  EVVAA LP+QE H+LP SNLDLLLPP+DVGVF CY+ P   S  T  
Sbjct  3     AENGDFSVDVTNEEVVAAVLPMQE-HWLPLSNLDLLLPPLDVGVFLCYKNPILTSTATME  61

Query  248   E--EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADV  421
             +   +  TFG MV +LK AL++ L+S+Y  AGEV  N   EPE++CNNRGVDFV+A ADV
Sbjct  62    DCGTNKMTFGSMVGSLKKALAQTLISYYVFAGEVVLNNMDEPEVLCNNRGVDFVEAEADV  121

Query  422   ELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             EL+ LN Y PD S+EGK VPKKK GVL+VQAT L+CGGI+V   FDHR+ADAYSANMFLV
Sbjct  122   ELKNLNFYNPDQSIEGKFVPKKKNGVLAVQATALRCGGIIVGCTFDHRIADAYSANMFLV  181

Query  602   SWSEIAQ---AKQLSQL------PCFRRSFLFPRRPAHYDLSLDNMYVPISSL--QPEAV  748
             SW+ +A    +K  + L      PCFRRS L PRRP     SL ++Y PIS L   P   
Sbjct  182   SWAAMAHPTTSKPTTILAATSCHPCFRRSLLSPRRPGSIHPSLHHLYTPISHLPPAPTTA  241

Query  749   EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNF  925
                 +SRIY V AEQ+  +QS A            RTKLE F AFLWK VA   SR RN 
Sbjct  242   ASALLSRIYYVTAEQLHHMQSLA----------ATRTKLECFSAFLWKMVARAASRDRNG  291

Query  926   KNF--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAV  1099
             K    K+GIVV+GR RL  GD+     ++ YFGNVLS PF  K ++EL ++PL +V  AV
Sbjct  292   KRVTAKMGIVVEGRKRLGNGDKESEAMMECYFGNVLSIPFGGKLVEELVKEPLGFVVEAV  351

Query  1100  HEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGW  1273
             HEFL  A T +HFLGLIDWVE  RP P + +++     +G A VVSSGQRFP  K+DFGW
Sbjct  352   HEFLAAAATEEHFLGLIDWVEGQRPIPGVARIYCNRADEGPAFVVSSGQRFPQEKVDFGW  411

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             GK  F SYHFPWGG++GYVMPMPSP GNGDW+VYMHL K+++  IET A+HVFKP T D+
Sbjct  412   GKAVFASYHFPWGGEAGYVMPMPSPLGNGDWVVYMHLAKKQLHTIETEAAHVFKPLTWDY  471

Query  1454  LN  1459
             LN
Sbjct  472   LN  473



>ref|XP_004303785.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   496 bits (1277),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 271/476 (57%), Positives = 339/476 (71%), Gaps = 36/476 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    F VS  K + VAAALP+QE H LP SNLDLLLPPVDVGVFFCY+  ++ S   +
Sbjct  1     MAGGREFKVSTRKQDAVAAALPLQE-HRLPLSNLDLLLPPVDVGVFFCYKNHSSPSVAAS  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                        V  LK  L++ALV++YA +GEV  N  GEPE++CNNRGVDF +AFADVE
Sbjct  60    R----------VGVLKKGLAQALVTYYAFSGEVVANSVGEPEILCNNRGVDFTEAFADVE  109

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++LNL+ PD+S+EGKLVP KK G+L+VQATELKCGG+VVA  FDHR+ADAYSANMFLVS
Sbjct  110   LKELNLHNPDESIEGKLVPNKKHGILAVQATELKCGGMVVACTFDHRIADAYSANMFLVS  169

Query  605   WSEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV------EEPKI  763
             W+++A ++  +  +P FRRS L PRRP     SL+++YVP++SL P         E+  +
Sbjct  170   WAKMANSESPVIIVPSFRRSLLNPRRPGQIHPSLNDLYVPVTSLPPPPKMETNDHEDRLL  229

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF-KL  940
             SRIY V AEQ+ +LQ+ A+          +R+KL +F AFLWK VA  ++  + +   K+
Sbjct  230   SRIYYVKAEQLIKLQALASSSGC------KRSKLVSFSAFLWKMVAGSETGNDVEKLCKM  283

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             GIVVDGR+RL+  DENK   +  YFGNVLS PF +K I+EL EK LNWVA  VHEFLE A
Sbjct  284   GIVVDGRSRLA--DENK---MASYFGNVLSIPFGDKVIQELNEKSLNWVADEVHEFLECA  338

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKPAF  1288
             +T +HFLGLIDWVEAHRP P + K+  C  G+    A VVSSGQR PV ++DFGWG P F
Sbjct  339   VTKEHFLGLIDWVEAHRPVPGMAKI--CCSGSEEGPAFVVSSGQRLPVSEVDFGWGAPLF  396

Query  1289  GSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             GSYHF WGG SGYVMPMPSP GNGDW+VYMH+ K ++++IE    HVFKP T D+L
Sbjct  397   GSYHFSWGGSSGYVMPMPSPVGNGDWVVYMHMLKGQLDVIEKEGGHVFKPLTYDYL  452



>ref|XP_010058993.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=487

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 276/495 (56%), Positives = 341/495 (69%), Gaps = 44/495 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              ++  F V + K EVV A LP+Q  H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6     GTSREFVVKLGKREVVVAPLPMQG-HWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G ++  LKAAL++ALVS+YALAGEV QN AGEPEL+CNN+GVDF++AFADVEL
Sbjct  59    ASQRLEYGPVIGVLKAALAQALVSYYALAGEVVQNSAGEPELLCNNQGVDFIEAFADVEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PD++VEGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYS NMF+V W
Sbjct  119   RHLNLYNPDNTVEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSINMFMVFW  178

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------------EAV  748
             +E A+ A  +S  P FRRS L PR P ++D SLD MY+P+S+L P            E V
Sbjct  179   AETARSATPISLPPSFRRSLLNPRHPLYFDPSLDRMYIPVSALPPPPKHKLQVDEQCETV  238

Query  749   ----EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                 ++  +SR+Y V A ++ ELQ  A    +      +RTKLE+F AFLW+ VA   S 
Sbjct  239   TLRDDDHLLSRLYYVTAAKLSELQQSACSNGS------KRTKLESFSAFLWRMVAESSSV  292

Query  917   RNFKNFK----LGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N  + K    +GIVVDGR RL S G+++K   +  YFGNVLS PF E   +E+ EKPL+
Sbjct  293   ANNDDNKTMSRMGIVVDGRCRLMSQGEDDKPTPMSSYFGNVLSVPFGETRAREVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDG--------AALVVSSG  1237
             WVA  VHEF+E A   +HFL LIDWVE HRP PA  ++  C  G         ALVVSSG
Sbjct  353   WVADVVHEFVERAAKKEHFLDLIDWVEGHRPVPASARIF-CKPGNEEEEEGSTALVVSSG  411

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV ++DFGWGKP  GSYHFPWGG+SGYVMPMPSP  NGDW+VY+HL + +V  IE++
Sbjct  412   QRFPVTEMDFGWGKPVLGSYHFPWGGKSGYVMPMPSPLSNGDWVVYLHLSRSQVAFIESH  471

Query  1418  ASHVFKPFTSDHLNF  1462
             A  +F+P T  +LN 
Sbjct  472   APTIFRPLTPHYLNL  486



>gb|KEH33678.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=470

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 336/482 (70%), Gaps = 32/482 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             + +  NF VSVT  EVVAA LP+QE H+LP SNLDLLLP VDVGVFFCY+ P        
Sbjct  3     IGNGDNFIVSVTNEEVVAAVLPIQE-HWLPLSNLDLLLPAVDVGVFFCYKNPMI------  55

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   TF  MV +LK AL++ LVS+YA AGEV  N  GEPEL+CNNRGVDFV+A ADVE
Sbjct  56    -----LTFESMVVSLKKALAKVLVSYYAFAGEVVSNSVGEPELLCNNRGVDFVEAVADVE  110

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+ LN Y PD+SVEGK VPKKK GVL++QAT LKCGGIVVA  FDHR+ADAYS NMFLVS
Sbjct  111   LQCLNFYNPDESVEGKFVPKKKHGVLAIQATSLKCGGIVVACTFDHRIADAYSTNMFLVS  170

Query  605   WSEIAQAKQ--------LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA--VEE  754
             W+E+A   +        ++  PCFRRS L PR P+    SLD+MY+PIS L P +    +
Sbjct  171   WAEMAHPVKPIKPTTITITNKPCFRRSLLSPRHPSFIHPSLDDMYIPISKLPPPSATATK  230

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF  934
             P +SRIY V AE++  LQS     ++ +    + +KLE+F A+LWK VA   +R   K  
Sbjct  231   PLLSRIYYVTAEELHRLQSLG---ASAKNGTTKPSKLESFSAYLWKLVAKAVTRDGSKMV  287

Query  935   --KLGIVVDGRTRLS--IGDENKAKFLQG-YFGNVLSFPFEEKTIKELREKPLNWVASAV  1099
               K+GIVVDGR R++    DE++ + L   YFGNVLS PF  K+++EL +KPL WV   V
Sbjct  288   IAKMGIVVDGRRRIANNSSDEDRGEALMTHYFGNVLSIPFGGKSVEELVDKPLGWVVDEV  347

Query  1100  HEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGW  1273
              EF+  A T +HFLGLIDWVEAHRP P + K++     +G A VVSSGQRFP  K+DFGW
Sbjct  348   REFVSVATTEEHFLGLIDWVEAHRPVPGLAKIYSGGTNEGPAFVVSSGQRFPEDKVDFGW  407

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             GK  F SYHFPWGG++GYVMPMPSP  NGDW+VYMHL KE++++IE+ A HVF P T D+
Sbjct  408   GKVVFASYHFPWGGEAGYVMPMPSPLRNGDWVVYMHLLKEQLDIIESEADHVFMPLTWDY  467

Query  1454  LN  1459
             LN
Sbjct  468   LN  469



>gb|KHN13176.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=469

 Score =   496 bits (1276),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 276/480 (58%), Positives = 332/480 (69%), Gaps = 34/480 (7%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N +F+V+VT  EVVAA +P+QE H+LP SNLDLLLPPVDVGVFFCY+ P + +      +
Sbjct  5     NGDFSVNVTNEEVVAAVVPMQE-HWLPLSNLDLLLPPVDVGVFFCYKNPISTTLGDNGNK  63

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                TFG MV TLK AL+ AL+S+Y  AGEV  N  GEPE++CNNRGVDFV+A ADVEL+ 
Sbjct  64    --MTFGSMVGTLKKALARALISYYVFAGEVVPNNMGEPEVLCNNRGVDFVEAVADVELKC  121

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             LN Y PDD++EG+ VPKKK GVL+VQAT LKCGGI+VA  FDHRVADAYS NMFLVSW+E
Sbjct  122   LNFYNPDDTIEGRFVPKKKNGVLAVQATSLKCGGIIVACTFDHRVADAYSTNMFLVSWAE  181

Query  614   IAQAKQLSQL-----------PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
             +AQ  + + +           PCFRRS L PRRP     SL +MY PIS   P       
Sbjct  182   MAQPTKPNNVITAAAASGYRHPCFRRSLLSPRRPGSIHPSLHHMYTPISEFPPPPASAAT  241

Query  761   --ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR-RNFKN  931
               +SRIY V AEQ+  +Q  A            RTKLE F AFLWK VA   S+  N K 
Sbjct  242   ALLSRIYYVKAEQLHRMQFLA----------ATRTKLECFSAFLWKMVALAASKEENGKR  291

Query  932   F--KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
                K+GIVVDGR RL  GD+     ++ YFGNVLS PF+ K ++EL EKPL   A AVHE
Sbjct  292   VVAKMGIVVDGRKRLGNGDKESEAMMECYFGNVLSIPFDGKPVQELVEKPL---AEAVHE  348

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGK  1279
             FL  A T +HFLGLIDWVE HRP P + K++  +  +G A VVSSGQRFP  K+DFGWGK
Sbjct  349   FLMAATTEEHFLGLIDWVEDHRPVPGVAKIYYSNTKEGPAFVVSSGQRFPEDKVDFGWGK  408

Query  1280  PAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
               F SYHFPW G++GYVMPMPSP  NGDW+VYMHL K+++E+IE+ A+HVFKP T D+LN
Sbjct  409   VVFASYHFPWAGEAGYVMPMPSPLENGDWVVYMHLAKKQLEIIESEAAHVFKPLTWDYLN  468



>emb|CDO99661.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   494 bits (1273),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 334/475 (70%), Gaps = 49/475 (10%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    F V VT  EVVAA LP+QE H+LP SNLDLLLPPVDVG                
Sbjct  1     MALKQGFEVKVTLTEVVAAVLPMQE-HWLPLSNLDLLLPPVDVG----------------  43

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                              AL++ LVS+YA AGE+ QNL+GEPEL+CNNRGVDFV+AFAD+E
Sbjct  44    ----------------KALAQTLVSYYAFAGEMVQNLSGEPELLCNNRGVDFVEAFADIE  87

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             LR+L+LY PD+SVEGKLVP+K+QGVLSVQAT+LKCGG+V+   FDHRVADAYSANMFLVS
Sbjct  88    LRELDLYNPDESVEGKLVPQKEQGVLSVQATQLKCGGLVIGCTFDHRVADAYSANMFLVS  147

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--------EPK  760
             W+E+AQ+K ++ LP  RRS L  RRP H+D+S+++MY+ I  + P   E        +  
Sbjct  148   WAEMAQSKPVTTLPSHRRSLLSSRRPGHFDISINDMYMKIPQMPPPDKELNDRINNNQAP  207

Query  761   ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKL  940
             ISRIY V AEQ+ +LQS AN       K   RTKLEAF AFLWK +A G    + K  +L
Sbjct  208   ISRIYYVKAEQVHQLQSLANDDKRGSKKFV-RTKLEAFTAFLWKLIAKGTGAGD-KYCRL  265

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             GIVVDGRTRL+ GDE+    +  YFGNVLS PF EK  KEL+E  L+ +A  VH FL+ A
Sbjct  266   GIVVDGRTRLNGGDES---MMNKYFGNVLSIPFGEKRNKELKEMNLSMIADEVHNFLDGA  322

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHD---CVDGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
             +T +HFLGLID+VEAHRPEPA  +++      +  A VVSSGQ+FP+RKIDFGWG P FG
Sbjct  323   VTREHFLGLIDYVEAHRPEPAFSRIYGSKVTREEPAFVVSSGQQFPIRKIDFGWGVPIFG  382

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             SYHFPWG QSG+VMPMP   GNGDWIVYMHL++E++E+IE  A HVF+PF  D+L
Sbjct  383   SYHFPWGAQSGFVMPMPCASGNGDWIVYMHLRQEQIEVIELNAPHVFRPFCHDYL  437



>ref|XP_010058994.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=504

 Score =   497 bits (1279),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 280/502 (56%), Positives = 345/502 (69%), Gaps = 44/502 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V   K EVVAA LP+Q  H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6     GAGREFVVKSGKREVVAAPLPMQG-HWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G +V  LKAAL++ALVS+YALAGEV QNLAGEPEL+CNN+GVDF++AFAD+EL
Sbjct  59    ASQRLEYGSVVGVLKAALAQALVSYYALAGEVVQNLAGEPELMCNNQGVDFIEAFADMEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PDD+VEGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYS NMF+V W
Sbjct  119   RHLNLYNPDDTVEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSVNMFMVFW  178

Query  608   SEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------------EAV  748
             +E A++   +S  P FRRS L PR P ++D SLD MY+P+S++ P            E V
Sbjct  179   AETARSTAPISLPPSFRRSLLNPRHPLYFDPSLDCMYIPVSAMPPPPKHNLQVDEQCETV  238

Query  749   ----EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                 ++  +SR+Y V A ++ ELQ  A    +      +RTKLE+F AFLWK VA   S 
Sbjct  239   TLRDDDRLLSRMYYVTAAKLSELQQSACSNGS------KRTKLESFSAFLWKMVAESSSV  292

Query  917   RNFKNFK----LGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N  + K    +GIVVDGR RL S G++NK   +  YFGNVLS PF EK  +E+ EKPL+
Sbjct  293   ANDDDKKTMSRMGIVVDGRCRLMSQGEDNKPTPMSSYFGNVLSVPFGEKRAREVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA--------ALVVSSG  1237
             WVA  VHEF+E A   +HFL LIDWVE HRP PA+ ++  C  G+        A VVSSG
Sbjct  353   WVADVVHEFVERAAKKEHFLDLIDWVEGHRPVPAMSRIF-CKPGSKEEEEGSTAFVVSSG  411

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRF V ++DFGWGKP  GSYHFPW G++GYVMPMPSP  NGDW+VY+HL K +V  IE++
Sbjct  412   QRFLVTEMDFGWGKPVLGSYHFPWRGKTGYVMPMPSPLSNGDWVVYLHLSKSQVAFIESH  471

Query  1418  ASHVFKPFTSDHLNFN*SSTTV  1483
             A  VF+P   DH++   S+TT 
Sbjct  472   APTVFRPKAFDHMSRLVSNTTT  493



>gb|EYU33936.1| hypothetical protein MIMGU_mgv1a005884mg [Erythranthe guttata]
Length=466

 Score =   494 bits (1272),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 272/478 (57%), Positives = 338/478 (71%), Gaps = 31/478 (6%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M +  +F V V+  EVVAAALP+QE H LP SNLDLLLPPVD GVFFCY           
Sbjct  1     MHAKRDFVVKVSGTEVVAAALPMQE-HLLPLSNLDLLLPPVDFGVFFCYD-------NNN  52

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                H  TF  MV  LK +L++ LV +Y  AGE+ +N AGEPEL+CNN GVDFV+A ADVE
Sbjct  53    NRRHELTFDHMVGVLKNSLAQTLVPYYPFAGELVKNGAGEPELLCNNCGVDFVEASADVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
              + L+ Y PDD+VEGKL+P +  GVL+VQAT+LK GG+VVA  F H+VADAYSANMFLVS
Sbjct  113   FKDLDFYNPDDTVEGKLIPARNHGVLAVQATQLKNGGLVVACTFAHQVADAYSANMFLVS  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEE----------  754
             W+E AQ+K LS+ P FRRS L PR P  Y  S+D+MYV +SS+ P    E          
Sbjct  173   WAETAQSKPLSRPPSFRRSLLLPRLPGGYHQSVDDMYVNVSSIPPPPPPENHPQDNDRLA  232

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF  934
               +SRIY + A+Q+ +LQ+QAN  ++      RRTK+EAFCAF+WKT+ASG+      + 
Sbjct  233   TAMSRIYYMKADQVNQLQAQANVDNSGT----RRTKMEAFCAFIWKTIASGEDSAGDNHC  288

Query  935   KLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFL  1111
             +LG+VVDGR RL   GDE     ++ YFGNVLS PF EK I EL  KPLNW A  VH FL
Sbjct  289   RLGVVVDGRNRLIDDGDE-----IESYFGNVLSIPFGEKKIAELTGKPLNWAAREVHAFL  343

Query  1112  EEALTGDHFLGLIDWVEAHRPEPAIPKVH---DCVDGAALVVSSGQRFPVRKIDFGWGKP  1282
             + A+T +HFLGLIDWVE  RPE  + +++   +  + AA+VVSSGQRFPVR++D+GWG P
Sbjct  344   QAAVTREHFLGLIDWVEERRPEKGVSRIYAAAEEEEEAAVVVSSGQRFPVREMDYGWGNP  403

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             AFGSYHFPWGG+SGYVMPMPSP GNGDWIVY+HL K +++LIE+ A+ VF P T D+L
Sbjct  404   AFGSYHFPWGGKSGYVMPMPSPNGNGDWIVYIHLMKAQLDLIESNAARVFNPITRDYL  461



>ref|XP_002532044.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF30334.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=455

 Score =   492 bits (1267),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 272/479 (57%), Positives = 331/479 (69%), Gaps = 46/479 (10%)
 Frame = +2

Query  65    MASNSN---FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASA  235
             M SN     F+V+V+K EVVAA LP QE H+LP SNLDLLLP +DVGVFFCY+KP     
Sbjct  1     MGSNGEANYFSVTVSKEEVVAAVLPSQE-HWLPLSNLDLLLPQLDVGVFFCYKKPKMG--  57

Query  236   QTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFA  415
                       FG MV+ LK A++EALV +Y  AGEV  N  GEPEL+CNNRGVDF +AF 
Sbjct  58    ----------FGSMVSVLKKAMAEALVLYYPFAGEVVANPLGEPELLCNNRGVDFSEAFT  107

Query  416   DVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMF  595
             D EL  LNLY PD  ++GKLVP+KK GV +VQATELKCGG+VV   FDHR+ADAYS NMF
Sbjct  108   DAELVDLNLYNPDVCIDGKLVPEKKNGVFAVQATELKCGGVVVGCTFDHRIADAYSTNMF  167

Query  596   LVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----  760
             LVSW+E AQ+K +S  P  RRS L PRRP H   SLDN+Y+PIS       ++PK     
Sbjct  168   LVSWAEAAQSKPISTTPSLRRSLLNPRRPGHIHPSLDNIYLPISLFA--LPKDPKTNNLD  225

Query  761   -----ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF  925
                  ISRIY V A+++ +LQS A+          +RTKLE+F AFLW+ +A   S+ N 
Sbjct  226   DHDHLISRIYYVKADELTQLQSLASSNGN------KRTKLESFSAFLWQLIAQCASKNNT  279

Query  926   KN-----FKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVA  1090
             KN      K+GIVVDGR+RL   D+     +  YFGNVLS P+    I EL E  L+WVA
Sbjct  280   KNGKTKVSKMGIVVDGRSRLLSDDK-----MCTYFGNVLSIPYGCMKIDELIEHKLSWVA  334

Query  1091  SAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKID  1264
             + VH+FLE  +T +HFLGLIDWVEAHRPEPA+ K++     DG A V+SSGQRFPV ++D
Sbjct  335   NKVHDFLESEVTKEHFLGLIDWVEAHRPEPAVSKIYASYKEDGPAFVISSGQRFPVCEVD  394

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPF  1441
             FGWG PAFGSYHFPWGG +GYVMPMPSP GNGDW++YMHL +E++E +E  A+  FKPF
Sbjct  395   FGWGIPAFGSYHFPWGGNTGYVMPMPSPAGNGDWVLYMHLFREQLEFLEIEAASFFKPF  453



>ref|XP_010030883.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=488

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 277/495 (56%), Positives = 343/495 (69%), Gaps = 45/495 (9%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +   F V + K EVVAAAL +QE H+LP SNLDLLLPP+DVGVFFCY  P A ++Q    
Sbjct  7     AGGEFAVKLGKKEVVAAALSMQE-HWLPLSNLDLLLPPLDVGVFFCYTNPTATASQRLE-  64

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
                  +G MV  LKAAL +ALVS+YALAGEV QN   EPEL+CNN GVDF++AFA+VELR
Sbjct  65    -----YGSMVGILKAALGQALVSYYALAGEVVQNSVCEPELLCNNSGVDFIEAFAEVELR  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W+
Sbjct  120   HLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWA  179

Query  611   EIAQAKQLSQL-PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP---------EAVEEPK  760
             + A++   + L P F  S L PRRP   + SLD+MY+P+S+L P         EA E   
Sbjct  180   DKARSAAPTSLPPSFNHSLLNPRRPLCVNASLDSMYIPVSALPPPPKQKQKADEACETTT  239

Query  761   -------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGK  910
                    +SR+Y V A ++ ELQ +A  YS       +R+KLE+F AFLWK VA   SG 
Sbjct  240   SRDDDCVVSRMYYVTAAELSELQQRA--YS----NGSKRSKLESFSAFLWKMVAESSSGA  293

Query  911   SRRNFKNF-KLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNW  1084
             S  + K   ++GIVVDGR RL S    ++   +  YFGNVLS PF EK   E+ EKPL+W
Sbjct  294   SNDDDKRMSRMGIVVDGRCRLMSQHMHDEPTPMASYFGNVLSIPFGEKRTTEVMEKPLSW  353

Query  1085  VASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA---------ALVVSSG  1237
             VA AVHEF++ A T +HFL LIDWVE HRP PA+ +++ C  G+         A VVSSG
Sbjct  354   VAEAVHEFVQRAATREHFLDLIDWVEEHRPVPAVARIY-CKSGSAKEEEEGSTAFVVSSG  412

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV ++DFGWGKPA GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  IE++
Sbjct  413   QRFPVTEMDFGWGKPALGSYHFPWGGEAGYVMPMPSPLSNGDWVVYLHLARSQVAFIESH  472

Query  1418  ASHVFKPFTSDHLNF  1462
             A  VF+P T  +LN 
Sbjct  473   APTVFRPLTPRYLNL  487



>ref|XP_011094024.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Sesamum 
indicum]
Length=447

 Score =   489 bits (1260),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 259/469 (55%), Positives = 333/469 (71%), Gaps = 29/469 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             +  F V V ++EVVAA LPVQE H+LP SNLDLLLPP+D  +FFCY K       T + E
Sbjct  3     SGGFPVVVRRSEVVAAVLPVQE-HWLPMSNLDLLLPPLDFAIFFCYNK------ITESPE  55

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
             +A      V  LK AL++ALVSFY  AGE+ QN  GEPE++CNNRGVDF  A+ADVEL+ 
Sbjct  56    NA------VAVLKKALAQALVSFYPFAGELVQNRHGEPEMLCNNRGVDFTVAYADVELKD  109

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             ++LY+PD SV GKLVP K  GVLS+QATELKCGG+ +   FDHRVADAYSA+MFL +W+E
Sbjct  110   VDLYRPDVSVHGKLVPVKMHGVLSIQATELKCGGLFIGCTFDHRVADAYSADMFLTAWAE  169

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK---ISRIYCVA  784
             IA+AK +++LP FRRS   PRRP     S+D +Y P+ S+ P    +      SRIYCV 
Sbjct  170   IARAKPITRLPSFRRSLFNPRRPPQPHKSIDRLYAPLLSMPPTPSADDDDHLTSRIYCVK  229

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             +++I  LQSQA++         +R+K+E+F AFLWK++A+    R+ K  KLGIVVDGRT
Sbjct  230   SDEIDRLQSQASYNGT------KRSKIESFSAFLWKSLAAACDDRS-KAVKLGIVVDGRT  282

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             RLS     +   L  YFGNVLS P+ E ++ EL+   L  VA  VHE +  A T +HFL 
Sbjct  283   RLS----GRTTSLDCYFGNVLSIPYVEASVGELQTTSLTGVADMVHECVAMASTAEHFLA  338

Query  1145  LIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ  1318
             LIDWVE  RP+PA+ KV+  D  D AA+VVSSGQRFPV+++DFGWG+P FGSYHFPWGG+
Sbjct  339   LIDWVEVLRPKPAVVKVYCKDENDEAAVVVSSGQRFPVQEVDFGWGRPEFGSYHFPWGGE  398

Query  1319  SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             +GYVMPMPS  GNG+WIVY+HL+K+ ++L+E  A HVF+PF  ++LN +
Sbjct  399   TGYVMPMPSASGNGNWIVYVHLKKKHLDLVEARAPHVFRPFNCEYLNLD  447



>gb|KCW54004.1| hypothetical protein EUGRSUZ_J03198 [Eucalyptus grandis]
Length=487

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 273/495 (55%), Positives = 334/495 (67%), Gaps = 44/495 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V + K EVVAA LP+QE H+LP SNLDLLLPP+DVGVFFCY  P      TT 
Sbjct  6     GAGREFMVKLGKTEVVAAPLPMQE-HWLPLSNLDLLLPPLDVGVFFCYINP------TTP  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LK AL++ALVS+YALAGEV +N   EPEL+CNNRGVDF++AFAD+EL
Sbjct  59    TSQRLEYGSMVGILKVALAQALVSYYALAGEVVKNSVSEPELLCNNRGVDFIEAFADIEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADA SANMF+V W
Sbjct  119   CHLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADATSANMFMVFW  178

Query  608   SEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--------EPK  760
             +E A++    S  PCFRRS L PRRP   D SLD MYVPIS+L P            EP 
Sbjct  179   AETARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPISALPPPPQHKQQAGGEFEPT  238

Query  761   --------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                     +SR+Y V A Q+ ELQ  A+          +R+KLE+F AFLWK VA     
Sbjct  239   TSREDDRLVSRMYYVTATQLSELQQSASSNGG------KRSKLESFSAFLWKMVAESSLV  292

Query  917   RNFKNFK----LGIVVDGRTRLSIGD-ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N ++ K    +GIVVDGR RL   D ++K   +  YFGNVLS PF EK  +E+ EKPL+
Sbjct  293   ANNEDNKAISRMGIVVDGRCRLMSQDGDDKPTPMASYFGNVLSIPFGEKRAREVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA--------ALVVSSG  1237
             WVA AVH+F+E A T +HFL LIDWVE HRP P + +++ C  G+        A VVSSG
Sbjct  353   WVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIY-CKLGSEEEQEGSTAFVVSSG  411

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV K+DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  +E+ 
Sbjct  412   QRFPVAKMDFGWGKPVLGSYHFPWGGETGYVMPMPSPLSNGDWVVYLHLSRSQVAFVESK  471

Query  1418  ASHVFKPFTSDHLNF  1462
             A  VF+P    +L+ 
Sbjct  472   APTVFRPLNPHYLHL  486



>ref|XP_010040470.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45194.1| hypothetical protein EUGRSUZ_L01180 [Eucalyptus grandis]
Length=487

 Score =   488 bits (1257),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 270/494 (55%), Positives = 333/494 (67%), Gaps = 42/494 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V + K EVVAA LP+QE H+LP SNLDLLLPP++VGVFFCY  P      TT 
Sbjct  6     GAGREFMVKLGKTEVVAAPLPMQE-HWLPLSNLDLLLPPLEVGVFFCYINP------TTP  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LK AL++ALVS+YALAGEV +N   EPEL+CNNRGVDF++AFAD+EL
Sbjct  59    TSQRLEYGSMVGILKVALAQALVSYYALAGEVVKNSVSEPELLCNNRGVDFIEAFADIEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADA SANMF+V W
Sbjct  119   CHLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADATSANMFMVFW  178

Query  608   SEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--------EPK  760
             +E A++    S  PCFRRS L PRRP   D SLD MYVPIS+L P            EP 
Sbjct  179   AETARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPISALPPPPQHKQQAGGEFEPT  238

Query  761   --------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                     +SR+Y V A Q+ ELQ  A+          +R+KLE+F AFLWK VA     
Sbjct  239   TSREDDRLVSRMYYVTATQLSELQQSASSNGG------KRSKLESFSAFLWKMVAESSLV  292

Query  917   RNFKNFK----LGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N ++ K    +GIVVDGR RL S+  ++K   +  YFGNVLS PF EK  +E+ EKPL+
Sbjct  293   ANNEDNKAISRMGIVVDGRCRLMSLDGDDKPTPMASYFGNVLSIPFGEKRAREVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH-------DCVDGAALVVSSGQ  1240
             WVA AVH+F+E A T +HFL LIDWVE HRP P + +++       +     A VVSSGQ
Sbjct  353   WVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIYCKLGSEEEEEGSTAFVVSSGQ  412

Query  1241  RFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYA  1420
             RFPV K+DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  +E+ A
Sbjct  413   RFPVAKMDFGWGKPVLGSYHFPWGGETGYVMPMPSPLSNGDWVVYLHLSRSQVAFVESKA  472

Query  1421  SHVFKPFTSDHLNF  1462
               VF+P    +L+ 
Sbjct  473   PTVFRPLNPHYLHL  486



>ref|XP_010251800.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=457

 Score =   487 bits (1253),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 262/470 (56%), Positives = 333/470 (71%), Gaps = 26/470 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F VS+ + EVVA  LP+QE  YL  SNLDLLLPP+DVGVFFCYQKP         ++   
Sbjct  4     FKVSLKRKEVVATVLPLQE-QYLQLSNLDLLLPPLDVGVFFCYQKP--------RKQENL  54

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             TF  MV  LK ALSEALVS+Y L+GE+  N  GEP L+CNNRGVDF++A ADV+L+ +  
Sbjct  55    TFTSMVRILKKALSEALVSYYPLSGEIVINSVGEPMLLCNNRGVDFIEACADVDLQDVQF  114

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD S+   +VP++K+GVL VQATEL+CG I+VA  FDHRV DA+SANMFLV+W+E+ Q
Sbjct  115   YNPDSSL-ANIVPERKEGVLCVQATELRCGAILVACTFDHRVVDAHSANMFLVAWAELVQ  173

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPK----ISRIYCVA  784
             ++ +S +P F RS L PR P  YD S D+MYV  P S L P  V +P     ISRIY V 
Sbjct  174   SRPISIIPSFTRSLLNPRSPTCYDPSFDDMYVAVPRSMLPPPTVPKPGADHLISRIYYVR  233

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A+ I  LQS +N  +     + +R+K+E+F AFLWK +A   S  + +  K+GIVVDGR 
Sbjct  234   AQDIDYLQSLSNSNN-----YKKRSKIESFSAFLWKIIAK-TSSDDAERCKMGIVVDGRR  287

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             RLS G E+    +  YFGNVLS PF +K + +L+ KPL+WVA+ VH++L++A+T +HFLG
Sbjct  288   RLSNGVEDTTCSMVNYFGNVLSIPFGKKAVGDLKTKPLDWVANVVHDYLKDAVTKEHFLG  347

Query  1145  LIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             LIDWVE HRPE A+  ++ C    DG A VVSSGQ FPV K+DFGWG+P FGSYHFPW G
Sbjct  348   LIDWVEEHRPEAALATIY-CSKREDGPAFVVSSGQGFPVSKVDFGWGRPVFGSYHFPWNG  406

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             ++GYVMPMPS  GNGDWIVYMHL K ++E +E  AS VF+P TSD+L  +
Sbjct  407   EAGYVMPMPSSSGNGDWIVYMHLLKGQLEFLEVEASDVFRPLTSDYLGLS  456



>ref|XP_010034103.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=530

 Score =   489 bits (1260),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 273/495 (55%), Positives = 334/495 (67%), Gaps = 44/495 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V + K EVVAA LP+QE H+LP SNLDLLLPP+DVGVFFCY  P      TT 
Sbjct  49    GAGREFMVKLGKTEVVAAPLPMQE-HWLPLSNLDLLLPPLDVGVFFCYINP------TTP  101

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LK AL++ALVS+YALAGEV +N   EPEL+CNNRGVDF++AFAD+EL
Sbjct  102   TSQRLEYGSMVGILKVALAQALVSYYALAGEVVKNSVSEPELLCNNRGVDFIEAFADIEL  161

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADA SANMF+V W
Sbjct  162   CHLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADATSANMFMVFW  221

Query  608   SEIAQAKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--------EPK  760
             +E A++    S  PCFRRS L PRRP   D SLD MYVPIS+L P            EP 
Sbjct  222   AETARSDAPFSLPPCFRRSLLNPRRPLCIDPSLDRMYVPISALPPPPQHKQQAGGEFEPT  281

Query  761   --------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                     +SR+Y V A Q+ ELQ  A+          +R+KLE+F AFLWK VA     
Sbjct  282   TSREDDRLVSRMYYVTATQLSELQQSASSNGG------KRSKLESFSAFLWKMVAESSLV  335

Query  917   RNFKNFK----LGIVVDGRTRLSIGD-ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              N ++ K    +GIVVDGR RL   D ++K   +  YFGNVLS PF EK  +E+ EKPL+
Sbjct  336   ANNEDNKAISRMGIVVDGRCRLMSQDGDDKPTPMASYFGNVLSIPFGEKRAREVVEKPLS  395

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA--------ALVVSSG  1237
             WVA AVH+F+E A T +HFL LIDWVE HRP P + +++ C  G+        A VVSSG
Sbjct  396   WVAEAVHDFVERAATREHFLDLIDWVEGHRPAPGVTRIY-CKLGSEEEQEGSTAFVVSSG  454

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV K+DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  +E+ 
Sbjct  455   QRFPVAKMDFGWGKPVLGSYHFPWGGETGYVMPMPSPLSNGDWVVYLHLSRSQVAFVESK  514

Query  1418  ASHVFKPFTSDHLNF  1462
             A  VF+P    +L+ 
Sbjct  515   APTVFRPLNPHYLHL  529



>gb|KCW56804.1| hypothetical protein EUGRSUZ_I02472, partial [Eucalyptus grandis]
Length=482

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 340/489 (70%), Gaps = 45/489 (9%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +   F V + K EVVAAAL +QE H+LP SNLDLLLPP+DVGVFFCY  P A ++Q    
Sbjct  7     AGGEFAVKLGKKEVVAAALSMQE-HWLPLSNLDLLLPPLDVGVFFCYTNPTATASQRLE-  64

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
                  +G MV  LKAAL +ALVS+YALAGEV QN   EPEL+CNN GVDF++AFA+VELR
Sbjct  65    -----YGSMVGILKAALGQALVSYYALAGEVVQNSVCEPELLCNNSGVDFIEAFAEVELR  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W+
Sbjct  120   HLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWA  179

Query  611   EIAQAKQLSQL-PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP---------EAVEEPK  760
             + A++   + L P F  S L PRRP   + SLD+MY+P+S+L P         EA E   
Sbjct  180   DKARSAAPTSLPPSFNHSLLNPRRPLCVNASLDSMYIPVSALPPPPKQKQKADEACETTT  239

Query  761   -------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGK  910
                    +SR+Y V A ++ ELQ +A  YS       +R+KLE+F AFLWK VA   SG 
Sbjct  240   SRDDDCVVSRMYYVTAAELSELQQRA--YS----NGSKRSKLESFSAFLWKMVAESSSGA  293

Query  911   SRRNFKNF-KLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNW  1084
             S  + K   ++GIVVDGR RL S    ++   +  YFGNVLS PF EK   E+ EKPL+W
Sbjct  294   SNDDDKRMSRMGIVVDGRCRLMSQHMHDEPTPMASYFGNVLSIPFGEKRTTEVMEKPLSW  353

Query  1085  VASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA---------ALVVSSG  1237
             VA AVHEF++ A T +HFL LIDWVE HRP PA+ +++ C  G+         A VVSSG
Sbjct  354   VAEAVHEFVQRAATREHFLDLIDWVEEHRPVPAVARIY-CKSGSAKEEEEGSTAFVVSSG  412

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             QRFPV ++DFGWGKPA GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  IE++
Sbjct  413   QRFPVTEMDFGWGKPALGSYHFPWGGEAGYVMPMPSPLSNGDWVVYLHLARSQVAFIESH  472

Query  1418  ASHVFKPFT  1444
             A  VF+P T
Sbjct  473   APTVFRPLT  481



>ref|XP_010058984.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
Length=487

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 271/494 (55%), Positives = 331/494 (67%), Gaps = 42/494 (9%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V   K EVVAA LP+Q  H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6     GAGREFVVKSGKREVVAAPLPMQG-HWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G M   LKAAL++ALVS+YALAGEV  N A EPEL+CNN+GVDF++AFADVEL
Sbjct  59    ASQRLEYGSMFGVLKAALAQALVSYYALAGEVVPNSADEPELLCNNQGVDFIEAFADVEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               LNLY PDD+VEGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYS NMF+V W
Sbjct  119   CHLNLYNPDDTVEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSINMFMVFW  178

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI-------  763
             +E A+ A  +S  P FRRS L PR P  +D SLD MY+P+S+L P    + ++       
Sbjct  179   AETARSAAPISLPPSFRRSLLNPRHPLCFDPSLDRMYIPVSALPPPLKHKLQVDEQCETM  238

Query  764   ---------SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS----  904
                      SR+Y V   ++ ELQ  A    +      +RTKLE+F AFLW+ VA     
Sbjct  239   TLRDDDHLLSRLYYVTNAKLSELQQSACSNGS------KRTKLESFSAFLWRMVAESSLV  292

Query  905   GKSRRNFKNFKLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
               +  N    ++GIVVDGR RL S G ++K   +  YFGNVLS PF EK  +E+ EKPL+
Sbjct  293   ADNDDNKTMSRMGIVVDGRCRLMSQGKDDKPTPMSSYFGNVLSVPFGEKRAREVVEKPLS  352

Query  1082  WVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKV-------HDCVDGAALVVSSGQ  1240
             WVA  VHEF+E A   +HFL LIDWVE HRP PA+ ++        +     ALVVSSGQ
Sbjct  353   WVADVVHEFVESAAKKEHFLDLIDWVEGHRPVPALARIFCKPGSEEEEEGSTALVVSSGQ  412

Query  1241  RFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYA  1420
             RFPV ++DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V  IE++A
Sbjct  413   RFPVTEMDFGWGKPMLGSYHFPWGGKAGYVMPMPSPLSNGDWVVYLHLSRSQVAFIESHA  472

Query  1421  SHVFKPFTSDHLNF  1462
               VF+P T  HLN 
Sbjct  473   PTVFRPLTPHHLNL  486



>ref|XP_003545151.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=467

 Score =   481 bits (1239),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 262/474 (55%), Positives = 319/474 (67%), Gaps = 34/474 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F VSVTK E+V   LP++E  +LP SNLDLL+PPVDV VFFCY+KP          E   
Sbjct  10    FIVSVTKEEIVVPELPMKE-QWLPLSNLDLLIPPVDVSVFFCYKKP--------LPEKYY  60

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              FG MV +LK AL++ALV +Y  AGE+  N  GEPEL C+NRGVDFV+A ADVEL+ LNL
Sbjct  61    CFGTMVGSLKNALAQALVYYYPFAGEMVANTMGEPELFCSNRGVDFVEAVADVELQCLNL  120

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PDD+VEGKLVP+KK GVL+VQAT LKCGG+VVA  FDHR+ADAYSANMFLVSW+E A+
Sbjct  121   YNPDDTVEGKLVPRKKHGVLAVQATGLKCGGLVVACTFDHRIADAYSANMFLVSWAEAAR  180

Query  623   AKQ--LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA--------VEEPKISRI  772
               +  +S  PCFRRS L PRRP      L +MYVP+S+L P +          EP ISRI
Sbjct  181   PNKPIISAQPCFRRSLLTPRRPPSIHPLLHHMYVPVSALPPPSDPNKKLVFESEPLISRI  240

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN---FKLG  943
             Y V +E +  +Q+ A+          +RTKLE+F AFLWK VA   +  + K     K+G
Sbjct  241   YYVTSESLNRMQALASSNGTV-----KRTKLESFSAFLWKMVAEATASVDGKKNVAAKMG  295

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             +VVDGR  L     N  K +  YFGNVLS P+    + EL EKPL+WVA  VHEFL+  +
Sbjct  296   VVVDGRKMLC----NDEKNMGSYFGNVLSIPYGGNAVDELVEKPLSWVAEKVHEFLKMGV  351

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKV---HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
             T DHFLGL+DWVE HRP P + ++   H    G + VVSSGQRFP  K+DFGWGKP F S
Sbjct  352   TEDHFLGLVDWVEEHRPVPGLSRIYCGHGKEKGPSFVVSSGQRFPESKVDFGWGKPVFAS  411

Query  1295  YHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             YHFPWGG SGYVMPMP   GNGDW+VYMHL K  +  +E  A  + +PF+ D+L
Sbjct  412   YHFPWGGDSGYVMPMPCANGNGDWLVYMHLLKAHLNFMEVRAPQILRPFSWDYL  465



>gb|KHN11990.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=467

 Score =   480 bits (1236),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 319/474 (67%), Gaps = 34/474 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F VSVTK E+V   LP++E  +LP SNLDLL+PPVDV VFFCY+KP          E   
Sbjct  10    FIVSVTKEEIVVPELPMKE-QWLPLSNLDLLIPPVDVSVFFCYKKP--------LPEKYY  60

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              FG MV +LK AL++ALV +Y  AGE+  N  GEPEL C+NRGVDFV+A ADVEL+ LNL
Sbjct  61    CFGTMVGSLKNALAQALVYYYPFAGEMVANTMGEPELFCSNRGVDFVEAVADVELQCLNL  120

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PDD+VEGKLVP+KK GVL+VQAT LKCGG+VVA  FDHR+ADAYSANMFLVSW+E A+
Sbjct  121   YNPDDTVEGKLVPRKKHGVLAVQATGLKCGGLVVACTFDHRIADAYSANMFLVSWAEAAR  180

Query  623   AKQ--LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA--------VEEPKISRI  772
               +  +S  PCFRRS L PRRP      L +MYVP+S+L P +          EP ISRI
Sbjct  181   PNKPIISAQPCFRRSLLTPRRPPSIHPLLHHMYVPVSALPPPSDPNKKLVFESEPLISRI  240

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN---FKLG  943
             Y V +E +  +Q+ A+          +RTKLE+F AFLWK VA   +  + K     K+G
Sbjct  241   YYVTSESLNRMQALASSNGTV-----KRTKLESFSAFLWKMVAEATASVDGKKNVAAKMG  295

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             +VVDGR  L     N  K +  YFGNVLS P+    + EL EKPL+WVA  VHEFL+  +
Sbjct  296   VVVDGRKMLC----NDEKNMGSYFGNVLSIPYGGNAVDELVEKPLSWVAEKVHEFLKMGV  351

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKV---HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
             T DHFLGL+DWVE HRP P + ++   H    G + VVSSGQRFP  K+DFGWGKP F S
Sbjct  352   TEDHFLGLVDWVEEHRPVPGLSRIYCGHGKEKGPSFVVSSGQRFPESKVDFGWGKPVFAS  411

Query  1295  YHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             YHFPWGG SGYVMPMP   GNGDW+VYMHL K  +  +E  A  + +PF+ D++
Sbjct  412   YHFPWGGDSGYVMPMPCANGNGDWLVYMHLLKAHLNFMEVRAPQILRPFSWDYI  465



>gb|KDP35222.1| hypothetical protein JCGZ_09381 [Jatropha curcas]
Length=466

 Score =   480 bits (1235),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 269/473 (57%), Positives = 333/473 (70%), Gaps = 39/473 (8%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+VTK EVVAA LPVQE H+LP SNLDLLLPP+DVGVF CY+KP  AS          
Sbjct  10    FTVTVTKKEVVAAVLPVQE-HWLPLSNLDLLLPPLDVGVFLCYKKPETAS----------  58

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              FG MV+ LK A+++ LVS+Y   GEV  N  GE EL+CNNRGVDF + FAD+EL+ L+L
Sbjct  59    -FGSMVSVLKKAMAQVLVSYYGFGGEVVSNPLGESELLCNNRGVDFFEGFADIELKDLDL  117

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD SVEGKLVPKKK GVL++QATELKCGGIVV   FDHR+ADAYS NMFLVSW+E AQ
Sbjct  118   YNPDHSVEGKLVPKKKDGVLAIQATELKCGGIVVGCTFDHRIADAYSTNMFLVSWAETAQ  177

Query  623   AKQLSQLPCFRRSFLFPRRPAH-YDLSLDNMYVPISS-LQPEAVE------EPKISRIYC  778
             +K +S LP FRRS L PRRP    D S+D++YVPISS + PE  E      +  +SRIY 
Sbjct  178   SKPISILPSFRRSLLNPRRPIRCIDTSMDDLYVPISSFISPEEPELNNDDHDRIVSRIYY  237

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN-----FKNFKLG  943
             V AE++  LQ  A+          + TKLE+F AFLW+ +A   ++ N      K  K+G
Sbjct  238   VKAEELTNLQYIASSSGF------KCTKLESFSAFLWQLIAKYANKSNPSNGKVKMSKIG  291

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             I+VDGR++L     N  K +  YFGNVLS P+  + I EL    L+ +A  VH+FL++A+
Sbjct  292   IIVDGRSKL-----NDTK-MGRYFGNVLSIPYHSERIDELVNHNLSSMADIVHDFLKKAV  345

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T +HFLGLIDWVEA+RP   + KV+     DG A VVSSGQRFPV K+DFGWGKP FGSY
Sbjct  346   TKEHFLGLIDWVEANRPVKCVAKVYANGKDDGPAFVVSSGQRFPVCKVDFGWGKPIFGSY  405

Query  1298  HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             HFPWGG +GY+MPMPSP  NGDWI+YMHL ++++E +ET AS+ FKPF  D++
Sbjct  406   HFPWGGNAGYIMPMPSPLENGDWILYMHLFRKQLEFLETEASNFFKPFKLDYV  458



>ref|XP_010040766.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
 gb|KCW44942.1| hypothetical protein EUGRSUZ_L01468 [Eucalyptus grandis]
Length=486

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 270/493 (55%), Positives = 333/493 (68%), Gaps = 41/493 (8%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   + V   K EVVAA LP+QE H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6     GAGREYVVKSGKREVVAAPLPMQE-HWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G +V  LKAAL++ALVS+YALAGEV QN AGEPEL+CNNRGVDF++AF DVEL
Sbjct  59    ASQRLGYGSVVGVLKAALTQALVSYYALAGEVVQNSAGEPELLCNNRGVDFIEAFVDVEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PDD+VEGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYS NMF+V W
Sbjct  119   RHLNLYNPDDTVEGKLVPTKKRGVLAVQATELKCGGIVVACMFDHRIADAYSVNMFMVFW  178

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------------EAV  748
              + A+ A  +S  P F  S L PR P  +D SLD MY+P+S+L P            E V
Sbjct  179   VQTARTAAPISLPPSFCHSLLNPRHPLCFDPSLDCMYIPVSALYPPPNHKLQVDEQCETV  238

Query  749   ----EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSR  916
                  +  +S +Y V A ++ ELQ  A    ++       TKLE+F AFLW+ VA     
Sbjct  239   TLRDNDRLLSHLYYVTAAKLSELQQSACSNGSNS------TKLESFSAFLWRMVAESSVV  292

Query  917   RNFKN---FKLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNW  1084
              N  N    ++GI+VDGR RL S G +NK   +  YFGNVLS PF EK ++E+ EKPL+W
Sbjct  293   DNDDNKTMSRMGIMVDGRCRLMSQGKDNKPTPMSSYFGNVLSVPFGEKRVREVVEKPLSW  352

Query  1085  VASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAI------PKVHDCVDGA-ALVVSSGQR  1243
             VA  VHEF+E A T +HFL L+DWVE H+P PA+      P + +  DG+ ALVVS GQR
Sbjct  353   VADVVHEFVERAATKEHFLDLVDWVEEHQPVPALARIFCKPVIEEEEDGSTALVVSFGQR  412

Query  1244  FPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYAS  1423
             FPV ++DFGWGKP   SYHFPWG ++GYVMPMPSP  NGDW+VY+HL + +V  I+++A 
Sbjct  413   FPVIEMDFGWGKPVLESYHFPWGSKAGYVMPMPSPLSNGDWVVYLHLPRSEVAFIKSHAP  472

Query  1424  HVFKPFTSDHLNF  1462
              VF+P    HLN 
Sbjct  473   TVFRPLIPHHLNL  485



>ref|XP_003617373.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AET00332.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=473

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 328/477 (69%), Gaps = 32/477 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V++T  EVVAA   +QE H L  SNLDLLLPPV +GVFFCY+ P             T
Sbjct  8     FSVNITNEEVVAATKAMQE-HRLALSNLDLLLPPVSIGVFFCYKNPMITIG--------T  58

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
             T   +V  LK +L+EALVS+Y  AGE+  N  GEPEL+CNNRGVDFV+A ADVEL+ L+L
Sbjct  59    TNNTIVGCLKNSLAEALVSYYVFAGEMVTNSMGEPELLCNNRGVDFVEAVADVELQSLDL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             YKP++++EGKLVPKKK GVL+VQAT +KCGG+VVA  FDHR+ADAYSANMFLVSW+EIA+
Sbjct  119   YKPEETIEGKLVPKKKYGVLAVQATWMKCGGLVVACNFDHRIADAYSANMFLVSWAEIAR  178

Query  623   AKQLSQL-----PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--------I  763
             +     L     PCF+RS L PR P     SL +MY+PIS L P    +P+        I
Sbjct  179   SSNNKSLIPTTQPCFQRSLLTPRHPPSIHPSLYDMYIPISDLPPPPESKPELDIKTNPLI  238

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF--K  937
             SR+Y V +E++  +Q  AN  ++  +K   R+KLE+F AFLWK VAS  S  N +N   K
Sbjct  239   SRMYYVTSEELNTMQLLANTNNSGSVK---RSKLESFSAFLWKMVASAAS-TNSENVVAK  294

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEE  1117
             +GIVVDGR RLS GD+NK +F+  YFGNVLS P+  + I+EL EK L WV   VHEF+E 
Sbjct  295   MGIVVDGRKRLSNGDKNKEEFMSSYFGNVLSTPYSCRLIEELVEKSLCWVTEQVHEFVEV  354

Query  1118  ALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPA  1285
             A T +HFLGLIDWVE HRP P + +++  V    DG   VVSSGQRF   K+DFGWGKP 
Sbjct  355   ADTEEHFLGLIDWVEEHRPVPGLARIYCGVTGGADGPTFVVSSGQRFSESKVDFGWGKPV  414

Query  1286  FGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
              GSYH P GG +GYVMPMPSPK NGDW++YM+L KE +  +   A H F+P + D+L
Sbjct  415   VGSYHIPCGGDAGYVMPMPSPKRNGDWLLYMNLPKEYLHFMVAEAPHFFRPISWDYL  471



>ref|XP_010539596.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Tarenaya hassleriana]
Length=459

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 321/465 (69%), Gaps = 25/465 (5%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+  + +VV A LP+QE H+L  SNLD LLPP+ V V FCY+KP + ++         
Sbjct  11    FHVTTVRKDVVTALLPLQE-HWLALSNLDPLLPPLAVSVCFCYKKPNSLTSSLAIN----  65

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                   NTLK AL+E LV++YA AGEV  N  GEPEL+CNNRGVDFV  FADV LR+LNL
Sbjct  66    ------NTLKKALAEVLVTYYAFAGEVVTNSTGEPELLCNNRGVDFVDGFADVALRELNL  119

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  K VPK K GV+S+Q TELKCG IVV   FDHR+ADAYSANMF VSW+++++
Sbjct  120   YDPDESI-AKFVPKNKHGVISIQVTELKCGSIVVGSTFDHRIADAYSANMFFVSWAQMSR  178

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP---EAVEEPKISRIYCVAAEQ  793
             ++ +S +P FRRS L PRRP   D S+D MY+P+SSL P      ++   SRIY + ++ 
Sbjct  179   SEPISLVPSFRRSLLNPRRPLLIDSSIDLMYMPVSSLPPPQETCGQDVLTSRIYYIKSDV  238

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFK-NFKLGIVVDGRTRL  970
             + +LQ+ A+          R TKLE+F A LWK VA    +   K   KLGIVVDGR RL
Sbjct  239   MNQLQALASSNGF------RCTKLESFSALLWKLVAKHARKYPRKITSKLGIVVDGRRRL  292

Query  971   SIGDENKAKF-LQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             +  + +K +  ++ YFGNVLS PF  + + +L EK L+WVAS +HEFL  A+T DHFL L
Sbjct  293   ADQETDKKESNMKTYFGNVLSIPFGGRRVDDLMEKSLSWVASEIHEFLNGAITKDHFLNL  352

Query  1148  IDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS  1321
             IDWVE  RP+PA+ +++     DG A+VVSSG  FPV K+DFGWG P FGSYHFPWGG +
Sbjct  353   IDWVETQRPKPAVSRIYSTGSDDGPAVVVSSGTGFPVNKVDFGWGPPVFGSYHFPWGGSA  412

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             GYVMPMPS  GNGDW+VY+HL + +++ IE  ASHVFKP  SD+L
Sbjct  413   GYVMPMPSAAGNGDWVVYLHLTQGQLKFIEEEASHVFKPLNSDYL  457



>gb|KFK22998.1| hypothetical protein AALP_AAs66525U000100 [Arabis alpina]
Length=456

 Score =   471 bits (1211),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 257/471 (55%), Positives = 325/471 (69%), Gaps = 34/471 (7%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             +F+V+ TK +++ AALP+Q+ H+LP SNLDLLLPPV V V FCY+KP   +     E   
Sbjct  10    DFHVTTTKKQLITAALPLQD-HWLPLSNLDLLLPPVHVSVCFCYKKPLNLTISVAKE---  65

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
                     TLK AL+E LVS+YA AGE+  N  GEPE+ICNNRGVDFV+A ADVELR LN
Sbjct  66    --------TLKTALAETLVSYYAFAGEIVTNSTGEPEIICNNRGVDFVEAGADVELRDLN  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD+S+  KLVP  K G++++Q T+LKCG +VV   FDHR+ADAYS NMFLVSW+E A
Sbjct  118   LYDPDESI-AKLVPINKHGIIAIQVTQLKCGSLVVGCTFDHRIADAYSMNMFLVSWAETA  176

Query  620   QAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVA  784
             ++   +S  P FRRS L PRRP   D S+D MYVP++SL P +    P    +SRIY + 
Sbjct  177   RSDVPISCAPSFRRSLLNPRRPVIMDSSIDEMYVPVTSLPPPQETTNPDNILVSRIYYIK  236

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDG  958
             A+ + ELQ+ A   S  E+K  +RTK+E+F A LWK VA   ++  F  KN KLGIVVDG
Sbjct  237   ADALEELQALA---SGSEIKD-KRTKIESFSALLWKLVAKHAAKDPFPSKNSKLGIVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R R      N       YFGNVLS PF  + I +L  KPL+WV + VH+FLE ++T DHF
Sbjct  293   RRRFMEQQTNT------YFGNVLSIPFGGQRINDLINKPLSWVTTEVHKFLESSVTKDHF  346

Query  1139  LGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             L LIDWVEAHRP PA+ +++ C    DG A+VVSSG+ FPV ++DFGWG P FGSYHFPW
Sbjct  347   LNLIDWVEAHRPTPALSRIY-CTGADDGPAIVVSSGRSFPVTRVDFGWGSPVFGSYHFPW  405

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS   +GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  406   GGSAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  456



>ref|XP_010539595.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=457

 Score =   468 bits (1204),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 261/465 (56%), Positives = 331/465 (71%), Gaps = 27/465 (6%)
 Frame = +2

Query  104   NEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVN  283
              +VVAAALP+QE H+LP SNLDLLLPP+DV V   Y+KP       T +E   +F  +  
Sbjct  6     GDVVAAALPIQE-HWLPLSNLDLLLPPLDVNVCLFYKKPPH---DVTKKE---SFISIAK  58

Query  284   TLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSV  463
             TLK AL+EALV+FYA AGEV  + AGEPEL+CNNRGVDFV+ FAD+ LR+LN Y PD+S+
Sbjct  59    TLKEALAEALVTFYAFAGEVVTSPAGEPELLCNNRGVDFVEGFADMALRELNFYDPDESI  118

Query  464   EGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQL  643
                 VPKK++GV+SVQ TELKCG I V + FDHRVADAYS NMFLVSWS+I++++ +S +
Sbjct  119   -AMFVPKKRRGVISVQVTELKCGSIAVGLTFDHRVADAYSTNMFLVSWSQISRSEPISLV  177

Query  644   PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPK--ISRIYCVAAEQIRELQS  811
             P FRRS L PRRP   D S+D +++P++SL P  E  ++     SRIY + ++ + +LQ 
Sbjct  178   PSFRRSLLNPRRPLLVDSSIDRLFIPLTSLPPPQETCDQDHALTSRIYYIESDVLDDLQR  237

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDGRTRLSIGDE  985
              A+  S       RRTK+E+F AFLWK +A  +G  +    + KLG+VVDGR RL+ G E
Sbjct  238   MASSGSCT-----RRTKIESFSAFLWKLLAKHAGNDQSTIIS-KLGVVVDGRRRLA-GQE  290

Query  986   N--KAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWV  1159
                K   ++ YFGNVLS PF  + I +L EKPL+WVA  VHEFL+EA T DHFL LIDWV
Sbjct  291   TGEKENVMETYFGNVLSVPFGGQRISDLIEKPLSWVADEVHEFLKEATTKDHFLNLIDWV  350

Query  1160  EAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYV  1330
             E HRP PA+  V+ C    +G A VVSSG+ FPV  +DFGWG P FGSYHFPWGG++GYV
Sbjct  351   ETHRPVPAVAAVY-CTGPNEGPAFVVSSGRGFPVTGVDFGWGPPVFGSYHFPWGGRTGYV  409

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             MP PSP GNGDWIVY+HL+K +++ +E  A HVFKP  SD+LN N
Sbjct  410   MPTPSPTGNGDWIVYLHLKKGQLKFVEEEAPHVFKPINSDYLNIN  454



>gb|ABG75942.1| coniferyl alcohol acyltransferase [Petunia x hybrida]
Length=454

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 320/469 (68%), Gaps = 27/469 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N++F+V+V K EVVAA LP+   H+LP SNLDLLLPP+D GVFFCY++    +     +E
Sbjct  3     NTDFHVTVKKKEVVAAVLPMHHEHWLPMSNLDLLLPPLDFGVFFCYKRSKINNDTKDDDE  62

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                       T+K AL+E LVSFYALAGEV  N  GEPEL+CNNRGVDF  A+AD+EL  
Sbjct  63    ----------TIKKALAETLVSFYALAGEVVFNSLGEPELLCNNRGVDFFHAYADIELNN  112

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             L+LY PD SV  KL+P KK GVLSVQ T LKCGGIVV   FDHRVADAYSANMFLV+W+ 
Sbjct  113   LDLYHPDVSVHEKLIPIKKHGVLSVQVTGLKCGGIVVGCTFDHRVADAYSANMFLVAWAA  172

Query  614   IAQAKQ--LSQLPCFRRSFLFPRRPAHYDLS-LDNMYVPISSLQPEAVEEPKISRIYCVA  784
             IA+      + +P FRRS L PRRP  +D S +D+ YV +SS  P+   +   SR+Y + 
Sbjct  173   IARKDNNINTVIPSFRRSLLNPRRPPQFDDSFIDSTYVFLSS-PPKQPNDVLTSRVYYIN  231

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             +++I  LQSQA    +      +R+KLE F AFLWKT+A G    + K  KLGIVVDGR 
Sbjct  232   SQEINLLQSQATRNGS------KRSKLECFSAFLWKTIAEG-GIDDSKRCKLGIVVDGRQ  284

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             RL     + +  ++ YFGNVLS P+ E ++ +L++ PL  VA  VH  L+      HF  
Sbjct  285   RLR---HDSSTTMKNYFGNVLSVPYTEASVGQLKQTPLGKVADLVHTCLDNVANEHHFPS  341

Query  1145  LIDWVEAHRPEPAIPKVH---DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
             LIDWVE HRP  AI KV+   +C D AA+VVSSG RFP+ +++FGWG P FGSY FPWGG
Sbjct  342   LIDWVELHRPRQAIVKVYCKDECNDEAAIVVSSGLRFPLSQVNFGWGCPDFGSYIFPWGG  401

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Q+GYVMPMPSP  NGDWIVYMHLQK+ ++L+ET A H+F P T+ +L+ 
Sbjct  402   QTGYVMPMPSPNKNGDWIVYMHLQKKHLDLVETRAPHIFHPLTACYLDL  450



>gb|KFK42277.1| hypothetical protein AALP_AA2G235000 [Arabis alpina]
Length=456

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 254/471 (54%), Positives = 324/471 (69%), Gaps = 34/471 (7%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             +F+V+ TK +++ AALP+Q+ H+LP SNLDLLLPPV V V FCY+KP   +     E   
Sbjct  10    DFHVTTTKKQLITAALPLQD-HWLPLSNLDLLLPPVHVSVCFCYKKPLNLTNSVAKE---  65

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
                     TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR LN
Sbjct  66    --------TLKTALAETLVSYYAFAGEIVTNSTGEPEILCNNRGVDFVEAGADVELRDLN  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD+S+  KLVP  K G++++Q T+LKC  +VV   FDHR+ADAYS NMFLVSW+E A
Sbjct  118   LYDPDESI-AKLVPINKHGIIAIQVTQLKCRSLVVGCTFDHRIADAYSMNMFLVSWAETA  176

Query  620   QAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVA  784
             ++   +S +P FRRS L PRRP   D S+D MYVP++SL P +    P    +SRIY + 
Sbjct  177   RSDVPISCVPSFRRSLLNPRRPLIMDSSIDEMYVPVTSLPPPQETTNPDNILVSRIYYIK  236

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDG  958
             A+ + ELQ+ A   S  E+K  +RTK+E+F A +WK VA   ++  F  KN KLGIVVDG
Sbjct  237   ADALEELQTLA---SGSEIKD-KRTKIESFSALIWKLVAKHAAKDPFPSKNSKLGIVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R R      N       YFGNVLS PF  + I +L  KPL+WV + VH+FLE ++T DHF
Sbjct  293   RRRFMEQQTNT------YFGNVLSIPFGGQRINDLINKPLSWVTTEVHKFLESSVTKDHF  346

Query  1139  LGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             L LIDWVEAHRP PA+ +++ C    DG A VVSSG+ FPV ++DFGWG P FGSYHFPW
Sbjct  347   LNLIDWVEAHRPTPALSRIY-CTGADDGPAFVVSSGRSFPVSQVDFGWGSPVFGSYHFPW  405

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS   +GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  406   GGSAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  456



>ref|XP_008778760.1| PREDICTED: rosmarinate synthase-like [Phoenix dactylifera]
Length=450

 Score =   464 bits (1193),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 249/468 (53%), Positives = 328/468 (70%), Gaps = 27/468 (6%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M  +  + V++   E VAA LPVQE H+LP SNLDLLLP +DVGVFFCY+KP A      
Sbjct  1     MGGSKEYAVTMRAKERVAAVLPVQE-HWLPLSNLDLLLPAIDVGVFFCYKKPPA------  53

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              ++  TTFG MV+ LKA+L++ALV++Y  AGEV  N   EPEL+CNNRGVDF++A+ADVE
Sbjct  54    -KQSKTTFGSMVSALKASLAQALVTYYPFAGEVLTNPVDEPELLCNNRGVDFIEAYADVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++L L  PD+SVE KL+PKKK+GVL VQATELKCGG+V+A  FDHR+ADAYSANMFLV+
Sbjct  113   LQELRLNNPDESVERKLLPKKKEGVLCVQATELKCGGLVLACTFDHRIADAYSANMFLVA  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV--EEPKISRIYC  778
             W+E A +K +S  P FRRS L PRRP  +D S D +Y  +SSLQP     +E  ++RI  
Sbjct  173   WAETAASKPISLAPSFRRSLLIPRRPGSHDSSPDRLYALVSSLQPPPSPDQEAAVNRICY  232

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             VAA+ I  +Q+ A           RRTK E+F A+LW+ +A G +R   K  ++G VVDG
Sbjct  233   VAADDIARIQAAAGG---------RRTKFESFTAYLWRVLARG-ARPEDKVCRMGAVVDG  282

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTRL+ G E     + GYFGNVLS P+    ++EL++  L   A+AVH +L +A T +HF
Sbjct  283   RTRLARGGE-----MAGYFGNVLSIPYGTLGVEELKDMDLAETAAAVHGWLRQATTEEHF  337

Query  1139  LGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
              GL+DWVEA RPEPA+ +++  +   G   VVSSG+ FPV +++FGWG+  FGSYHFPWG
Sbjct  338   RGLVDWVEARRPEPAVARIYLGEEDGGVGCVVSSGRAFPVGEVEFGWGRAVFGSYHFPWG  397

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
               +GYVMPMPS + NGDW+VYMHL K  ++++E     VF+P T+D+ 
Sbjct  398   SSAGYVMPMPSARRNGDWVVYMHLLKRFLDVLEAEKPPVFRPLTADYF  445



>ref|XP_003519535.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=471

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 318/462 (69%), Gaps = 31/462 (7%)
 Frame = +2

Query  125   LPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALS  304
             +P+ E H+LP SNLDLL+PP+DV VFFCY+KP          E    FG MV +LK AL+
Sbjct  24    IPMHE-HWLPLSNLDLLIPPMDVSVFFCYKKP--------LPEKYYCFGTMVGSLKNALA  74

Query  305   EALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPK  484
             +ALV +Y  AGE+  N  GEPEL C+NRG DFV+A A+VEL+ LNLY PDD+V+GK VP+
Sbjct  75    QALVYYYPFAGEMVANTMGEPELFCSNRGADFVEAVAEVELQCLNLYNPDDTVQGKFVPR  134

Query  485   KKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQ--LSQLPCFRR  658
             KK G+L+VQATELKCG +VVA  FDHR+ADAYSANMFLVSW+EIAQ+ +  +S  P F R
Sbjct  135   KKHGLLAVQATELKCGSLVVACTFDHRIADAYSANMFLVSWAEIAQSNKPIISIQPSFAR  194

Query  659   SFLFPRRPAHYDLSLDNMYVPISSL------QPEAVEEPKISRIYCVAAEQIRELQSQAN  820
             S   PR P  +  SL ++YV IS+L      +P    EP I+RIY V  E +  +Q  A 
Sbjct  195   SLFIPRNPPSFHSSLHDLYVSISALPRPSDPKPGFQSEPLINRIYYVTGENLNLMQELA-  253

Query  821   HYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF----KLGIVVDGRTRLSIGDEN  988
               S++ +K   RTKLE+F AFLWK VA   + +         K+G+VVDGR RLS GD+N
Sbjct  254   --SSNGVK---RTKLESFSAFLWKMVAEAAAAKVKGKKNLVAKMGVVVDGRKRLSNGDKN  308

Query  989   KAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAH  1168
             K   +  YFGNV+S P+  K ++EL EKPL+WVA  VHEFLE  LT +HFLGL+DWVE H
Sbjct  309   KEAIMGSYFGNVVSIPYGGKPVEELMEKPLSWVAEKVHEFLEIGLTEEHFLGLVDWVEVH  368

Query  1169  RPEPAIPKV---HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPM  1339
             RP P + ++   H   +G + VVSSGQRFP  K+DFGWGKP F SYHFPWGG SGYVMPM
Sbjct  369   RPAPGLSRIYCGHGKEEGPSFVVSSGQRFPESKVDFGWGKPVFASYHFPWGGDSGYVMPM  428

Query  1340  PSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             PS  GNGDW+VYMHL +  +  +E  A  +F PF+ D+ +FN
Sbjct  429   PSSTGNGDWLVYMHLLEAHLNFMEVRAPQIFWPFSRDY-HFN  469



>ref|NP_174567.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAF31274.1|AC006424_3 Highly similar to YUP8H12R.39 [Arabidopsis thaliana]
 gb|AEE31538.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=464

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 331/473 (70%), Gaps = 34/473 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V   + ++V AALP+Q+ H+LP SNLDLLLPPV + V FCY+KP              
Sbjct  11    FHVITIRKQIVTAALPLQD-HWLPLSNLDLLLPPVQISVCFCYKKPRH------------  57

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              F  +  TLKA+L+EALVS+YA AGE+ +N +GEPE++CNNRGVDF++A ADVELR+LNL
Sbjct  58    -FLSVAETLKASLAEALVSYYAFAGELVKNSSGEPEILCNNRGVDFLEAVADVELRELNL  116

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             + PD+S+  KLVPKKK GV+++Q T+LKCG IVV   FDHR+ADA+S NMFLVSW+EI++
Sbjct  117   HDPDESI-AKLVPKKKHGVIAIQVTQLKCGSIVVGCTFDHRIADAFSMNMFLVSWAEISR  175

Query  623   AKQ-LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL-----QPEAVEEPKISRIYCVA  784
                 +S +P FRRS L PRRP   D S+D MY+P++SL         ++    SRIY + 
Sbjct  176   FNAPISSVPSFRRSILNPRRPLIIDSSIDKMYMPVTSLPLPQETTNDLDNILTSRIYYIK  235

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDG  958
                + +LQ+ A+  S+ +  + +RTKLE+F AFLWK VA  +G+   + KN K+GIVVDG
Sbjct  236   ENALEDLQTLASG-SSPKTGYGQRTKLESFSAFLWKLVAKHTGRDLVSNKNSKMGIVVDG  294

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RL   ++N       YFGNVLS PF  ++I +L +KPL+WV + VH FLEEA+T +HF
Sbjct  295   RRRLMEKEDNT------YFGNVLSIPFGGQSIDDLIDKPLSWVTNEVHRFLEEAVTKEHF  348

Query  1139  LGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L LIDWVE HRP PA+ +++     DG A VVSSG+ FPV K+DFGWG P FGSYHFPW 
Sbjct  349   LNLIDWVEIHRPIPAVSRIYSTGTDDGPAFVVSSGRSFPVNKVDFGWGLPVFGSYHFPWE  408

Query  1313  GQSGYVMPMPSP--KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             G SGYVMPMPSP   GNGDW+VY+HL K +++ IE  ASHV KP  + +L  N
Sbjct  409   GSSGYVMPMPSPVDDGNGDWVVYLHLTKGQLKFIEEEASHVLKPIDNYYLKIN  461



>gb|KHN38347.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=471

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 315/462 (68%), Gaps = 31/462 (7%)
 Frame = +2

Query  125   LPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALS  304
             +P+ E H+LP SNLDLL+PP+DV VFFCY+KP          E    FG MV +LK AL+
Sbjct  24    IPMHE-HWLPLSNLDLLIPPMDVSVFFCYKKP--------LPEKYYCFGTMVGSLKNALA  74

Query  305   EALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPK  484
             +ALV +Y  AGE+  N  GEPEL C+NRG DFV+A A+VEL+ LNLY PDD+V+GK VP+
Sbjct  75    QALVYYYPFAGEMVANTMGEPELFCSNRGADFVEAVAEVELQCLNLYNPDDTVQGKFVPR  134

Query  485   KKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQ--LSQLPCFRR  658
             KK G+L+VQATELKCG +VVA  FDHR+ADAYSANMFLVSW+EIAQ+ +  +S  P F R
Sbjct  135   KKHGLLAVQATELKCGSLVVACTFDHRIADAYSANMFLVSWAEIAQSNKPIISIQPSFAR  194

Query  659   SFLFPRRPAHYDLSLDNMYVPISSL------QPEAVEEPKISRIYCVAAEQIRELQSQAN  820
             S   PR P  +  SL ++YV IS+       +PE   EP I+RIY V  E +  +Q  A+
Sbjct  195   SLFIPRNPPSFHSSLHDLYVSISASPRPSDPKPEFQSEPLINRIYYVTGENLNLMQKLAS  254

Query  821   HYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNF----KLGIVVDGRTRLSIGDEN  988
                       +RTKLE+F AFLWK VA   + +         K+G+VVDGR RLS GD+N
Sbjct  255   SNGV------KRTKLESFSAFLWKMVAEAAAAKVKGKKNLVAKMGVVVDGRKRLSNGDKN  308

Query  989   KAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAH  1168
             K   +  YFGNV+S P+  K ++EL EKPL+WVA  VHEFLE  LT +HFLGL+DWVE H
Sbjct  309   KEAIMGSYFGNVVSIPYGGKPVEELMEKPLSWVAEKVHEFLEIGLTEEHFLGLVDWVEVH  368

Query  1169  RPEPAIPKV---HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPM  1339
             RP P + ++   H   +G + VVSSGQRFP  K+DFGWGKP F SYHFPWGG SGYVMPM
Sbjct  369   RPAPGLSRIYCGHGKEEGPSFVVSSGQRFPESKVDFGWGKPVFASYHFPWGGDSGYVMPM  428

Query  1340  PSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             PS  GNGDW+VYMHL +  +  +E  A  +F PF+ D+ +FN
Sbjct  429   PSSTGNGDWLVYMHLLEAHLNFMEVRAPQIFWPFSRDY-HFN  469



>ref|XP_006301720.1| hypothetical protein CARUB_v10022178mg [Capsella rubella]
 gb|EOA34618.1| hypothetical protein CARUB_v10022178mg [Capsella rubella]
Length=456

 Score =   459 bits (1180),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 322/469 (69%), Gaps = 32/469 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+ +V+ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP      TTT  H  
Sbjct  11    FHVTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLNVSVCFCYKKPLTI---TTTVAH--  64

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                   +TLK AL+E LVS+YA +GE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  65    ------DTLKTALAETLVSYYAFSGEIVTNPTGEPEILCNNRGVDFVEADADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHR ADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRGADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKI--SRIYCVAA  787
             +   +S +P FRRS L PRRP   D ++D +Y+P++SL P  E      I  SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLIVDSTIDQIYMPVTSLPPPKETTNPENILASRIYYIKA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDGR  961
             + + ELQ+ A+          +RTKLE+F AFLWK VA  + K     K  KLGIVVDGR
Sbjct  238   DALEELQTLASSSKNGN----KRTKLESFSAFLWKLVAEHTAKDPVPSKTSKLGIVVDGR  293

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RL   + N       YFGNVLS PF  + + +L  KPL+WV   VH FLE ++T +HFL
Sbjct  294   RRLMEQENNT------YFGNVLSVPFGGQRVDDLINKPLSWVTEEVHRFLERSVTKEHFL  347

Query  1142  GLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
              LIDWVE  RP PA+ +++     DG A VVSSG+ FPV K+DFGWG P FGSYHFPWGG
Sbjct  348   NLIDWVETRRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNKVDFGWGSPVFGSYHFPWGG  407

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPS   NGDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  408   SAGYVMPMPSSLDNGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  456



>ref|XP_010429767.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=456

 Score =   458 bits (1179),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 324/470 (69%), Gaps = 34/470 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+ +V+ AALP+Q+ H+LP SNLDLLLPP+DV V FCY+K    +     E    
Sbjct  11    FHVTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLDVNVCFCYKKSLNITNTVALE----  65

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  66    -------TLKTALAETLVSYYAFAGEIVTNTTGEPEILCNNRGVDFVEAGADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +++P++SL P + +  P+    SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVTSLPPPQEITNPENLLTSRIYYIKA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN---FKNFKLGIVVDG  958
             + + ELQ+ A+  +     + +RTKLE+F AFLWK VA   ++ +    K  KLGIVVDG
Sbjct  238   DALEELQTLASSSN-----NGKRTKLESFSAFLWKLVAEKTAKDHPVLCKTSKLGIVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RL   + N       YFGNVLS PF  + I +L  KPL+WVA  VH FLE + T +HF
Sbjct  293   RRRLMEQENNT------YFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLERSATKEHF  346

Query  1139  LGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L LIDWVE  RP PA+ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWG
Sbjct  347   LNLIDWVETRRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPWG  406

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             G +GYVMPMPS   +GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  407   GSAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEKASHVFKPIDNDYLKI  456



>ref|XP_010417515.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
 ref|XP_010417516.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=456

 Score =   457 bits (1175),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 251/470 (53%), Positives = 324/470 (69%), Gaps = 34/470 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+ +V+ AALP+Q+ H+LP SNLDLLLPP+DV V FCY+K       T T  H  
Sbjct  11    FHVTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLDVNVCFCYKKSLNI---TNTVAH--  64

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  65    ------ETLKTALAETLVSYYAFAGEIVTNTTGEPEILCNNRGVDFVEASADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+ GKLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-GKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +++P++SL P +    P+    SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVTSLPPPQETTNPENLLTSRIYYIKA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN---FKNFKLGIVVDG  958
             + + ELQ+ A+       K+ +RTKLE+F AFLWK VA   ++ +    K  KLGIVVDG
Sbjct  238   DALDELQTLASSS-----KNGKRTKLESFSAFLWKLVAEQTAKDHPVPSKTSKLGIVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RL   + N       YFGNVLS PF  + I +L  KPL+WV   VH FLE + T +HF
Sbjct  293   RRRLMEQENNT------YFGNVLSIPFGGQRIDDLINKPLSWVTDEVHRFLERSATKEHF  346

Query  1139  LGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L LIDWVE  RP P++ +++     DG A VVSSG+ FPV ++D+GWG P FGSYHFPWG
Sbjct  347   LNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDYGWGSPVFGSYHFPWG  406

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             G +GYVMPMPS   +GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  407   GSAGYVMPMPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  456



>ref|XP_009104555.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=455

 Score =   454 bits (1169),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 319/474 (67%), Gaps = 35/474 (7%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A + +F+V+  + +++ AALP+Q+ H+LP SNLDL+LPPV V V FCY+KP   +     
Sbjct  8     ARDCDFHVTSNRKQLITAALPLQD-HWLPLSNLDLILPPVHVSVCFCYKKPRNMTNSMAH  66

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
             E           TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDF++A ADV+L
Sbjct  67    E-----------TLKTALAETLVSYYAFAGEIVTNPTGEPEILCNNRGVDFMEAGADVDL  115

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNLY PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFLVSW
Sbjct  116   RELNLYDPDESIV-KLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLVSW  174

Query  608   SEIAQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKI--SRI  772
             +EI+++   +S +P FRRS L PRRP   D ++D MY+P++SL P  E      I  SR+
Sbjct  175   AEISRSDVPISCVPSFRRSLLNPRRPLVMDSAIDQMYIPVTSLPPPQETTNPDSILASRL  234

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGI  946
             Y + A+ + +LQ+ A+          RRTKLE+F AFLWK VA   +      KN KLGI
Sbjct  235   YYIKADALDDLQALASGSK-------RRTKLESFSAFLWKLVAKHAATDPVPSKNSKLGI  287

Query  947   VVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALT  1126
             VVDGR R+   ++N       YFGNVLS PF  + I +L  KPL+WV   VH FLE ++T
Sbjct  288   VVDGRRRVMEQEKNT------YFGNVLSIPFGGQKIDDLVNKPLSWVTEVVHRFLESSVT  341

Query  1127  GDHFLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
              +HFL LIDWVE  RP P + +++     DG A VVSSG+ FPV ++DFGWG P FGSYH
Sbjct  342   KEHFLNLIDWVETRRPTPTVSRIYSTGSEDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYH  401

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             FPWGG +GYVMPMPS   +GDW+VY+HL K +++ IE  AS V KP  +++L  
Sbjct  402   FPWGGNAGYVMPMPSSVEDGDWMVYLHLTKGQLKFIEEEASQVLKPIDNNYLKI  455



>ref|XP_008795534.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=458

 Score =   454 bits (1169),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 245/462 (53%), Positives = 327/462 (71%), Gaps = 31/462 (7%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQK-PAAASAQTTTEEHAT  262
              V+V + E VAA LP+QE H+LP SNLDLLLPP+DVGVFFCY+K P + S          
Sbjct  9     TVTVRRKERVAAVLPLQE-HWLPFSNLDLLLPPLDVGVFFCYEKLPGSPS----------  57

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
              F  M+++LK +L +ALV++Y  AGEV  N  GEPEL+CNNRGVDF++A+ADVELR+L L
Sbjct  58    -FAAMLSSLKGSLVQALVTYYPFAGEVITNSTGEPELLCNNRGVDFIEAYADVELRELCL  116

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             YKPDDS + KLVPKK+ GV  VQATELKCGG+VVA  FDHR+ADA SA+MFLV+W+E+A 
Sbjct  117   YKPDDSFKEKLVPKKEGGVFCVQATELKCGGLVVACSFDHRIADAVSADMFLVAWAELAS  176

Query  623   AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA----VEEPKISRIYCVAAE  790
             +K +S++P FRRS L PRRP  +D   D ++ PISSL P +    +++P +SRIY + AE
Sbjct  177   SKPISRIPSFRRSLLNPRRPGRHDSFPDRLFAPISSLVPPSSPPQLQQPTVSRIYYITAE  236

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              +  +Q+ A+   A       RTK+EAF A+LW+ +A G    + K  ++G+VVDGR+R+
Sbjct  237   DVDRMQTAASSGGAAH-----RTKVEAFTAYLWRVLAKGTVSGD-KPCRMGLVVDGRSRI  290

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                    A+ +  YFGNVL+ P+   + +EL    L  VA  VHEFL  A+T +HF GL+
Sbjct  291   D------ARAMANYFGNVLTPPYGTLSAEELGRMALPEVADVVHEFLRPAMTAEHFRGLV  344

Query  1151  DWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSG  1324
             DWVE+HRPEPA+ +++  D   G A VVSSG+RFP  +++FGWGKPA  SY FPWGG +G
Sbjct  345   DWVESHRPEPAVARIYLEDEEGGVACVVSSGRRFPASEVEFGWGKPALASYFFPWGGSTG  404

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSD  1450
             +VMPMPSPKGNGDW+VY +L ++ VE++E  +  VF+P T D
Sbjct  405   FVMPMPSPKGNGDWVVYAYLLRDLVEVLEAESPQVFRPLTPD  446



>ref|XP_009106615.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
 emb|CDX87417.1| BnaA07g34560D [Brassica napus]
Length=457

 Score =   453 bits (1165),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 250/471 (53%), Positives = 321/471 (68%), Gaps = 31/471 (7%)
 Frame = +2

Query  77    SNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEH  256
             S F+V+ T+ +++ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP      T +  H
Sbjct  9     SGFHVTTTRKQLITAALPLQD-HWLPLSNLDLLLPPLNVSVCFCYKKPCNI---TISVAH  64

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKL  436
                      TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVD+V+A ADV+LR+L
Sbjct  65    --------KTLKTALAETLVSYYAFAGEIVTNPTGEPEILCNNRGVDYVEAGADVDLREL  116

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             NLY PD+S+  +LVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI
Sbjct  117   NLYDPDESI-ARLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLISWAEI  175

Query  617   AQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKI--SRIYCV  781
             +++   +S +P FRRS L PRRP   D S+D MY+P++SL P  E  +   I  SR+Y +
Sbjct  176   SRSDVPISCVPSFRRSLLNPRRPLIIDSSIDQMYMPVTSLPPPQETTDPDSILASRLYYI  235

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVD  955
              A+ + ELQ+ A   S  +    +RTKLEAF AFLWK VA  + K     KN KLGIVVD
Sbjct  236   KADALDELQTLA---SGSKTTLIKRTKLEAFSAFLWKLVAKHAAKDPVPTKNSKLGIVVD  292

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR RL   + N       YFGNVLS PF  + I +L  K L+WV   VH FLE ++T +H
Sbjct  293   GRRRLMTQENNT------YFGNVLSIPFGGQKIDDLVNKSLSWVTDEVHNFLESSVTKEH  346

Query  1136  FLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             FL LIDWVE  RP PA+ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPW
Sbjct  347   FLNLIDWVETRRPIPAVSRIYSTGSDDGPAFVVSSGRGFPVNQVDFGWGSPVFGSYHFPW  406

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS   + DW+VY+HL K ++E IE  ASHV KP  + +L  
Sbjct  407   GGNAGYVMPMPSSVDDKDWMVYLHLTKGQLEFIEKEASHVLKPVDNTYLKI  457



>ref|XP_008783080.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=452

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 321/472 (68%), Gaps = 33/472 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M  +  + V++   E VAA LP QE H LP SNLDLLLPP+DVGVFFCY+KP A      
Sbjct  1     MGGSKEYAVTMKAKERVAAVLPAQE-HRLPLSNLDLLLPPIDVGVFFCYEKPLA------  53

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              E+   TF  MV+ LK +L+ ALV++Y  AG+V  N  GEPEL+CNNRGVDF++A+ADVE
Sbjct  54    -EQSPATFATMVSALKTSLARALVTYYPFAGKVVTNSVGEPELLCNNRGVDFIEAYADVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L +L LY PD+SVE KLVPKKK+GV+ VQATELKCGG+V+A  FDHR+ADAYSANMFLV+
Sbjct  113   LHELRLYNPDESVERKLVPKKKEGVICVQATELKCGGMVLACTFDHRIADAYSANMFLVA  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV----EEPKISRI  772
             W+E A +K +S  P FRRS L PRRP  YD SLD +YVP+SSL         +EP ++RI
Sbjct  173   WAETAASKAISLPPSFRRSLLTPRRPGSYDPSLDRLYVPVSSLPALPPPSPDQEPAVNRI  232

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y + A+ I  +Q  A           +RTK+EAF A+LW+ V S  +R + K  ++G VV
Sbjct  233   YYIVADDIARIQVAAGG---------QRTKIEAFTAYLWR-VLSRATRLDDKVCRMGAVV  282

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR+RL+ G E     + GYFGNVLS P     + EL++  L  VA  VH +L  ALT +
Sbjct  283   DGRSRLARGGE-----MAGYFGNVLSIPCGSLRVGELKDMGLAEVAEVVHGWLRPALTEE  337

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
             HF GL+DWVEA RPEP   ++  C+     G   VVSSG+ FPV +++FGWG+P FGSYH
Sbjct  338   HFRGLVDWVEARRPEPVGARI--CLGYEDGGVGCVVSSGRGFPVGQVEFGWGRPVFGSYH  395

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             FPWG  +GYVMPMPS +GNGDW+VY+HL    V+++E      F+P T+D+ 
Sbjct  396   FPWGSPAGYVMPMPSARGNGDWVVYVHLLGSFVDVLEAEEPPFFRPLTADYF  447



>emb|CDX88496.1| BnaC06g39400D [Brassica napus]
Length=456

 Score =   451 bits (1160),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 250/471 (53%), Positives = 322/471 (68%), Gaps = 32/471 (7%)
 Frame = +2

Query  77    SNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEH  256
             S F+V+ T+ +++ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP   +     E  
Sbjct  9     SGFHVTTTRKQLITAALPLQD-HWLPLSNLDLLLPPLNVSVCFCYKKPCNITISVAHE--  65

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKL  436
                      TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVD+V+A ADV+LR+L
Sbjct  66    ---------TLKTALAETLVSYYAFAGEIVTNPTGEPEILCNNRGVDYVEAGADVDLREL  116

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             NLY PD+S+  +LVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI
Sbjct  117   NLYDPDESI-ARLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLISWAEI  175

Query  617   AQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKI--SRIYCV  781
             +++   +S +P FRRS L PRRP   D S+D MY+P++SL P  E  +   I  SR+Y +
Sbjct  176   SRSDVPISCVPSFRRSLLNPRRPLIIDSSIDQMYMPVTSLPPPQETTDPDSILASRLYYI  235

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVD  955
              A+ + ELQ+ A+  S   LK   RTKLEAF AFLWK VA   +      KN KLGIVVD
Sbjct  236   KADALDELQTLASG-SKTTLK---RTKLEAFSAFLWKLVAKHAANDPVPTKNSKLGIVVD  291

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR RL   + N       YFGNVLS PF  + I +L  KPL+WV   VH+FLE ++T +H
Sbjct  292   GRRRLMEQENNT------YFGNVLSIPFGGQKIDDLINKPLSWVTDEVHKFLESSVTKEH  345

Query  1136  FLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             FL LIDWVE  RP PA+ +++     DG A VVSSG+ FPV +++FGWG P FGSYHFPW
Sbjct  346   FLNLIDWVETRRPIPAVSRIYSTGSDDGPAFVVSSGRGFPVNQVNFGWGSPVFGSYHFPW  405

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS   + DWIVY+HL K +++ IE  ASHV KP  + +L  
Sbjct  406   GGNAGYVMPMPSSVNDKDWIVYLHLTKGQLKFIEKEASHVLKPVDNTYLKI  456



>ref|XP_010472736.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Camelina sativa]
Length=460

 Score =   451 bits (1161),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 252/475 (53%), Positives = 325/475 (68%), Gaps = 44/475 (9%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+N+V+ AALP+Q+ H+LP SNLDLLLPP+DV V FCY+K       T T  H  
Sbjct  11    FHVTTTRNQVITAALPLQD-HWLPLSNLDLLLPPLDVNVCFCYKKSVNI---TNTVAH--  64

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  65    ------ETLKTALAETLVSYYAFAGEIVTNTTGEPEILCNNRGVDFVEAGADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL-QPEAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +++P++SL  P+ +  P+    SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVTSLPPPQEITNPENLLTSRIYYIKA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN----------FKNFK  937
             + + ELQ+ A+  +     + +RTKLE+F AFLWK VA   ++ +           K  K
Sbjct  238   DALEELQTLASSSN-----NGKRTKLESFSAFLWKLVAEKTAKDHPKTAKDHPVPCKTSK  292

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEE  1117
             LGIVVDGR RL   + N       YFGNVLS PF  + I +L  KPL+WVA  VH FLE 
Sbjct  293   LGIVVDGRRRLMEQENNT------YFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLER  346

Query  1118  ALTGDHFLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
             + T +HFL LIDWVE  RP P++ +++     DG A VVSSG+ FPV ++DFGWG P FG
Sbjct  347   SATKEHFLNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVFG  406

Query  1292  SYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             SYHFPWGG +GYVMPMPS    GDW+VY+HL K +++ IE  ASHVFKP  +D+L
Sbjct  407   SYHFPWGGSAGYVMPMPS---YGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYL  458



>ref|XP_010472737.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Camelina sativa]
Length=459

 Score =   451 bits (1159),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 252/471 (54%), Positives = 326/471 (69%), Gaps = 33/471 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+N+V+ AALP+Q+ H+LP SNLDLLLPP+DV V FCY+K       T T  H  
Sbjct  11    FHVTTTRNQVITAALPLQD-HWLPLSNLDLLLPPLDVNVCFCYKKSVNI---TNTVAH--  64

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  65    ------ETLKTALAETLVSYYAFAGEIVTNTTGEPEILCNNRGVDFVEAGADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL-QPEAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +++P++SL  P+ +  P+    SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLVIDSSIDQIFMPVTSLPPPQEITNPENLLTSRIYYIKA  237

Query  788   EQIRELQS-QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN---FKNFKLGIVVD  955
             + + ELQ+  ++  +A    + +RTKLE+F AFLWK VA   ++ +    K  KLGIVVD
Sbjct  238   DALEELQTLASSSNNASSSNNGKRTKLESFSAFLWKIVAEKTAKDHPVPCKTSKLGIVVD  297

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR RL   + N       YFGNVLS PF  + I +L  KPL+WVA  VH FLE + T +H
Sbjct  298   GRRRLMEQENNT------YFGNVLSIPFGGQRIDDLTNKPLSWVAEEVHRFLERSATKEH  351

Query  1136  FLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             FL LIDWVE  RP P++ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPW
Sbjct  352   FLNLIDWVETRRPTPSVSRIYSVGSDDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPW  411

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS    GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  412   GGSAGYVMPMPS---YGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  459



>ref|NP_178020.1| HXXXD-type acyl-transferase [Arabidopsis thaliana]
 gb|AEE36189.1| HXXXD-type acyl-transferase [Arabidopsis thaliana]
Length=455

 Score =   449 bits (1156),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 321/469 (68%), Gaps = 33/469 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+ +V+ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP   +     E    
Sbjct  11    FHVTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLNVHVCFCYKKPLHFTNTVAYE----  65

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  66    -------TLKTALAETLVSYYAFAGELVTNPTGEPEILCNNRGVDFVEAGADVELRELNL  118

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  119   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  177

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +Y+P++SL P +    P+    SRIY + A
Sbjct  178   SDVPISCVPSFRRSLLNPRRPLVMDPSIDQIYMPVTSLPPPQETTNPENLLASRIYYIKA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDGR  961
               ++ELQ+ A+       K+ +RTKLE+F AFLWK VA  + K     K  KLGIVVDGR
Sbjct  238   NALQELQTLASSS-----KNGKRTKLESFSAFLWKLVAEHAAKDPVPIKTSKLGIVVDGR  292

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RL   + N       YFGNVLS PF  + I +L  KPL+WV   VH FL++++T +HFL
Sbjct  293   RRLMEKENNT------YFGNVLSVPFGGQRIDDLISKPLSWVTEEVHRFLKKSVTKEHFL  346

Query  1142  GLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
              LIDWVE  RP PA+ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWGG
Sbjct  347   NLIDWVETCRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNQVDFGWGSPVFGSYHFPWGG  406

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPS   + DW+VY+HL K ++  IE  ASHV KP  +D+L  
Sbjct  407   SAGYVMPMPSSVDDRDWMVYLHLTKGQLRFIEEEASHVLKPIDNDYLKI  455



>ref|XP_006343401.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=382

 Score =   445 bits (1145),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 226/373 (61%), Positives = 282/373 (76%), Gaps = 12/373 (3%)
 Frame = +2

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKF  556
             C   GV F++AF DVEL+++N Y PD+S+EGK VPKKK GVL++Q T+LKCGGI++   F
Sbjct  10    CTYSGVSFIEAFGDVELKEINFYNPDESIEGKFVPKKKHGVLAIQVTQLKCGGIILGCTF  69

Query  557   DHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ  736
             DHRVADAYSAN+FLVSWSE+AQ+K LSQLP FRRS LFPR P +YD S+D++YVPIS+L 
Sbjct  70    DHRVADAYSANLFLVSWSELAQSKPLSQLPSFRRSSLFPRHPGYYDDSIDDLYVPISTLP  129

Query  737   PEAVE-----EPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA  901
             P   E     +  ISRIY V  ++I  LQS AN +    +K  +R+KLE+F AFLWK++A
Sbjct  130   PTKSEILNPNDQVISRIYYVTGDKIEHLQSLANCHDQKGIKS-QRSKLESFSAFLWKSIA  188

Query  902   SG--KSRRNFKNFKLGIVVDGRTRL---SIGDENKAKFLQGYFGNVLSFPFEEKTIKELR  1066
              G  K    F NF+ GIVV+GRTRL   ++   N+ K L+GYFGNVLS PF EK ++EL+
Sbjct  189   CGINKETSGFNNFRFGIVVNGRTRLISNNVDVNNQDKSLKGYFGNVLSIPFGEKKVEELK  248

Query  1067  EKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV-DGAALVVSSGQR  1243
             EK L+WVA+ VHEFL+ A T +HFLGLIDWVEAHRPEP+I K++    DG A+VVSSGQ 
Sbjct  249   EKSLHWVANVVHEFLDIAKTQEHFLGLIDWVEAHRPEPSIAKIYAMNGDGPAVVVSSGQH  308

Query  1244  FPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYAS  1423
             FP +KI+FGWG PAF SYHFPW G+ GYVMPM SPKGNGDWIVYMHL K ++ELIE   S
Sbjct  309   FPAKKINFGWGLPAFWSYHFPWAGKVGYVMPMSSPKGNGDWIVYMHLLKWQMELIEASPS  368

Query  1424  HVFKPFTSDHLNF  1462
              VF+  T+++LN 
Sbjct  369   QVFELVTANYLNL  381



>gb|KFK42268.1| hypothetical protein AALP_AA2G233500, partial [Arabis alpina]
Length=397

 Score =   446 bits (1146),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 227/402 (56%), Positives = 283/402 (70%), Gaps = 20/402 (5%)
 Frame = +2

Query  284   TLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSV  463
             TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVD V+A ADV+L+ LNLY PD+S+
Sbjct  7     TLKTALAETLVSYYAFAGEIVTNPTGEPEILCNNRGVDLVEAGADVDLKDLNLYDPDESI  66

Query  464   EGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAK-QLSQ  640
               KLVP KK G++++Q T+LKCG IVV   FDHRVADAYS NMFLVSW+EIA++   +S 
Sbjct  67    -AKLVPIKKHGIIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLVSWAEIARSDVPISC  125

Query  641   LPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAAEQIRELQ  808
             +P FRRS L PRRP   D SLDNMY+P++SL P E    P     SRIY + A+ + ELQ
Sbjct  126   VPSFRRSLLNPRRPLIIDSSLDNMYMPVTSLPPLEETTHPDNILASRIYYIKADALEELQ  185

Query  809   SQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGRTRLSIGD  982
             + A   S  ++K  +RTKLE+F A LWK VA   ++  F  KN KLGIVVDGR RL    
Sbjct  186   TLA---SCSKMK-VQRTKLESFSALLWKLVAKHAAKDPFPSKNSKLGIVVDGRKRLMEQK  241

Query  983   ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVE  1162
              N       YFGNVLS PF  + I +L  KPL+WV + VH+FLE ++T  HFL LIDWVE
Sbjct  242   HNT------YFGNVLSIPFGGQRINDLINKPLSWVTTEVHKFLESSVTKVHFLNLIDWVE  295

Query  1163  AHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMP  1336
              HRP PA+ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWGG +GYVMP
Sbjct  296   THRPTPAVSRIYSTGSNDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPWGGSAGYVMP  355

Query  1337  MPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             MPS   +GDW+VY+HL K +++ IE  ASHVFKP  +D+L  
Sbjct  356   MPSSVDDGDWMVYLHLTKGQLKFIEEEASHVFKPIDNDYLKI  397



>ref|XP_002889224.1| hypothetical protein ARALYDRAFT_316796 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65483.1| hypothetical protein ARALYDRAFT_316796 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   450 bits (1158),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 255/469 (54%), Positives = 325/469 (69%), Gaps = 33/469 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+++ T+ +V+ AALP+Q+ H+LP SNLDLLLPP+DV V FCY+KP      T T  H  
Sbjct  128   FHMTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLDVNVCFCYKKPLNI---TNTVAH--  181

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGEV  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  182   ------ETLKTALAETLVSYYAFAGEVVTNPTGEPEILCNNRGVDFVEAGADVELRELNL  235

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EIA+
Sbjct  236   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEIAR  294

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +++P++SL P +    P+    SRIY + A
Sbjct  295   SDGPISCVPSFRRSLLNPRRPLIVDSSIDQIFMPVTSLPPPQETTNPENLLASRIYYIKA  354

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDGR  961
             + + ELQ+ A+       K+ +RTKLE+F AFLWK VA  + K     K  KLGIVVDGR
Sbjct  355   DALEELQTLASSS-----KNSKRTKLESFSAFLWKLVAEHAAKDPVPSKTSKLGIVVDGR  409

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RL +  ENK      YFGNVLS PF  + I +L  KPL+WV   VH FLE ++T +HFL
Sbjct  410   RRL-MEQENKT-----YFGNVLSIPFGGQRIDDLISKPLSWVTEEVHRFLERSVTKEHFL  463

Query  1142  GLIDWVEAHRPEPAIPKVH-DCVD-GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
              LIDWVE  RP PA+ +++ D  D G A VVSSG+ FPV ++DFGWG P FG+YHFPWGG
Sbjct  464   NLIDWVETRRPTPAVSRIYGDGSDNGPAFVVSSGRSFPVTQVDFGWGSPVFGTYHFPWGG  523

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPS   +GDW+VY+ L K +++ IE  ASHV KP  +D+L  
Sbjct  524   SAGYVMPMPSAVEDGDWMVYLLLTKGQLKFIEEEASHVLKPIDNDYLKI  572



>gb|EYU25783.1| hypothetical protein MIMGU_mgv1a006078mg [Erythranthe guttata]
Length=458

 Score =   446 bits (1146),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 315/464 (68%), Gaps = 21/464 (5%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             +  F V+V  +EVVAA LP+QE H+LP SNLDLLLPP+D G+FFCY+K    S +   + 
Sbjct  3     SGGFPVTVKWSEVVAAVLPLQE-HWLPMSNLDLLLPPLDFGIFFCYKK---RSGENQEDG  58

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                +   M   LK ALS+ALVSF+ LAGE+  N  GEPE++ NNRGVDF  A+ADVEL+ 
Sbjct  59    DLISPESMAAVLKKALSQALVSFFPLAGEIVHNRHGEPEILSNNRGVDFSYAYADVELKD  118

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             ++LY+PD SV GKLVP K  GVLSVQ TELKCGG+ V   FDHR ADA+SANMFL +W+E
Sbjct  119   VDLYRPDLSVHGKLVPVKMHGVLSVQVTELKCGGLFVGCTFDHRAADAHSANMFLTAWAE  178

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK---ISRIYCVA  784
             IA++K ++ LP FRRS   PRRP     SL+ +Y P+ S+ P    +      SRIY + 
Sbjct  179   IARSKPITLLPSFRRSIFNPRRPPQQHKSLEKIYAPLLSMPPPPSADDTDQLTSRIYYIK  238

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK--TVASGKSRRNFKNFKLGIVVDG  958
             + +I  LQSQ++H         RR+K+E+F AFLWK    A+       K  KLGIVVDG
Sbjct  239   SNEIDRLQSQSSHNGN------RRSKIESFSAFLWKAIAAAAVGGGERSKVVKLGIVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RLS     +   L+ YFGNVLS P+ E ++ EL+   LN +   VHEF+  A T +HF
Sbjct  293   RARLS----GETASLERYFGNVLSIPYVESSVGELKTASLNELVDVVHEFVAAASTAEHF  348

Query  1139  LGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L LIDWVE  RP PA+ KV+  D  + AA+VVSSGQRF V ++DFGWG P FGSYHFPWG
Sbjct  349   LALIDWVELRRPNPAVVKVYCRDENNEAAVVVSSGQRFRVGEMDFGWGGPEFGSYHFPWG  408

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             G++GYVMPMPS  GNGDWIVYMHL K++++ +E    HVF+PF+
Sbjct  409   GETGYVMPMPSACGNGDWIVYMHLMKKQLDFVEAREPHVFRPFS  452



>ref|XP_009408072.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=442

 Score =   445 bits (1144),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 247/465 (53%), Positives = 310/465 (67%), Gaps = 28/465 (6%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M  ++ + V+V + E VAAA PV E H LP SNLDLLLP +DVGVFFCY+KP        
Sbjct  1     MVRSTGYTVTVKETETVAAASPVGE-HRLPLSNLDLLLPALDVGVFFCYKKPRG------  53

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
               +H  +   MV +LKA+L+E L ++Y  AGEV  N AGEPEL+CNNRGVDFV A ADVE
Sbjct  54    --KHYPSLASMVCSLKASLAETLETYYPFAGEVVANSAGEPELLCNNRGVDFVVAQADVE  111

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             LR L L  P +SVEGKLVP KK GVL VQATELKCGG+V+A  FDHRVADA S NMFLV+
Sbjct  112   LRALRLCHPSESVEGKLVPPKKGGVLCVQATELKCGGLVLACAFDHRVADACSTNMFLVA  171

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--EPKISRIYC  778
             WSE++ +K LS LP FRRS LFPR P   D S D++YVP SSL P   +  E  I+RIY 
Sbjct  172   WSELSTSKPLSCLPAFRRSLLFPRSPLRVDHSFDHLYVPFSSLPPPEHDHSEEAINRIYY  231

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             +AA  I  +QS              RTK+EAF A+LW+ +A   +  +    ++GIVVDG
Sbjct  232   IAAADIDRMQSSTKG----------RTKIEAFTAYLWRALAITAAPGD-NWCRMGIVVDG  280

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RL      +   +  YFGNVLS P+    ++ELR   +  VA  VH +L++  T +HF
Sbjct  281   RARL------RDTVMSSYFGNVLSIPYGTLRVEELRRMEVAEVAEVVHSWLQQEATEEHF  334

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ  1318
              GL+DWVEAHRPEPA+ +++    G A VVSSG+ FPV ++ FGWGK AFGSYHFPWGG 
Sbjct  335   RGLVDWVEAHRPEPAVARIYSKEGGPACVVSSGREFPVAEVQFGWGKAAFGSYHFPWGGS  394

Query  1319  SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             +GYVMPMPS    GDW+VY++L K+  E++E     VF+  TSD+
Sbjct  395   TGYVMPMPSATAAGDWVVYVYLLKKVAEVLEAEQPPVFRTLTSDY  439



>gb|AAC17079.1| Contains similarity to C2-HC type zinc finger protein C.e-MyT1 
gb|U67079 from C. elegans and to hypersensitivity-related 
gene 201 isolog T28M21.14 from A. thaliana BAC gb|AF002109 [Arabidopsis 
thaliana]
Length=572

 Score =   449 bits (1156),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 249/469 (53%), Positives = 321/469 (68%), Gaps = 33/469 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F+V+ T+ +V+ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP   +     E    
Sbjct  128   FHVTTTRKQVITAALPLQD-HWLPLSNLDLLLPPLNVHVCFCYKKPLHFTNTVAYE----  182

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                    TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDFV+A ADVELR+LNL
Sbjct  183   -------TLKTALAETLVSYYAFAGELVTNPTGEPEILCNNRGVDFVEAGADVELRELNL  235

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFL+SW+EI++
Sbjct  236   YDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLLSWAEISR  294

Query  623   AK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAA  787
             +   +S +P FRRS L PRRP   D S+D +Y+P++SL P +    P+    SRIY + A
Sbjct  295   SDVPISCVPSFRRSLLNPRRPLVMDPSIDQIYMPVTSLPPPQETTNPENLLASRIYYIKA  354

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVDGR  961
               ++ELQ+ A+       K+ +RTKLE+F AFLWK VA  + K     K  KLGIVVDGR
Sbjct  355   NALQELQTLASSS-----KNGKRTKLESFSAFLWKLVAEHAAKDPVPIKTSKLGIVVDGR  409

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              RL   + N       YFGNVLS PF  + I +L  KPL+WV   VH FL++++T +HFL
Sbjct  410   RRLMEKENNT------YFGNVLSVPFGGQRIDDLISKPLSWVTEEVHRFLKKSVTKEHFL  463

Query  1142  GLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
              LIDWVE  RP PA+ +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWGG
Sbjct  464   NLIDWVETCRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNQVDFGWGSPVFGSYHFPWGG  523

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPS   + DW+VY+HL K ++  IE  ASHV KP  +D+L  
Sbjct  524   SAGYVMPMPSSVDDRDWMVYLHLTKGQLRFIEEEASHVLKPIDNDYLKI  572



>ref|XP_006389934.1| hypothetical protein EUTSA_v10018518mg [Eutrema salsugineum]
 gb|ESQ27220.1| hypothetical protein EUTSA_v10018518mg [Eutrema salsugineum]
Length=457

 Score =   444 bits (1142),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 248/471 (53%), Positives = 322/471 (68%), Gaps = 30/471 (6%)
 Frame = +2

Query  77    SNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEH  256
             ++F+V+  + +++ AALP+Q+ H+LP SNLDLLLPP++V V FCY+KP            
Sbjct  8     TDFHVTTIRKQLITAALPLQD-HWLPLSNLDLLLPPLNVSVCFCYKKP---------RNI  57

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKL  436
             AT       TLK AL+E LVS+YA AGE+  N +GEPE++CNNRGVDF++A ADVELR+L
Sbjct  58    ATNLVAPNETLKTALAETLVSYYAFAGEIVTNPSGEPEILCNNRGVDFLEAGADVELREL  117

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             NL  PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFLVSW+E+
Sbjct  118   NLSDPDESI-AKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVADAYSMNMFLVSWAEM  176

Query  617   AQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKI--SRIYCV  781
             +++   +S +P FRRS L PRRP   D S+D MY+P++SL P  E  +   I  SR+  +
Sbjct  177   SRSDVPISYVPSFRRSLLNPRRPLIVDSSIDPMYMPVTSLPPPQETFDPDTILASRLCYI  236

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA--SGKSRRNFKNFKLGIVVD  955
              A+ +++LQ+ A   S  +L   +RTKLE+F AFLWK VA  + K     KN K+GIVVD
Sbjct  237   KADALQKLQTLA---SGSKLTV-KRTKLESFSAFLWKLVANHAAKDPVPSKNSKIGIVVD  292

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR RL     N       YFGNVLS PF  + I +L  KPL+WV   VH FLE ++T +H
Sbjct  293   GRRRLMEQKHNT------YFGNVLSIPFGGQKIDDLINKPLSWVTEEVHRFLESSVTKEH  346

Query  1136  FLGLIDWVEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             FL LIDWVE  RP PA+ +++     DG A VVSSG+ FPV K+DFGWG P FGSYHFPW
Sbjct  347   FLNLIDWVETRRPTPAVSRIYSNGSDDGPAFVVSSGRSFPVTKVDFGWGSPVFGSYHFPW  406

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GG +GYVMPMPS   +GDW+VY+HL K +++ IE  ASHV  P  +D+L  
Sbjct  407   GGSAGYVMPMPSSVNDGDWMVYLHLTKGQLKFIEEEASHVLIPIDNDYLKI  457



>ref|XP_010938319.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Elaeis 
guineensis]
Length=458

 Score =   439 bits (1128),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 243/465 (52%), Positives = 323/465 (69%), Gaps = 31/465 (7%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQK-PAAASAQTTTEEH  256
              + V+V + E VAA LP+QE H+L  SNLDLLLPP+DVGVFFCY+K P + S        
Sbjct  7     GYAVTVHRKERVAAVLPLQE-HWLSLSNLDLLLPPLDVGVFFCYEKLPGSPS--------  57

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKL  436
                F  M+++LK +L +ALVS+Y  AGEV  N  GEPEL+CNNRGVDF++A+ADVELR+L
Sbjct  58    ---FATMLSSLKGSLVQALVSYYPFAGEVVTNSTGEPELLCNNRGVDFIEAYADVELREL  114

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             +LYKPD+S+ GKL+PKK+ GVL VQATEL+CGG+VVA  FDHR+ADA SA+MFLV+W+E+
Sbjct  115   SLYKPDESLGGKLMPKKEGGVLCVQATELRCGGLVVACAFDHRIADAVSADMFLVAWAEL  174

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVA  784
             A +K +S++P FRRS L PRRP  +D   D +Y PISSL       P     +SRIY + 
Sbjct  175   ATSKPVSRIPSFRRSLLNPRRPGRHDSFPDRLYAPISSLSRPPSPPPLQQPVVSRIYYIT  234

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             AE +  +Q+ A+   A       RTK+EAF A+LW+ +A G    + K  ++G+VVDGR+
Sbjct  235   AEDVDSMQTAASAGGA-----AYRTKVEAFTAYLWRVLAKGTVSGD-KPCRMGLVVDGRS  288

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             RL       A+ +  YFGNVL+ P+   +  EL    L  VA AVHEFL  A+T +HF G
Sbjct  289   RLD------ARAMANYFGNVLTLPYGTLSAAELGRMELPEVADAVHEFLRPAVTAEHFRG  342

Query  1145  LIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ  1318
             L+DWVE+HRPEPA+ +V+  D   G A +VSSG+RFP  +++FGWGKP   SY+FPWGG 
Sbjct  343   LVDWVESHRPEPAVARVYLEDEEGGMACIVSSGRRFPSSELEFGWGKPTLASYYFPWGGS  402

Query  1319  SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             +G+VMP PS KGNGDW+VY +L K+ VE++E  +  V +P T D+
Sbjct  403   AGFVMPTPSAKGNGDWVVYAYLLKDLVEVLEAQSPQVLRPLTPDY  447



>ref|XP_009609794.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nicotiana tomentosiformis]
Length=362

 Score =   435 bits (1119),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 260/328 (79%), Gaps = 9/328 (3%)
 Frame = +2

Query  500   LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRR  679
             +S+Q T+LKCGG+VV   FDHRVADAYSAN+FLVSWSE+AQ+K L+QLP FR+SFLFPR 
Sbjct  36    VSLQVTQLKCGGLVVGCAFDHRVADAYSANLFLVSWSELAQSKPLTQLPSFRKSFLFPRH  95

Query  680   PAHYDLSLDNMYVPISSL---QPEAVE--EPKISRIYCVAAEQIRELQSQANHYSADELK  844
             P +YD S+D +YVPI ++   +PE +   +  ISRIY V  E+I  LQS AN     +  
Sbjct  96    PGYYDDSIDGLYVPIPTIPLIKPETLNPNDQAISRIYYVTGEKINHLQSLANR--DQKST  153

Query  845   HPRRTKLEAFCAFLWKTVASG-KSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGN  1021
               +R+KLE+F AFLWKT+A G K   N KNF+ GI+VDGRTRLS GD+N+ K L+GYFGN
Sbjct  154   KFQRSKLESFSAFLWKTIACGIKETSNSKNFRFGIIVDGRTRLSNGDDNQEKLLKGYFGN  213

Query  1022  VLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHD  1201
             VLS PF  K I+EL+EK L+WVA+A+HE +E+A+T +HFLGLIDWVEAHRPEPA+ K++ 
Sbjct  214   VLSIPFGNKKIEELKEKSLSWVANAIHEIIEKAVTREHFLGLIDWVEAHRPEPAVTKIYA  273

Query  1202  CVD-GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYM  1378
               D G A+VVSSGQ+FP R+IDFGWG+P F SYHFPW G+SGYVMPMPSPKGNGDWI+YM
Sbjct  274   TDDDGPAVVVSSGQQFPAREIDFGWGEPVFWSYHFPWAGKSGYVMPMPSPKGNGDWIIYM  333

Query  1379  HLQKEKVELIETYASHVFKPFTSDHLNF  1462
             HL K ++ELIET ASHVFKP T+++LN 
Sbjct  334   HLMKWQLELIETSASHVFKPVTANYLNL  361



>ref|XP_009385887.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   435 bits (1119),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 249/467 (53%), Positives = 314/467 (67%), Gaps = 29/467 (6%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             M  +  F++ V  +E V A LPVQE H LP SNLDLLLP +DVGVF CY+KP        
Sbjct  1     MGGSEEFSIDVKGSETVVAVLPVQE-HRLPLSNLDLLLPDMDVGVFLCYRKPEG------  53

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              +   +TF  MV+ LKA+L++ALV++Y  AG+V  N  GEPEL CNNRGVDFV  FADVE
Sbjct  54    -KHFHSTFASMVSLLKASLAQALVTYYPFAGQVMANSVGEPELQCNNRGVDFVVVFADVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             LR+L L  PDDSVEGKLVPKKK+GVL VQATELKCG +V+A  FDHRVADAYSANMFLV+
Sbjct  113   LRELRLCNPDDSVEGKLVPKKKEGVLCVQATELKCGSLVLACTFDHRVADAYSANMFLVA  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA--VEEPKISRIYC  778
             WSEIA  K LS+LP FRRS L PR P     S D ++VP+SSL P      +  ++RIY 
Sbjct  173   WSEIAMLKPLSRLPSFRRSLLTPRHPLQLHPSFDRLFVPVSSLPPPKHHYSDQAVNRIYY  232

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             +AA  I  +QS A           RR+K+  F A+LW+ +A   +  + +  ++G+VVDG
Sbjct  233   IAAADINRMQSSAK----------RRSKIVVFTAYLWRVLAKAAAPED-RWCRMGVVVDG  281

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R+RL     N A  +  YFGNVLS P+    ++ LR   L  VA  V+ +L    T +HF
Sbjct  282   RSRLG----NAA--MSSYFGNVLSIPYGRLNVESLRRMELAEVAEVVYGWLRPGTTEEHF  335

Query  1139  LGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
              GL+DWVE HRPEPA+ +++  +  +G   VVSSG+ FPV +++FGWGK AFGSYHFPWG
Sbjct  336   RGLVDWVEVHRPEPAVARIYCGEADEGPGCVVSSGRAFPVAEVEFGWGKAAFGSYHFPWG  395

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             G +GYVMPMPS KGNGDW+VYMH+QKE V  +E     V +P T D+
Sbjct  396   GSAGYVMPMPSAKGNGDWVVYMHIQKEVVAALEEEQPPVLRPLTPDY  442



>ref|XP_010928753.1| PREDICTED: rosmarinate synthase [Elaeis guineensis]
Length=452

 Score =   426 bits (1095),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 243/471 (52%), Positives = 316/471 (67%), Gaps = 31/471 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    + V+V   E VAA LPVQE   LP SNLDLLLP +DVGVFFCY+K  A      
Sbjct  1     MAGCKEYAVTVKAKERVAAGLPVQE-QRLPLSNLDLLLPALDVGVFFCYKKLPA------  53

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              E+   TF  MV+ LK +L+ ALV++   AGEV  N  GEPEL+CNNRGVDF++A+A+VE
Sbjct  54    -EQSPATFATMVSALKTSLARALVTYQPFAGEVVTNSMGEPELLCNNRGVDFIEAYANVE  112

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++L LY PD+SVEGKLVPKK++GVL VQATELKCGG+V+A  FDHR+ADAYS N+FLV+
Sbjct  113   LQELRLYNPDESVEGKLVPKKEEGVLCVQATELKCGGLVLACTFDHRIADAYSTNIFLVA  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV----EEPKISRI  772
             W+E A +K +S  P FRRS L PRR   +D SLD ++VP SSL P       +E  +SRI
Sbjct  173   WAETAGSKPISLSPSFRRSLLTPRRSGSHDPSLDRLFVPFSSLPPLPPPSPDQEAAVSRI  232

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y + A+ I  +Q  A           +RTK+EAF A+LW+ V S  +R   K  ++G VV
Sbjct  233   YYIVADDIARIQVAAGG---------QRTKMEAFIAYLWR-VLSRTARPEDKVCRIGAVV  282

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR+RL+ G E     + GYFGNVLSFP+    ++EL++  L  VA  VH +L  A+T +
Sbjct  283   DGRSRLAPGGE-----MAGYFGNVLSFPYGSLGVEELKDMGLEEVAEVVHGWLRPAVTEE  337

Query  1133  HFLGLIDWVEAHRPEPAIPKV---HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
             HF GL+DWVE  R EP +P++   H   +G   +VSSG+R PV +++FGWG+  F SYHF
Sbjct  338   HFRGLVDWVEFQRREPVVPRILLGHK-EEGVGCMVSSGRRLPVGEVEFGWGRAVFASYHF  396

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             P    +GY MPMPS KGNGDW+VYMHL+K   +L+E     VF+P T+D+ 
Sbjct  397   PLENPTGYAMPMPSAKGNGDWVVYMHLRKSFADLLEAEEPPVFRPLTADYF  447



>ref|XP_002891015.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67274.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=432

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/407 (54%), Positives = 284/407 (70%), Gaps = 31/407 (8%)
 Frame = +2

Query  275   MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
             +  TLKA+L+EALVS+YA AGE+ +N  GEPE++CNNRGVDF++A ADVELR+LNL+ PD
Sbjct  44    LAETLKASLAEALVSYYAFAGELVKNYVGEPEILCNNRGVDFLEALADVELRELNLHDPD  103

Query  455   DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAK-Q  631
             +S+  KLVPKKK GVL++Q T+LKC  IVV   FDH++ADA+S NMFLVSW+EI+++   
Sbjct  104   ESI-AKLVPKKKHGVLAIQVTQLKCESIVVGCTFDHQIADAFSMNMFLVSWAEISRSDVP  162

Query  632   LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISS--LQPEAVEEPK---ISRIYCVAAEQI  796
             +S +P FRRS L PRRP   D S+D MY+P +S  L  E   +P     SRIY +    +
Sbjct  163   ISSVPSFRRSMLNPRRPLIIDSSIDKMYMPATSLPLPQETTNDPDNILTSRIYYIKGNAL  222

Query  797   RELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSI  976
              +LQ  A+  S+    + +RTKLE+F AFLWK  +           K+GIVVDGR RL +
Sbjct  223   EDLQRLASSSSSKN-GYSQRTKLESFSAFLWKLKS-----------KIGIVVDGRRRL-M  269

Query  977   GDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDW  1156
               EN       YFGNVLS PF   +I +L +KPL+W+++ VH+FLEEA+T DHFL LIDW
Sbjct  270   EKENST-----YFGNVLSIPFGGHSINDLIDKPLSWLSNEVHKFLEEAVTKDHFLNLIDW  324

Query  1157  VEAHRPEPAIPKVHD--CVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYV  1330
             VE HRP PA+ +++     DG A VVSSG  FPV K+DFGWG P FGSYHFPW G +GYV
Sbjct  325   VEIHRPIPAVSRIYSTGANDGPAFVVSSG--FPVTKVDFGWGLPVFGSYHFPWEGSAGYV  382

Query  1331  MPMPSP--KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             MPMPSP   G+GDW+VY++L K +++ IE   +HV KP  +D+L  N
Sbjct  383   MPMPSPVDDGDGDWVVYLYLTKGQLKFIEEEVAHVLKPIDNDYLKIN  429



>ref|XP_010041079.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like, partial 
[Eucalyptus grandis]
Length=447

 Score =   420 bits (1079),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 252/453 (56%), Positives = 308/453 (68%), Gaps = 45/453 (10%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +   F V + K EVVAAAL +QE H+LP SNLDLLLPPVDVGVFFCY  P      TTT 
Sbjct  7     AGGEFTVKLDKKEVVAAALSMQE-HWLPLSNLDLLLPPVDVGVFFCYTNP------TTTA  59

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
                  +G MV  LKAAL +ALVS+YALAGEV QN  GEPEL+CNNRGVDF +AFA+VELR
Sbjct  60    SQKLEYGSMVGILKAALGKALVSYYALAGEVIQNSVGEPELLCNNRGVDFTEAFAEVELR  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W+
Sbjct  120   HLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWA  179

Query  611   EIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP---------EAVEEPK  760
             + A+ A  +S  P F RS L PRRP   + SLD+MY+P+S+L P         EA E   
Sbjct  180   DKARSAAPISLPPSFNRSLLNPRRPLCVNASLDSMYLPVSALPPPPKQKQKADEACETTT  239

Query  761   -------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGK  910
                    +SR+Y V A ++ +LQ +A  YS       +R+KLE+F AFLWK VA   SG 
Sbjct  240   SRDDDCVVSRMYYVTAAELSKLQQRA--YS----NGSKRSKLESFSAFLWKMVAESSSGA  293

Query  911   SRRNFKNF-KLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNW  1084
             S  + K   ++GIVVDGR RL S   +++   +  YFGNVLS PF EK   E+ EKPL+W
Sbjct  294   SNDDDKRMSRMGIVVDGRCRLMSQRMDDEPTPMASYFGNVLSKPFGEKRTTEVMEKPLSW  353

Query  1085  VASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA---------ALVVSSG  1237
             VA AVHEF++ A T +HFL LIDWVE HR  PA+ +++ C  G+         A VVSSG
Sbjct  354   VAEAVHEFVQRAATREHFLDLIDWVEEHRSVPAVARIY-CKSGSAEEEEEGSTAFVVSSG  412

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMP  1336
             QRFPV ++DFGWGKP +G      GG++GYVMP
Sbjct  413   QRFPVTEMDFGWGKPRWGPTTSRGGGEAGYVMP  445



>gb|KCW74067.1| hypothetical protein EUGRSUZ_E02701 [Eucalyptus grandis]
Length=438

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 304/473 (64%), Gaps = 49/473 (10%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
              +   F V   K EVVAA LP+Q  H LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6     GAGREFVVKSGKREVVAAPLPMQG-HLLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                   +G MV  LKAAL++ALVS+YALAGEV QN A EPEL+CNN  VDF++AFADVEL
Sbjct  59    ASQRLDYGSMVGVLKAALAQALVSYYALAGEVVQNSASEPELLCNNWEVDFIEAFADVEL  118

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R LNLY PDD+VEGKLVP KK+GVL+VQ     CGGIVVA  FDHR+ +AYS NMF+V W
Sbjct  119   RHLNLYNPDDTVEGKLVPTKKRGVLAVQ-----CGGIVVACTFDHRIVEAYSVNMFMVFW  173

Query  608   SEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVA  784
              E A+ A  +S  P FRRS L  R    +D SLD MY+P+ +L P     PK        
Sbjct  174   VETARSAAPISLPPSFRRSLLNLRHRLCFDPSLDRMYIPVFALYP----PPK--------  221

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
                  +LQS  ++ S       +RTKLE+F AFLW+ VA   S  +  + K        +
Sbjct  222   ----HKLQSACSNGS-------KRTKLESFSAFLWRMVAESSSVVDNDDNKT------MS  264

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
              + IG+++K   +  YFGNVLS PF EK  +E+ EKPL+WV   VH+F+E A T +HF+ 
Sbjct  265   MMGIGEDDKPTPMSSYFGNVLSVPFREKRPREVVEKPLSWVVDVVHKFVERAATKEHFVD  324

Query  1145  LIDWVEAHRPEPAIPKVHDCVD-------GAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
              IDWVE HRP  A+ ++    D          LVVSSGQRFPV ++DFGWGK   GSYHF
Sbjct  325   PIDWVEEHRPVLALERIFCKPDSEEEEEGSMVLVVSSGQRFPVTEMDFGWGKLVLGSYHF  384

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             PWGG++ YVMPMP+P  NGDW+VY+HL + +V  IE++AS +FK  T  HLN 
Sbjct  385   PWGGKAEYVMPMPNPLSNGDWVVYLHLPRSQVAFIESHASTIFKLLTPHHLNL  437



>ref|XP_009126112.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=454

 Score =   413 bits (1061),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 233/478 (49%), Positives = 305/478 (64%), Gaps = 50/478 (10%)
 Frame = +2

Query  83    FNVSVTKNEVVAAA----LPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             F+V+ T+ E+VA A    LP+ E   +  SNLDLLLPPVD+ V F Y+KP   +      
Sbjct  9     FHVTTTRKEIVAPASSPLLPLPENRIISLSNLDLLLPPVDINVCFFYKKPLYNTTN----  64

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVEL  427
                       + LK +L+EALVS+Y LAGEV  N + GEPE++CNN GV+ V+A ADVEL
Sbjct  65    ----------DVLKTSLAEALVSYYVLAGEVVANPITGEPEILCNNSGVEVVEAAADVEL  114

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNL+ P  S+ GK VP K   V ++Q TEL+CG +VV   FDHR+ADAYS NMFL+SW
Sbjct  115   RELNLHDPYQSI-GKFVPLKVHEVFAIQLTELRCGSLVVGCTFDHRIADAYSMNMFLLSW  173

Query  608   SEIAQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL----QPEAVEEPKISRI  772
             +E +++    S +P F RS L PRRP   D S+D MY+P++SL    +   ++    SRI
Sbjct  174   AETSRSDVPTSYMPSFNRSLLNPRRPLIIDTSVDQMYMPVTSLPLPQETTNLDNILTSRI  233

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGKSRRNFKNFKLG  943
             Y + AE ++ELQ+QA            RTKLE+F AFLWK VA   +  +     N KLG
Sbjct  234   YYIKAEAVQELQTQAG-----------RTKLESFSAFLWKLVAKHAATTTDSKLLNSKLG  282

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             IVVDGR +L+  + +       YFGNVLS PF E+ I +L  KPL+WVA  VH+ LE ++
Sbjct  283   IVVDGRKKLTEQETST------YFGNVLSVPFGEQIIDDLTHKPLSWVADEVHKVLESSV  336

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T DHFL LIDW+E  RP P + +++     DG A VVSSG+ FPV +IDFGWG P FGSY
Sbjct  337   TKDHFLNLIDWIETRRPVPVLSRIYGAGSEDGPAFVVSSGKSFPVTRIDFGWGSPVFGSY  396

Query  1298  HFPWGGQSGYVMPMPSP---KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             H P G ++GYVM MPSP      GDWIVY+HL+K +++ IE  A HVFKP  +D+L  
Sbjct  397   HLPLGSRTGYVMTMPSPVVDNSAGDWIVYLHLEKGQLKFIEQEAPHVFKPVDNDYLKI  454



>gb|KDP25023.1| hypothetical protein JCGZ_22558 [Jatropha curcas]
Length=425

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 297/478 (62%), Gaps = 82/478 (17%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
              F VSV K EVVAA LP+QE H+LP SNLDLLLPPVDVGVFFCY+ P  +          
Sbjct  9     TFTVSVAKKEVVAAVLPLQE-HWLPLSNLDLLLPPVDVGVFFCYRNPLIS----------  57

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELI-----------CNNRGVDFVQ  406
               FG MV +LK AL++ LVS+YA AGEV  N AGEPE++             NRGVDF +
Sbjct  58    MNFGSMVGSLKKALAQVLVSYYAFAGEVVANSAGEPEILHYKKNGILRPTNRNRGVDFYE  117

Query  407   AFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSA  586
             AFAD+EL+ LNLY PD S+E KLVPKK+                                
Sbjct  118   AFADIELQHLNLYNPDQSIEAKLVPKKED-------------------------------  146

Query  587   NMFLVSWSEIAQAKQLSQ--LPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
                     E+AQ+K +S   +P FRRS L PRRPA    SLD+MYVPIS LQP    +  
Sbjct  147   --------EMAQSKAISDSVVPSFRRSLLNPRRPACIHPSLDDMYVPISKLQPPKDSDSD  198

Query  761   ----ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFK  928
                 ISRIY V A+ + +LQS A+          +RTKLE+F A LW+ VA        K
Sbjct  199   DDHLISRIYYVKADSLNKLQSLASSIGC------QRTKLESFSALLWQLVAKSAQNGMAK  252

Query  929   NFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEF  1108
               K+GIVVDGRTRL  GD      +  YFGNVLS P+ +K I EL   PL+WVA+ VH+F
Sbjct  253   VSKMGIVVDGRTRL--GDT-----MDSYFGNVLSIPYGKKKIDELIANPLSWVANEVHDF  305

Query  1109  LEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSSGQRFPVRKIDFGWGKP  1282
             LE A T +HFLGLIDWVEAHRPEPA+ K++     DG A VVSSGQRFPV K+DFGWG P
Sbjct  306   LESAATKEHFLGLIDWVEAHRPEPALAKIYGSGSDDGPAFVVSSGQRFPVSKVDFGWGAP  365

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
              FGSYHFPWGG +GYVMPMPSP  NGDWIVYMHL K ++ LIE  +S++F+P T  +L
Sbjct  366   FFGSYHFPWGGNAGYVMPMPSPLCNGDWIVYMHLLKTQIHLIEAESSNLFQPLTCVYL  423



>dbj|BAB09608.1| unnamed protein product [Arabidopsis thaliana]
Length=481

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 236/476 (50%), Positives = 308/476 (65%), Gaps = 46/476 (10%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPV---QEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +FNV+ T+ EVV AA P+    E   +P SNLDLL+PPVD+ V F Y+KP          
Sbjct  33    SFNVTTTRKEVVVAAAPLLSLPENRVIPLSNLDLLIPPVDINVCFFYKKPL---------  83

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVEL  427
                  +G + + LK A++EALVS+Y L+GEV  N   GE E++C+N GV+FV+A ADVEL
Sbjct  84    -----YGIIGDALKTAMAEALVSYYVLSGEVSINPTNGENEILCSNGGVEFVEAAADVEL  138

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNLY+P  S+  K VP KK GV ++Q TELKCG +VV   FDHR+ADAYS NMFLVSW
Sbjct  139   RELNLYEPYQSI-AKFVPMKKHGVFAIQVTELKCGSVVVGCTFDHRIADAYSMNMFLVSW  197

Query  608   SEIAQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAV---EEPKISRI  772
             +EI+++   +S +P  +RS L PRRP   D S+D +Y+PI+SL  P+ +   +    SRI
Sbjct  198   AEISRSDIPISYVPLLKRSLLKPRRPLIIDSSIDKLYMPITSLTVPQEITNQDNILTSRI  257

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF---KNFKLG  943
             Y + A+ + + Q+ A +         +RTKLE+F AFLWK +A   +  +    K  KLG
Sbjct  258   YYIKADVLEKFQTLATN--------GKRTKLESFSAFLWKLLAKHAATESVLPTKTSKLG  309

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             IVVDGR +L +  EN       YFGNVLS PF E+ I +L  KPL+WV   VH+ LE  +
Sbjct  310   IVVDGRKKL-MEQEN-----CNYFGNVLSVPFGERRIDDLIHKPLSWVTDEVHKLLESTM  363

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T DHFL LIDWVE  RP P I +++     DG A VVSSG+ FPV +IDFGWG P FGSY
Sbjct  364   TKDHFLNLIDWVETSRPIPVISRIYSTGSNDGPAFVVSSGKSFPVARIDFGWGSPVFGSY  423

Query  1298  HFPWGGQSGYVMPMPSP---KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             H P G ++GYVM MPSP    G+GDW VY+HL K ++  IE  ASHVF P  +D+L
Sbjct  424   HLPPGSRAGYVMTMPSPVENGGSGDWTVYLHLTKGQLRFIEQEASHVFNPVDNDYL  479



>ref|NP_197145.2| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAT71960.1| At5g16410 [Arabidopsis thaliana]
 gb|AAU95445.1| At5g16410 [Arabidopsis thaliana]
 gb|AED92289.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=480

 Score =   412 bits (1059),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 236/476 (50%), Positives = 308/476 (65%), Gaps = 46/476 (10%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPV---QEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +FNV+ T+ EVV AA P+    E   +P SNLDLL+PPVD+ V F Y+KP          
Sbjct  32    SFNVTTTRKEVVVAAAPLLSLPENRVIPLSNLDLLIPPVDINVCFFYKKPL---------  82

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVEL  427
                  +G + + LK A++EALVS+Y L+GEV  N   GE E++C+N GV+FV+A ADVEL
Sbjct  83    -----YGIIGDALKTAMAEALVSYYVLSGEVSINPTNGENEILCSNGGVEFVEAAADVEL  137

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNLY+P  S+  K VP KK GV ++Q TELKCG +VV   FDHR+ADAYS NMFLVSW
Sbjct  138   RELNLYEPYQSI-AKFVPMKKHGVFAIQVTELKCGSVVVGCTFDHRIADAYSMNMFLVSW  196

Query  608   SEIAQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAV---EEPKISRI  772
             +EI+++   +S +P  +RS L PRRP   D S+D +Y+PI+SL  P+ +   +    SRI
Sbjct  197   AEISRSDIPISYVPLLKRSLLKPRRPLIIDSSIDKLYMPITSLTVPQEITNQDNILTSRI  256

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF---KNFKLG  943
             Y + A+ + + Q+ A +         +RTKLE+F AFLWK +A   +  +    K  KLG
Sbjct  257   YYIKADVLEKFQTLATN--------GKRTKLESFSAFLWKLLAKHAATESVLPTKTSKLG  308

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
             IVVDGR +L +  EN       YFGNVLS PF E+ I +L  KPL+WV   VH+ LE  +
Sbjct  309   IVVDGRKKL-MEQEN-----CNYFGNVLSVPFGERRIDDLIHKPLSWVTDEVHKLLESTM  362

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
             T DHFL LIDWVE  RP P I +++     DG A VVSSG+ FPV +IDFGWG P FGSY
Sbjct  363   TKDHFLNLIDWVETSRPIPVISRIYSTGSNDGPAFVVSSGKSFPVARIDFGWGSPVFGSY  422

Query  1298  HFPWGGQSGYVMPMPSP---KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             H P G ++GYVM MPSP    G+GDW VY+HL K ++  IE  ASHVF P  +D+L
Sbjct  423   HLPPGSRAGYVMTMPSPVENGGSGDWTVYLHLTKGQLRFIEQEASHVFNPVDNDYL  478



>gb|KCW44660.1| hypothetical protein EUGRSUZ_L01809, partial [Eucalyptus grandis]
Length=440

 Score =   409 bits (1052),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 247/448 (55%), Positives = 303/448 (68%), Gaps = 45/448 (10%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             +   F V + K EVVAAAL +QE H+LP SNLDLLLPPVDVGVFFCY  P      TTT 
Sbjct  7     AGGEFTVKLDKKEVVAAALSMQE-HWLPLSNLDLLLPPVDVGVFFCYTNP------TTTA  59

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
                  +G MV  LKAAL +ALVS+YALAGEV QN  GEPEL+CNNRGVDF +AFA+VELR
Sbjct  60    SQKLEYGSMVGILKAALGKALVSYYALAGEVIQNSVGEPELLCNNRGVDFTEAFAEVELR  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LNLY PD+++EGKLVP KK+GVL+VQATELKCGGIVVA  FDHR+ADAYSANMFLV W+
Sbjct  120   HLNLYNPDETIEGKLVPTKKRGVLAVQATELKCGGIVVACTFDHRIADAYSANMFLVFWA  179

Query  611   EIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP---------EAVEEPK  760
             + A+ A  +S  P F RS L PRRP   + SLD+MY+P+S+L P         EA E   
Sbjct  180   DKARSAAPISLPPSFNRSLLNPRRPLCVNASLDSMYLPVSALPPPPKQKQKADEACETTT  239

Query  761   -------ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGK  910
                    +SR+Y V A ++ +LQ +A  YS       +R+KLE+F AFLWK VA   SG 
Sbjct  240   SRDDDCVVSRMYYVTAAELSKLQQRA--YS----NGSKRSKLESFSAFLWKMVAESSSGA  293

Query  911   SRRNFKNF-KLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNW  1084
             S  + K   ++GIVVDGR RL S   +++   +  YFGNVLS PF EK   E+ EKPL+W
Sbjct  294   SNDDDKRMSRMGIVVDGRCRLMSQRMDDEPTPMASYFGNVLSKPFGEKRTTEVMEKPLSW  353

Query  1085  VASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA---------ALVVSSG  1237
             VA AVHEF++ A T +HFL LIDWVE HR  PA+ +++ C  G+         A VVSSG
Sbjct  354   VAEAVHEFVQRAATREHFLDLIDWVEEHRSVPAVARIY-CKSGSAEEEEEGSTAFVVSSG  412

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQS  1321
             QRFPV ++DFGWGKP +G      GG++
Sbjct  413   QRFPVTEMDFGWGKPRWGPTTSRGGGEA  440



>emb|CDP14267.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 290/469 (62%), Gaps = 72/469 (15%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+V ++EVVAAALPVQE H+LP SNLDLLL  +DVGVFFCY+K    ++        +
Sbjct  6     FLVNVKRSEVVAAALPVQE-HWLPMSNLDLLLLALDVGVFFCYKKNNDTTSIPEKNLTTS  64

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                 MV T+K AL++ALVSFY  AGEV QN  GEPEL+CNNRGVDF+ AFAD+EL+ L+L
Sbjct  65    PTENMVATIKKALAQALVSFYPFAGEVVQNRLGEPELLCNNRGVDFLDAFADIELKDLDL  124

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
             Y PD S+ GK VP K QGVLS+Q TELKCGG+V+   FDHRVADA+SANMF  +W EIAQ
Sbjct  125   YHPDTSIHGKFVPFKNQGVLSIQVTELKCGGLVIGCTFDHRVADAHSANMFFTAWVEIAQ  184

Query  623   AKQLSQ--LPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP----EAVEEPKISRIYCVA  784
             AK  +   +PC RRS L PRRP  YD  +D++YV +SSL P    +A ++  +SRIY + 
Sbjct  185   AKGTATHTVPCLRRSLLNPRRPTTYDAEIDDLYVLLSSLPPPKELKASDDRLLSRIYYIE  244

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
              ++I +LQS A+          RRTKLE+F AFLW                         
Sbjct  245   GKEIGQLQSMASSNGC------RRTKLESFSAFLW-------------------------  273

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
                                        KTI E      +WVA  +H  +E A   DHFLG
Sbjct  274   ---------------------------KTIAEG-----SWVADMIHACIEGANKEDHFLG  301

Query  1145  LIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ  1318
             LIDWVE HRP+PA   V+  +  D  A+V+SS  RFPV +++FGW  P FGSYHF WGGQ
Sbjct  302   LIDWVEEHRPQPAAAAVYFKNSEDEEAIVISSRLRFPVAQMNFGWEMPDFGSYHFHWGGQ  361

Query  1319  SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             +GYVMPMPS    GDWIVYM+L K+ ++++E+ + HVF+P    +L  N
Sbjct  362   TGYVMPMPSVSREGDWIVYMNLLKKHLDIVESKSGHVFRPLNPAYLKMN  410



>ref|XP_010552395.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Tarenaya 
hassleriana]
Length=457

 Score =   399 bits (1025),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 224/476 (47%), Positives = 303/476 (64%), Gaps = 34/476 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA N +F V V+K E V+AALPVQE ++LP SNLDL+LPPVD  VFFCY           
Sbjct  1     MARNEDFLVKVSKTEAVSAALPVQE-YWLPLSNLDLMLPPVDFCVFFCY-----------  48

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
              +    TF   V TLK AL++ L  +YA AGE+  N  GEPEL+CNN GV+F +A A V 
Sbjct  49    -DHVDVTFASTVVTLKKALADTLAPYYAFAGEITTNSLGEPELLCNNYGVEFSEARAYVN  107

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  L+LY+ + S+  +L P+KK+GV++VQATEL CG ++V  +  HR+ADAYSAN+F VS
Sbjct  108   LHDLDLYRLEKSIY-RLFPEKKRGVMAVQATELNCGSLIVTCRVHHRIADAYSANLFFVS  166

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ--PEAVEEPK------  760
             W+E A++  +S +P FRRS L  R P  +  S+D +Y+P+ S+   P+    P       
Sbjct  167   WAESARSMPISVVPSFRRSLLSSRHPPKHSPSMDELYMPLPSVSSPPKPKRNPDSSDLDE  226

Query  761   -ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN-FKNF  934
              +SR++ VAA +I E+Q  A+       ++ R TKLEAFCAFLWK  A  + +    +  
Sbjct  227   FVSRVFYVAASKIDEIQCLASS------EYSRVTKLEAFCAFLWKLTAKTEQKSGGARKA  280

Query  935   KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLE  1114
              LGIV+DGRTRL  GD N    +  Y GNVL+ PF +  + EL   PL  VA  VH  +E
Sbjct  281   ALGIVIDGRTRL--GD-NGVNNMGSYIGNVLTAPFRQCEMAELVRNPLGSVAREVHGVIE  337

Query  1115  EALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
                + +HF+GLIDW+EA RP+P  PK +   DG A++VSSG+RFPVR++DFGWG PA GS
Sbjct  338   TGASKEHFMGLIDWIEAQRPKPITPKAYWVNDGPAVMVSSGRRFPVREVDFGWGPPALGS  397

Query  1295  YHFP-WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             Y+F  WG   GYVMPMPS   +GDW+VY  L +  + +I   A+ +F+P T+ +L 
Sbjct  398   YYFSEWGSPMGYVMPMPSATVDGDWVVYTVLPRRVIHVITEEAADMFRPMTNQYLT  453



>emb|CDY57949.1| BnaA07g38470D [Brassica napus]
Length=404

 Score =   392 bits (1007),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 227/469 (48%), Positives = 287/469 (61%), Gaps = 76/469 (16%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A +  F+V+ T+ +++ AALP+Q+ H+LP SNLDL+LPPV V V FCY+KP   +     
Sbjct  8     ARDCAFHVTTTRKQLITAALPLQD-HWLPLSNLDLILPPVHVSVCFCYKKPRNMTNSMAH  66

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
             E           TLK AL+E LVS+YA AGE+  N  GEPE++CNNRGVDF++A ADV+L
Sbjct  67    E-----------TLKTALAETLVSYYAFAGEIVTNPTGEPEILCNNRGVDFMEAGADVDL  115

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNLY PD+S+  KLVP KK GV+++Q T+LKCG IVV   FDHRVADAYS NMFLVSW
Sbjct  116   RELNLYDPDESIV-KLVPIKKHGVIAIQLTQLKCGSIVVGCTFDHRVADAYSMNMFLVSW  174

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVAA  787
             +EI+                   RP  +             L P A       R Y    
Sbjct  175   AEIS-------------------RPDVHTCHF---------LAPSA-------RNY----  195

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGR  961
                     Q+ H S       RRTKLE+F AFLWK VA   +      KN KLGIVVDGR
Sbjct  196   --------QSRHGSK------RRTKLESFSAFLWKLVAKHAATDPVPSKNSKLGIVVDGR  241

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
              R+   ++N       YFGNVLS PF  + I +L  KPL+WV   VH FLE ++T +HFL
Sbjct  242   RRVMEQEKNT------YFGNVLSIPFGGQKIDDLVNKPLSWVTEVVHRFLESSVTKEHFL  295

Query  1142  GLIDWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG  1315
              LIDWVE  RP P + +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWGG
Sbjct  296   NLIDWVETRRPTPTVSRIYSTGSEDGPAFVVSSGRSFPVTQVDFGWGSPVFGSYHFPWGG  355

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              +GYVMPMPS   +GDW+VY+HL K +++ IE  AS V KP  +++L  
Sbjct  356   NAGYVMPMPSSVEDGDWMVYLHLTKGQLKFIEEEASQVLKPIDNNYLKI  404



>ref|XP_010248256.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like, partial 
[Nelumbo nucifera]
Length=355

 Score =   382 bits (980),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 236/332 (71%), Gaps = 20/332 (6%)
 Frame = +2

Query  509   QATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAH  688
             QATELKCGG+VVA  FDHRVADAYSANMF VSW+EIAQAK +S  P FRRS L PR+PA 
Sbjct  26    QATELKCGGLVVACTFDHRVADAYSANMFFVSWAEIAQAKPISITPSFRRSLLNPRKPAG  85

Query  689   -YDLSLDNMYVPISSLQPEAV-------EEPKISRIYCVAAEQIRELQSQANHYSADELK  844
              YD SLD MY+PIS L P          ++  ISRIY V A+ I  LQSQAN        
Sbjct  86    CYDPSLDEMYIPISMLPPPPTVAELGVHDDHLISRIYYVTAQDIDRLQSQANSNG-----  140

Query  845   HPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKF-LQGYFGN  1021
             + +R+K+E+F AFLWK VA   S  + K  K+GIVVDGR RLS+  E K    +  YFGN
Sbjct  141   YKKRSKIESFSAFLWKMVAK-SSNDDAKRCKMGIVVDGRRRLSMDGEGKTTCSMDTYFGN  199

Query  1022  VLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHD  1201
             VLS PF ++++ EL+ +PLNWVA  VH +L++A+T +HFLGLIDWVE HRPEPA+ K++ 
Sbjct  200   VLSIPFGDESVSELKTRPLNWVAGVVHNYLKDAVTKEHFLGLIDWVEDHRPEPALAKIY-  258

Query  1202  C----VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWI  1369
             C    +DG   VVSSGQRFPV  +DFGWG P FGSYHFPW G++GYVMPMPS +GNGDWI
Sbjct  259   CSRRNMDGPTFVVSSGQRFPVGMVDFGWGSPIFGSYHFPWQGEAGYVMPMPSSRGNGDWI  318

Query  1370  VYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
             VYMH+ K ++E +E  A+ VF+P T  +L  +
Sbjct  319   VYMHMPKGQLEFLEAEAADVFRPLTRGYLKLS  350



>ref|XP_010535222.1| PREDICTED: agmatine coumaroyltransferase-1-like [Tarenaya hassleriana]
Length=462

 Score =   377 bits (967),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 215/478 (45%), Positives = 288/478 (60%), Gaps = 37/478 (8%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             MA    F V VTK E+V AA+   E      +   LL P     VFFCY          +
Sbjct  1     MAGEGGFEVKVTKEEIVKAAVRTGECMLPLSNLDLLLPPLDFC-VFFCYD-------LGS  52

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVE  424
                   +FG MV TLK AL E LV ++A +GE+  +  G+ +L+CN+ GV F QA+A V+
Sbjct  53    NNGERRSFGSMVATLKEALEETLVHYHAFSGELTSDSLGQLQLLCNDHGVHFSQAYASVD  112

Query  425   LRKLNL--YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFL  598
             LR LNL  Y  ++S+  +LVP K+ GVLSVQATEL CG ++V+ + DHRVADAYS NMFL
Sbjct  113   LRHLNLHMYHLEESMY-RLVPDKQGGVLSVQATELSCGSVIVSCRVDHRVADAYSTNMFL  171

Query  599   VSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP------EAVEEPK  760
             VSW+E A++   S  P FRRS L PR P   D SL+ +Y P+SS+ P         ++  
Sbjct  172   VSWAESARSAPPSVFPSFRRSLLSPRFPLKLDPSLEELYFPLSSVSPLNQPPKSDSDDKI  231

Query  761   ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-----SGKSRRNF  925
             +SR++ V A+++ E+Q  A+       K  R TKLEA  A LWK  A     SG+ +R  
Sbjct  232   VSRLFYVKAQKVEEIQRLASSE-----KSGRVTKLEAMSAVLWKLAAKTEQMSGRRKRTM  286

Query  926   KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
                 LG+VVDGRTRL+  DE     L  Y GNVL+FPF  +   EL ++PL WVA  VH 
Sbjct  287   ----LGVVVDGRTRLAGDDE-----LGSYVGNVLAFPFRGRDTDELVKRPLEWVAREVHA  337

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPA  1285
              ++     +HF+GLIDW+EAH+P+P  P ++   DG  +VVSSG+RFPV ++DFGWG P 
Sbjct  338   VVKAGAEEEHFMGLIDWIEAHKPKPMTPGLYWVDDGPIVVVSSGRRFPVEEVDFGWGPPV  397

Query  1286  FGSYHF-PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
              GSY++  WG +  YVMPMPS    GDW++Y  L+K  V+LI   A  VF+P +S +L
Sbjct  398   LGSYYYRDWGSEMEYVMPMPSATVEGDWVIYTLLRKRVVDLIVEAAGDVFQPMSSKYL  455



>gb|KHG25192.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=330

 Score =   367 bits (942),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 232/316 (73%), Gaps = 13/316 (4%)
 Frame = +2

Query  536   IVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMY  715
             I+VA  FDHRVADAY+ANMFLVSW+EIAQ+K +S +P FRRS L PRRP   D SLD MY
Sbjct  21    IMVACAFDHRVADAYTANMFLVSWAEIAQSKPVSMVPSFRRSLLNPRRPGRADPSLDEMY  80

Query  716   VPISSLQP-EAVEEPK---ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAF  883
             VPI SL P E   EP    ISRIY V+++QI ELQS A   S+D  K   R+KLE+F AF
Sbjct  81    VPIPSLPPPEENHEPTDHLISRIYYVSSDQINELQSLA---SSDGDK---RSKLESFSAF  134

Query  884   LWKTVAS-GKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKE  1060
             LWK VA+   S+   +  K+GIVVDGR+RL  GDE+KA  +  +FGNVLS P+  + I E
Sbjct  135   LWKQVAAFAASKDRNRISKMGIVVDGRSRLGEGDEDKATAMAYHFGNVLSVPYGSQPIGE  194

Query  1061  LREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV--DGAALVVSS  1234
             L E+PL  VA  VHEFL+ A   +HFLGLIDWVEAHRPEPA+ +V++ V  DG A+VVSS
Sbjct  195   LIEQPLCRVAKQVHEFLKPATNKEHFLGLIDWVEAHRPEPAMTRVYNVVKDDGPAVVVSS  254

Query  1235  GQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIET  1414
             G RFPV K+DFGWG PAFGSYHFPWGG  GYVMPMPSP  +GDW+VYM L K ++E IE 
Sbjct  255   GLRFPVSKMDFGWGCPAFGSYHFPWGGLCGYVMPMPSPVRDGDWVVYMLLLKGQLEQIEK  314

Query  1415  YASHVFKPFTSDHLNF  1462
              A+ VF+P TSD+LN 
Sbjct  315   EAALVFRPLTSDYLNL  330



>ref|XP_004978226.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=456

 Score =   361 bits (927),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 284/465 (61%), Gaps = 39/465 (8%)
 Frame = +2

Query  89    VSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTF  268
             V++T    VA ALPVQE H L  SNLDL+LPP+DVGVFFCY  P  +S   T        
Sbjct  20    VTITAVTTVAPALPVQE-HRLALSNLDLILPPIDVGVFFCYADPGGSSGAATV-------  71

Query  269   GWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD--VELRKLNL  442
                   LKAAL++ LV++Y LAGEV  N AGEPEL+C+ RGVD  +A A    ++R L L
Sbjct  72    ------LKAALAKTLVAYYPLAGEVVANAAGEPELLCSGRGVDVAEASAGDGTDMRDLRL  125

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
               PD+SVE +LVPKKK GV++VQ T+  CGGIVV   FDHRV DAYS NMFLV+W+  A+
Sbjct  126   GLPDESVE-QLVPKKKAGVMAVQVTKFGCGGIVVGCTFDHRVCDAYSFNMFLVAWAAAAR  184

Query  623   AKQLSQLPCFRRSFLFPRRPA--HYDLSLDNMYVPISSLQPEAVEEPKISRIYCVAAEQI  796
                    P FRRSFL PR+PA        D ++VP+S L P   +    +RIY V     
Sbjct  185   GGPAPPAPSFRRSFLAPRQPAPPCTGTLADRLFVPVS-LAPALPDTAAANRIYRV-----  238

Query  797   RELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSI  976
                 S A+  +      P RTKLEAF A LW   A   SRR   +  +G+VVDGRTRL  
Sbjct  239   ----SAADVAALQAAAGPGRTKLEAFTAHLWGLHARAASRRRIGSCCMGVVVDGRTRLRG  294

Query  977   GDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDW  1156
             GD         YFGNVLS P+       LR   L  VA  VH ++ EA TG+HF  L+DW
Sbjct  295   GDGAMGT----YFGNVLSIPYGVMGAGALRGAALADVAGDVHRWVAEAATGEHFRELVDW  350

Query  1157  VEAHRPEPAIPKVH----DCVDGA-ALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS  1321
             VEA RPEP + + +    +  +GA A VVSSG R P+ ++DFGWG+PAF SYHFPW G +
Sbjct  351   VEARRPEPTVARAYLGRGEGGEGATACVVSSGMRLPIGEVDFGWGRPAFASYHFPWPGGA  410

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             GYVMPMPS +G+GDW+VY+H+  E VE +E   + VF+   S ++
Sbjct  411   GYVMPMPSARGDGDWVVYVHVAPEVVEAMEEEPT-VFRALDSGYM  454



>emb|CDX79279.1| BnaC06g20240D [Brassica napus]
Length=340

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/341 (52%), Positives = 229/341 (67%), Gaps = 19/341 (6%)
 Frame = +2

Query  467   GKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAK-QLSQL  643
              KLVP KK GV+++Q T++KCG IVV   FDHRVADAYS NMFLVSW+EI+++   +S +
Sbjct  10    AKLVPIKKHGVIAIQVTQMKCGSIVVGCTFDHRVADAYSMNMFLVSWAEISRSDVPISCV  69

Query  644   PCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAAEQIRELQS  811
             P FRRS L PRRP   D ++D MY+P++SL P + +  P     SR+Y + A+ + +LQ+
Sbjct  70    PSFRRSLLNPRRPLVMDSAIDQMYIPVTSLPPPQEITNPDSILASRLYYIKADALGKLQT  129

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGRTRLSIGDE  985
              A   S  E+K   RTKLE+F AFLWK VA   +R     KN KLGIVVDGR RL   + 
Sbjct  130   LARG-SKMEVK---RTKLESFSAFLWKLVAKHAARDPVLSKNSKLGIVVDGRRRLMEQEN  185

Query  986   NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEA  1165
             N       YFGNVLS PF  + I +L  KPL+WV   VH FLE A+T +HFL LIDWVE 
Sbjct  186   NT------YFGNVLSIPFGGQQIDDLINKPLSWVTEEVHRFLETAVTKEHFLNLIDWVET  239

Query  1166  HRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPM  1339
              RP P + +++     DG A VVSSG+ FPV ++DFGWG P FGSYHFPWGG +GYVMPM
Sbjct  240   RRPTPTVSRIYSTGSEDGPAFVVSSGRSFPVSQVDFGWGSPVFGSYHFPWGGNAGYVMPM  299

Query  1340  PSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             PS   +GDW+VY+HL K +++ IE  AS V KP  +++L  
Sbjct  300   PSSVEDGDWMVYLHLTKGQLKFIEEEASQVLKPIDNNYLKI  340



>ref|XP_002447065.1| hypothetical protein SORBIDRAFT_06g027990 [Sorghum bicolor]
 gb|EES11393.1| hypothetical protein SORBIDRAFT_06g027990 [Sorghum bicolor]
Length=466

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 214/456 (47%), Positives = 275/456 (60%), Gaps = 42/456 (9%)
 Frame = +2

Query  89    VSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTF  268
             V++T    VA ALPVQE H LP SNLDL+LPP+DV VFFCY   A          H    
Sbjct  22    VTITAVSTVAPALPVQE-HRLPLSNLDLILPPIDVSVFFCYVPAAGGRGH----HHPAA-  75

Query  269   GWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD-VELRKLNLY  445
                   LKAAL++ LV++Y LAGEV  N AGEPEL+C+ RGVD  +A AD   L+ L L 
Sbjct  76    -----VLKAALAKTLVAYYPLAGEVVANAAGEPELLCSGRGVDVAEATADGTALQDLRLS  130

Query  446   KPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQA  625
              PD+SVE  LVPKKK GV+SVQ T+ KCGG VV   FDHRV DAYS NMFLV+W+  A+ 
Sbjct  131   LPDESVE-PLVPKKKAGVMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARG  189

Query  626   KQLSQLPCFRRSFLFPRRPAHYDLS-----LDNMYVPISSLQPEAVEEPKISRIYCVAAE  790
                   P F RSFL PR PA    +      D ++VP+S   P   +    +RIYCV+A+
Sbjct  190   GSAPPAPSFHRSFLAPREPAPLSTAGGNNLADRLFVPVSR-APALPDTAAANRIYCVSAD  248

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWK----TVASGKSRRNFKNFKLGIVVDG  958
              +  LQ+ A            RTKLEAF A LW+      A+ + ++  ++  +G+VVDG
Sbjct  249   DVAALQASAGS---------GRTKLEAFTAHLWQLYARAAAASRRQQRCQSCCMGVVVDG  299

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R+RL      +   ++ YFGNVL+ P+       LR   L  VA  VH ++ EA TG+HF
Sbjct  300   RSRL-----RRDGAMEAYFGNVLTIPYGVMGTDALRGMALGDVAGDVHRWVAEAATGEHF  354

Query  1139  LGLIDWVEAHRPEPAIPKVH-----DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
               L+DWVE  RPEP + + +        D  A VVSSG R P+ ++DFGWG+PAF SYHF
Sbjct  355   RELVDWVEEQRPEPTVARAYLGRGYGGEDAMACVVSSGMRLPIGEVDFGWGRPAFASYHF  414

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
             PW G +GYVMPMPS +G+GDW+VY+H   E V ++E
Sbjct  415   PWPGGAGYVMPMPSARGDGDWVVYVHAAPEVVGVME  450



>ref|XP_008668908.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Zea 
mays]
Length=460

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 279/472 (59%), Gaps = 43/472 (9%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQ-KPAAASAQTTTEEHAT  262
              V+V     VA ALP+QE H LP SNLDL+LPP+DVGVFFCY   PA   +         
Sbjct  9     TVTVAAVSTVAPALPMQE-HRLPLSNLDLILPPIDVGVFFCYDADPAGGRSHQPVA----  63

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD-VELRKLN  439
                     LKAAL++ LV++Y LAGEV  N AGEPEL+C+ RGVD  +A AD   LR L 
Sbjct  64    ------AVLKAALAKTLVAYYPLAGEVVANAAGEPELLCSGRGVDVAEAAADGTVLRDLR  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             L  PD+SVE  LVPKKK GV+SVQ T+ KCGG VV   FDHRV DAYS NMFLV+W+  A
Sbjct  118   LGLPDESVE-PLVPKKKAGVMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAA  176

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSL-----DNMYVPISSLQPEAVEEPKISRIYCVA  784
                     PCF RSFL PR PA   L       D ++VP+S   P   +    +RIY V+
Sbjct  177   SGSSAPPAPCFHRSFLAPREPAAAPLRTAGSLADRLFVPVSR-APALPDTATANRIYRVS  235

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLW---KTVASGKSRRNFKNFKLGIVVD  955
             A  +  LQ+ A            RTKLEAF A LW      A+   R+  ++  +G+VVD
Sbjct  236   AADVAALQASAGA---------GRTKLEAFTAHLWGLHAKAAAASRRQQPRSCCMGVVVD  286

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR+RL      +   +  YFGNVL+ P+       L E  L  VA  VH ++ EA TG+H
Sbjct  287   GRSRL-----RRDGAMGAYFGNVLTIPYGVMGTGALGEMALADVAGDVHRWVAEAATGEH  341

Query  1136  FLGLIDWVEAHRPEPAIPKV-----HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
             F  L+DWVEA RPEP + +      H   D  A VVSSG R P+ ++DFGWG+PAF SY 
Sbjct  342   FRELVDWVEAQRPEPTVARAYLGRGHGGEDAMACVVSSGMRLPLGEVDFGWGRPAFASYQ  401

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             FPW G +GYVMPMPS +G+GDW+VY+H   E VE++E   + VF+   S ++
Sbjct  402   FPWPGGAGYVMPMPSARGDGDWVVYVHAALEVVEVMEAEPT-VFRALESSYV  452



>tpg|DAA36101.1| TPA: hypothetical protein ZEAMMB73_105025 [Zea mays]
Length=541

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 226/486 (47%), Positives = 287/486 (59%), Gaps = 44/486 (9%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQ-KPAAASAQTTTEEHAT  262
              V+V     VA ALP+QE H LP SNLDL+LPP+DVGVFFCY   PA   +         
Sbjct  9     TVTVAAVSTVAPALPMQE-HRLPLSNLDLILPPIDVGVFFCYDADPAGGRSHQPVA----  63

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFAD-VELRKLN  439
                     LKAAL++ LV++Y LAGEV  N AGEPEL+C+ RGVD  +A AD   LR L 
Sbjct  64    ------AVLKAALAKTLVAYYPLAGEVVANAAGEPELLCSGRGVDVAEAAADGTVLRDLR  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             L  PD+SVE  LVPKKK GV+SVQ T+ KCGG VV   FDHRV DAYS NMFLV+W+  A
Sbjct  118   LGLPDESVE-PLVPKKKAGVMSVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAA  176

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSL-----DNMYVPISSLQPEAVEEPKISRIYCVA  784
                     PCF RSFL PR PA   L       D ++VP+S   P   +    +RIY V+
Sbjct  177   SGSSAPPAPCFHRSFLAPREPAAAPLRTAGSLADRLFVPVSR-APALPDTATANRIYRVS  235

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLW---KTVASGKSRRNFKNFKLGIVVD  955
             A  +  LQ+ A            RTKLEAF A LW      A+   R+  ++  +G+VVD
Sbjct  236   AADVAALQASAGA---------GRTKLEAFTAHLWGLHAKAAAASRRQQPRSCCMGVVVD  286

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR+RL      +   +  YFGNVL+ P+       L E  L  VA  VH ++ EA TG+H
Sbjct  287   GRSRL-----RRDGAMGAYFGNVLTIPYGVMGTGALGEMALADVAGDVHRWVAEAATGEH  341

Query  1136  FLGLIDWVEAHRPEPAIPKV-----HDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
             F  L+DWVEA RPEP + +      H   D  A VVSSG R P+ ++DFGWG+PAF SY 
Sbjct  342   FRELVDWVEAQRPEPTVARAYLGRGHGGEDAMACVVSSGMRLPLGEVDFGWGRPAFASYQ  401

Query  1301  FPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN*SSTT  1480
             FPW G +GYVMPMPS +G+GDW+VY+H   E VE++E   + VF+   S ++ F+ S   
Sbjct  402   FPWPGGAGYVMPMPSARGDGDWVVYVHAALEVVEVMEAEPT-VFRALESSYV-FDRSVIV  459

Query  1481  VDLHLI  1498
             ++ +LI
Sbjct  460   INANLI  465



>gb|EMT19167.1| Anthranilate N-benzoyltransferase protein 3 [Aegilops tauschii]
Length=456

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 200/433 (46%), Positives = 258/433 (60%), Gaps = 38/433 (9%)
 Frame = +2

Query  197   VFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELI  376
             VFFCY      +A  T    A+T       LKAAL++ LV++Y LAGEV  N AGEPEL+
Sbjct  44    VFFCYAAGDDYAAAGTGSLPAST-------LKAALAKVLVAYYPLAGEVVANAAGEPELL  96

Query  377   CNNRGVDFVQAFAD-VELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVK  553
             C+ RGVDF +A AD VELR+L L  PD+SVE +LVPKKK GV+SVQ T+ KCGG VV   
Sbjct  97    CSGRGVDFAEAAADGVELRELRLGLPDESVE-RLVPKKKSGVMSVQVTKFKCGGAVVGCT  155

Query  554   FDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRP---AHYDLSLDNMYVPI  724
             FDHRV DAYS NMFLV+W+  A+   +   P F RSFL P  P          D ++VP+
Sbjct  156   FDHRVCDAYSFNMFLVAWAAAARGTSIPLPPSFNRSFLAPSSPPPSCTAGTLADRLFVPV  215

Query  725   SSLQPEAVEEPK---ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKT  895
             S + P           +RIY VAA  +  LQ+ A          P RTKLEAF A LW+ 
Sbjct  216   SLVPPPPATAAPPTAFNRIYHVAAADVAALQASAG---------PGRTKLEAFTAHLWQL  266

Query  896   VASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKP  1075
              +   + R   +  +G+VVDGR RL          ++ YFGNVL+ P+      +LR+  
Sbjct  267   YSRAATPRQ-DSCCMGVVVDGRGRL-----RPDGAMRPYFGNVLTIPYGAFGAADLRDMA  320

Query  1076  LNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV--------DGAALVVS  1231
             L  VA  VH ++ EA TG+HF GL+DWVEA RPEP + + +           + A+ VVS
Sbjct  321   LADVADDVHRWVAEAATGEHFQGLVDWVEAQRPEPTVARAYIGGGDDDGSEGETASCVVS  380

Query  1232  SGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
             SG R P  ++DFGWG+PAF SYHFPW G +GYVMPMPS +G GDW+VY+H   E V+++E
Sbjct  381   SGLRLPFGEVDFGWGRPAFASYHFPWPGGAGYVMPMPSARGGGDWVVYVHAAPEVVKVME  440

Query  1412  TYASHVFKPFTSD  1450
                +    P +SD
Sbjct  441   QEPTVFRAPVSSD  453



>ref|NP_001053821.1| Os04g0609300 [Oryza sativa Japonica Group]
 emb|CAE03656.2| OSJNBa0060N03.21 [Oryza sativa Japonica Group]
 emb|CAH67748.1| H0702G05.7 [Oryza sativa Indica Group]
 dbj|BAF15735.1| Os04g0609300 [Oryza sativa Japonica Group]
 gb|EAY95485.1| hypothetical protein OsI_17330 [Oryza sativa Indica Group]
Length=466

 Score =   324 bits (831),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 220/471 (47%), Positives = 283/471 (60%), Gaps = 38/471 (8%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATT  265
              V VT    VA ALPVQE H LP SNLDL+LPP+DVGVFFCY     +         AT 
Sbjct  14    TVKVTSASTVAPALPVQE-HRLPLSNLDLILPPMDVGVFFCYGAGEGSGGGGALLPAATL  72

Query  266   FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFA-DVELRKLNL  442
                     KAAL++ LV++Y LAGEV  N  GE EL+C+ RGVDF +A A D  LR+L L
Sbjct  73    --------KAALAKVLVAYYPLAGEVVANTRGEGELLCSGRGVDFAEATAGDAVLRQLRL  124

Query  443   YKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQ  622
                D+S E KLVPKKK GV+ VQ T+ KCGG VV   FDHRV DAYS NMFLV+W+  A+
Sbjct  125   AVVDESAE-KLVPKKKAGVMCVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAAR  183

Query  623   AKQLSQLPCFRRSFLFPRRPA--HYDLSLDNMYVPISSLQPEAVEEPK-----ISRIYCV  781
                 +  P F RSFL P  PA    D   D ++VP+S +       P+     ++RI+ V
Sbjct  184   GSSAAPAPSFDRSFLAPTSPAPPCPDALSDRLFVPVSCVPAPPSSAPEAAAAAVNRIFRV  243

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK--TVASGKSRRNFKNFKLGIVVD  955
             AA  +  LQ+ A          P RTKLEAF A LW+    A+    R+ ++  +G+VVD
Sbjct  244   AAADVAALQAAAG---------PGRTKLEAFTAHLWQLHARAAASPPRHRRSCCMGVVVD  294

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GRTRL      +   +  YFGNVL+ P+   +  +L   PL  VA  VH ++ EA T DH
Sbjct  295   GRTRL-----RRDGAMGAYFGNVLTIPYGAMSSGDLSAMPLADVAGDVHRWVAEAATRDH  349

Query  1136  FLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
             F GL+DWVE  RPEP++ + +       + AA VVSSG R PV ++DFG G+PAF SYHF
Sbjct  350   FRGLVDWVEQLRPEPSVARAYLGGDGGAEAAACVVSSGMRMPVGEVDFGRGRPAFASYHF  409

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             PW G +GYVMPMPS +G+GDW+VY+H   E V+ +E   + VF+   SD++
Sbjct  410   PWPGGAGYVMPMPSARGDGDWVVYVHAAAEVVKAMEEEETTVFRALESDYV  460



>ref|NP_001150771.1| transferase [Zea mays]
 gb|ACG40329.1| transferase [Zea mays]
 gb|AFW59399.1| transferase [Zea mays]
Length=448

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 214/470 (46%), Positives = 276/470 (59%), Gaps = 53/470 (11%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATT  265
             +V+VT    V  ALPVQ+ H LP SNLDLLLPP+DV +FFCY  PA  +           
Sbjct  15    DVTVT----VEPALPVQQ-HRLPLSNLDLLLPPLDVSLFFCYLHPAPTAI----------  59

Query  266   FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQ-AFADVELRKLNL  442
                    LK AL++ LV++Y LAGEV  N  GEPEL+C+ RGVDF + A A VELR++ L
Sbjct  60    ------ALKEALAKTLVAYYPLAGEVVANGDGEPELLCSGRGVDFTETAAAGVELREVRL  113

Query  443   YKPDDSVEGKLVPKKKQGV-LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
                D+ VE KLVP KK GV ++V+ ++  CGG VV   FDHRV DAYS NMFLV+W+  A
Sbjct  114   GAVDEGVE-KLVPVKKTGVTMAVKLSKFTCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAA  172

Query  620   QAKQLSQLP--CFRRSFLFPRRPAH-----YDLSLDNMYVPISSLQPEAVEEP-KISRIY  775
             +       P  CFRRS + PR   H      D  ++ ++ P S+  P        ++RIY
Sbjct  173   RGSSAPPPPDPCFRRSLVAPRDTPHRRAPSTDALINRLFSPRSAAPPPPPAAAGSVNRIY  232

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVD  955
              +AAE I  L++ A          P RTK+EAF A LW+  A   S R      +G+VVD
Sbjct  233   RIAAEDIAALKASAG---------PGRTKMEAFTALLWQLCARAASPRQ-SQCCMGVVVD  282

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GRTR+      KA     YFGNVL+ P+     ++LR   L  VA  VH ++ EA TGDH
Sbjct  283   GRTRMFPDGAMKA-----YFGNVLTIPYGVIGSEDLRCMALADVADDVHRWVAEAATGDH  337

Query  1136  FLGLIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
             F GL+DWVEA RP+PA  + +    G     A +VSSG  FPV K DFG G PAF SYHF
Sbjct  338   FRGLVDWVEALRPKPAAARAYLGGTGGNEAMACIVSSGMSFPVGKADFGTGLPAFASYHF  397

Query  1304  PWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             PW   +GYVMPMPS +GNGDW+VY+H+  E  +++E   S VF+   + +
Sbjct  398   PWPAGAGYVMPMPSARGNGDWVVYVHVAPEVAKVMEE--STVFQALVNSY  445



>ref|XP_003581633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=467

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 205/481 (43%), Positives = 279/481 (58%), Gaps = 47/481 (10%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
              +N + + T    VA ALP+QE H L  SNLDLLLPP++V VF CY +PA  +A      
Sbjct  11    GANNDPAATTTTRVAPALPLQE-HRLAVSNLDLLLPPLEVSVFLCYAQPAPTAAALKEAL  69

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                                LV +Y LAGEV  +  GEPEL+C+ RGVDF +A    EL++
Sbjct  70    AKV----------------LVPYYPLAGEVVASAHGEPELLCSGRGVDFTEAVGGSELKE  113

Query  434   LNLYKPDDSVEGKLVPKKK-QGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV--S  604
             L L   D+ V+ +LVP KK  GV+SVQ T+ +CGGIVV   FDHRV DAYS N+FLV  +
Sbjct  114   LRLGLVDEGVQ-RLVPAKKLAGVVSVQVTKFRCGGIVVGCTFDHRVCDAYSFNLFLVAWA  172

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPA----HYDLSLDNMYVPISSLQPEAVEEPK---I  763
              +           P FRRS L PR P+      D  +D ++ P+SS+ P+     K   +
Sbjct  173   AAARGGGGPTPPAPTFRRSLLAPRDPSPRTNSTDALIDRLFSPLSSVPPQQAPPSKATAV  232

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLW----KTVASGKSRRNFKN  931
             +RIY ++A  I  LQ+ A          P RTKLE+F A LW    K+ A+ ++ +  K 
Sbjct  233   NRIYRISAADISALQAAAG---------PGRTKLESFTAHLWQLCSKSSAAAQAEQAQKL  283

Query  932   FKLGIVVDGRTRLSIGDE-NKAKFLQGYFGNVLSFPFEEKTIKELREK-PLNWVASAVHE  1105
               +G+VVDGR+R+S  DE N  + ++ YFGNVL+ P+   +  +LR +  L  VA  VH 
Sbjct  284   CCMGMVVDGRSRMSCSDEYNGDEAMKRYFGNVLTIPYGVISADDLRRRMTLAEVARDVHR  343

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGW  1273
             ++ EA T DHF GL+DWVEA RP PA  + +       D  A +VSSG  FPV ++DFG 
Sbjct  344   WVREAATADHFRGLVDWVEALRPRPAAARAYLGGTGGADATACIVSSGMGFPVGRLDFGT  403

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             G+PAF SYHFPW   +GYVMPMPS +G+GDW+VY+H   E V ++E     VF+   + +
Sbjct  404   GRPAFASYHFPWPAGAGYVMPMPSARGDGDWVVYVHAAPELVRVLEEEEHTVFRALENSY  463

Query  1454  L  1456
             +
Sbjct  464   V  464



>emb|CDY38115.1| BnaC02g06580D [Brassica napus]
Length=333

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 222/343 (65%), Gaps = 30/343 (9%)
 Frame = +2

Query  278   VNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
             ++ LK +L+EALVS+Y LAGEV  N + GEPE++CNN GV+ V+A ADVELR+LNL+ P 
Sbjct  1     MDALKRSLAEALVSYYVLAGEVVANPITGEPEILCNNGGVEVVEAAADVELRELNLHDPY  60

Query  455   DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAK-Q  631
              S+  K VP K  GV ++Q TELKCG +VV   FDHR+ADAYS NMFL SW++I+++   
Sbjct  61    QSL-AKFVPMKVHGVFAIQITELKCGSLVVGCTFDHRIADAYSMNMFLHSWAQISRSDVP  119

Query  632   LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAVEEPK---ISRIYCVAAEQIR  799
              S +P F RS L PRRP   D S+D MY+P++SL  P+    P     SRIY + A+ +R
Sbjct  120   TSYMPSFNRSLLNPRRPLVIDSSVDQMYMPVTSLPLPQETTNPDNILTSRIYYIKADVVR  179

Query  800   ELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA---SGKSRRNFKNFKLGIVVDGRTRL  970
             ELQ+ A +         +RTKLE+F AFLWK VA   +  +     N KLGIVVDGR +L
Sbjct  180   ELQTLAGN--------GKRTKLESFSAFLWKLVAKHAATTTDSKLLNSKLGIVVDGRKKL  231

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
             +  + N       YFGNVLS PF E+ I +L  K L+WVA  VH+ LE ++T DHFL LI
Sbjct  232   TEQETNT------YFGNVLSVPFGEQIIDDLTHKSLSWVADEVHKVLESSVTRDHFLNLI  285

Query  1151  DWVEAHRPEPAIPKVHDC--VDGAALVVSSGQRFPVRKIDFGW  1273
             DW+E  RP P + +++     +G A VVSSG+ FPV     GW
Sbjct  286   DWIETRRPVPVLSRIYGTGSEEGPAFVVSSGKSFPVT----GW  324



>ref|XP_002447068.1| hypothetical protein SORBIDRAFT_06g028020 [Sorghum bicolor]
 gb|EES11396.1| hypothetical protein SORBIDRAFT_06g028020 [Sorghum bicolor]
Length=457

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 211/468 (45%), Positives = 268/468 (57%), Gaps = 52/468 (11%)
 Frame = +2

Query  113   VAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLK  292
             VA ALPVQE H LP SNLDLLLPP+DV +FFCY  PA  +A        T          
Sbjct  20    VAPALPVQE-HRLPLSNLDLLLPPLDVSLFFCYLHPAPTAAALKEALAKT----------  68

Query  293   AALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQ--AFADVELRKLNLYKPDDSVE  466
                   LV++Y LAGEV  N  GEPEL+C+ RGVDF +  A   VELR++ L   D+ VE
Sbjct  69    ------LVAYYPLAGEVVANGDGEPELLCSGRGVDFTETTAAGGVELREIRLGAVDEGVE  122

Query  467   GKLVPKKKQG-VLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQL  643
              KLVP KK   V +V+ T+ +CGG VV   FDHRV DAYS NMFLV+W+  A+       
Sbjct  123   -KLVPAKKAASVTAVKVTKFRCGGAVVGCTFDHRVCDAYSFNMFLVAWAATARGSSAPPP  181

Query  644   PC--FRRSFLFPR------RPAHYDLSLDNMYVPISSLQPEAVE-----EPKISRIYCVA  784
             P   FRRS + PR      R    D  +D ++ P S+  P            ++RIY +A
Sbjct  182   PAPSFRRSLVAPRDDPTHERAPSTDALIDRLFSPRSAAPPPPPPAAAAGRRSVNRIYRIA  241

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  I  L++ A          P RTKLEAF A LWK  +   S        +G+VVDGRT
Sbjct  242   AADIAALKASAG---------PGRTKLEAFTAHLWKLCSRAASSPRQSQCCMGVVVDGRT  292

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+S G   KA     YFGNVL+ P+     ++LR   L  VA  VH ++ EA TGDHF G
Sbjct  293   RMSPGGAMKA-----YFGNVLTIPYGVIGSEDLRRMALADVAGDVHRWVAEAATGDHFRG  347

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L+DWVEA RP+PA  + +    G     A +VSSG  FPVRK+DFG G PAF SYHFPW 
Sbjct  348   LVDWVEALRPKPAAARAYLGGTGGNEAMACIVSSGMTFPVRKVDFGTGLPAFASYHFPWP  407

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
               +GYVMPMPS +G+GDW+VY+H+  E  +++E   S VF+   + ++
Sbjct  408   AGAGYVMPMPSARGDGDWVVYVHVAPEVAKVMEEEESTVFQALENSYV  455



>gb|EMT02774.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=449

 Score =   308 bits (790),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 268/454 (59%), Gaps = 46/454 (10%)
 Frame = +2

Query  89    VSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTF  268
             V++     VA ALP+QE H LP SNLDLLLPP+DVGVFFCY  PA  +A           
Sbjct  13    VTIMSATTVAPALPLQE-HRLPLSNLDLLLPPIDVGVFFCYLHPAPTAAALKEAL-----  66

Query  269   GWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFA-DVELRKLNLY  445
                        ++ LV+++ LAGEV  N  GEPEL+CN RGVDF +A A D ELR+L L 
Sbjct  67    -----------AKVLVAYHPLAGEVVANGDGEPELLCNCRGVDFTEASAGDTELRELRLG  115

Query  446   KPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQA  625
               D+ V+ KLVP KK GV+S+Q T+ KCGG VV   FDHRV DAYS NMFLV+W+  A+ 
Sbjct  116   IVDEGVD-KLVPSKKAGVISLQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARG  174

Query  626   KQLSQLPCFRRSFLFPRRPAHYDLS----LDNMYVPISSLQPEAVEEPKI---SRIYCVA  784
               +   P FRRS + PR P+    +    +D ++ P+SS  P           +RIY +A
Sbjct  175   GSVPPAPTFRRSLVSPRDPSPRTYATNALIDRLFSPLSSAPPPPPATVAATAVNRIYRIA  234

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  +  LQ+ A          P RTKLEAF A LW+  +   S    +   +G+VVDGR 
Sbjct  235   AADVAALQATAG---------PGRTKLEAFTAHLWQLCSMSASAHQ-RLCCMGMVVDGRA  284

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREK-PLNWVASAVHEFLEEALTGDHFL  1141
             R+S     KA     YFGNVL+  +   +  +LR +  L  VA  VH+++ EA T +HF 
Sbjct  285   RMSPDGAMKA-----YFGNVLTITYGVNSSDDLRRRMTLADVADDVHQWVREAATDEHFR  339

Query  1142  GLIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             GLIDWVEA RP PA  + +    G     A +VSSG  FPVR+I+FG G PAF SYHFPW
Sbjct  340   GLIDWVEALRPNPAAARAYLGGTGGTKATACIVSSGMSFPVREINFGTGLPAFASYHFPW  399

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
                + YVMPMPS +G+G+W+VY+H   E VE++E
Sbjct  400   PAGAAYVMPMPSARGDGEWVVYVHAAPELVEVME  433



>ref|XP_003581632.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=467

 Score =   306 bits (785),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 211/461 (46%), Positives = 270/461 (59%), Gaps = 44/461 (10%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
                +V     VA ALP+QE H LP SNLDLLLPP+DVGVFFCY     AS     ++  +
Sbjct  17    ITTAVASTWTVAPALPLQE-HRLPLSNLDLLLPPIDVGVFFCY-----ASGNGNDDDVPS  70

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFA-DVELRKLN  439
                     LKAAL++ LV +Y LAGEV    AGEPEL+C+ RGVDF +A A   ELR++ 
Sbjct  71    A-----LALKAALAKVLVPYYPLAGEVVATAAGEPELLCSGRGVDFTEATAAGAELRQVR  125

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             L  PD+S + KLVP KK GV+SVQ T+ KCGG VV   FDHRV DAYS NMFLV+W+  A
Sbjct  126   LSMPDESAD-KLVPAKKSGVMSVQFTKFKCGGAVVGCVFDHRVCDAYSFNMFLVAWANAA  184

Query  620   Q--AKQLSQLPCFRRSFLFPRR--PAHYDLSLDNMYVPISSLQPEAVEEP------KISR  769
             +  +  +S  P F RSFL PR    +  D   D ++VP+S + P +            +R
Sbjct  185   RGGSSSVSPAPSFDRSFLAPRNGISSSVDTLADRLFVPVSRVPPPSTSAAPAAATEAFNR  244

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK---TVASGKSRRNFKNFKL  940
             IY V         S A+  +      P RTKLEAF A LW+     A    RR      +
Sbjct  245   IYHV---------SAADVAALQAAAGPGRTKLEAFTAHLWQLYAMAADTSDRRPSCRVSM  295

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             G+VVDGR+RL          +  YFGNVL+ P+      +LR   L  VA+ VH ++ EA
Sbjct  296   GVVVDGRSRL-----RPDGAMGAYFGNVLTIPYGILGAGDLRGMALADVAADVHGWVSEA  350

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSGQRFPVRKIDFGWGKPAFG  1291
              +G+ F GL++WVEAHRPEP + + +      D    VVSSG R PV ++DFG G+PAF 
Sbjct  351   ASGERFRGLVEWVEAHRPEPTVARAYLGAGESDSMVCVVSSGMRLPVGEVDFGTGRPAFA  410

Query  1292  SYHFPWGGQSGYVMPMPSPK-GNGDWIVYMHLQKEKVELIE  1411
             SYHFPW G +GYVMPMPS + G+GDW+VY+H   E V  +E
Sbjct  411   SYHFPWPGGAGYVMPMPSARAGSGDWVVYVHAAPELVRAME  451



>gb|ACU24086.1| unknown [Glycine max]
Length=302

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 201/307 (65%), Gaps = 22/307 (7%)
 Frame = +2

Query  590   MFLVSWSEIAQAKQ--LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL------QPEA  745
             MFLVSW+EIAQ+ +  +S  P F RS   PR P  +  SL ++YV IS+L      +P  
Sbjct  1     MFLVSWAEIAQSNKPIISIQPSFARSLFIPRNPPSFHSSLHDLYVSISALPRPSDPKPGF  60

Query  746   VEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF  925
               EP I+RIY V  E +  +Q  A   S++ +K   RTKLE+F AFLWK VA   + +  
Sbjct  61    QSEPLINRIYYVTGENLNLMQELA---SSNGVK---RTKLESFSAFLWKVVAEAAAAKVK  114

Query  926   KNF----KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVAS  1093
                    K+G+VVDGR RLS GD+NK   +  YFGNV+S P+  K ++EL EKPL+WVA 
Sbjct  115   GKKNLVAKMGVVVDGRKRLSNGDKNKEAIMGSYFGNVVSIPYGGKPVEELMEKPLSWVAE  174

Query  1094  AVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKV---HDCVDGAALVVSSGQRFPVRKID  1264
              VHEFLE  LT +HFLGL+DWVE HRP P + ++   H   +G + VVSSGQRFP  K+D
Sbjct  175   KVHEFLEIGLTEEHFLGLVDWVEVHRPAPGLSRIYCGHGKEEGPSFVVSSGQRFPESKVD  234

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWGKP F SYHFPWGG SGYVMPMPS  GNGDW+VYMHL +  +  +E  A  +F PF+
Sbjct  235   FGWGKPVFASYHFPWGGDSGYVMPMPSSTGNGDWLVYMHLLEAHLNFMEVRAPQIFWPFS  294

Query  1445  SDHLNFN  1465
              D+ +FN
Sbjct  295   RDY-HFN  300



>gb|KCW74058.1| hypothetical protein EUGRSUZ_E02684 [Eucalyptus grandis]
Length=315

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 199/320 (62%), Gaps = 35/320 (11%)
 Frame = +2

Query  590   MFLVSWSEIAQ-AKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI-  763
             MF+V W+E A+ A  +S  P FRRS L PR P  +D SLD MY+P+S+L P    + ++ 
Sbjct  1     MFMVFWAETARSAAPISLPPSFRRSLLNPRHPLCFDPSLDRMYIPVSALPPPLKHKLQVD  60

Query  764   ---------------SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTV  898
                            SR+Y V   ++ ELQ  A    +      +RTKLE+F AFLW+ V
Sbjct  61    EQCETMTLRDDDHLLSRLYYVTNAKLSELQQSACSNGS------KRTKLESFSAFLWRMV  114

Query  899   AS----GKSRRNFKNFKLGIVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKEL  1063
             A       +  N    ++GIVVDGR RL S G ++K   +  YFGNVLS PF EK  +E+
Sbjct  115   AESSLVADNDDNKTMSRMGIVVDGRCRLMSQGKDDKPTPMSSYFGNVLSVPFGEKRAREV  174

Query  1064  REKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKV-------HDCVDGAAL  1222
              EKPL+WVA  VHEF+E A   +HFL LIDWVE HRP PA+ ++        +     AL
Sbjct  175   VEKPLSWVADVVHEFVESAAKKEHFLDLIDWVEGHRPVPALARIFCKPGSEEEEEGSTAL  234

Query  1223  VVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVE  1402
             VVSSGQRFPV ++DFGWGKP  GSYHFPWGG++GYVMPMPSP  NGDW+VY+HL + +V 
Sbjct  235   VVSSGQRFPVTEMDFGWGKPMLGSYHFPWGGKAGYVMPMPSPLSNGDWVVYLHLSRSQVA  294

Query  1403  LIETYASHVFKPFTSDHLNF  1462
              IE++A  VF+P T  HLN 
Sbjct  295   FIESHAPTVFRPLTPHHLNL  314



>ref|XP_004976754.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=444

 Score =   298 bits (762),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 265/453 (58%), Gaps = 48/453 (11%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATT  265
             +V+VT    VA ALPVQ  H LP SNLDLLLPP+DV +FFCY  PA  +A        T 
Sbjct  13    DVTVT----VAPALPVQG-HRLPLSNLDLLLPPLDVSLFFCYLHPAPTAAALKEALAKT-  66

Query  266   FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDF-VQAFADVELRKLNL  442
                            LV++Y LAGEV  N  GEPEL+C+ RGVDF V   A V+LR++ L
Sbjct  67    ---------------LVAYYPLAGEVVANADGEPELLCSGRGVDFTVATAAGVDLREIRL  111

Query  443   YKPDDSVEGKLVP-KKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
                D+SVE KLVP KK  GV++V+ T+ +CGG VV   FDHRV DAYS NMFLV+W+  A
Sbjct  112   GAVDESVE-KLVPVKKAGGVVAVKVTKFRCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAA  170

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLS----LDNMYVPISSLQPEAVEE-PKISRIYCVA  784
             +       P FRRS   PR P     S    +D ++ P S+  P        ++RIY +A
Sbjct  171   RGGPAPPAPSFRRSLAAPRDPPPRAPSTEALIDRLFSPRSAALPPPPVAASSVNRIYRIA  230

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  +  L++ A          P RTK+EAF A LW+  +   SRR      +G+VVDGRT
Sbjct  231   AADVAVLKAAAG---------PGRTKMEAFTAHLWRLCSRAASRRQ-SQCCMGVVVDGRT  280

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+      KA     YFGNVL+ P+     +ELR   L  VA  VH ++ EA TGDHF G
Sbjct  281   RMFPDGAMKA-----YFGNVLTIPYGVIGSEELRRMALADVADDVHRWVVEAATGDHFRG  335

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             L+DWVEA RP+PA  + +    G     A +VSSG  FPV K DFG G PAF SYHFPW 
Sbjct  336   LVDWVEALRPKPAAARAYLGGTGGSEAMACIVSSGMSFPVGKADFGTGLPAFASYHFPWP  395

Query  1313  GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
               +GYVMPMPS +G+GDW+VY+H+  E  +++E
Sbjct  396   AGAGYVMPMPSARGDGDWVVYVHVAPELAKVME  428



>emb|CBI33414.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   289 bits (739),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 191/255 (75%), Gaps = 12/255 (5%)
 Frame = +2

Query  80   NFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
            +F V+V++ EVVAA LPVQE ++LP SNLDLLLPPVDVGVFFCY+KP           H 
Sbjct  5    DFTVTVSRKEVVAAVLPVQE-YWLPTSNLDLLLPPVDVGVFFCYKKP-----------HD  52

Query  260  TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
             TFG M+  LK AL++ALVS+Y  AGEV  N AGEPEL+CNNRGVDF++A+ADV+L+ LN
Sbjct  53   LTFGSMIGVLKEALAQALVSYYPFAGEVLSNSAGEPELLCNNRGVDFMEAYADVQLQNLN  112

Query  440  LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
            LY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAYSANMFLVSW+E+A
Sbjct  113  LYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAYSANMFLVSWAEMA  172

Query  620  QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVAAEQIR  799
            Q+K LS LP FRRS L PRRP  YD SLDNMYVP+S+L P    +P +        + I 
Sbjct  173  QSKPLSVLPSFRRSLLNPRRPGSYDPSLDNMYVPMSALPPPKAPQPVLFCGRWWPKKTIN  232

Query  800  ELQSQANHYSADELK  844
            EL+ +   + AD ++
Sbjct  233  ELKEKPLSWVADAIR  247


 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  1037  FEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC--VD  1210
             + +KTI EL+EKPL+WVA A+ E+LE A+T +HFLGLIDWVEAHRPEPA+ K+++    D
Sbjct  226   WPKKTINELKEKPLSWVADAIREYLEGAVTKEHFLGLIDWVEAHRPEPALAKIYNSGSRD  285

Query  1211  GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQK  1390
             G A VVSSGQRFPV ++DFGWG PA GSYHFPWGG++GYVMPMPSP  +GDW+VYMHL  
Sbjct  286   GPAFVVSSGQRFPVSRVDFGWGMPALGSYHFPWGGEAGYVMPMPSPVRDGDWVVYMHLSV  345

Query  1391  EKVELIETYASHVFKPFTSDHLNFN  1465
              ++E IET A+H+F+P  S++LN +
Sbjct  346   GQIEWIETQAAHIFRPLNSEYLNLS  370



>ref|XP_008245067.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Prunus 
mume]
Length=341

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 214/362 (59%), Gaps = 71/362 (20%)
 Frame = +2

Query  404   QAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYS  583
             +AFADVEL+ LNLY PD+S+EGKLVPKKK GVL+VQATELKCGG+VVA  FDHR+ADAYS
Sbjct  39    EAFADVELKDLNLYDPDESIEGKLVPKKKHGVLAVQATELKCGGMVVACSFDHRIADAYS  98

Query  584   ANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP-----EAV  748
              NMFLVSW+E+AQ+K LS LP FRRS L PRRP H D SL++MYVPI++L P     +  
Sbjct  99    TNMFLVSWAEMAQSKSLSLLPTFRRSLLNPRRPGHIDPSLNDMYVPITALPPPKNDTDVD  158

Query  749   EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF-  925
             ++  ISRIY V AEQ+  LQ+ A   S++  K   RTKLE+FCAFLWK VA   ++    
Sbjct  159   QDHLISRIYYVTAEQLDNLQALA---SSNGFK---RTKLESFCAFLWKMVAKSDTKIGCA  212

Query  926   -KNFKLGIVVDGRTRLSIGD---ENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVAS  1093
              K  K+GIVVDGRTRLS  +    ++A  +  YFGN+ S   EE            +V S
Sbjct  213   QKLCKMGIVVDGRTRLSERENYRSHQASHMATYFGNIYSSGSEEGPA---------FVVS  263

Query  1094  AVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGW  1273
             +   F                            V     G  L V     FP       W
Sbjct  264   SGQRF---------------------------PVSKVDFGWGLPVFGSYHFP-------W  289

Query  1274  GKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDH  1453
             G            G +GYVMPMPSP   GDWIVYMH+ K ++ELIE  A+HVF+P T D+
Sbjct  290   G------------GNAGYVMPMPSPARKGDWIVYMHIFKGQLELIEKEAAHVFRPLTFDY  337

Query  1454  LN  1459
             L+
Sbjct  338   LS  339



>ref|XP_006851033.1| hypothetical protein AMTR_s00025p00227780, partial [Amborella 
trichopoda]
 gb|ERN12614.1| hypothetical protein AMTR_s00025p00227780, partial [Amborella 
trichopoda]
Length=311

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 198/325 (61%), Gaps = 26/325 (8%)
 Frame = +2

Query  515   TELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYD  694
             T+LKCG IVVA  FDHRVADAYSANMFL+SW++ AQ+   S LP F RS L PRR   Y 
Sbjct  2     TKLKCGSIVVACTFDHRVADAYSANMFLISWAQTAQSNPPSMLPSFERSLLSPRRQGSYT  61

Query  695   LSLDNMYV-----PISSLQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRT  859
             +S D M++     PIS+L      + + SRIY + A+ I  LQ++A+           RT
Sbjct  62    VSHDCMFMEESFQPISTLS----NDRRCSRIYYIKAKDIHLLQARASSNGQ------HRT  111

Query  860   KLEAFCAFLWKTVASGKSRRNFKNFK--LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSF  1033
             KLE+F   LW+ +A+        N K  LGI+VDGR+RL  G       + GYFGNVL+ 
Sbjct  112   KLESFATLLWQILAAKPKLAGNSNKKCGLGIMVDGRSRLGPG-------MSGYFGNVLAS  164

Query  1034  PFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCV  1207
             PF E    ELR  P N VA  VHEFL      D F GL+DWVE H P+P +P V+  +  
Sbjct  165   PFMEAEASELRAMPFNQVAGLVHEFLIGVTNNDFFKGLVDWVEMHWPKPMLPAVYFKNEA  224

Query  1208  DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQ  1387
             +  A+++SSG RFPV  +DF WG P F S HFPWGG SGYVMP+ S  G+GDW+V+MHL 
Sbjct  225   EVPAVLLSSGLRFPVSDVDFSWGGPVFASIHFPWGGTSGYVMPVMSALGDGDWVVFMHLP  284

Query  1388  KEKVELIETYASHVFKPFTSDHLNF  1462
             + ++E++E     V  P T+ +L  
Sbjct  285   EGQMEVVEAELGEVLHPMTASYLKL  309



>emb|CBI33412.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 171/245 (70%), Gaps = 11/245 (4%)
 Frame = +2

Query  194  GVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPEL  373
             VFFCY+ P     Q+    H  +FG MV  LK A+S+ALVS+YA +GEV  N AGEPEL
Sbjct  131  SVFFCYKNP---HDQSVNGRHGFSFGSMVGALKIAMSQALVSYYAFSGEVVSNSAGEPEL  187

Query  374  ICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVK  553
            +CNNRGVDF++A ADV L  LNLY PD S+EGKLVPKK+ GVLSVQ TELKC G+VVA  
Sbjct  188  LCNNRGVDFMEAHADVRLENLNLYNPDVSIEGKLVPKKENGVLSVQVTELKCSGVVVACT  247

Query  554  FDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSL  733
            FDHR+ADAYSANMFLVSW+E+AQ+K LS  P FRRS L  RRP  YD S DNMYVPIS+L
Sbjct  248  FDHRIADAYSANMFLVSWAEMAQSKPLSVTPAFRRSLLNTRRPGSYDPSFDNMYVPISAL  307

Query  734  QPEAVEEPK----ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA  901
             P    +P     +SR+Y V AEQ+  LQ  A   S+      +RTKLE+  AFLWK VA
Sbjct  308  PPSKAPQPSADPLMSRLYYVTAEQLSLLQMLATSKSSSC----KRTKLESLSAFLWKMVA  363

Query  902  SGKSR  916
               +R
Sbjct  364  KKDNR  368



>ref|NP_001053822.1| Os04g0609500 [Oryza sativa Japonica Group]
 emb|CAE03556.1| OSJNBa0085I10.1 [Oryza sativa Japonica Group]
 emb|CAE03657.2| OSJNBa0060N03.22 [Oryza sativa Japonica Group]
 emb|CAH67749.1| H0702G05.8 [Oryza sativa Indica Group]
 dbj|BAF15736.1| Os04g0609500 [Oryza sativa Japonica Group]
 gb|EAY95486.1| hypothetical protein OsI_17331 [Oryza sativa Indica Group]
Length=457

 Score =   285 bits (729),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 180/418 (43%), Positives = 228/418 (55%), Gaps = 50/418 (12%)
 Frame = +2

Query  197   VFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELI  376
             VF CY+ PA ++A                          V FY LAGEV  N  GEPEL+
Sbjct  49    VFLCYRHPAPSAAALKEALAKAL----------------VPFYPLAGEVVANGDGEPELL  92

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQG-VLSVQATELKCGGIVVAVK  553
             C+ RGVDF ++ A  E+R L +   D+ VE KLVP KK   V++VQ T+ KCGG VV   
Sbjct  93    CSGRGVDFTESVAGEEMRGLRIGMVDERVE-KLVPAKKAASVMAVQVTKFKCGGAVVGCT  151

Query  554   FDHRVADAYSANMFLVSWSEIAQ-------AKQLSQLPCFRRSFL-----FPRRPAHYDL  697
             FDHRV DAYS NMFLV+W+  A+       A     +P FRRS +      P R    D 
Sbjct  152   FDHRVCDAYSFNMFLVAWAAAARDGHGGGTAPPPPTIPSFRRSIVAPRDPPPPRSPSTDA  211

Query  698   SLDNMYVPISS--LQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEA  871
              +D ++ P+ S    P+      ++RIY VAA     LQ  A          P RTKLEA
Sbjct  212   LIDRLFAPLGSAPPPPDDAAAAAVNRIYRVAAADAASLQDSAG---------PGRTKLEA  262

Query  872   FCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKT  1051
             F A LW+  A   +    +   +G+VVDGR R+      +A     YFGNVL+ P+    
Sbjct  263   FTAHLWQLNARAAAAERERPCCMGVVVDGRGRMFPDGAMRA-----YFGNVLTIPYGVMG  317

Query  1052  IKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAA  1219
               ELR   L  VA  VH ++ EA TGDHF GL+DWVEA RP+PA  + +       D AA
Sbjct  318   SGELRAAALADVAGDVHRWVAEAATGDHFRGLVDWVEARRPKPAAARAYLGGTGGGDAAA  377

Query  1220  LVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKE  1393
              +VSSG  FPV + DFG G PAF SYHFPW   +GYVMPMPS +G+GDW+VY+H+  E
Sbjct  378   CIVSSGMGFPVGEADFGTGAPAFASYHFPWPAGAGYVMPMPSARGDGDWVVYVHVSPE  435



>ref|XP_009603648.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nicotiana 
tomentosiformis]
Length=455

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 249/469 (53%), Gaps = 24/469 (5%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A N ++ VS+ +  VV A  P+ EP  L  SNLDLL     V  F+ Y K          
Sbjct  6     ARNGDYAVSIIRKSVVKATGPIPEPRILTLSNLDLLSGRFPVTYFYVYHK----------  55

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
              +H  +   + + LK +L+  L  FY  AG +  N    EPE++C+N G  F+ A A + 
Sbjct  56    AKHNDSSASVADELKNSLANCLSHFYPFAGRIIPNPETNEPEILCDNTGALFLVAQASIS  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L +L+ Y  +  +EGKLVP  ++  + VQ T  +CGGI +   FDH + DA S   FL+ 
Sbjct  116   LNQLDFYNLNKCLEGKLVPIHEEFPVQVQLTNYECGGIFITFTFDHALGDASSFTKFLLM  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYC  778
             WSEIA+ K LS  P  RR  L  R P  Y+ S D  ++  S      +  P   + R+Y 
Sbjct  176   WSEIARKKPLSFSPDHRRYLLRARYPPIYNRSFDKSFISCSLHDILHISTPSTLLKRLYY  235

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  I  LQ  A+      L   +RTK+EAF A++WK +     + + K  K+G +VDG
Sbjct  236   IDASNIDRLQKLAS------LDGTKRTKIEAFSAYIWKIMVKAIDKGHSKKCKMGWLVDG  289

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTR+     N  K ++ Y GN LS    E ++ E+ +  +  VA+ VH  + +  + +HF
Sbjct  290   RTRIC----NTEKVMENYIGNALSIAVGEASVNEIEQASIANVANNVHNAISKVTSAEHF  345

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS-YHFPWGG  1315
             L LIDW+E ++P   + K+     G A+VVSSG+RFPV ++DFG+G P  G+ Y      
Sbjct  346   LDLIDWIECNKPGLVLAKIVLGQGGPAIVVSSGRRFPVAEVDFGFGSPVVGTVYSTIQKL  405

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               GY+   P  KG+G W +   L  E +E +E+ + HVF+P TS+HL  
Sbjct  406   GVGYINQRPGAKGDGSWTISAILWPEMIEALESDSEHVFQPMTSNHLKL  454



>gb|KFK22997.1| hypothetical protein AALP_AAs66525U000100 [Arabis alpina]
Length=256

 Score =   273 bits (699),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 180/264 (68%), Gaps = 20/264 (8%)
 Frame = +2

Query  692   DLSLDNMYVPISSLQP-EAVEEPK---ISRIYCVAAEQIRELQSQANHYSADELKHPRRT  859
             D S+D MYVP++SL P +    P    +SRIY + A+ + ELQ+ A   S  E+K  +RT
Sbjct  2     DSSIDEMYVPVTSLPPPQETTNPDNILVSRIYYIKADALEELQALA---SGSEIKD-KRT  57

Query  860   KLEAFCAFLWKTVASGKSRRNF--KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSF  1033
             K+E+F A LWK VA   ++  F  KN KLGIVVDGR R      N       YFGNVLS 
Sbjct  58    KIESFSALLWKLVAKHAAKDPFPSKNSKLGIVVDGRRRFMEQQTNT------YFGNVLSI  111

Query  1034  PFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV--  1207
             PF  + I +L  KPL+WV + VH+FLE ++T DHFL LIDWVEAHRP PA+ +++ C   
Sbjct  112   PFGGQRINDLINKPLSWVTTEVHKFLESSVTKDHFLNLIDWVEAHRPTPALSRIY-CTGA  170

Query  1208  -DGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHL  1384
              DG A+VVSSG+ FPV ++DFGWG P FGSYHFPWGG +GYVMPMPS   +GDW+VY+HL
Sbjct  171   DDGPAIVVSSGRSFPVTRVDFGWGSPVFGSYHFPWGGSAGYVMPMPSSVDDGDWMVYLHL  230

Query  1385  QKEKVELIETYASHVFKPFTSDHL  1456
              K +++ IE  ASHVFKP  +D+L
Sbjct  231   TKGQLKFIEEEASHVFKPIDNDYL  254



>ref|XP_009766130.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nicotiana 
sylvestris]
Length=454

 Score =   280 bits (716),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 249/469 (53%), Gaps = 25/469 (5%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A N ++ VS+ +  VV A  P+ EP  L  SNLDLL     V  F+ Y K          
Sbjct  6     ARNGDYTVSIIRKSVVKAIGPIPEPRILTLSNLDLLSGRFPVTYFYVYHK----------  55

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
              +H  +   +V+ L+ +L+  L  FY  AG +  N    EPE++C+N G  F+ A A + 
Sbjct  56    AKHNDSSASIVDELQNSLAICLSHFYPFAGRIIPNPETNEPEILCDNTGALFLVAQASIS  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L +L+ Y  +  +EGKLVP  K+  + VQ T  +CGGI +   FDH + DA S   FL+ 
Sbjct  116   LNQLDFYNLNKCLEGKLVPIHKEFPVQVQLTNYECGGIFITFTFDHALGDASSFTKFLLM  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYC  778
             WSEIA+ K LS  P  RR     R P  Y+ S D  ++  S      +  P   + R+Y 
Sbjct  176   WSEIARKKPLSFSPDHRRYLFRARYPPIYNRSFDESFISCSLHDILHISTPNTLLKRLYY  235

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  I  LQ  A+      L   +RTK+EAF A++WK +     + + K  K+G +VDG
Sbjct  236   IDASNIDRLQKLAS------LDGTKRTKIEAFSAYIWKIMVKAIDKGHSKKCKMGWLVDG  289

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTR+        K L+ Y GN LS    E ++ E+ +  +  VA+ VH+ + +  + +HF
Sbjct  290   RTRIC-----TEKVLENYIGNALSIAVGEASVDEIEQASIANVANNVHDAISKVTSAEHF  344

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS-YHFPWGG  1315
             L LIDW+E ++P   + K+     G A+VVSSG+RFPV ++DFG+G P  G+ Y      
Sbjct  345   LDLIDWIECNKPGLMLAKIVLGQGGPAIVVSSGRRFPVAEVDFGFGGPVVGTVYSTIQKL  404

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               GY+   P  KG+G W +   L  E +E +E+ + HVF+P TS+HL  
Sbjct  405   GVGYINQRPGAKGDGSWTISAILWPEMIEALESDSEHVFQPMTSNHLKL  453



>gb|KHM99654.1| Anthranilate N-benzoyltransferase protein 1 [Glycine soja]
Length=317

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 171/244 (70%), Gaps = 14/244 (6%)
 Frame = +2

Query  755   PKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN-  931
             P +SRIY V AEQ+ ++QS     + +  K   RTK E F AFLWK VA   SR N K  
Sbjct  78    PLLSRIYYVTAEQLEKMQSLVVMTNENNTK---RTKFECFSAFLWKIVAQAASRGNKKGK  134

Query  932   ---FKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVH  1102
                 K+GIVVDGR RL  GD+ K   +  YFGNVLS PF  K ++EL EKPL +VA AVH
Sbjct  135   KVIAKMGIVVDGRKRLCDGDKEKEALMGCYFGNVLSIPFGGKEVEELMEKPLGFVAEAVH  194

Query  1103  EFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV-----DGAALVVSSGQRFPVRKIDF  1267
             EFL  A T +HFLGLIDWVEAHRPEP + K++ C      +G + VVSSGQR    K+DF
Sbjct  195   EFLAVA-TKEHFLGLIDWVEAHRPEPGVAKIY-CGGGGGDEGPSFVVSSGQRLMEGKMDF  252

Query  1268  GWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS  1447
             GWG+  FGS+HFPWGGQ+GYVMPMPSP GNGDW+VYMHL KE++E++E+ AS VF+P + 
Sbjct  253   GWGEVVFGSFHFPWGGQAGYVMPMPSPLGNGDWVVYMHLAKEQLEVLESEASDVFRPISW  312

Query  1448  DHLN  1459
             D+LN
Sbjct  313   DYLN  316



>ref|XP_006355150.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Solanum 
tuberosum]
Length=454

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 164/469 (35%), Positives = 253/469 (54%), Gaps = 24/469 (5%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A + ++ VS  +  VV A + + EP+ L  SNLDLL     V  F+ Y K          
Sbjct  6     ARDDDYTVSFIRKSVVKATVTIPEPYVLTLSNLDLLSGRFPVTYFYIYHKA---------  56

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFADVE  424
              +H ++   + + L+ +L+  L  FY  AG +  N    EPE++C+N G  F++A +   
Sbjct  57    -KHNSSSASIADELRKSLANCLSHFYPFAGRIISNTETHEPEIVCDNTGALFLEAQSSNS  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L++L+LY  +  +EGKLVP  ++  + VQ T  KCGGI++   FDH + DA S + FL+ 
Sbjct  116   LKELDLYNLNKCLEGKLVPTNQEFPVQVQLTNYKCGGIIITFTFDHALGDASSFSKFLLM  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYC  778
             WS+IA+ K LS  P  RR  L  R P  Y+ S D  ++  S      +  P+  + R+Y 
Sbjct  176   WSQIARKKSLSFSPDHRRYLLRARNPPIYNHSFDESFISCSLNDIHNISTPRTLVKRLYY  235

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  I  LQ   +      +   +RTK+EAF A++WK +      +  K  K+G +VDG
Sbjct  236   IDASSIDMLQKIVS------IDGTKRTKIEAFSAYIWKIMVKAID-KGHKKCKMGWLVDG  288

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTR+   +E   K  + Y GN LS    E ++ E+ +  L+ VA  VH  + +  + +HF
Sbjct  289   RTRICTYNE---KVTENYIGNALSIAVGEASVSEIDQALLSDVAKKVHNAISKVTSAEHF  345

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS-YHFPWGG  1315
             L LIDW+E ++P   + K+     G A+VVSSG+RFPV ++DFG+G P  G+ Y      
Sbjct  346   LDLIDWIEWNKPGLMLSKIVLGQGGPAIVVSSGRRFPVAEVDFGFGSPVLGTVYSTIKKL  405

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               GY+      KG+G W V   L  + +E +E+ ++HVF+P TS+HL  
Sbjct  406   GVGYINQRQGAKGDGSWTVSAILWPDMIEALESDSNHVFQPMTSNHLKL  454



>emb|CBI33422.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 159/220 (72%), Gaps = 8/220 (4%)
 Frame = +2

Query  275  MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
            MV  LK A+++ALV +YA AGE+  N  GE EL+CNNRGVDF+ A+ADV+L+ LNLY PD
Sbjct  1    MVRVLKEAMAQALVPYYAFAGEILSNSLGEAELLCNNRGVDFLDAYADVKLQDLNLYNPD  60

Query  455  DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
            +S+EGKLVP +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW+E+AQ+K L
Sbjct  61   ESIEGKLVPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAEMAQSKPL  120

Query  635  SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVAAEQIRE  802
            S +P FRRS L PR P  Y  SLD+MYVPIS+L P  V +P     ISR+Y V AE++  
Sbjct  121  SVIPSFRRSLLNPRHPGSYAPSLDHMYVPISALPPPKVPQPGADPLISRLYYVTAEKLSL  180

Query  803  LQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRN  922
            LQ+ A   S+      +RTKLE+  AFLWK VA      N
Sbjct  181  LQTLATSKSSSY----KRTKLESLSAFLWKIVAKSAHMEN  216



>emb|CBI33404.3| unnamed protein product [Vitis vinifera]
Length=229

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 167/233 (72%), Gaps = 10/233 (4%)
 Frame = +2

Query  401   VQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAY  580
             ++A+ADV+L+ LNLY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAY
Sbjct  1     MEAYADVQLQNLNLYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAY  60

Query  581   SANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ----PEAV  748
             SANMFLVSW+E+AQ+K LS L  FRRS    R P  YD  LD+MYVP+S+L+    P++ 
Sbjct  61    SANMFLVSWAEMAQSKPLSILSSFRRSLHNARSPGSYDPFLDDMYVPMSALRPPKAPQSG  120

Query  749   EEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASG--KSRRN  922
             ++  I+R+Y V AEQ+  LQS A   S+      +RTKLE+  AFLWK VA        N
Sbjct  121   DDLLINRLYYVTAEQLSLLQSLATSKSSP----CKRTKLESLSAFLWKMVAKSAITEDAN  176

Query  923   FKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLN  1081
              K  ++G VVDGR RLS GDE KA  +  YFGNVLS PF +KTI EL+EKPL+
Sbjct  177   QKICRMGTVVDGRKRLSNGDEVKAAIMASYFGNVLSTPFGKKTINELKEKPLS  229



>ref|XP_010654997.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Vitis 
vinifera]
Length=329

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 6/180 (3%)
 Frame = +2

Query  935   KLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLE  1114
             K+ +VVDGR RLS GDE++   +  YFGNVLSFPF EKT+ +L+EKPL+WV   VH+FLE
Sbjct  148   KMSVVVDGRKRLSSGDEDRTTAMASYFGNVLSFPFGEKTVNDLKEKPLSWVGDEVHDFLE  207

Query  1115  EALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKIDFGWGKP  1282
              A+T +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+DFGWGKP
Sbjct  208   AAMTKEHFLGLIDWVEAHRPEPA--ALNMCCSGNSDGPGFMVSSGQRFPVTKVDFGWGKP  265

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             A GSYHFPWG + GYVMPMP+P  + DW+VYMHL K ++ELIET A+H+F+P T+DHLN 
Sbjct  266   ALGSYHFPWGAEVGYVMPMPTPTVDDDWVVYMHLLKAQIELIETEAAHIFRPLTADHLNL  325


 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = +2

Query  68   ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
            +S   F V+V + EVVAA LP+Q+ H+LP SNLDLLLPP++VGVFFCY+KP  +++    
Sbjct  3    SSGGEFMVTVRRKEVVAAMLPMQK-HWLPLSNLDLLLPPINVGVFFCYKKPRGSASGGDD  61

Query  248  EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                 TFG MV  LK A+++ALV +YA AGEV  N  GE EL+CNNRGVDF++A+ADV+L
Sbjct  62   ----FTFGSMVRVLKEAMAQALVPYYAFAGEVLSNSLGEAELLCNNRGVDFLEAYADVKL  117

Query  428  RKLNLYKPDDSVEGKLVPKKKQGVLSVQATEL  523
            + LNLY PD+S+EGKL P +K GVLSVQ  ++
Sbjct  118  QDLNLYNPDESIEGKLAPTRKHGVLSVQICKM  149



>gb|EAZ31931.1| hypothetical protein OsJ_16103 [Oryza sativa Japonica Group]
Length=463

 Score =   262 bits (669),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 260/470 (55%), Gaps = 39/470 (8%)
 Frame = +2

Query  86    NVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATT  265
              V VT    VA ALPVQE H LP SNLDL+LPP+DVGVFFCY     +         AT 
Sbjct  14    TVKVTSASTVAPALPVQE-HRLPLSNLDLILPPMDVGVFFCYGAGEGSGGGGALLPAATL  72

Query  266   FGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLY  445
                     KAAL++ LV++Y  AGEV  N  GE EL+C+ R     +       R+    
Sbjct  73    --------KAALAKVLVAYYPFAGEVVANTRGEGELLCSGR---GRRLRRGDRRRRRAAS  121

Query  446   KPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQA  625
              P      +    + Q       T+ KCGG VV   FDHRV DAYS NMFLV+W+  A+ 
Sbjct  122   APACRGRRERREARAQEEGWRHVTKFKCGGAVVGCTFDHRVCDAYSFNMFLVAWAAAARG  181

Query  626   KQLSQLPCFRRSFLFPRRPA--HYDLSLDNMYVPISSLQPEAVEEPK-----ISRIYCVA  784
                +  P F RSFL P  PA    D   D ++VP+S +       P+     ++RI+ VA
Sbjct  182   SSAAPAPSFDRSFLAPTSPAPPCPDALSDRLFVPVSCVPAPPSSAPEAAAAAVNRIFRVA  241

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK--TVASGKSRRNFKNFKLGIVVDG  958
             A  +  LQ+ A          P RTKLEAF A LW+    A+    R+ ++  +G+VVDG
Sbjct  242   AADVAALQAAAG---------PGRTKLEAFTAHLWQLHARAAASPPRHRRSCCMGVVVDG  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTRL      +   +  YFGNVL+ P+   +  +L   PL  VA  VH ++ EA T DHF
Sbjct  293   RTRL-----RRDGAMGAYFGNVLTIPYGAMSSGDLSAMPLADVAGDVHRWVAEAATRDHF  347

Query  1139  LGLIDWVEAHRPEPAIPKVH----DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
              GL+DWVE  RPEP++ + +       + AA VVSSG R PV ++DFG G+PAF SYHFP
Sbjct  348   RGLVDWVEQLRPEPSVARAYLGGDGGAEAAACVVSSGMRMPVGEVDFGRGRPAFASYHFP  407

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             W G +GYVMPMPS +G+GDW+VY+H   E V+ +E   + VF+   SD++
Sbjct  408   WPGGAGYVMPMPSARGDGDWVVYVHAAAEVVKAMEEEETTVFRALESDYV  457



>gb|EMS59417.1| Anthranilate N-benzoyltransferase protein 3 [Triticum urartu]
Length=355

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 204/343 (59%), Gaps = 30/343 (9%)
 Frame = +2

Query  422   ELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
             ELR+L L   D+ V+ KLVP K  GV+SVQ T+ KCGG VV   FDHRV DAYS NMFLV
Sbjct  14    ELRELRLVIVDEGVD-KLVPSKMAGVISVQVTKFKCGGAVVGCTFDHRVCDAYSFNMFLV  72

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLS----LDNMYVPISSLQPE---AVEEPK  760
             +W+  ++   +   P FRRS + PR P+    +    +D ++ P+SS  P     V    
Sbjct  73    AWAATSRGGSVPPAPTFRRSLVSPRDPSPRTYATNALIDRLFSPLSSASPPPPATVAATA  132

Query  761   ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVA-SGKSRRNFKNFK  937
             ++RIY +AA  +  LQ  A          P RTKLEAF A LW+  + SG + +      
Sbjct  133   VNRIYRIAAADVAALQVTAG---------PGRTKLEAFTAHLWQLCSMSGSAHQRL--CC  181

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREK-PLNWVASAVHEFLE  1114
             +G+VVDGR R+S     KA     YFGNVL+  +   +I +LR +  L  VA  VH ++ 
Sbjct  182   MGMVVDGRARMSPDGAMKA-----YFGNVLTITYGVNSIDDLRRRMALADVADDVHRWVR  236

Query  1115  EALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKP  1282
             EA T +HF GLIDWVEA RP+PA  + +    G     A +VSSG  FPVR+I+FG G P
Sbjct  237   EAATDEHFRGLIDWVEALRPKPAAARAYLGGTGGTKATACIVSSGMGFPVREINFGTGLP  296

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
             AF SYHFPW   + YVMPMPS + +G+W+VY+H   E V+++E
Sbjct  297   AFASYHFPWPAGAAYVMPMPSARDDGEWVVYVHAAPELVKVME  339



>emb|CDP19817.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 168/465 (36%), Positives = 245/465 (53%), Gaps = 29/465 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V   +  VV A  P+ + H L  SNLDLL     V  F+ Y KP         ++H  
Sbjct  3     FEVKFIRKTVVKAIGPLPDSHILTLSNLDLLSGRFPVTYFYFYNKP---------QDHIP  53

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
             T     + LK +L++ L  FY  AG++ QN    EPE+IC+N G   V+A A++ L++L+
Sbjct  54    T---PFHALKDSLAKCLSLFYPFAGKIVQNSQTNEPEIICDNSGALLVEAKANIPLKELD  110

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  D S++GKLV   +   L +Q T   CG + +   FDH + DA +   FL++WSEIA
Sbjct  111   FYNLDKSLQGKLVTIHQDFPLQIQVTNYTCGNLSMTFTFDHALGDASAFGRFLLTWSEIA  170

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEA---VEEPKISRIYCVAAE  790
              +K LS  P   R  +  R P  YD SLD  ++   +LQ  A        + R+Y V  +
Sbjct  171   TSKSLSGSPDHSRDLIQARSPPTYDPSLDETFIS-CTLQDIANIPTGNKVLKRLYYVDVK  229

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              I  LQ+ A+      L    RTK+EAF A++WK +    + +N +  K+G +VDGRTRL
Sbjct  230   SIDSLQTLAS------LDSEERTKIEAFSAYVWKIMVRAIN-KNHEKCKMGWLVDGRTRL  282

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                D N    +  Y GNV+S  F +  +  L++  L   A+ VH+ + +     HFL LI
Sbjct  283   G-KDRNS---MSNYIGNVISVAFGDGDVHGLKQASLAETATLVHDSISKVTNQAHFLDLI  338

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DW+E HRP   + K+   + G A+VVSSG+RFPV +ID G+G P  G+          GY
Sbjct  339   DWIECHRPGLMLSKIVLGLGGPAIVVSSGRRFPVSEIDIGFGNPILGTVCSTIEKIGVGY  398

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS KG+G WIV + L  E +  +E+  + VF+P  +  L  
Sbjct  399   INQRPSAKGDGSWIVSVILWPEMIAALESDPNQVFQPMNAKFLQL  443



>emb|CBI33409.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 154/212 (73%), Gaps = 8/212 (4%)
 Frame = +2

Query  299  LSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLV  478
            +++ALV +YA AGEV  N  GE EL+CNNRGVDF++A+ADV+L+ LNLY PD+S+EGKL 
Sbjct  1    MAQALVPYYAFAGEVLSNSLGEAELLCNNRGVDFLEAYADVKLQDLNLYNPDESIEGKLA  60

Query  479  PKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRR  658
            P +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW+E+AQ+K LS +P FRR
Sbjct  61   PTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAEMAQSKPLSVIPSFRR  120

Query  659  SFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVAAEQIRELQSQANHY  826
            S L PR P  Y  SLD+MYVPIS+L P  V +P     ISR+Y V AE++  LQ+ A   
Sbjct  121  SLLNPRHPGSYAPSLDHMYVPISALPPPKVPQPGADPLISRLYYVTAEKLSLLQTLATSK  180

Query  827  SADELKHPRRTKLEAFCAFLWKTVASGKSRRN  922
            S+      +RTKLE+  AFLWK VA      N
Sbjct  181  SSSY----KRTKLESLSAFLWKMVAKSAHMEN  208



>ref|XP_008778761.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like, 
partial [Phoenix dactylifera]
Length=270

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 177/279 (63%), Gaps = 19/279 (7%)
 Frame = +2

Query  632   LSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQP--EAVEEPKISRIYCVAAEQIREL  805
             +S  P FRRS L PRRP  YD S D +   +SS  P     +E  +SRI  VAA+ I  +
Sbjct  2     ISLAPTFRRSLLIPRRPGSYDSSPDRLCALVSSRPPPLSPDQEAAVSRICYVAADDIARI  61

Query  806   QSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDE  985
             Q+ +           +RTK EAF A+LW+ +A G +R   K  ++G VVDGRTRL+ G E
Sbjct  62    QAASGG---------QRTKFEAFTAYLWRVLARG-ARPEDKVCRMGAVVDGRTRLARGGE  111

Query  986   NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEA  1165
                  + GYFGNV+S P+    ++EL++  L   A+AVH  L +A T +HF GL+DWVEA
Sbjct  112   -----MAGYFGNVVSIPYGILGVEELKDMDLAETAAAVHGMLRQATTEEHFRGLVDWVEA  166

Query  1166  HRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPM  1339
              RPEPA+ +++  +   G   VVSSG+ FPV +++FGWG+  FGSYHFPWG  +GYVMPM
Sbjct  167   RRPEPAVARIYLGEEDGGVGCVVSSGRAFPVGEVEFGWGRAVFGSYHFPWGSSAGYVMPM  226

Query  1340  PSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             PS + NGDW+VYMHL K  V+++E     VF+P T+D+ 
Sbjct  227   PSARRNGDWVVYMHLLKRFVDVLEVEEPPVFRPLTADYF  265



>ref|XP_010113024.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC35195.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=452

 Score =   256 bits (654),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 246/469 (52%), Gaps = 27/469 (6%)
 Frame = +2

Query  71    SNSNFNVSVTKNEVVAAALP-VQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             S S F V++TKN +V A  P +  P+ L  SNLDLL     V  F+ Y         +  
Sbjct  5     STSLFEVNLTKNHIVKAFNPSLPNPNVLKLSNLDLLSGRFPVTYFYFY-------CNSLA  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFADVE  424
              EH  T   ++  LK +L+  L  +Y  AG + QN    EP++IC+N G   V+A A++ 
Sbjct  58    NEH--TSQPVIEGLKKSLAITLEHYYPFAGRIVQNTDTNEPQIICDNSGALIVEANANIP  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             ++ L+ Y  + S+EG+LV       L +Q T   CGGI +   FDH + DA +   FLVS
Sbjct  116   MKMLDFYNLNKSLEGRLVSITPGFPLQIQVTYYTCGGISLTFTFDHALGDATAFGKFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI--SRIYC  778
             WSEIA+ K +S  P  +R+ L  R P  YD SLD  +V  +  +   +  PKI   R+Y 
Sbjct  176   WSEIARNKPVSFKPNHQRNLLIARTPPIYDPSLDQTFVKCTIEEIMNIPTPKILLKRLYF  235

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  +  LQS A+      +   RRTK+EAF A++WK +      +N    K+G +VDG
Sbjct  236   IDASSVDRLQSLAS------VNGKRRTKIEAFSAYVWKIMVKAI-EKNQATSKMGWLVDG  288

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             RTR+          +  Y GNVLS  F E  + +L++  ++ +A+ VH+ + +     HF
Sbjct  289   RTRMC----KDQISMSNYIGNVLSLAFGEAKVDDLKQSSISDIANKVHDAISKVTNEAHF  344

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ  1318
             L LIDW+E HRP   + K+     G ALV+SSG+RFPV ++DFG+G P  G+        
Sbjct  345   LDLIDWIECHRPGLMLSKIVLGQGGPALVLSSGRRFPVAELDFGFGGPVLGTVCSTIERI  404

Query  1319  S-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                Y+   PS  GNG W V   L  E    +E+    +F+P T+ HL  
Sbjct  405   GVAYMNQRPSASGNGSWTVSAILWPEFASALES--DSIFQPMTASHLQL  451



>ref|XP_010244192.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Nelumbo 
nucifera]
Length=517

 Score =   255 bits (652),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 169/465 (36%), Positives = 250/465 (54%), Gaps = 26/465 (6%)
 Frame = +2

Query  83    FNVSVTKNEVV-AAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             F+V  T+N VV A++     PH L  SNLDLL     V  F+ Y+KP A S         
Sbjct  74    FSVIFTQNMVVKASSSASSPPHVLTLSNLDLLSGRFPVTYFYVYRKPPAES---------  124

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFADVELRKL  436
               F  ++N L ++L++ L  +Y  AG +  N    EPE+IC+N G   V+A A++ L +L
Sbjct  125   --FASVLNGLTSSLADTLTHYYPFAGRIVTNAKTSEPEIICDNHGALVVEAHANIPLDEL  182

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  D  ++GKLV    +  L VQ T   CGGI +   FDH + DA S   FL++WSEI
Sbjct  183   DYYNLDQFLQGKLVSINHEYPLHVQVTNYTCGGISITFTFDHALGDASSFGRFLLAWSEI  242

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPKISRIYCVAAE  790
             AQ K +S +P  RR+ L  R P  YD SLD+ ++   I  +     +   +  +Y + A 
Sbjct  243   AQGKTISCIPDHRRN-LVARSPPTYDPSLDDAFISCSIEEIANIPTKHTLLKLLYHIDAS  301

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              +  LQ  +     D +K   RTK+EAF A++WK +          + K+G +VDGRTR+
Sbjct  302   SVDRLQRLS---CVDGVK---RTKIEAFSAYIWKVMVRTIEESE-THCKMGWLVDGRTRM  354

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                D N +  +  Y GNVLS  F E ++++L+   L+ VA  VH  + +A    HFL LI
Sbjct  355   CRDDPNYS--MANYIGNVLSVVFGEASVEDLKRGSLSDVARIVHGAIAKATNEAHFLDLI  412

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DWVE+HRP   + ++     G ALV+SSG+RFPV +++FG+G P  G+          GY
Sbjct  413   DWVESHRPGLMLSRIVLGRGGPALVLSSGRRFPVAEMNFGFGPPVLGTVCTTVEKIGVGY  472

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS +G+G W+V   L  E  + +E+    +F+P +  HL  
Sbjct  473   MNQRPSARGDGSWVVSAILWPELADALESDPERIFQPMSRTHLGL  517



>gb|ACU18592.1| unknown [Glycine max]
Length=454

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 239/467 (51%), Gaps = 29/467 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N  F V+ ++  VV A  P  EP  +  SNLDLL     V   + Y+K            
Sbjct  13    NQKFEVTFSRKSVVKALNPSLEPFSITLSNLDLLSGRFPVTYLYFYRKL-----------  61

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
              +  F   V+ LK  L++ L  +Y  AG++ QN    EPE+IC+N G   ++A  ++ L+
Sbjct  62    ESDNFKAFVDALKNTLAQVLDRYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNIPLK  121

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              L+ Y  +++++ K+V  +    L +QATE  CGGI +A  FDH + DA S   F+ SW 
Sbjct  122   SLDFYNLNETLQEKVVSVEPDFPLQIQATEYTCGGISIAFTFDHALGDATSFGKFIASWC  181

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDN--MYVPISSLQPEAVEEPKISRIYCVA  784
             EIAQ K LS +P   R  L  R    Y  SLD   M   +  +Q   +    + R+Y + 
Sbjct  182   EIAQKKPLSSIPDHTRH-LRARSSPKYQPSLDQTFMKCTMKEIQNMPMNHVLLKRLYHIE  240

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  I  LQ  A+      L   +RTK+EAF A++WK +      R+ K  K+G +VDGR 
Sbjct  241   ASSIDMLQKLAS------LNGVKRTKIEAFSAYVWKIMIGTIDERH-KTCKMGWLVDGRE  293

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+  G       +  Y GNVLS  F E +I+EL+E  ++ +A  VHE + +    DHFL 
Sbjct  294   RMGRG----KNLMSNYIGNVLSLAFGEASIQELKEASISEIAKTVHEAISKVNNEDHFLD  349

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS-YHFPWGGQS  1321
             LIDW+E HRP   + K     +G  LVVSSGQRFPV+++DFG+G P  G+ Y        
Sbjct  350   LIDWIECHRPGLMLAKAVLGQEGPTLVVSSGQRFPVKEVDFGFGSPLLGTVYTSIQKVGV  409

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              Y+    S KG+G W V   L  E    ++     +F P ++ HL  
Sbjct  410   SYMNQRLSAKGDGSWTVSAILWPELEAALQD--DPIFHPMSASHLQL  454



>ref|XP_011070203.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=449

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 171/466 (37%), Positives = 244/466 (52%), Gaps = 33/466 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V V +  VV AA PV E H +  SNLDLL     V   + Y++  ++S          
Sbjct  11    FEVEVVRKTVVKAAGPVPESHVISLSNLDLLSGRFPVTYIYFYRRTHSSS----------  60

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
                 +  +LK +L++ L  FY  AG + +N  +GEPE+IC+N G   V+A A + L + +
Sbjct  61    ---LIRGSLKESLAQCLSHFYPFAGRISENPKSGEPEIICDNSGALVVEAQASISLDEFD  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  + S++GKL+    Q  + VQ T    GGI +   FDH + DA + + FLV+WSEIA
Sbjct  118   FYNLNKSLQGKLISVNHQFPVQVQITNYIRGGISMTFTFDHALGDATAFSKFLVTWSEIA  177

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS----RIYCVAA  787
               K +S  P   RS L  R P  YD SLD  +V  S    E    P IS    R+Y +  
Sbjct  178   MKKPISCSPDHSRS-LRARFPPTYDPSLDEEFV--SCTMEEICNIPAISILLKRLYYIDE  234

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
               I  LQ  A   SA+  K   RTK+EAF A++WK +A+   + N +  K+G +VDGR+R
Sbjct  235   SSINRLQRLA---SANGNK---RTKIEAFSAYIWKVMANAIDK-NHEFCKIGWLVDGRSR  287

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             LS    +    +  Y GNVLS  F E  + +L++  +  +A  +H+ +       HF  L
Sbjct  288   LSKCQNS----MSNYIGNVLSLAFGESNVADLKKGSIAGIADIIHKAISTVTNEAHFRNL  343

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             IDWVE HRP   I K    + G ALV+SSG+RFPV ++DFG+G P  G+      G   G
Sbjct  344   IDWVECHRPGLMISKNVLGLGGPALVISSGRRFPVAELDFGFGNPVLGTVSSTIEGLGVG  403

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Y+    S   +G W V   L  E VE +E+  +H+F+P   +H+  
Sbjct  404   YINQRQSAGADGSWTVSAILWPEMVEALESDPNHIFQPMNLNHIQL  449



>ref|XP_003519086.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Glycine 
max]
Length=454

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 239/467 (51%), Gaps = 29/467 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             N  F V+ ++  VV A  P  EP  +  SNLDLL     V   + Y+K            
Sbjct  13    NQKFEVTFSRKSVVKALNPSLEPFSITLSNLDLLSGRFPVTYLYFYRKL-----------  61

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
              +  F   V+ LK  L++ L  +Y  AG++ QN    EPE+IC+N G   ++A  ++ L+
Sbjct  62    ESDNFKAFVDALKNTLAQVLDHYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNIPLK  121

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              L+ Y  +++++ K+V  +    L +QATE  CGGI +A  FDH + DA S   F+ SW 
Sbjct  122   SLDFYNLNETLQEKVVSVEPDFPLQIQATEYTCGGISIAFTFDHALGDATSFGKFIASWC  181

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDN--MYVPISSLQPEAVEEPKISRIYCVA  784
             EIAQ K LS +P   R  L  R    Y  SLD   M   +  +Q   +    + R+Y + 
Sbjct  182   EIAQKKPLSSIPDHTRH-LRARSSPKYQPSLDQTFMKCTMKEIQNMPMNHVLLKRLYHIE  240

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  I  LQ  A+      L   +RTK+EAF A++WK +      R+ K  K+G +VDGR 
Sbjct  241   ASSIDMLQKLAS------LNGVKRTKIEAFSAYVWKIMIGTIDERH-KTCKMGWLVDGRE  293

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+  G       +  Y GNVLS  F E +I+EL+E  ++ +A  VHE + +    DHFL 
Sbjct  294   RMGRG----KNLMSNYIGNVLSLAFGEASIQELKEASISEIAKTVHEAISKVNNEDHFLD  349

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS-YHFPWGGQS  1321
             LIDW+E HRP   + K     +G  LVVSSGQRFPV+++DFG+G P  G+ Y        
Sbjct  350   LIDWIECHRPGLMLAKAVLGQEGPTLVVSSGQRFPVKEVDFGFGSPLLGTVYTSIQKVGV  409

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              Y+    S KG+G W V   L  E    ++     +F P ++ HL  
Sbjct  410   SYMNQRLSAKGDGSWTVSAILWPELEAALQD--DPIFHPMSASHLQL  454



>gb|KDP28072.1| hypothetical protein JCGZ_19480 [Jatropha curcas]
Length=449

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 246/472 (52%), Gaps = 33/472 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             +    +F V +T+  +V AA  +  P  L  +NLDLL     V   + YQ P   S    
Sbjct  5     ITEQGSFEVYLTEKSIVKAANHLPTPQRLALTNLDLLSGRFPVTYLYLYQNPQTVS----  60

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADV  421
                    F  +V +LK +L+E L  +Y  AG + QN L  EP +IC+N G   V+  A++
Sbjct  61    -------FTSIVESLKKSLAETLSHYYPFAGRIVQNPLTSEPVIICDNNGALVVEGHANI  113

Query  422   ELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
              L+KL+LY  + S+EGKLV       L VQ T   CGGI +   FDH + DA +   FL+
Sbjct  114   SLKKLDLYDLNHSLEGKLVSINPDFPLQVQVTNYTCGGISITFTFDHALGDASAFGKFLL  173

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISR  769
             SWSEIA  K LS +P  RR+ ++PR P  Y  SLD  +V  +    + +  P     + R
Sbjct  174   SWSEIALNKPLSCMPDHRRN-IYPRYPPSYHPSLDRTFVKCT--LDDIINMPTTNILLKR  230

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIV  949
             +Y +    I +LQ    H +       +RTK+EAF A++WK + +   +++ +  K+G +
Sbjct  231   LYHIDVSSINKLQ----HIACSNGN--KRTKIEAFSAYVWKIMVATIDQKH-ERCKMGWL  283

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VDGR R+      +   +  Y GNVLS    E +I +LR+  ++ +A+ VH+ + +    
Sbjct  284   VDGRGRIC----REQNSMSNYIGNVLSLAVAEASIAQLRQGSISDIATNVHDAISQVTNN  339

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             +HFL LIDW+E HRP   +  +     G ALV+SSG+RFPV +I+FG+G P  G+     
Sbjct  340   EHFLDLIDWIECHRPGLMLSNIVLGRGGPALVLSSGRRFPVAEINFGFGSPVLGTVCSTI  399

Query  1310  GGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                  GY+    S +G+G W +   L  E    +E  +  +F+P +  HL  
Sbjct  400   QKIGVGYMNQRSSAQGDGSWTISAILWPELAATLE--SDPIFEPMSDSHLQL  449



>ref|XP_006368253.1| transferase family protein [Populus trichocarpa]
 gb|ERP64822.1| transferase family protein [Populus trichocarpa]
Length=448

 Score =   251 bits (642),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 167/464 (36%), Positives = 241/464 (52%), Gaps = 29/464 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V  T+  VV AA P+ +P  L  SNLDLL     V  F+ Y  P              
Sbjct  10    FAVIFTEKSVVKAANPLPKPQRLTLSNLDLLSGRFPVTYFYFYHNP-----------EKV  58

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
              F  ++ +LK++L+E L  +Y  AG++ QN    EPE+IC++ G   V+  A++ L+KL+
Sbjct  59    CFSSIMESLKSSLAETLSYYYPFAGQIVQNPNTNEPEIICDDNGALVVEGHANISLKKLD  118

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  D  ++GKLV    +  L VQ T   CGGI +   FDH + DA +   FLVSWSEIA
Sbjct  119   FYNLDQFLQGKLVSLNTEFPLQVQVTRYTCGGISITFTFDHALGDASAFGKFLVSWSEIA  178

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPKISRIYCVAAEQ  793
             Q K +S +P  RR+ L  R P  Y  SLD  +V   I  +      +  + R+Y +    
Sbjct  179   QRKPISCMPDHRRN-LLARCPPTYHPSLDQTFVKCTIEEIINMPTTQILLKRLYHIDVSS  237

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLS  973
             I  LQ  A           +RTK+EAF A++WK + +    R+ K  K+G +VDGR R+ 
Sbjct  238   INRLQQLACASGN------KRTKIEAFSAYVWKIMVTAIDERHQK-CKMGWLVDGRGRVH  290

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
              G +N    +  Y GNVLS    E TI EL++  ++ +AS VH+ + +     HFL LID
Sbjct  291   -GAQN---LMSNYIGNVLSVAVAEATIAELKQGSISDIASNVHDSISKVTNEAHFLDLID  346

Query  1154  WVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYV  1330
             W+E HRP   +  +     G ALV+SSG+RFPV ++DFG+G P  G+          GY+
Sbjct  347   WIECHRPGLMLSSIVLGRGGPALVLSSGRRFPVAELDFGFGGPVLGTVCTTVEKIGVGYM  406

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                PS + +G W V   L  E    +E+    +F+P ++  L  
Sbjct  407   NQRPSARNDGSWTVSAILWPELAAALES--DSIFQPMSASLLRL  448



>ref|XP_006471640.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=451

 Score =   251 bits (640),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 164/470 (35%), Positives = 248/470 (53%), Gaps = 30/470 (6%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +++  F V  T   +V A  P+ EPH L  SNLDLL     V  F+ Y++P         
Sbjct  7     SADGKFEVKPTGKSIVKAIGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP---------  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
                   +  ++ TL+ +L++ L  +Y  AG + QN    EPE+IC+  G   ++A A++ 
Sbjct  58    --FGKNYPLIIQTLRISLAKTLNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIP  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  L+ Y  ++S++GKLV  +    L +Q T   CGGI +   FDH + DA S   FLVS
Sbjct  116   LVNLDFYNLNESLQGKLVSIQPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI--SRIYC  778
             WSEIAQ K ++  P  RR+ L  R P  Y  SLD  +V  +  +   +    I   R+Y 
Sbjct  176   WSEIAQQKPITCSPDLRRN-LRARFPPSYHPSLDQTFVKCTIEEISNIPSTNILLKRLYH  234

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  I  LQ  A+      +K  +RTK+EAF A++WK + +    ++ K  K+G +VDG
Sbjct  235   IDASSISRLQQLAS------VKGKKRTKVEAFSAYIWKIMVTSIDEKHGK-CKMGWLVDG  287

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R R+ +  EN    +  Y GNVLS    E ++ EL++  ++ +A+ VH+ + +     HF
Sbjct  288   RCRI-LKHENP---MSSYIGNVLSLAVGEASVTELKQGSISEIANRVHDSITKVTNEAHF  343

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY-HFPWGG  1315
             L LIDW+E HRP   + +V    DG  +VVSSG+RFPV ++DFG+G P  G+        
Sbjct  344   LDLIDWIECHRPGLMLARVVLGRDGPTVVVSSGRRFPVAELDFGFGNPVLGAVSSIIERS  403

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT-SDHLNF  1462
               GY+   PS   +G W V   L  E    +E+    +F+P + +DHL  
Sbjct  404   GVGYINQRPSATCDGSWTVSAILWPELATALES--DSIFQPMSAADHLQL  451



>ref|XP_004148999.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Cucumis 
sativus]
 gb|KGN53458.1| hypothetical protein Csa_4G056000 [Cucumis sativus]
Length=453

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/426 (36%), Positives = 227/426 (53%), Gaps = 31/426 (7%)
 Frame = +2

Query  200   FFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELI  376
             F+ Y++P   S+             +++ LK +L++ L  +Y  AG++ QN    EPE+I
Sbjct  54    FYFYRRPTTNSST-----------GIIDALKISLAKTLNHYYPFAGKIVQNPTTNEPEII  102

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKF  556
             CNN G   V+A A++ L  LN +  ++ ++ KLV       L +Q T   CGGI +   F
Sbjct  103   CNNFGALVVEAKANLPLNALNFHDLNELLQEKLVTVNPDFPLQIQITSYTCGGISITFTF  162

Query  557   DHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ  736
             DH + DA +   FL++WSEI++ KQ+S +P  RRS L PR P  Y   L+N  V  +   
Sbjct  163   DHALGDATAFGKFLLAWSEISRGKQISTIPDHRRSIL-PRSPPTYHPDLNNTMVKCTMED  221

Query  737   PEAVEEPK--ISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGK  910
                +   K  I R+Y +    I +LQ   +          +RTK+EAF A++WK + S  
Sbjct  222   INNIPTLKKLIKRLYYIDQTSIDQLQKLGSSNGV------KRTKIEAFSAYVWKKMVSAM  275

Query  911   SRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVA  1090
                + K  K+G +VDGR+RL  GD N   ++  Y GNVLS  F E +I+EL+   +  +A
Sbjct  276   GTEHTK-CKMGWLVDGRSRLG-GDRN---YMSDYIGNVLSVVFGEASIEELKCSSIAEIA  330

Query  1091  SAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFG  1270
               VHE + +A    HFL L+DW+E HRP   + ++   + G  LVVSSGQRFPV ++DFG
Sbjct  331   DVVHEAISKATNKAHFLDLVDWIECHRPGLMMSRIVLGLGGPGLVVSSGQRFPVSELDFG  390

Query  1271  WGKPAFGSY--HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             +G P  G+        G S Y+   PS KG+G W V   L+ E    +E     VF+P T
Sbjct  391   FGGPVLGTVGSTIERIGVS-YMNQRPSAKGDGSWTVSAILEPELAATLE--LDSVFQPMT  447

Query  1445  SDHLNF  1462
             +  L  
Sbjct  448   TTLLQL  453



>emb|CDY38112.1| BnaC02g06610D [Brassica napus]
Length=376

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 165/367 (45%), Positives = 219/367 (60%), Gaps = 48/367 (13%)
 Frame = +2

Query  83    FNVSVTKNEVVAAA----LPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
             F+V+ T+ E+VA A    LP+ E   +  SNLDLLLPPVD+ V F Y+KP   +      
Sbjct  39    FHVTTTRKEIVAPASSPLLPLPENMIISVSNLDLLLPPVDINVCFFYKKPLYNTTN----  94

Query  251   EHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVEL  427
                       + LK +L+EALVS+Y LAGEV  N + GE E++CNN GV+ V+A ADVEL
Sbjct  95    ----------DVLKTSLAEALVSYYVLAGEVVANPITGESEILCNNGGVEVVEAAADVEL  144

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
             R+LNL+ P  S+  K VP K  GV ++Q TELKCG +VV   FDHR+ADAYS NMFL SW
Sbjct  145   RELNLHDPYQSI-AKFVPMKVHGVFAIQITELKCGSLVVGCTFDHRIADAYSMNMFLHSW  203

Query  608   SEIAQAK-QLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAVEEPK---ISRI  772
             ++I+++    S +P F RS L PRRP   D S+D MY+P++SL  P+    P     SRI
Sbjct  204   AQISRSDVPTSYMPSFNRSLLNPRRPLVIDSSVDQMYMPVTSLPLPQETTNPDNILTSRI  263

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTV---ASGKSRRNFKNFKLG  943
             Y + A+ +RELQ+ A         + +RTKLE+F AFLWK V   A+  +     N KLG
Sbjct  264   YYIKADVVRELQTLAG--------NGKRTKLESFSAFLWKLVAKHAATTTDSKLLNSKLG  315

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEK----TIKELREKPLNWVASAVHEFL  1111
             IVVDGR +L+  + N       YFGNVLS PF+      +IK+LR +      +     L
Sbjct  316   IVVDGRKKLTEQETNT------YFGNVLSVPFDSPSGPGSIKDLRYRIRG--GTRFRGLL  367

Query  1112  EEALTGD  1132
              E  +GD
Sbjct  368   REEFSGD  374



>ref|XP_007040904.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY25405.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=450

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 168/464 (36%), Positives = 248/464 (53%), Gaps = 34/464 (7%)
 Frame = +2

Query  89    VSVTKNEVVAA--ALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             V+ TK  +V A   LP +    +  SNLDLL     V   + Y +P+  +  +T E    
Sbjct  15    VNFTKKSIVKAFNLLPERHHKLITLSNLDLLSGRFPVTYLYFYHRPSINNLSSTVE----  70

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFADVELRKLN  439
                    +LK++L+E L  +Y  AG + ++    EP +IC+N G   V+A A++ LRKL+
Sbjct  71    -------SLKSSLAETLSYYYPFAGRITEDPDTSEPIIICDNTGALLVEAQANIPLRKLD  123

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY  +DS++GKLV       L VQ T   CGG+ +   FDH + DA +   FL SWS++A
Sbjct  124   LYNINDSLQGKLVSTDPNFPLQVQVTHYTCGGVSMTFTFDHALGDASAFGNFLSSWSQVA  183

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI--SRIYCVAAEQ  793
             +   LS +P   R+ L PR P  Y   LD  +V  +  +   + +  I   R+Y V A  
Sbjct  184   RKMPLSCIPDHGRN-LRPRLPPTYRPCLDQTFVKCTLEEIRNIPKTNILLKRLYYVDASS  242

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLS  973
             I +LQS A    AD  K   RTK+EAF A++WK + +   + + K  K+G +VDGR RL+
Sbjct  243   INKLQSLA---CADGNK---RTKIEAFSAYIWKVMVTTIDKSHAK-CKMGWLVDGRGRLN  295

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
                 N       Y GNVLS   EE +I E+++  ++ +A+ VHE + +    +HFL LID
Sbjct  296   GSMSN-------YIGNVLSVAIEEASIVEIKQGSISEIANNVHEAISKVANEEHFLDLID  348

Query  1154  WVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY-HFPWGGQSGYV  1330
             W+E H+P   +PKV     G ALV+SSG+RFPV ++DFG+G P  G+          GY+
Sbjct  349   WIECHKPGLMLPKVVLGRGGPALVLSSGRRFPVAELDFGFGSPVLGTVSSIIEKSGVGYM  408

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                PS + +G WIV   +  E    +E+    VF+P  + HL  
Sbjct  409   NQRPSARSDGSWIVSAIIWPELAAALES--DSVFQPLCASHLQI  450



>ref|XP_011018370.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Populus 
euphratica]
Length=448

 Score =   249 bits (636),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 168/464 (36%), Positives = 241/464 (52%), Gaps = 29/464 (6%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+ T+  VV AA P+ +P  L  SNLDLL     V  F+ Y  P              
Sbjct  10    FAVNFTEKSVVKAANPLPKPQRLTLSNLDLLSGRFPVTYFYFYHNP-----------EKV  58

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLA-GEPELICNNRGVDFVQAFADVELRKLN  439
              F  ++ +LK++L+E L  +Y  AG++ QN +  EPE+IC++ G   V+  A++ L+KL+
Sbjct  59    CFSSIMESLKSSLAETLSYYYPFAGQIVQNPSTNEPEIICDDNGALVVEGHANISLKKLD  118

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  D  ++GKLV       L VQ T   CGGI +   FDH + DA +   FLVSWSEIA
Sbjct  119   FYNLDQFLQGKLVSLNTGFPLQVQVTRYSCGGISITFTFDHALGDASAFGKFLVSWSEIA  178

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI--SRIYCVAAEQ  793
             Q K +S  P  RR+ L  R P  Y  SLD  +V  +  +   +   +I   R+Y +    
Sbjct  179   QRKPISCTPDHRRN-LLARCPPTYHPSLDQTFVKCTIEEIINIPTTRILLKRLYHIDVSS  237

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLS  973
             I  LQ  A           +RTK+EAF A++WK + +    R+ K  K+G +VDGR R+ 
Sbjct  238   INRLQQLACASGN------KRTKIEAFSAYVWKIMVTAIDERHQK-CKMGWLVDGRGRVH  290

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
              G E+    +  Y GNVLS    E TI EL++  ++ VAS VH+ + +     HFL LID
Sbjct  291   -GAED---LMSNYIGNVLSVAVAEATIAELKQGSISDVASNVHDSISKVTNEAHFLDLID  346

Query  1154  WVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYV  1330
             W+E HRP   +  +     G ALV+SSG+RFPV ++DFG+G P  G+          GY+
Sbjct  347   WIECHRPGLMLSSIVLGRGGPALVLSSGRRFPVAELDFGFGGPVLGTVCTTVEKIGVGYM  406

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                PS + +G W V   L  E    +E+    +F P ++  L  
Sbjct  407   NQRPSARNDGSWTVSAILWPELAAALES--DSIFLPMSASLLRL  448



>ref|XP_007145597.1| hypothetical protein PHAVU_007G252100g [Phaseolus vulgaris]
 gb|ESW17591.1| hypothetical protein PHAVU_007G252100g [Phaseolus vulgaris]
Length=452

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 165/471 (35%), Positives = 250/471 (53%), Gaps = 31/471 (7%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTT  244
             +A+  NF+V ++K  VV A  P  EP  +  SNLDLL     V   + Y+KP        
Sbjct  8     IAAPENFDVKLSKKSVVKALNPPAEPFKITLSNLDLLSGRFPVTYLYFYRKP--------  59

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADV  421
                 +  F   V+ LK++L++ L  +Y  AG++ QN    EPE+IC+N G   ++A  ++
Sbjct  60    ---QSDNFKAFVDALKSSLAQILDHYYPFAGQIVQNPKTSEPEIICDNNGALVIEAHTNI  116

Query  422   ELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLV  601
              ++ ++ Y  +++++ K+V  +      +Q TE  CGG+ +A  FDH + DA S   F+ 
Sbjct  117   PIKDIDFYNLNETLQDKVVSVEPDFPTQIQVTEYSCGGMSIAFTFDHALGDASSFGKFIA  176

Query  602   SWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPKISRIY  775
             SW EIAQ K LS +P   R  L  R    Y   LD  ++   +  +Q   + +  + R+Y
Sbjct  177   SWCEIAQKKPLSCVPDHTRH-LRARSSPKYQPFLDQNFIRCTMEEIQNMPMNQISLKRLY  235

Query  776   CVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVD  955
              + A  I  LQ  A   SAD +K   +TK+EAF A++WK +     +R+ K  K+G +VD
Sbjct  236   HIKASSINMLQKLA---SADGVK---KTKIEAFSAYVWKIIIGTIDQRHEK-CKMGWLVD  288

Query  956   GRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDH  1135
             GR R+  G+      +  Y GNVLS  F E +I+EL+E  ++ +A+ VHE + +     H
Sbjct  289   GRERMGRGE----NLMSNYIGNVLSVGFGEASIQELKESSISDIANTVHEAISKVNNEVH  344

Query  1136  FLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH--FPW  1309
             FL LIDWVE HRP   + K     +   LVVSSGQRFPV  +DFG+G P  G+ +   P 
Sbjct  345   FLDLIDWVECHRPGLMLAKAVLGGEVPTLVVSSGQRFPVTDVDFGFGSPLLGTVYTTIPR  404

Query  1310  GGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              G  GY+    S KG+G W V   L  E  + ++     +F P ++ HL  
Sbjct  405   VG-VGYMNQRLSAKGDGSWTVSAILWPELEDALQN--DPIFHPMSASHLEL  452



>emb|CBI18360.3| unnamed protein product [Vitis vinifera]
Length=334

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 141/179 (79%), Gaps = 4/179 (2%)
 Frame = +2

Query  275  MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
            MV  +K AL++ALVS+YA AGEV  N  GEPEL+CNNRGVDF +A+ADV+L+ LNLY PD
Sbjct  1    MVRVVKEALAQALVSYYAFAGEVVSNSVGEPELLCNNRGVDFTEAYADVQLQDLNLYNPD  60

Query  455  DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
            DS+EGKLVPKKK GVLSVQ TELKCGG VV   FDHR+ADAYSAN+F+VSW+E+AQ+K L
Sbjct  61   DSIEGKLVPKKKNGVLSVQVTELKCGGAVVGCTFDHRIADAYSANLFIVSWAEMAQSKPL  120

Query  635  SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK----ISRIYCVAAEQIR  799
            S +P FRRS L PRRP  Y  SLD MYVPIS+L P    +P     ISR+Y V+AEQ++
Sbjct  121  SVIPSFRRSLLNPRRPGSYHPSLDEMYVPISALPPPKAPQPGAEHLISRLYYVSAEQLK  179


 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +2

Query  1094  AVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDF  1267
             AVH+FLE A+T +HFLGLIDWVE HRPEPA+ K++     DG A VVSSGQRFP  K+DF
Sbjct  192   AVHDFLERAVTKEHFLGLIDWVETHRPEPALAKIYCSGSSDGPAFVVSSGQRFPASKVDF  251

Query  1268  GWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS  1447
             GWG+PA GSYHFPWGG +GYVMPMPSP  +GDW+VYMHL   ++ELIE   +H+F+P TS
Sbjct  252   GWGRPALGSYHFPWGGDAGYVMPMPSPARDGDWVVYMHLLNGQIELIENQGAHIFRPLTS  311

Query  1448  DHLNF  1462
             D+L  
Sbjct  312   DYLKL  316



>ref|XP_008380661.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Malus 
domestica]
Length=458

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 168/475 (35%), Positives = 249/475 (52%), Gaps = 26/475 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPV-QEPHYLPHSNldlllppvdvGVFFCY-QKPAAASAQ  238
             MA  ++F V+ T   +V A  P+  +PH L  SNLDLL     V  F+ Y  KP      
Sbjct  1     MAVETDFEVNFTGKFIVKATNPMPDQPHILTLSNLDLLSGRFPVTYFYFYPNKPHDH---  57

Query  239   TTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFA  415
                +  A+ F  ++ +LK +L+  L  +Y   G +  N    EP+++C+N G   V+A A
Sbjct  58    ---DHDASNFTSIIESLKTSLANTLDCYYPFCGRIVTNPHTNEPKIMCDNSGALVVEAHA  114

Query  416   DVELRKLNLYKPDDSVE-GKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ++ L++LN Y  D S++  KLV       L VQAT   CGG+ +   FDH + DA S   
Sbjct  115   NIPLKRLNFYNIDLSLQKDKLVSINPDFPLQVQATFYTCGGVSITFTFDHALGDATSFGN  174

Query  593   FLVSWSEIAQAKQLSQLPCFRRSF-LFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--I  763
             FL+SWSEIA+ K +S +P  RR+  L  R P  Y  SLD+ +V  +  +   +   K  I
Sbjct  175   FLLSWSEIARKKPISCMPDHRRNLHLRARSPPTYHSSLDHTFVKCTMEEIMNIPTAKTLI  234

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLG  943
              R+Y +    I++LQ+ A+          +RTK+EA  A++WKT+ +    ++    K+G
Sbjct  235   KRLYFIDGSSIKQLQNLASRNGK------QRTKIEAVSAYIWKTMVTAIDTKSHGMCKMG  288

Query  944   IVVDGRTRL-SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
              +VDGR+RL    DEN    L  Y GNVLS  F E ++ +L +  ++ VA  V E + + 
Sbjct  289   WLVDGRSRLHKKEDENS---LSNYIGNVLSVAFGEASVSDLNQNSISEVADMVGEAISKV  345

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
                +HFL LIDW+E HRP   + +V     G  LV+SSG RFPV ++DFG+G P  G+  
Sbjct  346   TNEEHFLDLIDWIECHRPGIMLSRVVLGQGGPTLVLSSGSRFPVGELDFGFGSPVLGTVC  405

Query  1301  FPWGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                      Y+    S KG+G W V   L  E    +E  +  +F+P T+ HL  
Sbjct  406   STIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALE--SDSIFQPMTTSHLQL  458



>ref|XP_010943006.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=457

 Score =   248 bits (632),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 157/450 (35%), Positives = 238/450 (53%), Gaps = 31/450 (7%)
 Frame = +2

Query  134   QEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEAL  313
             ++P  LP SN D L+    V +F+ Y+KP+              F  +V  +K +LSE L
Sbjct  28    RQPSILPLSNFDRLMGGFPVTIFYAYRKPSTGD-----------FDSIVAAIKTSLSETL  76

Query  314   VSFYALAGEVEQNLA-GEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKK  490
               FY  AG + +N A GE E++CNN G++F++A A V L  L+ +  + S+   L+P   
Sbjct  77    THFYPFAGRIVRNSATGEAEILCNNAGINFMEARASVPLATLDFHDQNQSIRKVLLPVLP  136

Query  491   QGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPC-FRRSFL  667
             +  LSVQ T   CGG  VA  FDHR+ADA +   FL SWS+IA+A+Q+S +     RS  
Sbjct  137   EHPLSVQVTGYTCGGFSVAWCFDHRLADATAFIKFLNSWSQIARAEQVSSVAINHDRSIF  196

Query  668   FPRRPAHYDLSLDNMYV-----PISSLQPEAVEEPKISRIYCVAAEQIRELQSQANHYSA  832
              PR P  Y  S+   Y       I S+ P  + + +   +     E++RE  S+      
Sbjct  197   RPRSPPLYGPSVGRTYTVCTMDDILSMPPNGISQKRSYYVEGPCLERLREASSRGVS---  253

Query  833   DELKHPRRTKLEAFCAFLWKTVASGKSRRNFKN-FKLGIVVDGRTRLSIGDENKAKFLQG  1009
                   +RT+ EA  A+LWK +A      +  N  K+G ++DGR R++    N    +  
Sbjct  254   ------KRTRTEALSAYLWKVMARACGGGDSNNRCKMGWLIDGRRRMAA--RNHDDSMSN  305

Query  1010  YFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIP  1189
             Y GNV+S    E++ +EL+ +PL+ VA  V   + EA    HFL LIDW+E HRP   +P
Sbjct  306   YVGNVVSIAVGEESAQELKHRPLSHVAGIVSGAITEAANDGHFLDLIDWIECHRPGMMLP  365

Query  1190  KVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG-QSGYVMPMPSPKGNGDW  1366
             ++   +   ALVVSS    PV  +DFG+G+P+ G ++       +GYV  + S + +  W
Sbjct  366   ELLLGLRVPALVVSSCHNMPVMAVDFGFGRPSLGMFYSTVDQIGAGYVNLVSSGREDEGW  425

Query  1367  IVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             +V   +  E  + +E+   HVF+P T+DHL
Sbjct  426   LVSTFIWPELADALESDPDHVFQPITADHL  455



>ref|XP_008451859.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Cucumis 
melo]
Length=477

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 236/447 (53%), Gaps = 31/447 (7%)
 Frame = +2

Query  137   EPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALV  316
             EP  L  SNLDLL     +  F+ Y++P   S+             +++ LK +L++ L 
Sbjct  57    EPLILHLSNLDLLSGRFPITYFYFYRRPTTNSST-----------GIIDALKISLAKTLN  105

Query  317   SFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQ  493
              +Y  AG++ QN    EPE+ICNN G   V+A A++ L  LN +  ++ ++GKLV     
Sbjct  106   HYYPFAGKIVQNPTTNEPEIICNNFGALVVEAKANLRLDALNFHDLNELLQGKLVTVNPD  165

Query  494   GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFP  673
               L +Q T   CGGI +   FDH + DA +   FL++WSEI + K +S +P  RR+ L P
Sbjct  166   FPLQIQITCYACGGISITFTFDHALGDATAFGKFLLAWSEITRGKPISTIPDHRRNIL-P  224

Query  674   RRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAEQIRELQSQANHYSADELKH  847
             R P  Y   L+N  V  +      +   K  I R+Y +    I +LQ  A+         
Sbjct  225   RSPPTYHPDLNNTMVKCTMEDINNIPTLKKLIKRLYYIDQTSIDQLQKLASSNGV-----  279

Query  848   PRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVL  1027
              +RTK+EAF A++WK + S     + K  K+G +VDGR+RL  GD N   ++  Y GNVL
Sbjct  280   -KRTKIEAFSAYVWKKMVSAMETEHTK-CKMGWLVDGRSRLG-GDRN---YMSDYIGNVL  333

Query  1028  SFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV  1207
             S  F E +I+EL+   +  +A  VHE + +A    HFL L+DW+E  RP   + ++   +
Sbjct  334   SVVFGEASIEELKCNSIPEIADVVHEAISKATNKAHFLDLVDWIECRRPGLMMSRIVLGL  393

Query  1208  DGAALVVSSGQRFPVRKIDFGWGKPAFGSY--HFPWGGQSGYVMPMPSPKGNGDWIVYMH  1381
              G  LVVSSGQRFPV ++DFG+G P  G+        G S Y+   PS KG+G W V   
Sbjct  394   GGPGLVVSSGQRFPVSELDFGFGGPVLGTVGSTIERIGVS-YLNQRPSAKGDGSWTVSAI  452

Query  1382  LQKEKVELIETYASHVFKPFTSDHLNF  1462
             L+ E    +E     VF+P T+  L  
Sbjct  453   LEPELATTLE--LDSVFQPMTTTLLQL  477



>ref|XP_008238079.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Prunus 
mume]
Length=460

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 170/474 (36%), Positives = 250/474 (53%), Gaps = 24/474 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALP-VQEPHYLPHSNldlllppvdvGVFFCY-QKPAAASAQ  238
             M + ++F V+ T   +V    P V  PH L  SNLDLL     V  F+ Y  +P    A 
Sbjct  1     MGAEADFEVNFTTKFIVKPTNPMVDHPHILSLSNLDLLSGRFPVSYFYFYPNEPHDLHA-  59

Query  239   TTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFA  415
                   AT F  ++ +L  +L+  L S+Y  AG +  N    EPE++C+N GV  V+A A
Sbjct  60    ------ATDFSSIIESLNTSLASTLNSYYPFAGRIVPNQHTNEPEIMCDNSGVLVVEAHA  113

Query  416   DVELRKLNLYKPDDSVE-GKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ++ L+KLN Y  D S++  KL          VQ T   CGG+ +   FDH + DA S   
Sbjct  114   NIPLKKLNFYDLDQSLQSNKLASISPDFPFQVQVTLYTCGGVSITFTFDHALGDATSFGN  173

Query  593   FLVSWSEIAQAKQLSQLPCFRRSF-LFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--I  763
             FL+SWSEIA+ K +S +P  RR+  L  R P  Y  SLD  +V  +  +   +   K  I
Sbjct  174   FLLSWSEIARKKPVSCVPDHRRNLHLRARCPPSYHSSLDQSFVKCTMEEIMNIPTAKTLI  233

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLG  943
              R+Y +    I+ LQS A+          +RTK+E+  A++WKT+ +    ++    K+G
Sbjct  234   KRLYYIEDSSIKHLQSLASRNGK------KRTKIESVSAYIWKTMVTAIDTKSHGMCKMG  287

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
              +VDGR+R+    EN+   +  Y GNVLS  F E ++ +L++  ++ VAS V E + +  
Sbjct  288   WLVDGRSRMH-KKENQINPMSNYIGNVLSLAFGEASVGDLKQGSISDVASIVGEAISKVT  346

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
               +HFL LIDW+E HRP   + KV     G ALV+SSG++FPV ++DFG+G P  G+   
Sbjct  347   NEEHFLDLIDWIECHRPGLMLSKVVLGQGGPALVLSSGRKFPVAELDFGFGSPVLGTVCS  406

Query  1304  PWGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                     Y+    S KG+G W V   L  E    +E  +  +F+P T+ HLNF
Sbjct  407   TIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALE--SDTIFQPITTAHLNF  458



>ref|XP_006303518.1| hypothetical protein CARUB_v10010922mg [Capsella rubella]
 gb|EOA36416.1| hypothetical protein CARUB_v10010922mg [Capsella rubella]
Length=444

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 149/405 (37%), Positives = 219/405 (54%), Gaps = 21/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKL  436
             +F  +V +LKA+LSE L  FY  AG++  N     EP +ICN+ G   V+A A V+L+ L
Sbjct  54    SFETIVKSLKASLSETLNYFYPFAGQIVTNETSQEEPIIICNDNGALLVEARASVDLKSL  113

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  D  ++ KLV   +   L +QATE +CGG+ +   FDH + DA S   FL SWSEI
Sbjct  114   DFYNLDAFLQSKLVRVNQDFPLQIQATEFECGGLAITFTFDHALGDASSFGNFLTSWSEI  173

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAE  790
             ++ + +S +P  RR+ L  R P  YD  LD  ++  S    + +  PK  I R+Y + A 
Sbjct  174   SRNQPVSCVPDHRRNLLRARSPPRYDPHLDKTFIKCSEDDIKNIPTPKTLIKRLYHINAS  233

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              +  LQ+ A       +    RTK+EAF A++WK +       + K  K+G +VDGR RL
Sbjct  234   SLYTLQALAT------VNGESRTKIEAFSAYVWKKMVDSIESSH-KTCKMGWLVDGRGRL  286

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                  N       Y GNVLS    E TI+ LR+  ++ +A+ VH+ + +     HF  LI
Sbjct  287   ETVTSN-------YIGNVLSVAVGEATIENLRQNHVSEIANIVHKSITQVTNDIHFTDLI  339

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DW+E+HRP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY
Sbjct  340   DWIESHRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTIEKIGVGY  399

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS   +G W V   +  E  E +E+    VF+P ++ HL  
Sbjct  400   LNQRPSACNDGSWSVSAIVWPELAEALES--DSVFQPMSAKHLQL  442



>ref|XP_007210153.1| hypothetical protein PRUPE_ppa023735mg [Prunus persica]
 gb|EMJ11352.1| hypothetical protein PRUPE_ppa023735mg [Prunus persica]
Length=458

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 170/474 (36%), Positives = 248/474 (52%), Gaps = 24/474 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALP-VQEPHYLPHSNldlllppvdvGVFFCY-QKPAAASAQ  238
             M S ++F V+ T   +V    P V  PH L  SNLDLL     V  F+ Y  KP    A 
Sbjct  1     MGSEAHFEVNFTTKFIVKPTNPMVDHPHILSLSNLDLLSGRFPVSYFYFYPNKPHDLHA-  59

Query  239   TTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFA  415
                   AT F  ++ +L  +L+  L S+Y  AG +  N    EPE++C+N GV  V+A A
Sbjct  60    ------ATDFSSIIESLNTSLASTLNSYYPFAGRIVPNQHTNEPEIMCDNSGVLVVEAHA  113

Query  416   DVELRKLNLYKPDDSVE-GKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ++ L++LN Y  D S++  KL          +Q T   CGG+ +   FDH + DA S   
Sbjct  114   NIPLKELNFYDLDQSLKSNKLASISPDFPFQIQVTLYTCGGVSITFTFDHALGDATSFGN  173

Query  593   FLVSWSEIAQAKQLSQLPCFRRSF-LFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--I  763
             FL+SWSEIA+ K +S +P  RR+  L  R P  Y  SLD  +V  +  +   +   K  I
Sbjct  174   FLLSWSEIARKKPVSCVPDHRRNLHLRARCPPSYHSSLDQSFVKCTMEEIMNIPTAKTLI  233

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLG  943
              R+Y +    I+ LQS A+          RRTK+EA  A++WKT+ +    ++    K+G
Sbjct  234   KRLYYIEDSSIKHLQSLASRNGK------RRTKIEAVSAYIWKTMVTAIDTKSHGMCKMG  287

Query  944   IVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
              +VDGR+R+    EN+   +  Y GNVLS  F E ++ +L++  ++ VAS V E + +  
Sbjct  288   WLVDGRSRMH-KKENQINPMSNYIGNVLSLAFGEASVGDLKQGSISDVASIVGEAISKVT  346

Query  1124  TGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHF  1303
               +HFL LIDW+E HRP   + KV     G ALV+SSG++FPV ++DFG+G P  G+   
Sbjct  347   NEEHFLDLIDWIECHRPGLMLSKVVLGQGGPALVLSSGRKFPVAELDFGFGSPVLGTVCS  406

Query  1304  PWGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                     Y+    S KG+G W V   L  E    +E  +  +F+P T+ HL  
Sbjct  407   TIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALE--SDSIFQPITTTHLQL  458



>ref|XP_003612550.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES95508.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=458

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/406 (36%), Positives = 224/406 (55%), Gaps = 19/406 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
              F   VN LK +L++ L  +Y  AG + QN    EP++IC+N G   ++A  +V LR L+
Sbjct  66    NFKSFVNNLKTSLAQILNHYYPFAGHIVQNHKTDEPQIICDNNGSLVIEAQVNVPLRNLD  125

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  ++++E K+V  +    L +Q TE  CGGI +A  FDH + DA S   F+ SW EIA
Sbjct  126   FYNLNETLEEKIVSIELDFPLQIQVTEFTCGGISIAFTFDHALGDATSFGKFISSWCEIA  185

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK---ISRIYCVAAE  790
             Q K LS +P  +R+ L  R P  Y   LD +++  +  + + ++  K   + R+Y + A 
Sbjct  186   QNKPLSCIPNHKRN-LCARSPLIYQPYLDQIFIKCTMEEIQNMKMSKNISLKRLYHIDAS  244

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              I  LQ  A+      +   +RTK+EAF A++WK + +   ++ +K  K+G +VDGR R+
Sbjct  245   SINMLQRLAS------VNGIKRTKIEAFSAYVWKKMINTVDQKLYKKCKMGWLVDGRERM  298

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
             S+   +    +  Y GNVLS  F E  I+EL+E  L+ +   VH+ + +    +H+L LI
Sbjct  299   SVSKNS----MSNYIGNVLSLAFGEARIQELKEGSLSDIGEIVHDAISKVSNEEHYLDLI  354

Query  1151  DWVEAHRPEPAIPK-VHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             DW+E HRP   + K V    DG  LVVSSGQRFPV ++D G+G P  G+ +        G
Sbjct  355   DWIEFHRPGLMLAKAVLGQDDGPVLVVSSGQRFPVSEVDLGFGSPLLGTVYTSIERVGVG  414

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Y+    S KG+G W V   L  E V+ ++     +F+P T+ +L  
Sbjct  415   YMNQRQSGKGDGSWTVSAILWPELVDALKD--DPIFQPMTASYLQL  458



>ref|XP_009374636.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Pyrus 
x bretschneideri]
Length=458

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 166/475 (35%), Positives = 249/475 (52%), Gaps = 26/475 (5%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPV-QEPHYLPHSNldlllppvdvGVFFCY-QKPAAASAQ  238
             MA  ++F V+ T   +V A  P+  +PH L  SNLDLL     V  F+ Y  KP      
Sbjct  1     MAVEADFEVNFTGKFIVKATNPMPDQPHILTLSNLDLLSGRFPVTYFYFYPNKPHDH---  57

Query  239   TTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFA  415
                +  A+ F  ++ +LK +L+  L  +Y   G +  N    EP+++C+N G   V+A A
Sbjct  58    ---DHDASNFTSIIESLKTSLANTLDCYYPFCGRIVTNPHTNEPKIMCDNSGALVVEAHA  114

Query  416   DVELRKLNLYKPDDSVE-GKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ++ L++LN Y  D S++  KLV       L VQAT   CGG+ +   FDH + DA S   
Sbjct  115   NIPLKRLNFYNIDRSLQKDKLVSINPDFPLQVQATFYTCGGVSITFTFDHALGDATSFGN  174

Query  593   FLVSWSEIAQAKQLSQLPCFRRSF-LFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--I  763
             FL+SWSEIA+ K +S +P  RR+  L  R P  Y  SLD+ +V  +  +   +   K  I
Sbjct  175   FLLSWSEIARKKPISCMPDHRRNLHLRARSPPTYHSSLDHTFVKCTMEEIMNIPTAKTLI  234

Query  764   SRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLG  943
              R+Y +    I++LQ+ A+          +RTK+EA  A++WKT+ +    ++    K+G
Sbjct  235   KRLYFIDGSSIKQLQNLASKNGK------QRTKIEAVSAYIWKTMVTAIDTKSHGMCKMG  288

Query  944   IVVDGRTRLSIG-DENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
              +VDGR+RL    DEN    L  Y GNVLS    E ++ +L +  ++ VA  V E + + 
Sbjct  289   WLVDGRSRLHKNEDENS---LSNYIGNVLSLACGEASVSDLNQNSISEVADMVGEAISKV  345

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
                +HFL LIDW+E HRP   + +V     G  +V+SSG+RFPV ++DFG+G P  G+  
Sbjct  346   TNEEHFLDLIDWIECHRPGIMLSRVVLGQGGPTVVLSSGRRFPVGELDFGFGSPVLGTVC  405

Query  1301  FPWGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                      Y+    S KG+G W V   L  E    +E  +  +F+P T+ HL  
Sbjct  406   STIERIGVAYMNQRSSAKGDGSWTVSSILWPELAAALE--SDSIFQPMTTSHLQL  458



>ref|XP_004512355.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=458

 Score =   244 bits (623),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 158/467 (34%), Positives = 246/467 (53%), Gaps = 31/467 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPH-SNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             F V  T+  VV ++ P+ +P  + + SNLDLL     V   + Y+KP   +         
Sbjct  16    FEVKFTRKSVVKSSNPLTKPFSVINLSNLDLLSGRFPVTYLYFYKKPKQGN---------  66

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKL  436
               F   V++LK +L++ L  +Y  AG++ QN    EP++IC+N G   ++A  ++ L+ L
Sbjct  67    --FKSFVDSLKTSLAQILNHYYPFAGQIVQNPKTNEPQIICDNNGSLLIEAQVNIPLKSL  124

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  ++++E K+V  +    L +Q T+  CGGI ++  FDH + DA S   F+ SW EI
Sbjct  125   DFYNLNETLEEKIVKVQPNFPLQIQVTQYTCGGISISFTFDHALGDATSFGKFISSWCEI  184

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPKIS--RIYCVA  784
             +Q K LS +P   R+ L    P  Y   LD +++   +  +Q  ++E   IS  R+Y + 
Sbjct  185   SQNKPLSCIPNHTRN-LCTNSPPKYKPYLDKIFIKCTMEEIQNMSMENNNISLKRLYHID  243

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  I  LQ  A+      +   +RTK+E+F A++WK +     +  +K  K+G +VDGR 
Sbjct  244   ASSINTLQRLAS------INGTKRTKIESFSAYVWKIMIGTIDQSKYKKCKMGWLVDGRE  297

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+   ++NK   +  Y GNVLS  F E  I+EL+E  L+ +   VH+ + +    +HFL 
Sbjct  298   RM---NQNKNS-MSNYIGNVLSLAFGEAMIQELKEASLSKICDIVHDSISKVNNEEHFLD  353

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-  1321
             LIDW+E HRP   + K     DG  LVVSSGQRFPV ++D G+G P  G+ +        
Sbjct  354   LIDWIEIHRPGLMLAKAVLGKDGPVLVVSSGQRFPVCEVDLGFGCPLLGTVYTSIKRVGV  413

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GY+    S KG+G W V   L  E    +      +F+P  + HL  
Sbjct  414   GYMNQRQSGKGDGSWTVSAILWPELEAALMN--DSIFQPMNASHLQL  458



>ref|XP_010478899.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=444

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 217/411 (53%), Gaps = 21/411 (5%)
 Frame = +2

Query  245   TEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFAD  418
             T++   +F  +  +L+A+LSE L  FY  AG++  N A   EP +ICNN G   V+A A 
Sbjct  48    TKQPNVSFETIFKSLQASLSETLNYFYPFAGQIVTNEASQEEPIIICNNNGALLVEARAS  107

Query  419   VELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFL  598
             V+L+ L+ +  D  ++ KLV       L +QATE +CGG+ +   FDH + DA S   FL
Sbjct  108   VDLKSLDFHNLDALLQSKLVRVNPDFALQIQATEFECGGLAITFTFDHALGDASSFGKFL  167

Query  599   VSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRI  772
               WSEI++ + +S +P  RR+ L  R P  YD  LD +++  S    + +  PK  I R+
Sbjct  168   TLWSEISRNQPVSCVPDHRRNLLRARSPPRYDPHLDKIFIKCSEEDIKNIPMPKTLIKRL  227

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y + A  I  LQ  A       +    RTK+EAF A++WK +         K  K+G +V
Sbjct  228   YHIDASSIDTLQVLAT------VNGESRTKIEAFSAYVWKKMVDSI-ESGHKTCKMGWLV  280

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR RL             Y GNVLS    E TI+ L++  ++ +A+ VH+ + E     
Sbjct  281   DGRGRLE-------TVTSSYIGNVLSVAVGEATIENLKQNHVSEIANIVHKSITEVTNDT  333

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             HF  LIDW+E+HRP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+      
Sbjct  334   HFTDLIDWIESHRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTVE  393

Query  1313  GQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                 GY+   PS   +G W V   +  E  E  E  +  VF+P ++ HL  
Sbjct  394   KIGVGYLNQRPSACNDGSWSVSAIVWPELAEAFE--SDSVFQPMSAKHLQL  442



>ref|XP_002891141.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67400.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   241 bits (615),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/405 (36%), Positives = 214/405 (53%), Gaps = 21/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKL  436
             +F  +V +LK++LSE L  FY  AG++  N     EP +ICNN G   V+A A ++ + L
Sbjct  54    SFESIVKSLKSSLSETLTYFYPFAGQIVTNETSQEEPMIICNNNGALLVEARAHIDFKSL  113

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  D  ++ KLVP      L +Q TE +CGG+ +   FDH + DA S   FL  WSEI
Sbjct  114   DFYNLDVFLQSKLVPVNPDFALQIQVTEFECGGLAITFTFDHALGDASSFGKFLTLWSEI  173

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAE  790
             ++ +Q+S +P  RR+ L  R P  YD  LD  +V  S    + +   K  I R+Y + A 
Sbjct  174   SRNQQVSCVPDHRRNLLRARSPPRYDPHLDKKFVKCSKEDIKNIPMSKTLIKRLYHIDAS  233

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              I  LQ+ A       +    RTK+EAF A++WK +         K  K+G +VDGR RL
Sbjct  234   SIDALQALAT------VNGESRTKIEAFSAYVWKKMVDSI-ESGHKTCKMGWLVDGRGRL  286

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                  N       Y GNVLS    E +I+ L++  ++ +A+ VH+ + +     HF  LI
Sbjct  287   ETVTSN-------YIGNVLSVAVGEASIENLKQNHVSEIANIVHKSITDVTNNTHFTDLI  339

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DW+E+HRP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY
Sbjct  340   DWIESHRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGY  399

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS   +G W V   +  E    +E  +  VF+P ++ HL  
Sbjct  400   LNQRPSACNDGSWSVSAIVWPELATALE--SDSVFQPMSAKHLQL  442



>ref|XP_006471642.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Citrus 
sinensis]
Length=451

 Score =   241 bits (614),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 248/473 (52%), Gaps = 36/473 (8%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +++    V  T   +V A  P+ EPH L  SNLDLL     V  F+ Y++P         
Sbjct  7     SADGKLEVKPTGKSIVKAMGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP---------  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
                   +  ++ TL+ +L++ L  +Y  AG + QN    EPE+IC+  G   ++A A++ 
Sbjct  58    --FGKNYPLIIQTLRISLAKTLNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIP  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  L+ Y  ++S++GKLV  +    L +Q T   CGGI +   FDH + DA S   FLVS
Sbjct  116   LVNLDFYNLNESLQGKLVSIQPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVP-----ISSLQPEAVEEPKISR  769
             WSEIAQ K ++  P  RR+ L  R P  Y  SLD  +V      IS++ P  +    + R
Sbjct  176   WSEIAQQKPITCSPDLRRN-LRARFPPSYHPSLDQTFVKCTIEEISNIPPTNI---LLKR  231

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIV  949
              Y + A  I  LQ  A+      +   +RTK+EAF A++WK + +   +++ K  K+  +
Sbjct  232   FYHIDASSISRLQQLAS------VNGKKRTKVEAFSAYIWKIMVTSIDKKHGK-CKMDWL  284

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             +DG +R+    EN    +  Y GNVLS    E ++ EL++  ++ +AS VH+ + +    
Sbjct  285   LDGCSRIR-KYENP---MSSYIGNVLSLAVGEASVTELKQGSISEIASRVHDSITKVTNE  340

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY-HFP  1306
              HFL LIDW+E HRP     +V    DG A+++SSG+RFPV ++DFG+G P  G+     
Sbjct  341   AHFLDLIDWIECHRPGLMPARVVLGRDGPAVLMSSGRRFPVVELDFGFGSPVLGAVSSII  400

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS-DHLNF  1462
                  GY+   PS K +G W V   L  E    +E+    +F+P +S DHL  
Sbjct  401   ERSGVGYINQRPSAKCDGSWTVSAILWPELATALES--DFIFQPMSSADHLQL  451



>emb|CDY12305.1| BnaA09g25050D [Brassica napus]
Length=440

 Score =   239 bits (611),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 209/398 (53%), Gaps = 21/398 (5%)
 Frame = +2

Query  284   TLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKLNLYKPDD  457
             +LKA+L+E L  FY  AG++  N     EP ++C+N G   VQA A+ +L+ L+ Y  D 
Sbjct  57    SLKASLAETLNYFYPFAGQIVPNETSHEEPIILCSNNGALLVQARANTDLKSLDFYNLDA  116

Query  458   SVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLS  637
              ++ KLV         +QATE +CGG  +   FDH + DA S   FL +WSEI++ + +S
Sbjct  117   FLQAKLVRVNPDFPFQIQATEFECGGFSLTFTFDHALGDASSFGKFLTTWSEISRKEPVS  176

Query  638   QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAEQIRELQS  811
              +P  RR+ L PR P HY   LD  ++  S    + +  PK  I R+Y + A  I  LQ 
Sbjct  177   CVPDHRRNLLLPRSPPHYHPLLDKTFIKCSVEDIKNIPTPKTLIKRLYHINASSINALQD  236

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENK  991
              AN      +    RTK+EAF A++WK +       + K  K+G +VDGR RL       
Sbjct  237   LAN------VNGESRTKIEAFSAYVWKKMVDSIESCH-KTCKMGWLVDGRGRLE------  283

Query  992   AKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHR  1171
                   Y GNVLS    E TI+ L+   ++ +A  VHE + E     HF  LIDW+E+HR
Sbjct  284   -TVTSSYIGNVLSIAVGEATIENLKLNHVSEIAKIVHESITEVTNNTHFTDLIDWIESHR  342

Query  1172  PEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYVMPMPSP  1348
             P   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY+   PS 
Sbjct  343   PGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGYLNQRPSA  402

Query  1349  KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               +G W V   +  E    +E+    VF+P ++ HL  
Sbjct  403   CNDGSWSVSAMVWPELAAALES--DSVFQPMSAKHLQL  438



>ref|XP_004166659.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate N-benzoyltransferase 
protein 1-like [Cucumis sativus]
Length=453

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/426 (35%), Positives = 223/426 (52%), Gaps = 31/426 (7%)
 Frame = +2

Query  200   FFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELI  376
             F+ Y++P   S+             +++ LK +L++ L  +Y  AG++ QN    EPE+I
Sbjct  54    FYFYRRPTTNSSTG-----------IIDALKISLAKTLNHYYPFAGKIVQNPTTNEPEII  102

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKF  556
             CNN G   V+A A++ L  LN +  ++ ++ KLV       L +Q T   CGGI +   F
Sbjct  103   CNNFGALVVEAKANLPLNALNFHDLNELLQEKLVTVNPDFPLQIQITSYACGGISITFTF  162

Query  557   DHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISS  730
             DH + DA +   FL++WSEI++ KQ+S +P  RR+ L PR P  Y   L+N  V   +  
Sbjct  163   DHALGDATAFGKFLLAWSEISRGKQISTIPDHRRNIL-PRSPPTYHPDLNNTMVKCTMED  221

Query  731   LQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGK  910
             +         I R+Y +    I +LQ   +          +RTK+EAF A++WK + S  
Sbjct  222   INNIPTLNKLIKRLYYIDQTSIDQLQKLGSSNGV------KRTKIEAFSAYVWKKMVSAM  275

Query  911   SRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVA  1090
                + K  K+G +VDGR+RL  GD N   ++  Y GNVLS  F E +I+EL+   +  +A
Sbjct  276   GTEHTK-CKMGWLVDGRSRLG-GDRN---YMSDYIGNVLSVVFGEASIEELKCNSIAEIA  330

Query  1091  SAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFG  1270
               VHE + +A    HFL L+DW+E H P   + ++   + G  LVVSSGQ FPV ++DFG
Sbjct  331   DVVHEAISKATNKAHFLDLVDWIECHWPGLMMSRIVLGLGGPGLVVSSGQMFPVSELDFG  390

Query  1271  WGKPAFGSY--HFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             +G P  G+        G S Y+   PS  G+G W V   L+ E    +E     VF+P T
Sbjct  391   FGGPVLGTVGSTIERIGVS-YMNQRPSANGDGSWTVSAILEPELAATLE--LDSVFQPMT  447

Query  1445  SDHLNF  1462
             +  L  
Sbjct  448   TTLLQL  453



>emb|CBI18364.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 138/187 (74%), Gaps = 5/187 (3%)
 Frame = +2

Query  275  MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
            M   L+ AL++ALVS+YA AGEV  N  GEPEL+CNN+GVDF +A+AD +L  L+LY PD
Sbjct  1    MAGVLRKALAQALVSYYAFAGEVVSNSVGEPELLCNNQGVDFTEAYADAKLHDLSLYNPD  60

Query  455  DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
            DS+EGKLVPKK+ GVL VQ TELKCGG+VV   FDHR+ADAYSANMFLVSW+E+A  K L
Sbjct  61   DSIEGKLVPKKQHGVLCVQVTELKCGGVVVGCTFDHRIADAYSANMFLVSWAEMALCKPL  120

Query  635  SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----ISRIYCVAAEQIR  799
            S +P FRRS L  RRP  YD SLD MYV IS+L P    +P      ISRIY V AEQ+ 
Sbjct  121  SVVPSFRRSLLNIRRPGSYDPSLDEMYVLISALPPPRAPQPGGADPFISRIYYVTAEQLS  180

Query  800  ELQSQAN  820
             LQ+ AN
Sbjct  181  LLQTLAN  187


 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = +2

Query  1094  AVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDF  1267
             AVHE+LE A+T +HFLGLIDWVEAHRPEPA+ +++     DG ALVVSSGQRF V K+DF
Sbjct  192   AVHEYLEGAVTKEHFLGLIDWVEAHRPEPALARIYCSGSSDGPALVVSSGQRFAVSKVDF  251

Query  1268  GWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS  1447
             GWG+PA GS+HFPWGG++GYVMPMPSP  +GDW+VYMHL K ++E IET A+HVF+P TS
Sbjct  252   GWGRPALGSFHFPWGGEAGYVMPMPSPARDGDWVVYMHLLKGQIEFIETEAAHVFRPVTS  311

Query  1448  DHLNF  1462
             ++LN 
Sbjct  312   EYLNL  316



>ref|XP_006432873.1| hypothetical protein CICLE_v10003717mg [Citrus clementina]
 gb|ESR46113.1| hypothetical protein CICLE_v10003717mg [Citrus clementina]
Length=451

 Score =   238 bits (608),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 247/473 (52%), Gaps = 36/473 (8%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +++    V  T   +V A  P+ EPH L  SNLDLL     V  F+ Y +P         
Sbjct  7     SADGKLEVKPTGKSIVKAMGPLPEPHTLQLSNLDLLSGRFPVTYFYFYCRP---------  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
                   +  ++ TL+ +L++ L  +Y  AG + QN    EPE+IC+  G   ++A A++ 
Sbjct  58    --FGKNYPLIIQTLRISLAKTLNFYYPFAGRIIQNPQTNEPEIICDKNGALVLEAEANIP  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L  L+ Y  ++S++GKLV  +    L +Q T   CGGI +   FDH + DA +   FLVS
Sbjct  116   LVNLDFYNLNESLQGKLVSIQPDFPLQIQVTSYTCGGISITFSFDHALGDASTFGKFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVP-----ISSLQPEAVEEPKISR  769
             WSEIAQ K ++  P  RR+ L  R P  Y  SLD  +V      IS++ P  +    + R
Sbjct  176   WSEIAQQKPITCSPDLRRN-LRARFPPSYHPSLDQTFVKCTIEEISNIPPTNI---LLKR  231

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIV  949
              Y + A  I  LQ  A+      +   +RTK+EAF A++WK + +   +++ K  K+  +
Sbjct  232   FYHIDASSISRLQQLAS------VNGKKRTKVEAFSAYIWKIMVTSIDKKHGK-CKMDWL  284

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             +DG +R+    EN    +  Y GNVLS    E ++ EL++  ++ +AS VH+ + +    
Sbjct  285   LDGCSRIR-KYENP---MSSYIGNVLSLAVGEASVTELKQGSISEIASRVHDSITKVTNE  340

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY-HFP  1306
              HFL LIDW+E HRP     +V    DG A+++SSG+RFPV ++DFG+G P  G+     
Sbjct  341   AHFLDLIDWIECHRPGLMPARVVLGRDGPAVLMSSGRRFPVVELDFGFGSPVLGAVSSII  400

Query  1307  WGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTS-DHLNF  1462
                  GY+   PS K +G W V   L  E    +E+    +F+P +S DHL  
Sbjct  401   ERSGVGYINQRPSAKCDGSWTVSAILWPELATALES--DFIFQPMSSADHLQL  451



>emb|CDY62304.1| BnaA09g54240D [Brassica napus]
Length=440

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 144/398 (36%), Positives = 211/398 (53%), Gaps = 21/398 (5%)
 Frame = +2

Query  284   TLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKLNLYKPDD  457
             +LKA+L+E L  FY  AG++  N     EP ++CNN G   VQA A+ +L+ L+    D 
Sbjct  57    SLKASLAETLNYFYPFAGQIVPNETSHEEPIILCNNNGALLVQARANTDLKSLDFNNLDA  116

Query  458   SVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLS  637
              ++ KLV       L +QATE +CGG  +   FDH + DA S + FL +WSEI++ + +S
Sbjct  117   FLQAKLVRVNPDFPLQIQATEFECGGFSLTFTFDHALGDASSFSKFLTTWSEISRKQPVS  176

Query  638   QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAEQIRELQS  811
               P  RR+ L PR P  Y   LD  ++  S  + + +  PK  I R+Y + A  I  LQ 
Sbjct  177   CEPDHRRNLLLPRSPPRYHPLLDKTFIKCSVEEIKNIPTPKTLIKRLYHINASSINALQD  236

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENK  991
              AN      +    RTK+EAF A++WK +       + K  K+G +VDGR RL       
Sbjct  237   LAN------VNGESRTKIEAFSAYVWKKMVDSIESCH-KTCKMGWLVDGRGRLE------  283

Query  992   AKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHR  1171
                   Y GNVLS    E TI+ L++  ++ +A  VHE + E     HF+ LIDW+E+HR
Sbjct  284   -TVTSSYIGNVLSIAVGEATIENLKQNKVSEIAKIVHESITEVTNNTHFIDLIDWIESHR  342

Query  1172  PEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYVMPMPSP  1348
             P   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY+   PS 
Sbjct  343   PGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGYLNQRPSA  402

Query  1349  KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               +G W V   +  E    +E+    +F+P ++ HL  
Sbjct  403   CNDGSWSVSAIVWPELAAALES--DSLFQPMSAKHLQL  438



>ref|XP_002274239.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
Length=450

 Score =   238 bits (607),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 234/466 (50%), Gaps = 33/466 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+ T   V+ A  P+ EPH +  SNLDLL     V  F+ Y +P              
Sbjct  12    FEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDD----------  61

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
              F  ++  LK +L++ L  +Y  +G + +N    EPE+IC+N G   V+A A++ L+ L+
Sbjct  62    -FSSIIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLD  120

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              +  + S++GKLV    +    VQ T   CGGI +   FDH + DA +   FL SWSEIA
Sbjct  121   FHNLNLSLQGKLVSINPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSEIA  180

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS----RIYCVAA  787
               + LS +P  RR+ L  R P  YD  LD  +V  +    E V  P ++    R+Y V A
Sbjct  181   LRRPLSCIPDHRRN-LHARCPPTYDPLLDRTFVKCT--MEEIVNIPTMNTLLKRLYHVDA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
               I  LQ  A       L   +RTK+EAF A+LWK +      ++ K   +G +VDGR  
Sbjct  238   SSINHLQKLAC------LNGHKRTKIEAFSAYLWKVMVKAIDEKHEK-CNMGWLVDGRMS  290

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             +  G  +    L  Y GNVLS    E ++ E+++  +  VA  VH+ + +     HFL L
Sbjct  291   MCGGQNS----LSNYIGNVLSVAVGEASVVEVKQGSILDVAKIVHKVISKVTNKAHFLDL  346

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             IDW+E HRP   + +      G  LVVSSG+RFPV ++DFG+G P  G+          G
Sbjct  347   IDWIECHRPGLMLSRTVLGRGGPTLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLGVG  406

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Y+    S +G+G W V   L  E    +E+    + +P T+ HL  
Sbjct  407   YINQRQSARGDGSWTVSAILWPELAAALES--DSILQPMTATHLQL  450



>emb|CAN76941.1| hypothetical protein VITISV_042905 [Vitis vinifera]
Length=450

 Score =   238 bits (606),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 234/466 (50%), Gaps = 33/466 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+ T   V+ A  P+ EPH +  SNLDLL     V  F+ Y +P              
Sbjct  12    FEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDD----------  61

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
              F  ++  LK +L++ L  +Y  +G + +N    EPE+IC+N G   V+A A++ L+ L+
Sbjct  62    -FSSIIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLD  120

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              +  + S++GKLV    +    VQ T   CGGI +   FDH + DA +   FL SWSEIA
Sbjct  121   FHNLNLSLQGKLVSINPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSEIA  180

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS----RIYCVAA  787
               + LS +P  RR+ L  R P  YD  LD  +V  +    E V  P ++    R+Y V A
Sbjct  181   LRRPLSCIPDHRRN-LHARCPPTYDPLLDRTFVKCT--MEEIVNIPTMNTLLKRLYHVDA  237

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
               I  LQ  A       L   +RTK+EAF A+LWK +      ++ K   +G +VDGR  
Sbjct  238   SSINHLQKLAC------LNGHKRTKIEAFSAYLWKVMVKAIDEKHEK-CNMGWLVDGRMS  290

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             +  G  +    L  Y GNVLS    E ++ E+++  +  VA  VH+ + +     HFL L
Sbjct  291   MCGGXNS----LSNYIGNVLSVAVGEASVVEVKQGSILDVAKIVHKVISKVTNKAHFLDL  346

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             IDW+E HRP   + +      G  LVVSSG+RFPV ++DFG+G P  G+          G
Sbjct  347   IDWIECHRPGLMLSRTVLGRGGPTLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLGVG  406

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Y+    S +G+G W V   L  E    +E+    + +P T+ HL  
Sbjct  407   YINQRQSARGDGSWTVSAILWPELAAALES--DSILQPMTATHLQL  450



>ref|XP_004243072.2| PREDICTED: uncharacterized protein LOC101253393 [Solanum lycopersicum]
Length=223

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 148/195 (76%), Gaps = 9/195 (5%)
 Frame = +2

Query  887   WKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELR  1066
             W  +A  K      +F  GIVVDGRT+L I + +K+  L+GYF NVLS PF EK ++E++
Sbjct  34    WSELAQSKPLSQLPSF--GIVVDGRTQLIINNVDKS--LKGYFVNVLSIPFGEKKVEEVK  89

Query  1067  EKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV---DGAALVVSSG  1237
             EK LNWVA+ +HEF++ A T +HFLGLIDW+EAHRPEP++ K+  C    DG A+VVSSG
Sbjct  90    EKSLNWVANVIHEFVDIAKTQEHFLGLIDWIEAHRPEPSMAKI--CAMNGDGPAVVVSSG  147

Query  1238  QRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
             Q FPV+KI+FGWGKPA  SYHFPW G+SGYVMPMPSPKGNGDWIVYMHL K K+ELI+  
Sbjct  148   QHFPVKKINFGWGKPALWSYHFPWAGKSGYVMPMPSPKGNGDWIVYMHLLKWKIELIKAS  207

Query  1418  ASHVFKPFTSDHLNF  1462
               HVFK  T+++LN 
Sbjct  208   PYHVFKSVTANYLNL  222


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  506  VQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCF  652
            +Q T+LKCGGI+V   FDHRVADAYSAN+FLVSWSE+AQ+K LSQLP F
Sbjct  1    MQVTQLKCGGIIVGCTFDHRVADAYSANLFLVSWSELAQSKPLSQLPSF  49



>ref|XP_009114984.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Brassica 
rapa]
Length=440

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 144/398 (36%), Positives = 208/398 (52%), Gaps = 21/398 (5%)
 Frame = +2

Query  284   TLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKLNLYKPDD  457
             +LKA+L+E L  FY  AG++  N     EP ++CNN G   VQA A+ +L+ L+ Y  D 
Sbjct  57    SLKASLAETLNYFYPFAGQIVPNETSHEEPIILCNNNGALLVQARANTDLKSLDFYNLDA  116

Query  458   SVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLS  637
              ++ KLV       L +QATE +CGG  +   FDH + DA S   FL +WSEI++ + +S
Sbjct  117   FLQAKLVRVNPDFPLQIQATEFECGGFSLTFTFDHALGDASSFAKFLTTWSEISRKQPVS  176

Query  638   QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAEQIRELQS  811
               P  RR+ L PR P  Y   LD  ++  S  + + +  PK  I R+Y + A  I  LQ 
Sbjct  177   CEPDHRRNLLLPRSPLRYHPLLDKTFIKCSVEEIKNIPTPKTLIKRLYHINASSINALQD  236

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENK  991
              AN      +    RTK+EAF A++WK +         K  K+G +VDGR RL       
Sbjct  237   LAN------VNGESRTKIEAFSAYVWKKMVDSI-ESGHKTCKMGWLVDGRGRLE------  283

Query  992   AKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHR  1171
                   Y GNVLS    E  I+ L++  ++ +A  VHE + E     HF  LIDW+E+HR
Sbjct  284   -TVASSYIGNVLSIAVGEAPIENLKQNKVSEIAKIVHESITEVTNNTHFTDLIDWIESHR  342

Query  1172  PEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYVMPMPSP  1348
             P   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY+   PS 
Sbjct  343   PGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPVLGTVCSTVEKIGVGYLNQRPSA  402

Query  1349  KGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
               +G W V   +  E    +E+    +F+P ++ HL  
Sbjct  403   CNDGSWSVSAIVWPELAAALES--DSLFQPMSAKHLQL  438



>ref|XP_006415323.1| hypothetical protein EUTSA_v10009746mg [Eutrema salsugineum]
 gb|ESQ33676.1| hypothetical protein EUTSA_v10009746mg [Eutrema salsugineum]
Length=446

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 144/405 (36%), Positives = 213/405 (53%), Gaps = 21/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN--LAGEPELICNNRGVDFVQAFADVELRKL  436
             TF  +V +LKA L+E L  FY  AG++ QN     EP ++CNN G   V+A A+ +L+ L
Sbjct  56    TFDSIVKSLKATLAETLNYFYPFAGQIVQNETTQEEPMIVCNNNGALLVEARANQDLKSL  115

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  D  ++ KLV       L +QATE +CGG+ +   FDH + DA S   FL SWSEI
Sbjct  116   DFYNLDALLQAKLVRVNPDFALQIQATEFECGGLSITFTFDHALGDANSFGKFLTSWSEI  175

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAE  790
             ++ + +S +P  RR+ L  R P  Y   LD  ++  S  + + +  PK  I R+Y + A 
Sbjct  176   SRNQPVSCIPDHRRNLLRARSPPRYHPLLDKTFIKCSEEEIKNIPMPKTLIKRLYHIDAL  235

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              I  L + A       +    RTK+EAF A++WK +         K  K+G +VDGR RL
Sbjct  236   SINALHALAT------VNGESRTKIEAFSAYVWKKMVDS-IESGHKTCKMGWLVDGRGRL  288

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                          Y GNVLS    E T++ L++  ++ +A+ VH  + E     HF  LI
Sbjct  289   E-------TVTSSYIGNVLSVAVGEATVENLKQNHVSEIANIVHNSINEVTNDSHFKDLI  341

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DW+E+HRP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY
Sbjct  342   DWIESHRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTIEKIGVGY  401

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS   +G W V   +  +    +E+    VF+P ++ HL  
Sbjct  402   LNQRPSACNDGSWSVSAIVWPDLAAALES--DSVFQPMSAKHLQL  444



>ref|XP_010918051.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=454

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 148/467 (32%), Positives = 228/467 (49%), Gaps = 24/467 (5%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             NS  ++ +    ++ AA     P  LP SN D L     V +F+ Y KP+          
Sbjct  8     NSKLSIRLISKSIIKAANSNTPPSVLPVSNFDHLSGRYPVTIFYAYSKPSTGD-------  60

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
                 F  ++NT+K +L+E L  F+  AG +  N  +GE E++CNN G++ ++A ADV + 
Sbjct  61    ----FDSVINTIKTSLAETLDYFFPFAGRIVPNPESGELEILCNNEGIELIEASADVSIT  116

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LN Y  +DSV+  ++P   +  LSVQ T   CGG  +A  FDH +AD      FL  WS
Sbjct  117   SLNFYDLNDSVKRVMLPSTTEIPLSVQVTSYACGGFSIAWSFDHLLADGNGFVKFLFLWS  176

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS--RIYCVA  784
             E+A+  ++  +P   RS   PR P  Y   LD  +   +     A+    IS  R+Y + 
Sbjct  177   ELARTGRIPAMPNHDRSIFRPRSPPSYGPLLDRTFTACTLHDVLAMPRNDISLKRMYYIH  236

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
                I  LQ+        E     RT+ EA  A+LWK +A      +    ++G +VDGR 
Sbjct  237   GSCIDRLQATVKEGVGVE-----RTRTEAISAYLWKVLARSLGETD-TECRMGWLVDGRP  290

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
              +        + L  Y GNV+S    E + +EL+E  L++VA  V + + E     HFL 
Sbjct  291   WMV---SEPGEDLSDYVGNVVSMAVGEASTRELKEGSLSYVAGMVAQVIAEVKNKAHFLE  347

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG-QS  1321
             L+DW+E  RPE  + ++   + G A+VVSS    PV   DFG+G P  G+++       +
Sbjct  348   LLDWIECRRPEMVLARILLGLQGPAMVVSSCHNMPVMATDFGFGSPRLGTFNTALDAIGA  407

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GYV  + S + +G W ++  +       +E+    VF P T D++  
Sbjct  408   GYVNLVSSGREDGSWFIFAFIWPRLALELESDPEQVFLPITVDYIGL  454



>ref|XP_004301771.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 245/473 (52%), Gaps = 33/473 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+ T+  +V A+ P+ +PH L  SNLDLL     V  F+ Y  P+   A     E   
Sbjct  8     FEVNFTRKFIVKASNPLVKPHILTLSNLDLLSGRFPVTYFYFY--PSKPHANFNITE---  62

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
                    +LK++L++ L S+Y  AG++  N    EPE++C+N G   ++A A++ L  LN
Sbjct  63    -------SLKSSLAKTLNSYYPFAGKIVLNPSTNEPEIMCDNSGALVLEAQANIPLNTLN  115

Query  440   LYKPDDSVEG-KLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
              Y  + S+ G KLV       L +Q T   CGG+ +   FDH + DA S   FL+SWSE+
Sbjct  116   FYDLNQSLRGNKLVSIYPDIPLQIQVTYYTCGGVSITFTFDHALGDASSFGKFLLSWSEM  175

Query  617   AQAKQLSQLPCFRRSF-LFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAA  787
             A+ K +S +P  +RS  +  R P  Y  SLD  +V  +  +   +   K  + R+Y +  
Sbjct  176   ARNKSMSCVPDHQRSLRISARNPPRYHSSLDQSFVKCTMEEIMNIPTAKTLVKRLYFIEN  235

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS---GKSRRNFKN--FKLGIVV  952
               I +LQSQA           +RTK+EA  A++WKT+     G S     N   K+G +V
Sbjct  236   SSINQLQSQACR------NGKKRTKIEAVSAYVWKTMVQANIGTSTNKSHNAVCKMGWLV  289

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR+RL   D +    +  Y GNVLS  F E ++ +L++  ++ VA+ V E + +    +
Sbjct  290   DGRSRLHKRDYDPNTNMSNYIGNVLSLAFGEASVNDLKKGSISDVANMVREAISKVTNEE  349

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGA--ALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
             HFL LIDW+E HRP   + K+     G   ALV+SSG+ FPV ++DFG+G P  G+    
Sbjct  350   HFLDLIDWIECHRPGLMLSKIVLGQGGGVPALVLSSGRMFPVAELDFGFGSPVLGTVCST  409

Query  1307  WGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                    Y+   PS  G+G W +   L  E    +E+    +F+P T+D L  
Sbjct  410   IEKIGVAYMNQRPSATGDGSWTMSCILWPELAAALES--DSIFQPMTADRLQL  460



>ref|NP_174434.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAG51274.1|AC027135_15 N-hydroxycinnamoyl/benzoyltransferase, putative [Arabidopsis 
thaliana]
 gb|AAG60146.1|AC074360_11 hypothetical protein [Arabidopsis thaliana]
 gb|AEE31361.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=444

 Score =   235 bits (600),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 144/405 (36%), Positives = 214/405 (53%), Gaps = 21/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRKL  436
             +F  +V +L+++LS+ L  FY  AG++  N     EP +ICNN G  FV+A A V+L+ L
Sbjct  54    SFETIVKSLQSSLSQTLSYFYPFAGQIVPNETSQEEPMIICNNNGALFVEARAHVDLKSL  113

Query  437   NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEI  616
             + Y  D  ++ KLV       L +QATE +CGG+ +   FDH + DA S   FL  WSEI
Sbjct  114   DFYNLDAFLQSKLVQVNPDFSLQIQATEFECGGLALTFTFDHALGDASSFGKFLTLWSEI  173

Query  617   AQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAE  790
             ++ K +S +P  RR+ L  R P  YD  LD  ++  S    + +   K  I R+Y + A 
Sbjct  174   SRNKPVSCVPDHRRNLLRARSPPRYDPHLDKTFIKCSEEDIKNIPMSKTLIKRLYHIGAS  233

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              +  LQ+ A       +    RTK+EAF A++WK +         K  K+G +VDGR RL
Sbjct  234   SLDALQALAT------VNGESRTKIEAFSAYVWKKMVDSI-ESGHKTCKMGWLVDGRGRL  286

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                          Y GNVLS    E +I+ L++  ++ +A+ VH+ + E     HF  LI
Sbjct  287   E-------TVTSSYIGNVLSIAVGEASIENLKKNHVSDIANIVHKSITEVTNDTHFTDLI  339

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GY  1327
             DW+E+HRP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY
Sbjct  340   DWIESHRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVGY  399

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             +   PS   +G W V   +  E    +E+    VF+P ++ HL  
Sbjct  400   LNQRPSACNDGSWSVSAIVWPELATALES--DSVFQPMSAKHLQL  442



>ref|XP_010519084.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Tarenaya 
hassleriana]
Length=446

 Score =   235 bits (600),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 148/405 (37%), Positives = 217/405 (54%), Gaps = 21/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLAG-EPELICNNRGVDFVQAFADVELRKLN  439
             +FG ++ +L+ +LSE L  FY  AG++  N A  EP +ICNN G   VQA A+ EL+ ++
Sbjct  58    SFGSIIESLRKSLSETLTYFYPFAGQIIHNKASQEPVIICNNNGALLVQAQAEYELQDID  117

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  D  ++ KLV       L VQ T   CGG+ VA  FDH + DA S   FL SWSEI+
Sbjct  118   FYNIDLVLQAKLVQVNPDFPLQVQVTGFTCGGVSVAFTFDHALGDASSFGKFLKSWSEIS  177

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYV--PISSLQPEAVEEPKISRIYCVAAEQ  793
             + + +S +P  RR  L PR P  Y   LD  ++   +  ++   V +  I R+Y V    
Sbjct  178   RKQPISCMPDHRRG-LRPRSPPTYHPLLDKSFIKCTVEEIKSIPVSKKLIKRLYHVDVSS  236

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLS  973
             I+ LQ++A   +  E+    RTK+EAF A++WK +     + +    K+G ++DGR RL 
Sbjct  237   IKALQARA--CANGEI----RTKIEAFSAYVWKKMVDCIEKSH-TTCKMGWLIDGRGRLR  289

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
                 N       Y GNVLS    E +I++L+E  ++ +A  VH+ + EA    HF  LID
Sbjct  290   AATTN-------YIGNVLSVAVGEASIQQLKEDSVSDIADIVHKAITEATNETHFADLID  342

Query  1154  WVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYV  1330
             WVE HRP   + +V     G ALV+SSG+RFPV ++DFG+G P  G+           Y+
Sbjct  343   WVECHRPGLMLSRVVLGQGGPALVLSSGRRFPVAELDFGFGAPLLGTVCSTVKNIGVCYL  402

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
                PS   NG W +   +  E    +E+    VF+P ++ HL  +
Sbjct  403   NQRPSAWSNGSWTISAIVWPELAAALES--DTVFQPMSAKHLQLH  445



>ref|XP_010499698.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=444

 Score =   235 bits (599),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 165/464 (36%), Positives = 237/464 (51%), Gaps = 33/464 (7%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEP-HYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHA  259
             F+VS T   +V A+    E  + L  SNLDLL     V  F+ Y K    S QT      
Sbjct  4     FDVSFTGEFIVKASGDQPEKVNSLTLSNLDLLSGRFPVTYFYFYPKQPNVSFQT------  57

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAG--EPELICNNRGVDFVQAFADVELRK  433
                  +  +L+A+LSE L  F+  AG++  N A   EP +ICNN G   ++A A V+L+ 
Sbjct  58    -----IFKSLQASLSETLNYFHPFAGQIVTNEASQEEPIIICNNNGALLLEARASVDLKS  112

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             L+ +  D  ++ KLV       L +QATE +CGG+ +   FDH + DA S   FL  WSE
Sbjct  113   LDFHNLDALLQSKLVRVNPDFSLQIQATEFECGGLAMTFTFDHALGDASSFGKFLTLWSE  172

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAA  787
             I++ + LS +P  RR+ L  R P  YD  LD  ++  S    + +  PK  I R+Y + A
Sbjct  173   ISRNQPLSFVPDHRRNLLRARSPPRYDPHLDKTFIKCSEEDIKNIPMPKTLIKRLYHIDA  232

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
               I  LQ  A       +    RTK+EAF A++WK +         K  K+G +VDGR R
Sbjct  233   SSIDMLQVLAT------VNRESRTKIEAFSAYVWKKMVDSI-ESGHKTCKMGWLVDGRGR  285

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             L             Y GNVLS    E TI+ L++  ++ +A+ VH+ + E     HF  L
Sbjct  286   LE-------TVTSSYIGNVLSVAVGEATIENLKQNHVSEIANIVHKSITEVTNDTHFTDL  338

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             IDW+E+HRP   + ++    +G ALV+SSG+RFPV ++DFG+G P  G+          G
Sbjct  339   IDWIESHRPGLMLARMVLGQEGPALVLSSGRRFPVAELDFGFGAPFLGTVCSTVEKIGVG  398

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             Y+   PS   +G W V   +  E  E  E+    VF+P ++ HL
Sbjct  399   YLNQRPSACNDGSWSVSAIVWPELAEAFES--DSVFQPMSAKHL  440



>ref|XP_008228082.1| PREDICTED: uncharacterized protein LOC103327529 [Prunus mume]
Length=181

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 134/179 (75%), Gaps = 5/179 (3%)
 Frame = +2

Query  938   LGIVVDGRTRLS---IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEF  1108
             +GIVVDGRTR +       ++A  +  YFGNVLS PF  + +++L EK LNWVA  VH+F
Sbjct  1     MGIVVDGRTRFNERGNYQSHQASHMATYFGNVLSIPFGGEKVEDLVEKSLNWVADEVHDF  60

Query  1109  LEEALTGDHFLGLIDWVEAHRPEPAIPKVH--DCVDGAALVVSSGQRFPVRKIDFGWGKP  1282
             L+ ALT +HFLGLIDWVE H+P PA+ K++     +G A VVSSGQRFPV K+DFGWG P
Sbjct  61    LKCALTKEHFLGLIDWVEVHKPVPALAKIYYSRSEEGPAFVVSSGQRFPVSKVDFGWGLP  120

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
              FGSYHFPWGG +GYVMPMPSP   GDWIVYMH+ K ++ELIE  A+HVF+P T D+L+
Sbjct  121   VFGSYHFPWGGNAGYVMPMPSPARKGDWIVYMHIFKGQLELIEKEAAHVFRPLTFDYLS  179



>emb|CBI33421.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   228 bits (581),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  275  MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPD  454
            MV  LK A+++ALV +YA AGE+  N  GE EL+CNNRGVDF++A+ADV+L+ LNLY PD
Sbjct  1    MVRVLKEAMAQALVPYYAFAGEILSNSLGEAELLCNNRGVDFLEAYADVKLQDLNLYNPD  60

Query  455  DSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL  634
            +S+EGKL P +K GVLSVQ TELKCGGIVVA  FDHR+ADAYS NMFLVSW+E+AQ+K L
Sbjct  61   ESIEGKLAPTRKHGVLSVQVTELKCGGIVVACTFDHRIADAYSTNMFLVSWAEMAQSKPL  120

Query  635  SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEP  757
            S +P FRRS L PR P  Y LSLD+MYVPIS+L P  V +P
Sbjct  121  SVIPSFRRSLLNPRHPGSYALSLDHMYVPISALPPPKVPQP  161


 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 6/126 (5%)
 Frame = +2

Query  1097  VHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCV----DGAALVVSSGQRFPVRKID  1264
             VH+FLE A+T +HFLGLIDWVEAHRPEPA   ++ C     DG   +VSSGQRFPV K+D
Sbjct  190   VHDFLEAAMTKEHFLGLIDWVEAHRPEPA--ALNMCCSGNSDGPGFMVSSGQRFPVTKVD  247

Query  1265  FGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT  1444
             FGWGKPA GSYHFPWG + GYVMPMPSP  +GDW+VYMHL K ++ELIET A+ +F P T
Sbjct  248   FGWGKPALGSYHFPWGAEVGYVMPMPSPTVDGDWVVYMHLLKAQIELIETEAADIFSPLT  307

Query  1445  SDHLNF  1462
             +DHLN 
Sbjct  308   ADHLNL  313



>ref|XP_010056138.1| PREDICTED: anthranilate N-benzoyltransferase protein 1 [Eucalyptus 
grandis]
 gb|KCW72727.1| hypothetical protein EUGRSUZ_E01171 [Eucalyptus grandis]
Length=454

 Score =   232 bits (591),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 163/466 (35%), Positives = 244/466 (52%), Gaps = 26/466 (6%)
 Frame = +2

Query  80    NFNVSVTKNEVVAAALPVQEP-HYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEH  256
              F V+V+K  +V +  P+++P   L  SNLDLL     V  F+ Y+KPA           
Sbjct  10    GFMVNVSKKSIVKSITPLEDPPQVLSLSNLDLLSGRFPVTYFYFYRKPA---------ND  60

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLA-GEPELICNNRGVDFVQAFADVELRK  433
                F  +V  LK++L+  L  FY  AG +  NL+ GEPE++C+N G   ++A A  +L+K
Sbjct  61    GGNFASIVEALKSSLAVTLSYFYPFAGRILSNLSTGEPEIVCDNTGALLLEADASSDLKK  120

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             L+    +  ++GKLV  +    + VQ T+  CGGI +   FDH + DA + + FL+SWSE
Sbjct  121   LDFRDINQFMQGKLVHIQPDFPVQVQVTKYTCGGISLTFSFDHALGDATAFHRFLLSWSE  180

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAA  787
             I++   +S  P   R+ L  R P  Y  SLD  ++  +      +  PK  + R+Y V  
Sbjct  181   ISRNVPISCRPDHSRN-LRARIPPTYHPSLDQAFLKCTMEDILNIPTPKTLLKRLYHVEY  239

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
             E I +LQ  A   S+D      RTK+EAF A+LWK +      +     K+G +VDGR R
Sbjct  240   ESINKLQKLA---SSDGRS---RTKIEAFSAYLWKMMVRAIDVKFHATCKMGWLVDGRRR  293

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             +  G+ + +     Y GNVLS    E +I EL+   +  V+S VHE + +  T  HFL L
Sbjct  294   MRNGESDPSP---DYIGNVLSLAVGEASIAELKNGTIADVSSKVHEAISKVTTRSHFLDL  350

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
             IDW+E HRP   + +V     G  LVVSSG+RFPV ++DFG+G+P  G+          G
Sbjct  351   IDWIECHRPGLMLARVVLGQGGPTLVVSSGRRFPVAELDFGFGRPVLGTVCSTIEKIGVG  410

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             YV    S +G+G W +   L  E     ++    + +P ++ +L  
Sbjct  411   YVNQRASARGDGSWTLSAILWPELAAAFDS--DPIIQPMSTRYLQL  454



>emb|CAN83973.1| hypothetical protein VITISV_018429 [Vitis vinifera]
Length=414

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 156/265 (59%), Gaps = 60/265 (23%)
 Frame = +2

Query  260   TTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
              TFG MV  LK A+++ALVS+YA AGEV  N  GEPEL+CNNRGVDF +A ADV L  LN
Sbjct  126   CTFGSMVGVLKKAMAQALVSYYAFAGEVVGNSVGEPELLCNNRGVDFTEAHADVRLEDLN  185

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             LY PD                    TELKCGG+VVA  FDHR+ADAYSAN+FLVSW+E+A
Sbjct  186   LYNPD-------------------VTELKCGGLVVACTFDHRIADAYSANLFLVSWAEMA  226

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----ISRIYCVA  784
             Q+K LS +P FRRS L  RRP+ YD SLD+MYVPIS+L+P   ++P      ISRIY + 
Sbjct  227   QSKPLSIVPSFRRSLLNIRRPSSYDPSLDDMYVPISALRPPRAQQPGGADHLISRIYHIV  286

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A+                                   V    ++R     K+GIVVDGR 
Sbjct  287   AKS---------------------------------AVVENDNKR---ICKMGIVVDGRR  310

Query  965   RLSIGDENKAKFLQGYFGNVLSFPF  1039
             RLS GDE+KA  +  YFG VLS PF
Sbjct  311   RLSSGDEDKAAVMATYFGKVLSIPF  335


 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +2

Query  1211  GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGN-GDWIVYMHLQ  1387
             G  L +  G+ FP  K+DFGWG+PA GSYHFPW G++GYVMPMPSP G+ GDW+VYMHL 
Sbjct  328   GKVLSIPFGRTFPASKVDFGWGRPALGSYHFPWDGEAGYVMPMPSPAGDGGDWVVYMHLL  387

Query  1388  KEKVELIETYASHVFKPFTSDHLNF  1462
             K ++ELIET A+HVF+P TS++LN 
Sbjct  388   KGQIELIETEAAHVFRPLTSEYLNL  412



>gb|KFK44930.1| hypothetical protein AALP_AA1G321300 [Arabis alpina]
Length=443

 Score =   230 bits (587),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 144/405 (36%), Positives = 213/405 (53%), Gaps = 20/405 (5%)
 Frame = +2

Query  263   TFGWMVNTLKAALSEALVSFYALAGE-VEQNLAGEPELICNNRGVDFVQAFADVELRKLN  439
             TF  +V +LK +L+E L  FY  AG+ V      EP +ICNN G   V+A A+++L+ LN
Sbjct  54    TFDSIVKSLKTSLAETLNYFYPFAGQIVPDETTQEPMIICNNNGALLVEARANLDLKSLN  113

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              Y  D  ++ KLV       L +QATE +CGG+ +   FDH + DA S   FL SWSEI+
Sbjct  114   FYNLDMFLQAKLVRVNPDYALQIQATEFQCGGLSITFTFDHALGDASSFGKFLTSWSEIS  173

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK--ISRIYCVAAEQ  793
             + + +S  P  RR+ L  R P  Y   LD  ++  +  + + +   K  I R+Y + A  
Sbjct  174   RKQPVSCEPDHRRNLLRARSPPRYHPLLDKTFIKCNEEEIKNIPMSKTLIKRLYHIDASS  233

Query  794   IRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLS  973
             I  LQ+ A       +K   RTK+EAF A++WK +         K  K+G +VDGR RL 
Sbjct  234   IDALQALAT------VKGESRTKIEAFSAYVWKKMVDA-IESGHKTCKMGWLVDGRGRLE  286

Query  974   IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLID  1153
                         Y GNVLS    E T++ L++  ++ VA+ VH+ + EA    HF  LID
Sbjct  287   -------TVTSSYIGNVLSVAVGEATVENLKQNHVSEVANIVHKSITEATNDTHFRDLID  339

Query  1154  WVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-GYV  1330
             W+E +RP   + +V    +G ALV+SSG+RFPV ++DFG+G P  G+          GY+
Sbjct  340   WIENNRPGLMLARVVLGQEGPALVLSSGRRFPVAELDFGFGSPFLGTVCSTVEKIGVGYL  399

Query  1331  MPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
                PS   +G W V   +  E    +E+    +F+P ++  L  +
Sbjct  400   NQRPSACNDGSWSVSAIVWPELAAALES--DSIFQPMSAKCLQLH  442



>gb|EEE61652.1| hypothetical protein OsJ_16104 [Oryza sativa Japonica Group]
Length=416

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 162/418 (39%), Positives = 205/418 (49%), Gaps = 91/418 (22%)
 Frame = +2

Query  197   VFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELI  376
             VF CY+ PA ++A                          V FY LAGEV  N  GEPEL+
Sbjct  49    VFLCYRHPAPSAAALKEALAKAL----------------VPFYPLAGEVVANGDGEPELL  92

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQG-VLSVQATELKCGGIVVAVK  553
             C+ RGVDF ++ A  E+R L +   D+ VE KLVP KK   V++VQ T+ KCGG VV   
Sbjct  93    CSGRGVDFTESVAGEEMRGLRIGMVDERVE-KLVPAKKAASVMAVQVTKFKCGGAVVGCT  151

Query  554   FDHRVADAYSANMFLVSWSEIAQ-------AKQLSQLPCFRRSFL-----FPRRPAHYDL  697
             FDHRV DAYS NMFLV+W+  A+       A     +P FRRS +      P R    D 
Sbjct  152   FDHRVCDAYSFNMFLVAWAAAARDGHGGGTAPPPPTIPSFRRSIVAPRDPPPPRSPSTDA  211

Query  698   SLDNMYVPISS--LQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEA  871
              +D ++ P+ S    P+      ++RIY VAA     LQ  A          P RTKLEA
Sbjct  212   LIDRLFAPLGSAPPPPDDAAAAAVNRIYRVAAADAASLQDSAG---------PGRTKLEA  262

Query  872   FCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKT  1051
             F A     VA+ +           ++ D       GD ++                    
Sbjct  263   FTA---PPVAAQRQGGGGGACAPRLLAD-----VAGDVHR--------------------  294

Query  1052  IKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH----DCVDGAA  1219
                       WVA        EA TGDHF GL+DWVEA RP+PA  + +       D AA
Sbjct  295   ----------WVA--------EAATGDHFRGLVDWVEARRPKPAAARAYLGGTGGGDAAA  336

Query  1220  LVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKE  1393
              +VSSG  FPV + DFG G PAF SYHFPW   +GYVMPMPS +G+GDW+VY+H+  E
Sbjct  337   CIVSSGMGFPVGEADFGTGAPAFASYHFPWPAGAGYVMPMPSARGDGDWVVYVHVSPE  394



>emb|CBI33415.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  1037  FEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC--VD  1210
             + +KTI EL+EKPL+WVA A+HE+LE A+T +HFLGLIDWVEAHRPEPA+ K++     D
Sbjct  128   WPKKTINELKEKPLSWVADAIHEYLEGAVTKEHFLGLIDWVEAHRPEPALAKIYSSGSRD  187

Query  1211  GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQK  1390
             G A VVSSGQRFP  ++DFGWG PA GSYHFPWGG++GYVMPMPSP  +GDW+VYMHL  
Sbjct  188   GPAFVVSSGQRFPASRVDFGWGMPALGSYHFPWGGEAGYVMPMPSPVRDGDWVVYMHLSV  247

Query  1391  EKVELIETYASHVFKPFTSDHLNFN  1465
              +VE IET A+H+F+P +S++LN +
Sbjct  248   GQVEWIETEAAHIFRPLSSEYLNLS  272


 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 5/150 (3%)
 Frame = +2

Query  401  VQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAY  580
            ++A+ADV+L+ LNLY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAY
Sbjct  1    MEAYADVQLQNLNLYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAY  60

Query  581  SANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
            SANMFLVSW+E+AQ+K LS LP FRRS L  RRP  YD SLD+MYVP+S+L P   + P 
Sbjct  61   SANMFLVSWAEMAQSKPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMSALPPP--KAPH  118

Query  761  ISRIYC---VAAEQIRELQSQANHYSADEL  841
            +S ++C      + I EL+ +   + AD +
Sbjct  119  LSVLFCGRWWPKKTINELKEKPLSWVADAI  148



>emb|CBI33403.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +2

Query  1037  FEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC--VD  1210
             + +KTI EL+EKPL+WVA A+HE+LE A+T +HFLGLIDWVEAHRPEPA+ K++     D
Sbjct  128   WPKKTINELKEKPLSWVADAIHEYLEGAVTKEHFLGLIDWVEAHRPEPALAKIYSSGSRD  187

Query  1211  GAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQK  1390
             G A VVSSGQRFP  ++DFGWG PA GSYHFPWGG++GYVMPMPSP  +GDW+VYMHL  
Sbjct  188   GPAFVVSSGQRFPGSRVDFGWGMPALGSYHFPWGGEAGYVMPMPSPVRDGDWVVYMHLSV  247

Query  1391  EKVELIETYASHVFKPFTSDHLNFN  1465
              ++E IET A+H+F+P +S++LN +
Sbjct  248   GQIEWIETEAAHIFRPLSSEYLNLS  272


 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 5/150 (3%)
 Frame = +2

Query  401  VQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAY  580
            ++A+ADV+L+ LNLY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAY
Sbjct  1    MEAYADVQLQNLNLYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAY  60

Query  581  SANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
            SANMFLVSW+E+AQ+K LS LP FRRS L  RRP  YD SLD+MYVP+S+L P   + P 
Sbjct  61   SANMFLVSWAEMAQSKPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMSTLPPP--KAPH  118

Query  761  ISRIYC---VAAEQIRELQSQANHYSADEL  841
            +S ++C      + I EL+ +   + AD +
Sbjct  119  LSVLFCGRWWPKKTINELKEKPLSWVADAI  148



>emb|CBI33419.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +2

Query  1043  EKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDC--VDGA  1216
             +KTI EL+EKPL+WVA A+HE+LE A+T +HFLGLIDWVEAHRPEPA+ K++     DG 
Sbjct  130   KKTINELKEKPLSWVADAIHEYLEGAVTKEHFLGLIDWVEAHRPEPALAKIYSSGSRDGP  189

Query  1217  ALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEK  1396
             A VVSSGQRFP  ++DFGWG PA GSYHFPWGG++GYVMPMPSP  +GDW+VYMHL   +
Sbjct  190   AFVVSSGQRFPGSRVDFGWGMPALGSYHFPWGGEAGYVMPMPSPVRDGDWVVYMHLSVGQ  249

Query  1397  VELIETYASHVFKPFTSDHLNFN  1465
             +E IET A+H+F+P +S++LN +
Sbjct  250   IEWIETEAAHIFRPLSSEYLNLS  272


 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 5/150 (3%)
 Frame = +2

Query  401  VQAFADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAY  580
            ++A+ADV+L+ LNLY PD+S+E KLVPKKK GVLSVQ TELKCGG+VVA  FDHR+ADAY
Sbjct  1    MEAYADVQLQNLNLYNPDESIESKLVPKKKHGVLSVQVTELKCGGVVVACTFDHRIADAY  60

Query  581  SANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK  760
            SANMFLVSW+E+AQ+K LS LP FRRS L  RRP  YD SLD+MYVP+S+L P   + P 
Sbjct  61   SANMFLVSWAEMAQSKPLSVLPSFRRSLLNARRPGSYDPSLDDMYVPMSTLPPP--KAPH  118

Query  761  ISRIYC---VAAEQIRELQSQANHYSADEL  841
            +S ++C      + I EL+ +   + AD +
Sbjct  119  LSVLFCGKWGPKKTINELKEKPLSWVADAI  148



>ref|XP_008800447.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=454

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 222/467 (48%), Gaps = 24/467 (5%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
              S  ++ +    +V AA        +P SN D L     V +F+ Y+KP+          
Sbjct  8     TSELSIRLISKSIVKAANSNAPLSVIPVSNFDHLSGRYPVTIFYAYRKPSTGD-------  60

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNL-AGEPELICNNRGVDFVQAFADVELR  430
                 F  +VN +K +L+E L  F   AG +  N   GEPE++CNN G++ ++A ADV + 
Sbjct  61    ----FNSVVNAIKTSLAETLNYFLPFAGRIVPNPETGEPEILCNNEGIELIEASADVSIT  116

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              LN +  +DSV+  ++P   +  LSVQ T   CGG  +   FDH +AD      FL  WS
Sbjct  117   SLNFHDLNDSVKRVMLPLPTEIPLSVQVTGFACGGFSMVWSFDHLLADGAGFIKFLHLWS  176

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS--RIYCVA  784
             E+A+  ++   P   RS   PR P  Y   LD  +         A+    IS  R Y + 
Sbjct  177   ELARTGRIPVTPNHDRSIFRPRSPPSYGPLLDRTFTGCKLHDVLAMPRNDISLKRAYYIH  236

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
                I  LQ+ A+     E     RT+ EA  A+LWK +A      +    K+G +VDGR 
Sbjct  237   GSCIDRLQAAASKGGGVE-----RTRTEAISAYLWKLLARSLGETD-TGCKMGWLVDGRP  290

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
              +    +     L  Y GN++S    E +  EL+E  L++VA    + +EE     HFL 
Sbjct  291   WMRSEPDGD---LSNYVGNLVSMAVGEASAGELKEGSLSYVAEMAAQVIEEVKNKAHFLE  347

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGG-QS  1321
             L+DW+E  RPE  + ++   + G A+VVSS    PV   DFG+G P  G+++       +
Sbjct  348   LLDWIECRRPEMVLARILLGLKGPAVVVSSCHNMPVMATDFGFGSPRLGTFYTVLDAIGA  407

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GYV  + S + +G   V+  +       +E+    VF P T+D++  
Sbjct  408   GYVNLISSGREDGSSFVFAFIWPRLALELESDPEQVFLPVTADYIGL  454



>ref|XP_006432870.1| hypothetical protein CICLE_v10003778mg [Citrus clementina]
 gb|ESR46110.1| hypothetical protein CICLE_v10003778mg [Citrus clementina]
Length=414

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 151/470 (32%), Positives = 224/470 (48%), Gaps = 67/470 (14%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +++  F V  T   +V A  P+ EPH L  SNLDLL     V  F+ Y++P         
Sbjct  7     SADGKFEVKPTGKSIVKAIGPLPEPHTLQLSNLDLLSGRFPVTYFYFYRRP---------  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
                   +  ++ TL+ +L++ L  +Y  AG + QN    EPE+IC+N G   ++A A++ 
Sbjct  58    --FGKNYPLIIQTLRISLAKTLNFYYPFAGRIIQNPQTNEPEIICDNNGALVLEAEANIP  115

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L   + Y  ++S++GKLV  +    L +Q T   CGGI +   FDH + DA S   FLVS
Sbjct  116   LVNHDFYNLNESLQGKLVSIQPDFPLQIQVTSYTCGGISITFSFDHALGDASSFGKFLVS  175

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKI--SRIYC  778
             WSEIAQ K ++  P  RR+ L  R P  Y  SLD  +V  +  +   +    I   R+Y 
Sbjct  176   WSEIAQQKPITCSPDLRRN-LRARFPPSYHPSLDQTFVKCTIEEISNIPSTNILLKRLYH  234

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
             + A  I  LQ  A+      +K  +RTK+EAF A++WK + +    ++ K  K+G +VDG
Sbjct  235   IDASSISRLQQLAS------VKGKKRTKVEAFSAYIWKIMVTSIDEKHGK-CKMGWLVDG  287

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R R+ +  EN    +  Y GNVLS    E +                             
Sbjct  288   RCRI-LKHENP---MSSYIGNVLSLAVGEAS-----------------------------  314

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY-HFPWGG  1315
                      HRP   + +V    DG  +VVSSG+RFPV ++DFG+G P  G+        
Sbjct  315   --------CHRPGLMLARVVLGRDGPTVVVSSGRRFPVAELDFGFGNPVLGAVSSIIERS  366

Query  1316  QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFT-SDHLNF  1462
               GY+   PS   +G W V   L  E    +E+    +F+P + +DHL  
Sbjct  367   GVGYINQRPSATCDGSWTVSAILWPELATALES--DSIFQPMSAADHLQL  414



>gb|EPS71697.1| hypothetical protein M569_03062 [Genlisea aurea]
Length=449

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/473 (31%), Positives = 229/473 (48%), Gaps = 44/473 (9%)
 Frame = +2

Query  65    MASNSNFNVSVTKNEVVAAALPVQ-EPHYLPHSNldlllppvdvGVFFCYQKPAAASAQT  241
             M +  +FN+++   +++        +PH +  SNLDLL     V   F Y   + +S+  
Sbjct  1     MTTTESFNLTILDKKLIKIQQQDDGDPHVISPSNLDLLSGRFPVTYLFIYAHSSPSSSN-  59

Query  242   TTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNR---GVDFVQA  409
                              A+LSE+L  FY  A  +  N  +G+ E++C +    GV FV A
Sbjct  60    ---------------FLASLSESLRIFYPFAARIAHNPNSGDLEIVCGDTSTGGVLFVHA  104

Query  410   FADVELRKLNLYKPDDSVEGKLVPKKKQGV-LSVQATELKCGGIVVAVKFDHRVADAYSA  586
              A+V L   +LY  D  +EGKLVP     +   +Q T   CG   V   FDH + DA + 
Sbjct  105   AANVSLDDFDLYDLDRILEGKLVPVGDTDLGFKIQITTFACGSTAVTFTFDHLLGDASAF  164

Query  587   NMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPE---AVEEP  757
               FL ++SEIA  K +S  P   R+ L PR P  YD ++D+ +V  +  Q      +  P
Sbjct  165   AKFLSTFSEIALRKPVSCSPDHTRN-LKPRNPPVYDPAMDDSFVACTMEQIRNMPTIALP  223

Query  758   KISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFK  937
              I R+Y V    I  LQ  A           +RTK+EAF +++WK +A+    +  K  +
Sbjct  224   LIKRLYRVEKASIERLQGLAGENGT------KRTKIEAFSSYIWKIMAASIKNKG-KRCR  276

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEE  1117
             +G +VDGR R+S      +K ++ Y GNV+S    E  ++ +RE  +  +A  VH  + E
Sbjct  277   MGWLVDGRRRMS------SKSMENYIGNVVSIASGEMEVRAIRESSIADMAETVHRSISE  330

Query  1118  ALTGDHFLGLIDWVEAHRPEPAIPK----VHDCVDGAALVVSSGQRFPVRKIDFGWGKPA  1285
                  HF  LIDW+E  +    +      + D  D   +VVSSG+RFPVR++D G+G P 
Sbjct  331   VTVESHFRNLIDWIECKKRAGGLVSSKLVLGDGGDCPCIVVSSGRRFPVREVDLGFGNPV  390

Query  1286  FGSYHFPWGGQS-GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPF  1441
              G+          GY+       G+G W V + L +E V+ +E++   +F+P 
Sbjct  391   LGTVCSSVERLGVGYINQREGGSGDGSWTVSVILWREMVDAMESHPDSIFRPL  443



>ref|XP_002519902.1| transferase, putative [Ricinus communis]
 gb|EEF42506.1| transferase, putative [Ricinus communis]
Length=392

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 138/467 (30%), Positives = 218/467 (47%), Gaps = 79/467 (17%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             A      V +TK  ++ A   + +P  L  SNLDLL     V   + Y  P AAS     
Sbjct  3     AGQGKLEVFITKKSIIRAINSLPKPQILTLSNLDLLSGRFPVTYLYFYPNPEAAS-----  57

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVE  424
                   F  ++ ++K +L+E L  +Y  AG + QN +  EPE++C+N G   V+  A++ 
Sbjct  58    ------FTSIIESVKCSLAETLSYYYPFAGRIVQNPVTAEPEIVCDNNGALVVEGHANIS  111

Query  425   LRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
             L+KL  Y  +  ++GKLV       L VQ T   CGGI +A  FDH              
Sbjct  112   LKKLEFYNLNQCLQGKLVSISPDFPLHVQVTHYTCGGISIAFNFDH--------------  157

Query  605   WSEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVA  784
                                            +LD + +P +++         + R+Y + 
Sbjct  158   -------------------------------ALDIINMPTTNIL--------LKRLYHID  178

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRT  964
             A  I +LQ  A           +RTK+EAF A++WK + +   +++ +  K+G +VDGR 
Sbjct  179   ASSINKLQHIACANGN------KRTKIEAFSAYIWKIMVTAIDKKH-ERCKMGWLVDGRG  231

Query  965   RLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
             R+  G ++    +  Y GNVLS    E ++ EL+   ++ +A+ VHE + +     HF  
Sbjct  232   RMH-GAQDP---MSDYIGNVLSVTVGEASVAELKLGSISDIAAIVHETISKVTDEKHFQD  287

Query  1145  LIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-  1321
             LIDW+E HRP   +PK+     G A+V+SSG+RFPV +++FG+G P  G+          
Sbjct  288   LIDWIECHRPGLMLPKIVLGRGGPAVVLSSGRRFPVAELNFGFGSPVLGTVCSTIEKIGV  347

Query  1322  GYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             GY    PS + +G W V   L  E    +E+    +F+P + +HL  
Sbjct  348   GYFNQRPSAQNDGSWTVSAILWPELAAALES--DPIFEPMSVNHLQL  392



>emb|CBI29221.3| unnamed protein product [Vitis vinifera]
Length=450

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 148/466 (32%), Positives = 212/466 (45%), Gaps = 70/466 (15%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
             F V+ T   V+ A  P+ EPH +  SNLDLL     V  F+ Y +P              
Sbjct  49    FEVNFTSKTVIKAIGPLPEPHIITLSNLDLLSGRFPVTYFYFYHRPVLDD----------  98

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLN  439
              F  ++  LK +L++ L  +Y  +G + +N    EPE+IC+N G   V+A A++ L+ L+
Sbjct  99    -FSSIIEALKCSLAKILNHYYPFSGRIAENPNTNEPEIICDNSGALVVEAHANIPLKDLD  157

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
              +  + S++GKLV    +    VQ T   CGGI +   FDH + DA +   FL SWSEIA
Sbjct  158   FHNLNLSLQGKLVSINPEFPFQVQVTNYTCGGISITFTFDHALGDASAFGKFLFSWSEIA  217

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS----RIYCVAA  787
               + LS +P  RR+ L  R P  YD  LD  +V  +    E V  P ++    R+Y V A
Sbjct  218   LRRPLSCIPDHRRN-LHARCPPTYDPLLDRTFVKCT--MEEIVNIPTMNTLLKRLYHVDA  274

Query  788   EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTR  967
               I  LQ  A       L   +RTK+EAF A+LWK +      ++ K   +G +VDGR  
Sbjct  275   SSINHLQKLAC------LNGHKRTKIEAFSAYLWKVMVKAIDEKHEK-CNMGWLVDGRMS  327

Query  968   LSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGL  1147
             +  G  +    L  Y GNVLS    E +                                
Sbjct  328   MCGGQNS----LSNYIGNVLSVAVGEAS--------------------------------  351

Query  1148  IDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQS-G  1324
                   HRP   + +      G  LVVSSG+RFPV ++DFG+G P  G+          G
Sbjct  352   -----CHRPGLMLSRTVLGRGGPTLVVSSGRRFPVSELDFGFGTPVLGTVCSTIERLGVG  406

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             Y+    S +G+G W V   L  E    +E+    + +P T+ HL  
Sbjct  407   YINQRQSARGDGSWTVSAILWPELAAALES--DSILQPMTATHLQL  450



>ref|XP_010555967.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Tarenaya hassleriana]
Length=235

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 144/229 (63%), Gaps = 20/229 (9%)
 Frame = +2

Query  317  SFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQG  496
            ++YA AGE+  N  GEPEL+CNN GV+F +A A V L  L+L   + S+  +L P+KK+G
Sbjct  6    NYYAFAGEITTNSLGEPELLCNNYGVEFSEARAYVNLHDLDLL--EKSIY-RLFPEKKRG  62

Query  497  VLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCFRRSFLFPR  676
            V+ VQATEL  G ++V  + DHR+ADAYSAN+F VSW+E A++  +S +P FRRS L  R
Sbjct  63   VMVVQATELNYGSLIVTCRVDHRIADAYSANLFFVSWAESARSMPISIVPSFRRSLLSSR  122

Query  677  RPAHYDLSLDNMYVPISSLQ--PEAVEEPK--------ISRIYCVAAEQIRELQSQANHY  826
             P  +  S+D +Y+P+ S+   P+    P         +SR++ + A +I E+Q  A+  
Sbjct  123  HPPKHSPSMDELYMPLPSVSSPPKPKRNPDSDSDLDEFVSRVFYIEASKIDEIQCLASS-  181

Query  827  SADELKHPRRTKLEAFCAFLWKTVASGKSRR-NFKNFKLGIVVDGRTRL  970
                 ++ R TKLEAFCAFLWK  A  K +    +   LGIV+DGRTRL
Sbjct  182  -----EYSRVTKLEAFCAFLWKLTAKTKQKSGGARKAALGIVIDGRTRL  225



>ref|XP_006851032.1| hypothetical protein AMTR_s00025p00227680 [Amborella trichopoda]
 gb|ERN12613.1| hypothetical protein AMTR_s00025p00227680 [Amborella trichopoda]
Length=166

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 11/176 (6%)
 Frame = +2

Query  77   SNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEH  256
            +NF V + + + V  ALP++E   +P SNLDL +PPVD GVFFCY++P            
Sbjct  2    ANFQVEIIQQDTVVPALPLEESR-VPLSNLDLFIPPVDFGVFFCYKQPLLKHG-------  53

Query  257  ATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKL  436
               +  +   LK +LSE LVS+Y L+GE+  N  G+PE++C +RGV+F++A A++EL+ L
Sbjct  54   ---YSEITGKLKKSLSEVLVSYYVLSGEIVVNNGGKPEILCGSRGVEFLEASAEIELKDL  110

Query  437  NLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVS  604
            +L+KPD+SVEGK++P KK GV  VQ T+LKCG IVVA  FDHRVADAYSANMFL+S
Sbjct  111  DLHKPDESVEGKIIPTKKWGVFCVQLTKLKCGSIVVACTFDHRVADAYSANMFLIS  166



>gb|EMT01890.1| hypothetical protein F775_20351 [Aegilops tauschii]
Length=319

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 135/238 (57%), Gaps = 27/238 (11%)
 Frame = +2

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWK---TVASGKSRRNFKNFK  937
             R Y VAA  +  L + A          P RTKLEAF A LW+     ASG  R       
Sbjct  99    REYHVAAHDVATLHASAG---------PGRTKLEAFTAHLWQLCSMAASGHQRLCC----  145

Query  938   LGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREK-PLNWVASAVHEFLE  1114
             +G+VVDGR R+      KA     YFGNVL+ P+      ELR    L  VA  VH ++ 
Sbjct  146   MGMVVDGRARMFPDGAMKA-----YFGNVLTIPYGVIGTDELRRSMTLADVADDVHRWVR  200

Query  1115  EALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGA----ALVVSSGQRFPVRKIDFGWGKP  1282
             EA TG+HF GLIDWVEA RP+PA+ + +    G     A  VSSG  FPV + DFG G P
Sbjct  201   EAATGEHFRGLIDWVEALRPKPAVARAYLGGTGGSEAMACFVSSGMGFPVGEADFGTGLP  260

Query  1283  AFGSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHL  1456
             AF SYHFPW   +GY+MPMPS +G+GDW+VY+H   E V+++E   S VFK   + ++
Sbjct  261   AFASYHFPWPADTGYIMPMPSARGDGDWVVYVHAVPELVKVMEEEPS-VFKALENSYV  317



>ref|XP_010942972.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=485

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 133/475 (28%), Positives = 219/475 (46%), Gaps = 36/475 (8%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             ++  +F V V    ++ A+    +P+ L  SNLD L   +       Y KP +    ++ 
Sbjct  24    SAGGSFQVKVISKTLIKASDTTIQPYVLHPSNLDHLPSNIPSPFITIYPKPPSGGDYSS-  82

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                      +   L+  L   L  F+   G +  +  G PE+ CNN G + V A AD+ L
Sbjct  83    ---------VAAILRRTLPTFLNYFFPFTGRIRPDENGVPEVHCNNEGAELVVARADIRL  133

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               +N +    S+E   +P  +Q  LS+Q     CGG  +     H ++D +  +     W
Sbjct  134   ADVNFHDKSKSLEPIQLPYDEQIPLSIQVVGFACGGFSIVWGGTHLLSDGHGLSFLPTLW  193

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----ISRI  772
             +E  +  QLS++P   RS   PR P  Y    D     ++ L P+ +         + R+
Sbjct  194   TEYVRTGQLSRIPNHDRSIFRPRSPPTYSPETDRS---LACLTPDDLINSLSAGAFVKRL  250

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y V  + I  L+  A+            T++EAF A+LWK +A+     +  + ++  +V
Sbjct  251   YHVEGKHIDRLRELASREGRGA------TRMEAFSAYLWKALATAVGDSDV-SCRMAWLV  303

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVA----SAVHEFLEEA  1120
             D R RL       A+ ++ Y GNV++F  +E  + EL     + VA    +AV E  + A
Sbjct  304   DARQRLG---PKYAQAMKDYMGNVITFATKEAGVAELVNGSYSQVAGMASAAVKEVADNA  360

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
                DHF  +IDWVE+H+      +V   +   ALVVSS     +  +DFG G+PA     
Sbjct  361   --EDHFQEMIDWVESHKLGKRANRVQVGLGSPALVVSSFHHIGL-NLDFGLGQPALAMAD  417

Query  1301  FPWGG-QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
              PWG   S +V+ + SPKG+G   +  ++  +  +++E+    VFKP T++ L  
Sbjct  418   LPWGRLGSAFVIVLASPKGDGSLYMNAYIWSQLADVLESDPDRVFKPATAEDLGL  472



>ref|XP_002873775.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50034.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   175 bits (443),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/382 (36%), Positives = 178/382 (47%), Gaps = 117/382 (31%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALP---VQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             FNV+ T+ EVV AA P   V E   +P SNLDLLL PVD+ V   Y+KP           
Sbjct  33    FNVTTTRKEVVVAAPPLLSVPENQIIPLSNLDLLLLPVDINVCLFYKKPLNDLTNN----  88

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRK  433
                      + LK AL+EAL S+ A                                   
Sbjct  89    ---------DALKTALAEALASYIA-----------------------------------  104

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
                         K VP KK GV ++Q TELKCG +VV   FDHR         FL+    
Sbjct  105   ------------KFVPMKKHGVFTIQVTELKCGSLVVGCTFDHR-----PTTTFLI----  143

Query  614   IAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQ-PEAVEEPK---ISRIYCV  781
                                       D S+D +Y+PI+SL  P+ +  P     SRIY +
Sbjct  144   -------------------------IDSSIDQLYMPITSLTVPQEITNPDNILTSRIYYI  178

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF---KNFKLGIVV  952
              A+ + +LQ+ A+        + +RTKLE+F AFLWK +A   +  +    KN KLGIVV
Sbjct  179   KADVLEKLQTLAS--------NGKRTKLESFSAFLWKLLAKHAATDSVLLTKNSKLGIVV  230

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR +L   +EN       YFGN+LS PF E+ I +L  KPL+WV   VH+ LE  +T D
Sbjct  231   DGRKKLMEQEEN-----CNYFGNILSVPFGEQKIDDLIHKPLSWVTDEVHKLLESTMTKD  285

Query  1133  HFLGLIDWVEAHRPEPAIPKVH  1198
             HFL LIDW+E  RP P I +++
Sbjct  286   HFLNLIDWIETRRPIPVISRIY  307



>ref|XP_008808376.1| PREDICTED: agmatine coumaroyltransferase-2-like [Phoenix dactylifera]
Length=465

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 128/472 (27%), Positives = 214/472 (45%), Gaps = 32/472 (7%)
 Frame = +2

Query  68    ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
               +S+F V +    ++ A+    +P+ L  SNLD L   +       Y KP +    ++ 
Sbjct  5     GDSSSFQVKIISKTLIKASDTTIQPYVLYPSNLDHLPSNIPSPFLTIYPKPPSGGDYSS-  63

Query  248   EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                      +  TL+  L   L  F+   G +  +  G PE+ CNN G + V A AD+ L
Sbjct  64    ---------VAATLRRTLPTFLNYFFPFTGRIRPDRNGVPEVYCNNEGAELVVARADIRL  114

Query  428   RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
               +N +    S+E   +P +++  LS+Q     CGG  +     H ++D +  +     W
Sbjct  115   ADVNFHDKSKSLERIELPYEEEIPLSIQVVGFACGGFSIVWGGTHLLSDGHGLSFLPTLW  174

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPK-----ISRI  772
             +E  +  +LS++P   RS   PR P  Y    D     ++ L P+ +         + R+
Sbjct  175   TEYVRTGELSRIPNHDRSIFRPRSPPSYSPETDR---SLACLTPDDLINSLSAGAFVKRL  231

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y V  + I  L+  A+            T++EAF A+LWK++A      +    ++  +V
Sbjct  232   YHVDGKHIDRLRELASREGRSA------TRMEAFSAYLWKSLAKAVGDSDV-GCRMAWLV  284

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG-  1129
             D R RL        + ++ Y GNV++F  +E  + EL     + VA  V   ++E     
Sbjct  285   DARQRLG---PKYTEAMKDYMGNVITFATKEAGVAELVNGSYSQVAGMVSAAVKEVADNA  341

Query  1130  -DHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFP  1306
              DHF  +IDWVE H+      +V   +   ALVVSS     +  +DFG G+ A      P
Sbjct  342   EDHFQEMIDWVEGHKVGKRANRVQVGLGSPALVVSSFHHMNM-NLDFGLGQAALAIPDLP  400

Query  1307  WGG-QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
             WG   S +V+ + SPKG+G   +  ++  +   ++E+    VFKP T++ L 
Sbjct  401   WGRLGSAFVIVLASPKGDGSLYMNAYIWSQLAVVLESDPDRVFKPATAEGLG  452



>gb|KCW74060.1| hypothetical protein EUGRSUZ_E02688 [Eucalyptus grandis]
Length=182

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = +2

Query  68   ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +   F V   K EVVAA LP+QE H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6    GAGREFMVKPGKREVVAAPLPMQE-HWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248  EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  +G +V  LKA L++ALVS+YALAGEV QN AGEPEL+CNNRGVDF++AFAD+EL
Sbjct  59   ASQRLGYGSVVGVLKATLAQALVSYYALAGEVMQNSAGEPELLCNNRGVDFIEAFADMEL  118

Query  428  RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVV  544
            R LNLY PDD+VEGKLVP KK+GVL+VQ   L    + +
Sbjct  119  RHLNLYNPDDTVEGKLVPTKKRGVLAVQVLILDTASLYI  157



>gb|KCW74065.1| hypothetical protein EUGRSUZ_E02699 [Eucalyptus grandis]
Length=191

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 117/159 (74%), Gaps = 7/159 (4%)
 Frame = +2

Query  68   ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +   F V   K EVVAA LP+Q  H+LP SNLDLLLPP+DVGVFFCY  P      TTT
Sbjct  6    GAGREFVVKSGKREVVAAPLPMQ-GHWLPLSNLDLLLPPLDVGVFFCYANP------TTT  58

Query  248  EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  +G +V  LKAAL++ALVS+YALAGEV QNLAGEPEL+CNN+GVDF++AFAD+EL
Sbjct  59   ASQRLEYGSVVGVLKAALAQALVSYYALAGEVVQNLAGEPELMCNNQGVDFIEAFADMEL  118

Query  428  RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVV  544
            R LNLY PDD+VEGKLVP KK+GVL+VQ   L    + +
Sbjct  119  RHLNLYNPDDTVEGKLVPTKKRGVLAVQVLILDTASLYI  157



>ref|XP_009391475.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=457

 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 139/472 (29%), Positives = 217/472 (46%), Gaps = 39/472 (8%)
 Frame = +2

Query  77    SNFNVSVTKNEVVAAALP-VQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             SN  + V    +V A+ P V   H LP SNLDL      V +   Y +       TT + 
Sbjct  3     SNLGMRVASRSLVKASHPSVATNHVLPVSNLDLFPNDFQVALCSIYPR------HTTGD-  55

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
                 F  + + L+  L   L  ++   G +  N   G PE+ CNN G + V A++DV L 
Sbjct  56    ----FASVADALRTCLPAFLDHYHPFTGRIVTNPETGLPEVHCNNEGAELVVAYSDVPLA  111

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              ++ +  D S+   ++P      LSVQA E  CGG  ++   +H + D YS  M      
Sbjct  112   HVDFHDTDGSLNQIVLPFAHDVPLSVQAVEFACGGFSISWGTNHLLVDGYSICMLATHLC  171

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVE--EPKISRIYCVA  784
             E+ +  +LS  P   RS   PR P  Y  +L   +VP +S     V   E  + R+Y + 
Sbjct  172   ELVRTGKLSVYPNHDRSLFLPRVPRTYSPALARSFVPCTSDNLFNVLNCEVNVRRLYYIE  231

Query  785   A---EQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVD  955
             A   +++RE  S+A           R T++EA  A++WK  A           ++  +V+
Sbjct  232   AGDIDRLRESSSKAGR---------RATRMEAVSAYIWKLFAGIVEDAGDTCCRMAWLVE  282

Query  956   GRTRLS-IGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             GR+RL  I D      +Q Y GN  +F  +E + +EL    L+ +A  V   + E    +
Sbjct  283   GRSRLKEISD------MQNYIGNTTTFATKEASTEELGSGSLSQIARVVSASIREVAKKE  336

Query  1133  HFLGLIDWVEAHRPEPA-IPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             HF  ++DW+E H+ E   + +V       A+V++S   F V  +DFG G+P       P 
Sbjct  337   HFQEMVDWMEEHKREGRWVERVSVGFGSPAVVLTSFHNFGV-DLDFGLGRPVLVMPVVPK  395

Query  1310  GGQ-SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
             G   S ++  + SPKG+G W V   +  +  + +E     +FKP TS +L  
Sbjct  396   GRLCSAFLQVVGSPKGDGSWNVSALMWPKLAKALEL--DGLFKPITSRYLGL  445



>gb|EMT15648.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=461

 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 215/471 (46%), Gaps = 27/471 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             + + ++ V    +V A+ P  +PH    SNLDL        +   Y K            
Sbjct  9     SGDLSIRVLSRRLVKASDPSTKPHVAAFSNLDLYPGNEQASIVCLYPK----------LP  58

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
             +A  F  +V T  + L   L  FY  AG +  N  +G PEL+C+N+G + V   A V + 
Sbjct  59    NAGDFPAVVATFDSILPSLLNDFYHFAGRIRTNPSSGLPELLCDNQGAELVVGEAGVAMA  118

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              L+    + S++  ++P  +   LSVQ     CGG  V    ++ V D  +  MF+  WS
Sbjct  119   SLDYGLAEQSLKKIMLPYAEDVTLSVQLLSFTCGGFSVVWATNNLVCDGQAFTMFVRRWS  178

Query  611   EIAQAKQL-SQLPCFRRSFLFPRRPAHYDLSLDNMYVPISS---LQPEAVEEPKISRIYC  778
             E+A+  ++    P   RS   PRRP  Y  S+ +M+        +      +  + R+Y 
Sbjct  179   ELARTGRIVDGPPNHDRSVFSPRRPPSYGASIRDMFATYDHDRLVNVLTAHDSFVERLYY  238

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS--GKSRRNFKNFKLGIVV  952
             + A  I  L+  A+       K  R ++++A  A+LWK +A     SR   +   +G +V
Sbjct  239   IEASDIAALREAASS------KLQRPSRVQAVSAYLWKALARVVAASRVPEERCCMGWMV  292

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             D R R+   +  +A  +  YFGNV ++   E  ++E++EK L+ VA+ V E +      +
Sbjct  293   DARRRVKAPELVRA--MGNYFGNVTAYALGEAAVEEIQEKELSEVAAMVRETITSIDYDE  350

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             +   L+DWVE H+ E  + K    +    L  +    FP+   DFG+G          +G
Sbjct  351   YTQELVDWVEEHKTERLMEKGVIGLGTPTLNQTVFASFPL-DTDFGFGHAVLAMPMCDYG  409

Query  1313  G-QSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                SGY+     P G+G W+V  ++       +E+    +FKP T+++L  
Sbjct  410   RLSSGYLSIGARPGGDGSWLVNAYIWPRLAAALESDQQRIFKPLTAEYLGL  460



>dbj|BAA92405.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
 dbj|BAA92409.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
 dbj|BAB03452.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase -like [Oryza 
sativa Japonica Group]
Length=460

 Score =   164 bits (416),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 146/489 (30%), Positives = 217/489 (44%), Gaps = 58/489 (12%)
 Frame = +2

Query  65    MASNSN---FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASA  235
             MAS  N    +V V    +V A+     PH L  SNLDL+   + V +F  Y KP+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGG-  59

Query  236   QTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAF  412
                       F  +V    A L   L  F+ LAG +  N  +G PE+ C+N+G + V   
Sbjct  60    ---------DFHDVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGE  110

Query  413   ADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ADV L  L+      SV   L+P      LSVQ     CGG  VA   +H V D  + +M
Sbjct  111   ADVALASLDYGTVGASVGKILLPYAGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  593   FLVSWSEIAQAKQLS--QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS  766
              + +WSE+A++  L+    P   RS   PR P  Y  SLD  + P+   +          
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTPLDGARQ---------  221

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGI  946
                   A  I  L+ QA           R T+++A  A+LWK +A+    R+ +  ++  
Sbjct  222   ------AADIARLREQA-----------RATRVQAVSAYLWKALAAVVGSRDAR-CRMVW  263

Query  947   VVDGRTRLSIGDENKAK-FLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
              VDGR RL++    + +  ++ Y GNV +F   E T++E++ KPL  VAS   + +    
Sbjct  264   WVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATMEEIQRKPLAEVASMARDAIAAPA  323

Query  1124  TGDHFLGLIDWVEAHRP--EPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
              G+HF  L+DWVE H+   +  I      +   A+ V++   F V   DFG G  A    
Sbjct  324   YGEHFQELVDWVEEHKAGKQRYIDTASVGLGSPAVSVTAFASFEV-DTDFGHGHAAMA--  380

Query  1298  HFPWGGQS-----GYVMPMPSP-KGNGDWIVYMHLQKEKVELIET--YASHVFKPFTSDH  1453
               P    S     G+V     P  G+G WI    L       +E+      +FKP T+++
Sbjct  381   -LPTSSSSARLCTGFVQIAARPGGGDGSWIASALLWPRLAAALESDERLGRIFKPVTAEY  439

Query  1454  LNFN*SSTT  1480
             L    +S +
Sbjct  440   LGLRPASGS  448



>gb|EAY73387.1| hypothetical protein OsI_01269 [Oryza sativa Indica Group]
Length=494

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 128/430 (30%), Positives = 196/430 (46%), Gaps = 28/430 (7%)
 Frame = +2

Query  257   ATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRK  433
             A  F  +V    A L   L  F+ LAG +  N  +G PE+ C+N+G + V   ADV L  
Sbjct  59    AGGFHDVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGEADVALAS  118

Query  434   LNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSE  613
             L+  +  +S++  L+P      LSVQ     CGG  VA   +H V D  + +M + SWSE
Sbjct  119   LDYGRVGESIQKILLPYAGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSMLVGSWSE  178

Query  614   IAQAKQLS--QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV-----EEPKISRI  772
             +A++  L+    P   RS   PR    Y  SLD  + P+       +     ++  + R+
Sbjct  179   LARSGTLAAGARPNHDRSVFRPRATPSYGASLDEAFTPLDGNGERQINVLTRDQSLVRRL  238

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             Y V A  I  LQ  A+  +AD     R T+++A  A+LWK +A G  R      ++G  V
Sbjct  239   YYVEAADIARLQEMASLPAAD---GERATRVQAISAYLWKALA-GVVRERDARCRMGWWV  294

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR RL+  +   A   + Y GNV+++   E T++E++ KPL  VAS     +      +
Sbjct  295   DGRRRLASPELRAAT--RNYVGNVVAYTVAEATVEEIQRKPLAEVASMARRAIAAPAYDE  352

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGAAL-----VVSSGQRFP--VRKIDFGWGKPAFG  1291
             HF  L+DWVE H+      +    V+ A +      VS     P      DFG+G  A  
Sbjct  353   HFQELVDWVEEHKAPAPEQEQQRYVEAATVGLGSPTVSVTAFAPSLAADTDFGYGHAAMA  412

Query  1292  SYHFPWGGQ---SGYVMPMPSPKGNGDWIVYMHLQKEKVELIET----YASHVFKPFTSD  1450
                    G    SG+V  +  P G+G     + +       +E         +FKP T++
Sbjct  413   LPVSSSSGARLCSGFVRIIARPGGDGSCFASVLVWPRLAAALEAGDGERLGRIFKPVTAE  472

Query  1451  HLNFN*SSTT  1480
             +L    +S +
Sbjct  473   YLGLRPASGS  482



>ref|XP_004971568.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Setaria 
italica]
Length=462

 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 130/450 (29%), Positives = 204/450 (45%), Gaps = 27/450 (6%)
 Frame = +2

Query  137   EPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALV  316
             +PH L  SNLDL+   +   +F  Y +P               F  +V   +A L   L 
Sbjct  29    KPHVLAVSNLDLIPQTIQTSMFCIYPRPPTGD-----------FNAVVAAFEAGLPSFLN  77

Query  317   SFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVPKKKQ  493
              F+ LAG +  N  +G PE  C+N+G + V   A V L  L+      SV     P  + 
Sbjct  78    HFFPLAGRIATNPSSGLPEFHCHNQGAELVVGEAGVPLASLDFGTMTASVRRVQQPYCED  137

Query  494   GVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQL--SQLPCFRRSFL  667
               LSVQ     CGG  VA   +H + D  + +M + +WSE+A++  L  S  P   RS  
Sbjct  138   MALSVQLVSFACGGFAVAWCTNHVLVDGSALSMLVSAWSELARSGTLCASSRPNHDRSVF  197

Query  668   FPRRPAHYDLSLDNMYVPISSLQPEAV---EEPKISRIYCVAAEQIRELQSQANHYSADE  838
              PR    Y  S +  ++P+ + +   V   E+  + R+Y + A  +  L+  A+   ++ 
Sbjct  198   RPRATPSYSASFNEAFMPLHAERQVNVLTAEQSFVERLYYIEASDVARLREAASRDGSE-  256

Query  839   LKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFG  1018
                 R T+ +A  A+LWK +A G       + ++   VDGR RL+   E +A  ++ Y G
Sbjct  257   ----RATRFQAVSAYLWKALA-GVVGTADAHCRMQWWVDGRRRLTDEPELRAA-MRNYIG  310

Query  1019  NVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVH  1198
             NV +F   E ++ E++   L  VA+ V E +     G HF  L+DWVE  R +  +    
Sbjct  311   NVTTFAIREASVDEVQRMALPDVAAMVGEAIAAPSYGQHFQELVDWVEERRADRYVETAS  370

Query  1199  DCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWGGQ--SGYVMPMPSPKGNGDWIV  1372
               +    + V++   FP+   DFG+G  A          +  SG+V     P G+G WI 
Sbjct  371   LGLGSPTVGVTAFTSFPL-DTDFGFGHAAMAMPTTSPTARLCSGFVQIAARPDGDGSWIS  429

Query  1373  YMHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                L       +E+    VFKP T+++L  
Sbjct  430   SAFLWPRLAAALESDEPCVFKPVTAEYLGL  459



>gb|KCW74064.1| hypothetical protein EUGRSUZ_E02693 [Eucalyptus grandis]
Length=185

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = +2

Query  68   ASNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTT  247
             +   F V   K EVVAA LP QE H+LP SNLDLLLPP+D+GVFFCY      +  TT 
Sbjct  6    GAGREFVVKSGKREVVAAPLPKQE-HWLPLSNLDLLLPPLDIGVFFCY------ANSTTI  58

Query  248  EEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVEL  427
                  +G +V  LKAAL++ALVS+YA+AGEV QN AGEPEL+CNN+GVDF++AF DVEL
Sbjct  59   ASQRLGYGSVVGVLKAALAQALVSYYAIAGEVVQNSAGEPELLCNNQGVDFIKAFVDVEL  118

Query  428  RKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVV  544
            R +NLY PDD+VEGKLVPK+K+GVL+VQ   L    + +
Sbjct  119  RHINLYNPDDTVEGKLVPKEKRGVLAVQVLILDTASLYI  157



>ref|XP_008361799.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Malus domestica]
Length=173

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 113/147 (77%), Gaps = 12/147 (8%)
 Frame = +2

Query  71   SNSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTE  250
            + + F V+++K EVVAAALP+QE H+LP SNLDLLL P+DVGVFFCY+            
Sbjct  2    ARAEFKVTMSKQEVVAAALPLQE-HWLPLSNLDLLLQPLDVGVFFCYKN-----------  49

Query  251  EHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELR  430
            + + +FG MV  LK A+++AL++FYA +GEV  N  GEPE++CNNRGVDF +AFADVEL+
Sbjct  50   KQSMSFGSMVGVLKKAMAQALMTFYAFSGEVVPNSVGEPEILCNNRGVDFAEAFADVELK  109

Query  431  KLNLYKPDDSVEGKLVPKKKQGVLSVQ  511
            +LNLY PD+S+EGKLVP KK GVL+VQ
Sbjct  110  ELNLYDPDESIEGKLVPNKKHGVLAVQ  136



>ref|NP_001042650.2| Os01g0261600 [Oryza sativa Japonica Group]
 dbj|BAF04564.2| Os01g0261600 [Oryza sativa Japonica Group]
Length=454

 Score =   155 bits (393),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 143/489 (29%), Positives = 212/489 (43%), Gaps = 64/489 (13%)
 Frame = +2

Query  65    MASNSN---FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASA  235
             MAS  N    +V V    +V A+     PH L  SNLDL+   + V +F  Y KP+    
Sbjct  1     MASCINGGELHVRVVHRRLVKASDESIRPHVLAVSNLDLIPRTIQVSMFCIYPKPSTGG-  59

Query  236   QTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAF  412
                       F  +V    A L   L  F+ LAG +  N  +G PE+ C+N+G + V   
Sbjct  60    ---------DFHDVVAAFAAGLPSLLNHFFPLAGRIVSNPCSGLPEIHCHNQGAELVVGE  110

Query  413   ADVELRKLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANM  592
             ADV L  L+      SV   L+P      LSVQ     CGG  VA   +H V D  + +M
Sbjct  111   ADVALASLDYGTVGASVGKILLPYAGDVALSVQVVSFACGGFTVAWGTNHVVVDGSALSM  170

Query  593   FLVSWSEIAQAKQLS--QLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKIS  766
              + +WSE+A++  L+    P   RS   PR P  Y  SLD  + P+   +          
Sbjct  171   LVSAWSELARSGTLAAGARPNHDRSVFRPRSPPSYGASLDEAFTPLDGAR----------  220

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGI  946
                            Q N  ++DE          A  A+LWK +A+    R+ +  ++  
Sbjct  221   ---------------QVNVLTSDE-------SSPAVSAYLWKALAAVVGSRDAR-CRMVW  257

Query  947   VVDGRTRLSIGDENKAK-FLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEAL  1123
              VDGR RL++    + +  ++ Y GNV +F   E T++E++ KPL  VAS   + +    
Sbjct  258   WVDGRRRLTLSSSPELRAAMRSYVGNVTTFAVAEATMEEIQRKPLAEVASMARDAIAAPA  317

Query  1124  TGDHFLGLIDWVEAHRP--EPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSY  1297
              G+HF  L+DWVE H+   +  I      +   A+ V++   F V   DFG G  A    
Sbjct  318   YGEHFQELVDWVEEHKAGKQRYIDTASVGLGSPAVSVTAFASFEV-DTDFGHGHAAMA--  374

Query  1298  HFPWGGQS-----GYVMPMPSP-KGNGDWIVYMHLQKEKVELIET--YASHVFKPFTSDH  1453
               P    S     G+V     P  G+G WI    L       +E+      +FKP T+++
Sbjct  375   -LPTSSSSARLCTGFVQIAARPGGGDGSWIASALLWPRLAAALESDERLGRIFKPVTAEY  433

Query  1454  LNFN*SSTT  1480
             L    +S +
Sbjct  434   LGLRPASGS  442



>gb|AFW55789.1| agmatine coumaroyltransferase [Zea mays]
Length=468

 Score =   155 bits (393),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 132/476 (28%), Positives = 220/476 (46%), Gaps = 28/476 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             + + ++ V    +V A+ P  +PH +  SNLDL    V   +   Y K       +T   
Sbjct  6     SCDVSIRVLSRRLVKASDPSLQPHVVTFSNLDLYPDNVQASIVCLYPK------LSTKSG  59

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
                 F  +V+T +A L   L  FY LAG +  N  +G PEL C+N+G + V     V L 
Sbjct  60    PGGGFDAVVSTFEAVLPTLLNHFYPLAGRIVVNPSSGVPELHCHNQGAELVVGEVGVALG  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              L+    ++S++  ++P  +   LSVQ     CGG  V    ++ + D  +  M +  WS
Sbjct  120   SLDYGLAEESLKKIMMPYPEDVTLSVQLLSFACGGFSVVWANNNLLNDGNAITMCVRMWS  179

Query  611   EIAQA-KQLSQLPCFR----RSFLFPRRPAHYDLSLDNMYVPIS---SLQPEAVEEPKIS  766
             E+A+A   ++ +        RS   PR P  Y  +LD M+       ++         + 
Sbjct  180   ELARAGGSIATVGAVSVNHDRSMFRPRNPPAYSDALDAMFATYDDHRTVNALTAAASFVE  239

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS--GKSRRNFKNFKL  940
             R+Y V A  I +L+  A   +  EL+ P R  ++A  A+LWK +A+     R   +   +
Sbjct  240   RLYYVEAADIAKLRDMA---TVTELQRPSR--VQAVSAYLWKVLAAVVAACRVPEERCCM  294

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             G +VD R R+   +   A  ++ YFGNV ++      ++E+R KPL  VA+ V E +   
Sbjct  295   GWMVDARRRVKSPELIPA--MRNYFGNVTAYALGGAAVEEIRRKPLAEVAAMVRETITSI  352

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
                ++   L+DWVE H+ E  + K    +    L  +    FP+   +FG+G  A     
Sbjct  353   DYDEYLQELVDWVEVHKTEHVMEKGVLGLGSPTLNQTVFASFPL-DTNFGFGDAALALPI  411

Query  1301  FPWGGQ-SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
               +G   SGY+     P G+G W++  ++  +    +E+    VFKP T+++L   
Sbjct  412   CDYGRLCSGYLSVGARPGGDGSWLLSAYIWPQMAAALES--DGVFKPLTAEYLGLT  465



>ref|NP_001146980.1| LOC100280589 [Zea mays]
 gb|ACG24879.1| agmatine coumaroyltransferase [Zea mays]
Length=468

 Score =   155 bits (391),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 131/476 (28%), Positives = 220/476 (46%), Gaps = 28/476 (6%)
 Frame = +2

Query  74    NSNFNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEE  253
             +S+ ++ V    +V A+ P  +PH +  SNLDL    V   +   Y K       +T   
Sbjct  6     SSDVSIRVLSRRLVKASDPSLQPHVVTFSNLDLYPDNVQASIVCLYPK------LSTKSG  59

Query  254   HATTFGWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELR  430
                 F  +V+T +A L   L  FY LAG +  N  +G PEL C+N+G + V     V L 
Sbjct  60    PGGGFDAVVSTFEAVLPTLLNHFYPLAGRIVVNPSSGVPELHCHNQGAELVVGEVGVALG  119

Query  431   KLNLYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
              L+    ++S++  ++P  +   LSVQ     CGG  V    ++ + D  +  M +  WS
Sbjct  120   SLDYGLAEESLKKIMMPYPEDVTLSVQLLSFACGGFSVVWANNNLLNDGNAITMCVRMWS  179

Query  611   EIAQ-AKQLSQLPCFR----RSFLFPRRPAHYDLSLDNMYVPIS---SLQPEAVEEPKIS  766
             E+A+    ++ +        RS   PR P  Y  +LD M+       ++         + 
Sbjct  180   ELARTGGSIATVGAVSVNHDRSMFRPRNPPAYSDALDAMFATYDDHRTVNALTAAASFVE  239

Query  767   RIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS--GKSRRNFKNFKL  940
             R+Y V A  I +L+  A   +  EL+ P R  ++A  A+LWK +A+     R   +   +
Sbjct  240   RLYYVEAADIAKLRDMA---TVTELQRPSR--VQAVSAYLWKVLAAVVAACRVPEERCCM  294

Query  941   GIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEA  1120
             G +VD R R+   +   A  ++ YFGNV ++      ++E+R KPL  VA+ V + +   
Sbjct  295   GWMVDARRRVKSPELIPA--MRNYFGNVTAYALGGAAVEEIRRKPLAEVAAMVRDTITSI  352

Query  1121  LTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYH  1300
                ++   L+DWVE H+ E  + K    +    L  +    FP+   +FG+G  A     
Sbjct  353   DYDEYLQDLVDWVEVHKTEHVMEKGVLGLGSPTLNQTVFASFPL-DTNFGFGDAALALPI  411

Query  1301  FPWGGQ-SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN  1465
               +G   SGY+     P G+G W++  ++  +    +E+    VFKP T+++L   
Sbjct  412   CDYGRLCSGYLSVGARPGGDGSWLLSAYIWPQMAAALES--DGVFKPLTAEYLGLT  465



>ref|XP_006655791.1| PREDICTED: agmatine coumaroyltransferase-2-like [Oryza brachyantha]
Length=468

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 193/416 (46%), Gaps = 33/416 (8%)
 Frame = +2

Query  269   GWMVNTLKAALSEALVSFYALAGEVEQN-LAGEPELICNNRGVDFVQAFADVELRKLNLY  445
             G +++ ++AA    L  F+  AG V ++ +   PE++CNN G + V A A V L  ++  
Sbjct  57    GAVLSAVRAAFRSYLSRFFPFAGRVVRDPVTNIPEIVCNNAGAELVVADAAVPLAAVDFR  116

Query  446   KPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQA  625
              PD S     VP +    LS+Q     CGG  +AV   H + D  +  + L + +E+ + 
Sbjct  117   DPDRSTGLMHVPFEASLPLSLQLVRFACGGFSLAVGTSHLLVDGRAYILLLNALAEMLRE  176

Query  626   KQ--LSQLPCFRRSFLFPRRPAHYDLSLD---NMYVPISSLQPEAVEEPKISRIYCVAAE  790
                 LS+ P   RS   PR P  +  SLD     + P + + P      +  R+Y + A 
Sbjct  177   GSLCLSREPLLDRSIFRPRSPPRFSPSLDAEFARFTPATMINPLMAAAIQ-RRMYRIEAA  235

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
              +  LQ  A+          R ++  A CA +WK +A      +  N ++  +VDGR  L
Sbjct  236   DLEGLQKAASAGGR------RASRFVALCAHVWKLLARAVGDSD-PNCRMAWIVDGRKAL  288

Query  971   --SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLG  1144
               S+G E     L  Y GNV+++   E +++E+   PL+ VA+ V E +   +T D F  
Sbjct  289   EPSVGGEGA---LDRYMGNVITYTSREVSVEEVLRMPLHGVAAMVRESITPVMTKDRFQE  345

Query  1145  LIDWVEAHRPE-----PAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW  1309
             L+DW+E ++            V+  +   ALV+S    FP+   D G+GKP       PW
Sbjct  346   LVDWMETNKAAFKDGGKWTESVNLGLGSPALVISGLLPFPIDG-DLGFGKPRL---VMPW  401

Query  1310  GGQ----SGYVMPMPSPKGNGDWIVY-MHLQKEKVELIETYASHVFKPFTSDHLNF  1462
                    S  +  +P+P G+G W +    +    +E++E+    + KP T+  L F
Sbjct  402   VRHGRLGSASMTAVPTPAGDGSWFISGTRMWPRLLEVVESAPDCLLKPVTAASLGF  457



>gb|KHN23945.1| Anthranilate N-benzoyltransferase protein 1 [Glycine soja]
Length=239

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 130/252 (52%), Gaps = 14/252 (6%)
 Frame = +2

Query  710   MYVPISSLQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLW  889
             M   +  +Q   +    + R+Y + A  I  LQ  A+      L   +RTK+EAF A++W
Sbjct  1     MKCTMKEIQNMPMNHVLLKRLYHIEASSIDMLQKLAS------LNGVKRTKIEAFSAYVW  54

Query  890   KTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELRE  1069
             K +      R+ K  K+G +VDGR R+  G       +  Y GNVLS  F E +I+EL+E
Sbjct  55    KIMIGTIDERH-KTCKMGWLVDGRERMGRGK----NLMSNYIGNVLSLAFGEASIQELKE  109

Query  1070  KPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFP  1249
               ++ +A  VHE + +    DHFL LIDW+E HRP   + K     +G  LVVSSGQRFP
Sbjct  110   ASISEIAKTVHEAISKVNNEDHFLDLIDWIECHRPGLMLAKAVLGQEGPTLVVSSGQRFP  169

Query  1250  VRKIDFGWGKPAFGS-YHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASH  1426
             V+++DFG+G P  G+ Y         Y+    S KG+G W V   L  E    ++     
Sbjct  170   VKEVDFGFGSPLLGTVYTSIQKVGVSYMNQRLSAKGDGSWTVSAILWPELEAALQD--DP  227

Query  1427  VFKPFTSDHLNF  1462
             +F P ++ HL  
Sbjct  228   IFHPMSASHLQL  239



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 182/383 (48%), Gaps = 25/383 (7%)
 Frame = +2

Query  287   LKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDSVE  466
             +KAAL  ALV FY +AG ++++  G  E+ CN  GV FV+A +D  +     + P+  + 
Sbjct  59    MKAALGRALVPFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGSVDDYGDFAPNLELR  118

Query  467   GKLVP--KKKQGV-----LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQA  625
              +L+P     QG+     L +Q T+ KCGG+ + V   H VAD +S   F+ +WS++A+ 
Sbjct  119   -RLIPAVDYSQGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARG  177

Query  626   KQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAVEEPKISRIYCVAAEQIREL  805
               ++  P   R+ L  R P          Y P  +++     E  +S I+ +  EQ+  L
Sbjct  178   LDITLPPFIDRTLLLARDPPQPQFKHIE-YQPAPAMKTYDATETVVS-IFKLTREQLTTL  235

Query  806   QSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDE  985
             +++    S ++      +  E     +W+     +S    ++ KL I  DGR RL     
Sbjct  236   KAK----SKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLYIATDGRARL-----  286

Query  986   NKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEA  1165
              +    QGYFGNV+     +    +L  KP+ + AS +H+ L + +  ++    +D++E 
Sbjct  287   -QPPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYAASKIHDALAQ-MDNEYLRSALDYLEL  344

Query  1166  HRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG-GQSGYVMPMP  1342
                  A+ +         L ++S  R P+   DFGWG+P F     P G    G    +P
Sbjct  345   QPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG---PGGIAYEGLSFVLP  401

Query  1343  SPKGNGDWIVYMHLQKEKVELIE  1411
             SP  +G   V + LQ E ++L E
Sbjct  402   SPANDGSLSVAISLQAEHMKLFE  424



>dbj|BAJ95580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 208/482 (43%), Gaps = 47/482 (10%)
 Frame = +2

Query  83    FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
               + V    VV A+ P  EP+ L  SNLDL+       V   Y+KPA+            
Sbjct  1     MTIQVVSRHVVKAS-PCVEPYVLAVSNLDLIHRSTQSSVACIYRKPASGD----------  49

Query  263   TFGWMVNTLKAALSEALVSFYALAGEVEQNLA-GEPELICNNRGVDFVQAFADVELRKLN  439
              F  +     A L   L  F+ LAG +  N + G PE+ C N+G + V   A V+L  L+
Sbjct  50    -FSAVTAAFHAELPAFLNYFFPLAGRIVTNTSSGHPEVQCCNQGAELVIGHAGVDLGSLD  108

Query  440   LYKPDDSVEGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVA-DAYSANMFLVSWSEI  616
               + D+S+    +       LSVQ     CGG  V    +  +A D  +A+M +  WSE 
Sbjct  109   WSRSDESLNRIKLAHAADVALSVQLVSFTCGGFAVVWATNSLIAGDGEAASMLVRMWSEF  168

Query  617   AQAKQLSQLPCFRRS-FLFPRRPAHYDLSLDNMYVPIS---SLQPEAVEEPKISRIYCVA  784
                  ++ +P   RS FL PR P  YD S+D M+ P      +     +E  + R+Y V 
Sbjct  169   LCVGTIA-VPNHDRSLFLRPRDPPSYDASMDGMFTPWHHEHEVNTLTAQENLVERLYYVH  227

Query  785   AEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVAS--GKSRRNFKNFKLGIVVDG  958
                I  L+  A+          R ++++A  A++WK VA     S R  K  ++G  VDG
Sbjct  228   GRDIERLRQMASR------GGQRSSRVQALSAYIWKVVAGVVAASTRQEKRCRMGWWVDG  281

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R RL      +A  L+ Y GN  ++  EE  +  + + PL  V++ V E +      + +
Sbjct  282   RQRL------RAPALRNYVGNATTYVVEEAAVDTILQAPLADVSATVREAITSVDYEERY  335

Query  1139  LGLIDWVEAHRPEPAIP--KVHDCVDGAALVVSSGQRFPV------RKIDFGWGKPAFGS  1294
               ++DW+E H P P     +    V+ A + + S     +         DFG+G+ A  +
Sbjct  336   KQVVDWLEKHNPAPPPQGGRRRRFVEAATVGLGSPTVSQMVWASFAGDTDFGFGEAAL-A  394

Query  1295  YHFPWGGQ-----SGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLN  1459
                P         SGY+  +  P     WI+   +       +E+    +F P T++ L 
Sbjct  395   MPMPVSASTMKLCSGYLCVVSRPSDEAPWIIRACIWPRLAAALESDEQRIFNPLTAEFLG  454

Query  1460  FN  1465
             F+
Sbjct  455   FS  456



>gb|KHG25194.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=153

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 12/144 (8%)
 Frame = +2

Query  83   FNVSVTKNEVVAAALPVQEPHYLPHSNldlllppvdvGVFFCYQKPAAASAQTTTEEHAT  262
            F V+V KNEVV A  P Q+ H+LP +NLDLLLPP+D GVFFCY+KP        T  H++
Sbjct  8    FTVAVRKNEVVGAVAPFQD-HWLPLTNLDLLLPPLDFGVFFCYKKP--------TSSHSS  58

Query  263  TFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNL  442
                M++ LK +L+EAL+S+Y L GEV  N  GEPEL+CNNRGVDFV+A+AD+ELR LN 
Sbjct  59   P---MLSVLKKSLAEALISYYGLGGEVVPNALGEPELLCNNRGVDFVEAYADIELRNLNF  115

Query  443  YKPDDSVEGKLVPKKKQGVLSVQA  514
            + PDDS+EGK VP KK+GVL+VQ 
Sbjct  116  HNPDDSIEGKFVPTKKRGVLAVQC  139



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 114/396 (29%), Positives = 186/396 (47%), Gaps = 39/396 (10%)
 Frame = +2

Query  281   NTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDS  460
             N LK ALS+ALV FY +AG ++++  G  E+ C  +GV FV+A +D  +     + P   
Sbjct  55    NMLKEALSKALVPFYPMAGRLKRDEDGRIEIECIGQGVLFVEAESDGIVDDFGDFAPTLK  114

Query  461   VEGKLVP--KKKQGV-----LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             +  +L+P     QG+     L +Q T  KCGG+ + V   H  AD +S   F+ +WS++A
Sbjct  115   LR-RLIPAVDYSQGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMA  173

Query  620   QAKQLSQLPCFRRSFLFPRRP-----AHYDLSLDNMYVPISSL----QPEAVEEPKISRI  772
             +   L+  P   R+ L  R P      H +      Y P  +L    + EAV E  +S I
Sbjct  174   RGLDLTIPPFINRTLLRARDPPLPQFPHIE------YQPPPTLKNIAKTEAVPETAVS-I  226

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             + +  +QI  L+++    S ++      +  E     +W++    +     +  KL I  
Sbjct  227   FKLTRDQINALKAK----SKEDGNTVNYSSYEMLAGHVWRSTCMARGLEEDQGSKLYIAT  282

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR+RL      +     GYFGNV+          +L+ KP+ + AS +H+ L + +  D
Sbjct  283   DGRSRL------RPILPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALAQ-MDND  335

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             +    +D++E      A+ +         L ++S  R P+   DFGWG+P F     P G
Sbjct  336   YLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG---PGG  392

Query  1313  -GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
                 G    +PSP  +G   V + LQ + ++L E Y
Sbjct  393   IAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKY  428



>ref|XP_008223800.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Prunus 
mume]
Length=462

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/413 (27%), Positives = 191/413 (46%), Gaps = 44/413 (11%)
 Frame = +2

Query  278   VNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDD  457
             VNTLK +L  ALV FY LAG +     G  EL CN  GV F++A +D +L  L  + P  
Sbjct  56    VNTLKDSLCRALVPFYPLAGRLHWIGGGRLELDCNGMGVQFIEAESDSKLDDLGDFSPSP  115

Query  458   SVEGKL------VPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
               +  +      +P  +  +L VQ T  +CGG+ + +   H V D  S   F+  W+ +A
Sbjct  116   EYDYIIPTVDYTLPIHELPILLVQLTRFRCGGLSLGLTISHAVVDGQSTFHFISEWARLA  175

Query  620   QAKQLSQLPCF-RRSFLFPRRPAHYDLSLDNM---YVPISSLQPEAVEEPK------ISR  769
             + + +  +P   R++F     PA   L LD+     +P+   Q + +EE K      + +
Sbjct  176   KGEPIGVMPFLDRKAFQARTLPAGNTLGLDHSELDRLPLLLGQSDNIEERKKKTTVAMLK  235

Query  770   IYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIV  949
             +     E+++ + ++ N Y+    K    T+ E     +W+  +  +  RN +   +G+ 
Sbjct  236   LTKQQVEKLKRMANEGNDYNNSGTKR-GYTRYETVAGHIWRCASKARVHRNEQPTAMGVC  294

Query  950   VDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTG  1129
             VD R+R+           QGYFGN   +        +L  KPL + +S + E +E+ ++ 
Sbjct  295   VDLRSRM------LPPLPQGYFGNATFYGVARSLAGDLVSKPLGYASSRIREAIEK-VSN  347

Query  1130  DHFLGLIDWVEAHRPEPAIPKVHDC----------VDGAALVVSSGQRFPVRKIDFGWGK  1279
             D+ L  ID     R +P + +  D                L V S    P+  +DFGWGK
Sbjct  348   DYVLSAIDHF---RNQPDLTRFQDLHALGIAEGNFYGNPNLEVVSWSTLPIYGLDFGWGK  404

Query  1280  PAF-GSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFK  1435
               + GS  + + G+S     +PSP G+G  ++ + LQ   V  ++ +  H ++
Sbjct  405   EIYMGSGTYDFDGES---FLLPSPDGDGSMVLTLCLQ---VAHMDAFKKHFYE  451



>ref|XP_010023888.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW60290.1| hypothetical protein EUGRSUZ_H03002 [Eucalyptus grandis]
Length=432

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/351 (31%), Positives = 178/351 (51%), Gaps = 31/351 (9%)
 Frame = +2

Query  278   VNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNR-GVDFVQAFADVELRKL-NLYKP  451
             V+ +K AL++ LV +Y LAG +  N  G+  + C N+ GV FV+A AD +++ L ++   
Sbjct  58    VDVIKQALAKVLVHYYPLAGRLAINSRGKLVVDCQNKLGVPFVKAIADCDIKNLGDVRIL  117

Query  452   DDSVEGKLVPKKKQG-------VLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWS  610
             D  V GKLV K+          +L+ Q T+ KCGG ++ V  +H + D  SA  F+ +W+
Sbjct  118   DGDVLGKLVYKEPTQDKLEVAPLLTAQVTKFKCGGFILGVSINHCITDGISAMDFMNAWA  177

Query  611   EIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV---EEPKISRIYCV  781
             EIA+ K LS++PC  R+ L  R P       D+ +V IS +        E+  + + +  
Sbjct  178   EIARGKPLSRVPCHDRTILSARFPPQITGPYDD-FVQISDVSNTKALYEEQQIVYKSFLF  236

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGR  961
              AE++  L+  A   + D+    R +   A  AF+W+  +   + +  +  KL   V+ R
Sbjct  237   DAEKLAALKRMA---TKDDQVTSRCSSFVALAAFVWRARSVALNMKLHQQTKLLFPVNFR  293

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
             +RL      +     GYFGN ++ P    T  EL E+P++  A  + + + E++T D+  
Sbjct  294   SRL------RTPLPDGYFGNAIAMPCCLCTKGELIEEPISASAERIKKAI-ESVTEDYIR  346

Query  1142  GLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
               ID+++ HR E   P          LV++S         DFGWG+P FG+
Sbjct  347   SKIDFLDMHRFE-GFPT-------GTLVINSWTSLEHGSTDFGWGEPRFGT  389



>ref|XP_010023890.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010023891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010023893.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010023894.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Eucalyptus grandis]
Length=432

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/352 (31%), Positives = 177/352 (50%), Gaps = 31/352 (9%)
 Frame = +2

Query  275   MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNR-GVDFVQAFADVELRKL-NLYK  448
             +V  +K AL++ LV +Y LAG +  N  G+  + C N+ GV FV+A AD +++ L ++  
Sbjct  57    VVEVIKQALAKVLVHYYPLAGRLAINSRGKLVVDCQNKLGVPFVEAIADCDIKNLGDVRI  116

Query  449   PDDSVEGKLVPKKKQG-------VLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
              D  V GKLV K+          +L+ Q T+ KCGG ++ V  +H +AD  SA  F+ +W
Sbjct  117   LDGDVLGKLVYKEPTQDKLEVAPLLTAQVTKFKCGGFILGVSINHCIADGISAMDFMNAW  176

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNMYVPISSLQPEAV---EEPKISRIYC  778
             +EIA+ K LS++PC  R+ L  R P       D+ +V IS +        E+  + + + 
Sbjct  177   AEIARGKPLSRVPCHDRTILSARFPPQITGPYDD-FVQISDVSNTKALYEEQQIVYKSFL  235

Query  779   VAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDG  958
               AE++  L+  A   + D+    R +   A  AF+W+  +   + +  +  KL   V+ 
Sbjct  236   FDAEKLAALKRMA---TKDDQVTSRCSSFVALAAFVWRARSVALNMKLHQQTKLLFPVNF  292

Query  959   RTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHF  1138
             R+RL      +     GYFGN ++ P    T  EL E+P++  A  + + + E +T D  
Sbjct  293   RSRL------RTPLPDGYFGNAVAMPCCLCTKGELIEEPISASAERIKKAI-EGVTEDSI  345

Query  1139  LGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
                ID+++ HR E   P          LV++S         DFGWG+P FG+
Sbjct  346   RSKIDFLDMHRFE-GFPT-------GTLVINSWTSLEHGSTDFGWGEPRFGT  389



>gb|EYU21749.1| hypothetical protein MIMGU_mgv1a006630mg [Erythranthe guttata]
Length=437

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 120/420 (29%), Positives = 192/420 (46%), Gaps = 42/420 (10%)
 Frame = +2

Query  197   VFFCYQKPAAASAQTTTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELI  376
             V+F Y++PAAA              +    LK AL  A V FY +AG ++++  G  E+ 
Sbjct  39    VYF-YRRPAAADGSF----------FDAAVLKEALGRATVLFYPIAGRLKKDANGRFEID  87

Query  377   CNNRGVDFVQAFADVELRKLNLYKPDDSVEGKLVP--KKKQG-----VLSVQATELKCGG  535
             CN  GV FV+A +D  +     + P   +  +L+P     QG     +L +Q T  KCGG
Sbjct  88    CNAEGVLFVEAESDGVVDDFGDFAPSLELRRRLIPVVDYTQGFSTYPLLLLQVTHFKCGG  147

Query  536   IVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQLPCF-RRSFLFPRRPAHYDLS-LDN  709
             + + V   H VAD +S   F+ +WS++A+    + +P F  RS L  R P       ++ 
Sbjct  148   VTLGVGMQHHVADGFSGLHFINTWSDMARGLAAATVPPFIDRSILCARDPPRPQFEHIEY  207

Query  710   MYVPISSLQPEAVEEPKISRIYCVAAEQIRELQSQANHYSADELKH--PRRTKLEAFCAF  883
              Y P    +P A E      ++ +  +Q+  L+S+    S DE+ +     T  +   A 
Sbjct  208   HYPP----KPPADETTTTVSLFKLTPDQLNNLKSKFKS-SDDEINNAVSSYTSFQMVVAH  262

Query  884   LWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKEL  1063
             +W+ V   +     +  KL I  DGR+RL      +     GYFGNV+          ++
Sbjct  263   IWRCVTRARGLPRAQETKLYISTDGRSRL------RPALPPGYFGNVIFTAAPVAVSGDI  316

Query  1064  REKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHRPEPAI---PKVHDCVDGAALVVSS  1234
               +P+ + A  +   L   +  ++    +D++E      A+   P+   C D   L V S
Sbjct  317   LSEPVTYAAGKIRAALAR-MDDEYMRSALDYLELQGDVKAVARGPQTFTCPD---LGVIS  372

Query  1235  GQRFPVRKIDFGWGKPAF-GSYHFPWGGQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
               R PV   DFGWGKP + G     + G+  ++MP P     G  +V M LQK+ VE+ +
Sbjct  373   WVRLPVYDADFGWGKPVYMGPGGLAYEGRC-FLMPPPPANEEGGLLVAMSLQKQHVEIFK  431



>ref|XP_004966759.1| PREDICTED: anthranilate N-benzoyltransferase protein 1-like [Setaria 
italica]
Length=476

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 195/419 (47%), Gaps = 27/419 (6%)
 Frame = +2

Query  287   LKAALSEALVSFYALAGEVEQNLA-GEPELICNNRGVDFVQAFADVELRKLNLYKPDDSV  463
             ++A+L   L  F+  AG V  N + G PE+ CNN G + V A     L +++    D S+
Sbjct  63    VRASLPAFLSRFFPFAGRVVTNASTGVPEIACNNAGAELVVANVGTSLAEMDFANADRSL  122

Query  464   EGKLVPKKKQGVLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIAQAKQLSQL  643
                 VP ++   LS+Q     CGG       DH + D +       +W+E+ +A  LS  
Sbjct  123   GIIQVPFEQGLALSLQLVRFACGGFAFVWGADHLLVDGHGLMELPNAWAELLRAGGLSWE  182

Query  644   PCFRRSFLF-PRRPAHYDLSLD---NMYVPISSLQPEAVEEPKISRIYCVAAEQIRELQS  811
             P   R  LF PR P  Y  +LD     Y P S   P  V    + R+Y V+   +  L++
Sbjct  183   PQHDRVSLFRPRSPPRYSPALDAEFTRYAPASLPNPLLVAT-LVRRMYVVSGADLDRLRA  241

Query  812   QANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRLSIGDENK  991
              A+  +AD     R T+LEA  A +WK +A+     +  + +L  +VDGR  L     +K
Sbjct  242   AAS--TADR----RATRLEALSAHIWKLLAAAVGGSD-THCRLAWLVDGRRHLDPSKYDK  294

Query  992   AKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLIDWVEAHR  1171
             A+ L  Y GNV+++   E  ++ +   P+  VA+     +++A   + +  L+DW+EA++
Sbjct  295   AR-LGRYLGNVVTYASREVAVESISSAPIADVATMAGAAIKKAFRSERYEELVDWMEANK  353

Query  1172  -----PEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPW--GGQ--SG  1324
                         V       ALVVSS   F V   DFG+G+P       PW   G+  S 
Sbjct  354   GVFRDGGKWTEAVGVGTGSPALVVSSFVPFRVEG-DFGFGRPRL---VMPWVRPGRLGSA  409

Query  1325  YVMPMPSPKGNGDWIVYMHLQKEKVELIETYASHVFKPFTSDHLNFN*SSTTVDLHLII  1501
              +M   SP+ +G W+V   +  +  + +E     VF+P T+  L F+   +   +H  I
Sbjct  410   AMMVARSPEEDGSWVVTARMWPQLADAVEADLEAVFRPATAARLGFSVPESVSAVHKCI  468



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/396 (29%), Positives = 183/396 (46%), Gaps = 39/396 (10%)
 Frame = +2

Query  281   NTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDS  460
             N LK ALS+ALV FY +AG ++++  G  E+ C  +GV FV+A +D  +     + P   
Sbjct  55    NVLKEALSKALVPFYPMAGRLKKDEDGRIEIECRGQGVLFVEAESDGTVDDFGDFAPTLE  114

Query  461   VEGKLVP--KKKQGV-----LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             +  +L+P     QG+     L +Q T  KCGG+ + V   H  AD +S   F+ +WS++A
Sbjct  115   LR-RLIPAVDYTQGIHSYALLVLQITHFKCGGVSLGVGMQHHAADGFSGLHFINAWSDMA  173

Query  620   QAKQLSQLPCFRRSFLFPRRP-----AHYDLSLDNMYVPISSL----QPEAVEEPKISRI  772
             +   L+      R+ L  R P      H +      Y P  +L    + EAV E  +S I
Sbjct  174   RGIDLTIPTFIDRTLLRARDPPLPQFPHIE------YQPPPTLNNIAKTEAVPETDVS-I  226

Query  773   YCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVV  952
             + +  +QI  L+++    S ++      +  E     +W++    +     +  KL I  
Sbjct  227   FKLTRDQINALKAK----SKEDGNTVNYSSYEMLAGHVWRSTCMARGLEEDQGSKLYIAT  282

Query  953   DGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGD  1132
             DGR RL      +     GYFGNV+          +L+ KP+ + AS +H+ L   +  D
Sbjct  283   DGRFRL------RPTLPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDALAR-MDND  335

Query  1133  HFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG  1312
             +    +D++E      A+ +         L ++S  R P+   DFGWG+P F     P G
Sbjct  336   YLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG---PGG  392

Query  1313  -GQSGYVMPMPSPKGNGDWIVYMHLQKEKVELIETY  1417
                 G    +PSP  +G   V + LQ + ++L E Y
Sbjct  393   IAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKY  428



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 183/388 (47%), Gaps = 26/388 (7%)
 Frame = +2

Query  281   NTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADVELRKLNLYKPDDS  460
               LKAAL  ALV FY +AG ++++  G  E+ CN  GV FV+A +D  +     + P   
Sbjct  54    GVLKAALGRALVPFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGVVDDFGDFAPTLE  113

Query  461   VEGKLVP--KKKQGV-----LSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSWSEIA  619
             +  +L+P     QG+     L +Q T  KCGG+ + V   H VAD +S   F+ +WS++A
Sbjct  114   LR-RLIPAVDYSQGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMA  172

Query  620   QAKQLSQLPCFRRSFLFPRRPAHYDLS-LDNMYVP-ISSLQPEAVEEPKIS-RIYCVAAE  790
             +   L+  P   R+ L  R P       ++    P + +L  +  E P+ +  I+ +  +
Sbjct  173   RGLDLTIPPFIDRTLLRARDPPQPQFKHIEYQPAPAMKTLASKDAEAPETAVSIFKLTRD  232

Query  791   QIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGRTRL  970
             Q+  L++++     + + +   +  E     +W++V   +     ++ KL I  DGR+RL
Sbjct  233   QLNALKAKSKE-GGNTVTY---SSYEMLAGHVWRSVCMARGLPEDQDTKLYIATDGRSRL  288

Query  971   SIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFLGLI  1150
                   +     GYFGNV+          +L  KP+ + AS +H+ L   +  D+    +
Sbjct  289   ------QPPLPPGYFGNVIFTATPIAVSGDLTSKPVWYAASKIHDALAR-MDNDYLRSAL  341

Query  1151  DWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGSYHFPWG-GQSGY  1327
             D++E      A+ +         L ++S  R P+   DFGWG+P F     P G    G 
Sbjct  342   DYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG---PGGIAYEGL  398

Query  1328  VMPMPSPKGNGDWIVYMHLQKEKVELIE  1411
                +PSP  +G   V + LQ E ++L E
Sbjct  399   SFVLPSPTNDGSLSVAISLQAEHMKLFE  426



>ref|XP_010031397.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Eucalyptus grandis]
 gb|KCW50678.1| hypothetical protein EUGRSUZ_J00364 [Eucalyptus grandis]
Length=432

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/351 (30%), Positives = 178/351 (51%), Gaps = 29/351 (8%)
 Frame = +2

Query  275   MVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNR-GVDFVQAFADVELRKL-NLYK  448
             +V+ +K AL++ LV +Y LAG +  N  G+  + C N+ GV FV+A AD  +  L ++  
Sbjct  57    VVDVIKQALAKVLVHYYPLAGRLAINSRGKLVVDCQNKLGVPFVEAIADCNITNLGDVRI  116

Query  449   PDDSVEGKLVPKKKQG-------VLSVQATELKCGGIVVAVKFDHRVADAYSANMFLVSW  607
              D  V GKLV K+          +L+ Q T+ KCGG ++ V  +H +AD  SA  F+ +W
Sbjct  117   LDGDVLGKLVYKEPTQDKLEAAPLLTAQVTKFKCGGFILGVSLNHCIADGISAMDFMNAW  176

Query  608   SEIAQAKQLSQLPCFRRSFLFPRRPAHYDLSLDNM--YVPISSLQPEAVEEPKISRIYCV  781
             +EIA+ K LS++PC  R+ +  R P       D+      +S+++    E+  + + +  
Sbjct  177   AEIARGKPLSRVPCHDRTIISARFPPQITGPYDDFVQITDVSNMKALYEEQQLVYKSFLF  236

Query  782   AAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNFKNFKLGIVVDGR  961
              AE++  L+  A   + D+    R +   A  AF+W+  +   + +  +  KL   V+ R
Sbjct  237   DAEKLAALKRMA---TKDDQVTSRCSSFVALAAFVWRARSMALNMKLHQQTKLLFPVNFR  293

Query  962   TRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHEFLEEALTGDHFL  1141
             +RL      +     GYFGN ++ P    T+ +L E+P++     + + + E++T D+  
Sbjct  294   SRL------RTLLPDGYFGNAVAMPCCLCTMGDLIEEPISASVERIKKAI-ESVTEDYIR  346

Query  1142  GLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPAFGS  1294
               ID+++ HR E   P          LV++S         DFGWG+P FG+
Sbjct  347   SKIDFLDMHRFE-GFPT-------GTLVINSWTSLEHGSTDFGWGEPRFGT  389



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/400 (29%), Positives = 177/400 (44%), Gaps = 29/400 (7%)
 Frame = +2

Query  242   TTEEHATTFGWMVNTLKAALSEALVSFYALAGEVEQNLAGEPELICNNRGVDFVQAFADV  421
             T   H  +F +    LK AL++ALV FY LAG ++QN  G  E+ CN  GV FV A    
Sbjct  49    TGSHHGNSF-FDPAVLKRALAKALVPFYPLAGRLQQNETGRSEINCNGEGVLFVVAETAS  107

Query  422   ELRKLNLYKPDDSVEGKLVP--KKKQGV-----LSVQATELKCGGIVVAVKFDHRVADAY  580
              L     + P      KL+P      G+     L VQ T  KCGG+ + V  +HRVAD  
Sbjct  108   VLEDFGDFAPTPEFR-KLIPVVDYSAGISTYPLLVVQVTYFKCGGVSLGVGLEHRVADGC  166

Query  581   SANMFLVSWSEIAQAKQLSQLPCFRRSFLFPRRPA-----HYDLSLDNMYVPISSLQPEA  745
             S   F+ +WS+IA+   L+  P   R+ L  R P      H +   D           + 
Sbjct  167   SGLHFVNTWSDIARGLDLTIPPFIDRTLLRARDPPQTTFDHVEYQPDPPSKTPPPSTKDG  226

Query  746   VEEPKISRIYCVAAEQIRELQSQANHYSADELKHPRRTKLEAFCAFLWKTVASGKSRRNF  925
               E     I+ +  EQ+  L+++    S +E      +  E     +W+     ++  + 
Sbjct  227   DAESTRVSIFRLTREQLSVLKAK----SKEEGNSINYSTYEMLAGHVWRCATKARNLPDD  282

Query  926   KNFKLGIVVDGRTRLSIGDENKAKFLQGYFGNVLSFPFEEKTIKELREKPLNWVASAVHE  1105
             +  KL + VDGR+RL      +     G+FGNV+       T  +L+ KP  + A  +H+
Sbjct  283   QVTKLHVAVDGRSRL------QPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHD  336

Query  1106  FLEEALTGDHFLGLIDWVEAHRPEPAIPKVHDCVDGAALVVSSGQRFPVRKIDFGWGKPA  1285
              +   +  D+    +D++E      A+ +         L ++S  R P+   DFGWG+P 
Sbjct  337   VVVR-MNNDYLRSALDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPIYDADFGWGRPI  395

Query  1286  FGSYHFPWG-GQSGYVMPMPSPKGNGDWIVYMHLQKEKVE  1402
             F     P G G  G    +PSP  +G   V + LQ + ++
Sbjct  396   FMG---PGGIGYEGLAFVLPSPTNDGSLSVAISLQSDHMK  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4843750934154