BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24833_g1_i4 len=2217 path=[2650:0-230 4485:231-1052 109:1053-1053
110:1054-1132 3333:1133-1174 189:1175-1260 275:1261-1269
284:1270-1322 337:1323-1344 359:1345-1435 450:1436-1443
458:1444-1675 690:1676-1704 719:1705-1854 869:1855-1856
871:1857-1969 3186:1970-2034 1051:2035-2216]

Length=2217
                                                                      Score     E

ref|XP_004237813.1|  PREDICTED: syntaxin-81                             388   3e-125   
ref|XP_009760959.1|  PREDICTED: syntaxin-81-like                        384   2e-123   
ref|XP_006363439.1|  PREDICTED: syntaxin-81-like                        382   1e-122   
ref|XP_009594626.1|  PREDICTED: syntaxin-81                             382   1e-122   
ref|XP_006343391.1|  PREDICTED: syntaxin-81-like                        380   5e-122   
ref|XP_004234608.1|  PREDICTED: syntaxin-81-like                        379   3e-121   
gb|EYU30482.1|  hypothetical protein MIMGU_mgv1a010233mg                370   3e-118   
ref|XP_006435564.1|  hypothetical protein CICLE_v10032191mg             367   3e-117   
gb|KDO69261.1|  hypothetical protein CISIN_1g0217001mg                  366   1e-116   
ref|XP_007218719.1|  hypothetical protein PRUPE_ppa009021mg             364   3e-116   
gb|KDO66408.1|  hypothetical protein CISIN_1g039000mg                   362   5e-116   
ref|XP_011084953.1|  PREDICTED: syntaxin-81                             363   9e-116   
ref|XP_008232847.1|  PREDICTED: syntaxin-81 isoform X1                  363   1e-115   
emb|CDO97362.1|  unnamed protein product                                363   1e-115   
ref|XP_009350599.1|  PREDICTED: syntaxin-81-like isoform X1             362   2e-115   
ref|XP_006470497.1|  PREDICTED: syntaxin-81-like isoform X1             362   3e-115   
ref|XP_008359732.1|  PREDICTED: syntaxin-81-like isoform X1             362   3e-115   
ref|XP_002316241.1|  syntaxin 81 family protein                         362   4e-115   Populus trichocarpa [western balsam poplar]
ref|XP_006446367.1|  hypothetical protein CICLE_v10016032mg             360   1e-114   
ref|XP_009375853.1|  PREDICTED: syntaxin-81 isoform X1                  360   1e-114   
gb|KDP26062.1|  hypothetical protein JCGZ_21095                         357   1e-113   
ref|XP_010543751.1|  PREDICTED: syntaxin-81                             357   2e-113   
ref|XP_011036017.1|  PREDICTED: syntaxin-81-like isoform X1             357   2e-113   
ref|XP_011036019.1|  PREDICTED: syntaxin-81-like isoform X2             356   3e-113   
ref|XP_008375891.1|  PREDICTED: syntaxin-81                             355   2e-112   
ref|XP_010658487.1|  PREDICTED: syntaxin-81                             354   2e-112   
ref|XP_002523004.1|  Syntaxin-81, putative                              348   8e-110   Ricinus communis
gb|AFK37975.1|  unknown                                                 347   2e-109   
gb|AFK47396.1|  unknown                                                 345   8e-109   
gb|KEH27041.1|  syntaxin-81 protein                                     345   1e-108   
ref|XP_004512932.1|  PREDICTED: syntaxin-81-like                        344   3e-108   
ref|NP_001239902.1|  uncharacterized protein LOC100801587               344   3e-108   
ref|XP_008441427.1|  PREDICTED: syntaxin-81                             343   5e-108   
ref|XP_003543163.1|  PREDICTED: syntaxin-81-like                        343   6e-108   
ref|XP_004138436.1|  PREDICTED: syntaxin-81-like                        342   1e-107   
ref|XP_010247832.1|  PREDICTED: syntaxin-81-like isoform X1             341   3e-107   
ref|XP_011039007.1|  PREDICTED: syntaxin-81-like                        341   3e-107   
ref|XP_007152765.1|  hypothetical protein PHAVU_004G157700g             340   5e-107   
ref|XP_007010755.1|  Syntaxin of plants 81 isoform 1                    338   4e-106   
gb|KHG28837.1|  Syntaxin-81 -like protein                               337   1e-105   
ref|XP_010247310.1|  PREDICTED: syntaxin-81-like isoform X2             337   2e-105   
ref|XP_010247309.1|  PREDICTED: syntaxin-81-like isoform X1             337   3e-105   
ref|XP_010091565.1|  hypothetical protein L484_002138                   334   1e-104   
ref|XP_006393000.1|  hypothetical protein EUTSA_v10011542mg             338   1e-104   
ref|XP_002891655.1|  hypothetical protein ARALYDRAFT_892151             333   2e-104   
ref|XP_010690321.1|  PREDICTED: syntaxin-81                             332   9e-104   
ref|XP_004306866.1|  PREDICTED: syntaxin-81-like                        330   5e-103   
ref|XP_010500758.1|  PREDICTED: syntaxin-81                             329   1e-102   
ref|XP_010067483.1|  PREDICTED: syntaxin-81                             328   2e-102   
ref|XP_008232848.1|  PREDICTED: syntaxin-81 isoform X2                  327   3e-102   
ref|XP_008359738.1|  PREDICTED: syntaxin-81-like isoform X2             325   1e-101   
gb|KHN20725.1|  Syntaxin-81                                             325   3e-101   
gb|KFK35826.1|  hypothetical protein AALP_AA4G042200                    325   8e-101   
ref|XP_009375858.1|  PREDICTED: syntaxin-81 isoform X2                  323   1e-100   
ref|XP_002311197.1|  syntaxin 81 family protein                         320   2e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010479670.1|  PREDICTED: syntaxin-81-like                        320   4e-99    
ref|XP_009593496.1|  PREDICTED: syntaxin-81-like                        315   5e-98    
ref|XP_009350601.1|  PREDICTED: syntaxin-81-like isoform X2             314   3e-97    
ref|XP_010462009.1|  PREDICTED: syntaxin-81-like                        315   4e-97    
ref|XP_010927380.1|  PREDICTED: syntaxin-81-like                        308   2e-94    
gb|AAM63632.1|  unknown                                                 308   2e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDY22868.1|  BnaA06g02090D                                          310   2e-94    
ref|XP_009147733.1|  PREDICTED: syntaxin-81                             307   3e-94    
ref|NP_564597.1|  syntaxin-81                                           307   4e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDY33863.1|  BnaC06g04900D                                          307   8e-92    
gb|EPS69472.1|  hypothetical protein M569_05295                         296   5e-90    
ref|XP_006857303.1|  hypothetical protein AMTR_s00067p00058500          294   5e-89    
pir||D96556  hypothetical protein F19C24.5 [imported] - Arabidops...    308   5e-88 
ref|XP_002448341.1|  hypothetical protein SORBIDRAFT_06g025460          289   3e-87    Sorghum bicolor [broomcorn]
gb|ABA95851.1|  Syntaxin 81, putative                                   287   3e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132043.1|  uncharacterized protein LOC100193453               287   1e-86    Zea mays [maize]
gb|EEC68882.1|  hypothetical protein OsI_37514                          287   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_008778974.1|  PREDICTED: syntaxin-81                             286   2e-86    
ref|NP_001053389.1|  Os04g0530400                                       286   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976323.1|  PREDICTED: syntaxin-81-like                        285   4e-86    
ref|NP_001146627.1|  Syntaxin 81                                        285   4e-86    Zea mays [maize]
dbj|BAK00323.1|  predicted protein                                      285   6e-86    
ref|XP_006652554.1|  PREDICTED: syntaxin-81-like                        285   9e-86    
gb|EMT31924.1|  hypothetical protein F775_28929                         283   1e-85    
ref|XP_002446837.1|  hypothetical protein SORBIDRAFT_06g023420          284   1e-85    Sorghum bicolor [broomcorn]
gb|EMS47984.1|  hypothetical protein TRIUR3_08168                       283   2e-85    
ref|XP_009383722.1|  PREDICTED: syntaxin-81                             283   5e-85    
gb|ACG31789.1|  syntaxin 81                                             280   2e-84    Zea mays [maize]
gb|ACG35270.1|  syntaxin 81                                             278   8e-84    Zea mays [maize]
ref|XP_003580197.1|  PREDICTED: syntaxin-81                             276   3e-83    
emb|CAJ86206.1|  B1011H02.1                                             272   4e-82    Oryza sativa [red rice]
gb|AFW59191.1|  hypothetical protein ZEAMMB73_972004                    263   3e-79    
ref|XP_007010756.1|  Syntaxin of plants 81 isoform 2                    257   5e-79    
gb|AFW59193.1|  hypothetical protein ZEAMMB73_972004                    259   3e-78    
ref|XP_010247837.1|  PREDICTED: syntaxin-81-like isoform X2             249   1e-74    
ref|XP_010247314.1|  PREDICTED: syntaxin-81-like isoform X3             248   4e-74    
emb|CAJ86385.1|  OSIGBa0155K17.12                                       181   1e-54    Oryza sativa [red rice]
ref|XP_009144881.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-81        182   7e-52    
gb|ABR17175.1|  unknown                                                 179   1e-50    Picea sitchensis
ref|XP_002967975.1|  hypothetical protein SELMODRAFT_145148             176   9e-50    
ref|XP_002963944.1|  hypothetical protein SELMODRAFT_227430             175   2e-49    
ref|XP_001762254.1|  Qa-SNARE, SYP8/Ufe1p/Syntaxin 18-type              176   2e-47    
ref|XP_010923249.1|  PREDICTED: syntaxin-81-like                        154   8e-40    
ref|XP_010042815.1|  PREDICTED: syntaxin-81-like                        128   2e-31    
gb|ACL54417.1|  unknown                                               97.4    8e-30    Zea mays [maize]
gb|KHN31601.1|  Syntaxin-81                                           84.0    5e-26    
emb|CDX87839.1|  BnaC06g09010D                                          105   1e-20    
ref|XP_003059240.1|  predicted protein                                79.7    1e-18    
ref|NP_001066186.2|  Os12g0154400                                     62.8    9e-16    Oryza sativa Japonica Group [Japonica rice]
emb|CDX87840.1|  BnaC06g09020D                                        65.1    9e-15    
ref|XP_005648246.1|  hypothetical protein COCSUDRAFT_41865            84.3    2e-14    
ref|XP_001419559.1|  predicted protein                                68.2    2e-13    Ostreococcus lucimarinus CCE9901
emb|CBN81147.1|  Syntaxin-18                                          75.5    2e-13    
ref|XP_008282715.1|  PREDICTED: syntaxin-18                           75.5    3e-13    
ref|XP_002502580.1|  predicted protein                                80.9    3e-13    Micromonas commoda
ref|NP_001019596.1|  syntaxin-18                                      75.1    3e-13    Danio rerio [leopard danio]
ref|XP_005844491.1|  hypothetical protein CHLNCDRAFT_138844           81.3    3e-13    
ref|XP_009305912.1|  PREDICTED: syntaxin-18 isoform X1                75.1    4e-13    
ref|XP_010740429.1|  PREDICTED: syntaxin-18                           74.3    8e-13    
ref|XP_005918659.1|  PREDICTED: syntaxin-18-like isoform X1           74.3    9e-13    
ref|XP_005731368.1|  PREDICTED: syntaxin-18-like                      73.9    1e-12    
ref|XP_006629663.1|  PREDICTED: syntaxin-18-like isoform X1           76.6    1e-12    
ref|XP_004545247.1|  PREDICTED: syntaxin-18-like                      73.6    1e-12    
ref|XP_004069234.1|  PREDICTED: syntaxin-18-like                      72.8    2e-12    
ref|XP_006784584.1|  PREDICTED: syntaxin-18-like                      72.4    3e-12    
ref|XP_006277470.1|  PREDICTED: syntaxin-18 isoform X1                70.5    7e-12    
ref|XP_006629664.1|  PREDICTED: syntaxin-18-like isoform X2           73.9    7e-12    
ref|XP_005715830.1|  Syn18                                            57.8    8e-12    
ref|XP_005798007.1|  PREDICTED: syntaxin-18-like                      70.9    1e-11    
gb|AAH73006.1|  LOC443606 protein                                     69.3    1e-11    Xenopus laevis [clawed frog]
ref|XP_007554292.1|  PREDICTED: syntaxin-18                           70.5    2e-11    
ref|XP_007240750.1|  PREDICTED: syntaxin-18                           69.7    2e-11    
ref|XP_010788627.1|  PREDICTED: syntaxin-18                           70.1    2e-11    
ref|XP_008407622.1|  PREDICTED: syntaxin-18                           69.7    4e-11    
ref|XP_003441600.1|  PREDICTED: syntaxin-18-like isoform 1            70.1    4e-11    
ref|NP_001239087.1|  syntaxin-18                                      68.6    5e-11    
ref|XP_007895508.1|  PREDICTED: syntaxin-18 isoform X1                68.9    7e-11    
ref|XP_007895510.1|  PREDICTED: syntaxin-18 isoform X2                68.6    8e-11    
emb|CAG01866.1|  unnamed protein product                              67.4    1e-10    Tetraodon nigroviridis
ref|XP_008494356.1|  PREDICTED: syntaxin-18 isoform X2                67.4    1e-10    
ref|XP_005866201.1|  PREDICTED: syntaxin-18 isoform X1                66.2    2e-10    
ref|XP_002740578.1|  PREDICTED: syntaxin-18-like                      66.6    2e-10    Saccoglossus kowalevskii
ref|XP_006106128.1|  PREDICTED: syntaxin-18-like                      66.2    2e-10    
ref|XP_008318646.1|  PREDICTED: syntaxin-18                           66.2    2e-10    
ref|XP_006877344.1|  PREDICTED: syntaxin-18                           66.2    2e-10    
ref|XP_010581760.1|  PREDICTED: syntaxin-18 isoform X1                66.6    2e-10    
ref|XP_004885844.1|  PREDICTED: syntaxin-18                           65.9    3e-10    
ref|XP_007063009.1|  PREDICTED: syntaxin-18                           64.3    3e-10    
ref|XP_006216442.1|  PREDICTED: syntaxin-18                           65.5    4e-10    
ref|XP_004624630.1|  PREDICTED: syntaxin-18                           65.1    4e-10    
ref|XP_001631010.1|  predicted protein                                59.7    5e-10    Nematostella vectensis
ref|XP_005485810.1|  PREDICTED: syntaxin-18                           65.1    6e-10    
ref|XP_004579276.1|  PREDICTED: syntaxin-18                           64.7    6e-10    
ref|XP_010971283.1|  PREDICTED: syntaxin-18                           64.7    7e-10    
ref|XP_008831338.1|  PREDICTED: syntaxin-18                           63.9    7e-10    
ref|XP_003934719.1|  PREDICTED: syntaxin-18 isoform X1                63.9    8e-10    
ref|XP_003973628.1|  PREDICTED: syntaxin-18-like                      64.3    8e-10    
gb|ADO28217.1|  syntaxin-18                                           63.9    8e-10    
ref|XP_004669887.1|  PREDICTED: syntaxin-18                           64.3    8e-10    
ref|XP_004617477.1|  PREDICTED: syntaxin-18                           66.2    9e-10    
ref|XP_001364357.2|  PREDICTED: syntaxin-18 isoform X1                63.5    1e-09    Monodelphis domestica
ref|XP_007191023.1|  PREDICTED: syntaxin-18                           64.3    1e-09    
ref|XP_010879094.1|  PREDICTED: syntaxin-18                           65.1    1e-09    
ref|XP_005366016.1|  PREDICTED: syntaxin-18                           63.9    1e-09    
gb|AAH92152.1|  Unknown (protein for IMAGE:6949850)                   63.2    1e-09    Xenopus laevis [clawed frog]
ref|XP_006004716.1|  PREDICTED: syntaxin-18 isoform X1                65.1    1e-09    
ref|XP_004847359.1|  PREDICTED: syntaxin-18                           63.2    1e-09    
ref|XP_003985557.1|  PREDICTED: syntaxin-18                           63.2    1e-09    
ref|XP_001154387.1|  PREDICTED: syntaxin-18                           63.2    1e-09    Pan troglodytes
ref|NP_058626.1|  syntaxin-18                                         63.2    1e-09    Homo sapiens [man]
ref|NP_001016709.1|  syntaxin 18                                      62.8    1e-09    Xenopus tropicalis [western clawed frog]
gb|AAV38937.1|  syntaxin 18                                           63.2    1e-09    Homo sapiens [man]
ref|XP_004038425.1|  PREDICTED: syntaxin-18                           63.2    1e-09    
gb|AAP36884.1|  Homo sapiens syntaxin 18                              63.2    2e-09    
gb|AAS47513.1|  growth-inhibiting protein 9                           63.2    2e-09    Homo sapiens [man]
ref|XP_006985678.1|  PREDICTED: syntaxin-18 isoform X2                62.8    2e-09    
ref|XP_008565148.1|  PREDICTED: syntaxin-18                           62.8    2e-09    
ref|XP_005300316.1|  PREDICTED: syntaxin-18                           60.8    2e-09    
ref|XP_003496675.1|  PREDICTED: syntaxin-18 isoform X1                62.8    2e-09    
ref|XP_006919057.1|  PREDICTED: syntaxin-18                           63.5    2e-09    
ref|XP_003800236.1|  PREDICTED: syntaxin-18                           62.8    2e-09    
ref|XP_007451562.1|  PREDICTED: syntaxin-18                           62.8    2e-09    
ref|XP_008494355.1|  PREDICTED: syntaxin-18 isoform X1                67.0    2e-09    
ref|XP_004269676.1|  PREDICTED: syntaxin-18                           62.4    2e-09    
gb|KFM25556.1|  Syntaxin-81                                           69.7    3e-09    
ref|XP_007100894.1|  PREDICTED: syntaxin-18                           62.0    3e-09    
ref|XP_010640119.1|  PREDICTED: syntaxin-18                           61.6    3e-09    
ref|XP_006128254.1|  PREDICTED: syntaxin-18 isoform X2                60.8    3e-09    
ref|XP_006163251.1|  PREDICTED: syntaxin-18 isoform X1                62.0    3e-09    
ref|NP_001012151.1|  syntaxin-18                                      62.0    3e-09    Rattus norvegicus [brown rat]
ref|XP_005148618.1|  PREDICTED: syntaxin-18                           62.8    4e-09    
ref|XP_008967786.1|  PREDICTED: syntaxin-18 isoform X1                61.6    4e-09    
ref|NP_001247460.1|  syntaxin-18                                      61.6    4e-09    
ref|XP_010355880.1|  PREDICTED: syntaxin-18                           61.2    5e-09    
ref|NP_001124885.1|  syntaxin-18                                      61.2    5e-09    
ref|NP_081235.2|  syntaxin-18 isoform 1                               61.2    5e-09    Mus musculus [mouse]
ref|XP_005408888.1|  PREDICTED: syntaxin-18                           61.6    5e-09    
gb|ERE89834.1|  syntaxin-18-like protein                              61.2    5e-09    
ref|XP_009272051.1|  PREDICTED: syntaxin-18                           62.0    6e-09    
ref|XP_004010040.1|  PREDICTED: syntaxin-18                           61.2    6e-09    
ref|XP_004383596.1|  PREDICTED: syntaxin-18                           61.6    6e-09    
ref|XP_006277471.1|  PREDICTED: syntaxin-18 isoform X2                60.8    6e-09    
ref|XP_003898515.1|  PREDICTED: syntaxin-18 isoform X1                60.8    6e-09    
ref|XP_006043889.1|  PREDICTED: syntaxin-18 isoform X1                60.8    7e-09    
ref|XP_004770602.1|  PREDICTED: syntaxin-18                           60.8    7e-09    
ref|XP_008683976.1|  PREDICTED: syntaxin-18 isoform X1                60.5    8e-09    
ref|XP_009684593.1|  PREDICTED: syntaxin-18                           61.6    8e-09    
ref|XP_004432324.1|  PREDICTED: syntaxin-18                           60.8    8e-09    
gb|KFZ67080.1|  Syntaxin-18                                           61.2    9e-09    
ref|XP_001917859.2|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-18      60.5    9e-09    Equus caballus [domestic horse]
ref|XP_010226306.1|  PREDICTED: syntaxin-18                           60.5    1e-08    
ref|XP_010187713.1|  PREDICTED: syntaxin-18                           60.8    1e-08    
gb|EHH25743.1|  Cell growth-inhibiting gene 9 protein                 60.8    1e-08    
gb|KFM03808.1|  Syntaxin-18                                           60.5    1e-08    
ref|XP_007529279.1|  PREDICTED: syntaxin-18                           60.8    1e-08    
ref|XP_007665754.1|  PREDICTED: syntaxin-18                           58.9    1e-08    
ref|XP_003224195.1|  PREDICTED: syntaxin-18                           67.0    2e-08    
gb|KFQ67893.1|  Syntaxin-18                                           60.1    2e-08    
ref|XP_010288612.1|  PREDICTED: syntaxin-18                           60.1    2e-08    
ref|XP_010072337.1|  PREDICTED: syntaxin-18                           60.1    2e-08    
ref|XP_002923338.1|  PREDICTED: syntaxin-18-like                      59.3    2e-08    
ref|XP_005893263.1|  PREDICTED: syntaxin-18                           59.7    2e-08    
ref|XP_004415941.1|  PREDICTED: syntaxin-18                           59.3    2e-08    
ref|XP_851021.1|  PREDICTED: syntaxin-18 isoformX1                    59.3    2e-08    Canis lupus familiaris [dogs]
ref|XP_010846094.1|  PREDICTED: syntaxin-18                           59.7    2e-08    
gb|KFU93737.1|  Syntaxin-18                                           59.7    2e-08    
ref|XP_007510663.1|  predicted protein                                53.1    2e-08    
ref|XP_010001439.1|  PREDICTED: syntaxin-18                           59.7    2e-08    
ref|XP_004715136.1|  PREDICTED: syntaxin-18                           59.7    2e-08    
ref|XP_009559831.1|  PREDICTED: syntaxin-18                           59.3    2e-08    
ref|XP_005068888.1|  PREDICTED: syntaxin-18 isoform X1                58.9    2e-08    
gb|EHH53557.1|  Cell growth-inhibiting gene 9 protein                 58.9    3e-08    
ref|XP_006016840.1|  PREDICTED: syntaxin-18                           58.5    3e-08    
ref|XP_005618639.1|  PREDICTED: syntaxin-18 isoform X2                58.9    3e-08    
gb|KFP56174.1|  Syntaxin-18                                           59.3    3e-08    
ref|NP_001093189.1|  syntaxin-18                                      58.9    3e-08    Bos taurus [bovine]
gb|KFV19956.1|  Syntaxin-18                                           59.3    3e-08    
ref|XP_010115937.1|  PREDICTED: syntaxin-18                           59.3    3e-08    
ref|XP_005243157.1|  PREDICTED: syntaxin-18                           58.9    3e-08    
gb|KFW70498.1|  Syntaxin-18                                           59.3    4e-08    
ref|XP_008919201.1|  PREDICTED: syntaxin-18                           58.9    4e-08    
ref|XP_009488135.1|  PREDICTED: syntaxin-18                           58.9    4e-08    
gb|KFP13188.1|  Syntaxin-18                                           58.9    4e-08    
ref|XP_009878842.1|  PREDICTED: syntaxin-18                           58.9    4e-08    
ref|XP_006766637.1|  PREDICTED: syntaxin-18                           58.2    4e-08    
tpg|DAA28458.1|  TPA: syntaxin 18                                     58.5    4e-08    
ref|XP_009327170.1|  PREDICTED: syntaxin-18                           58.9    4e-08    
gb|KFW09559.1|  Syntaxin-18                                           58.9    4e-08    
ref|XP_010154600.1|  PREDICTED: syntaxin-18                           58.5    5e-08    
ref|XP_005866202.1|  PREDICTED: syntaxin-18 isoform X2                58.2    5e-08    
gb|KFV87074.1|  Syntaxin-18                                           58.5    5e-08    
ref|XP_005517901.1|  PREDICTED: syntaxin-18                           65.5    5e-08    
ref|XP_009987899.1|  PREDICTED: syntaxin-18                           58.5    5e-08    
ref|XP_009934667.1|  PREDICTED: syntaxin-18                           58.5    5e-08    
gb|AAI06216.1|  MGC130640 protein                                     62.4    6e-08    Xenopus laevis [clawed frog]
ref|XP_006985677.1|  PREDICTED: syntaxin-18 isoform X1                62.8    6e-08    
ref|XP_005501455.1|  PREDICTED: syntaxin-18                           58.5    6e-08    
ref|XP_010973657.1|  PREDICTED: syntaxin-18                           58.2    6e-08    
ref|XP_010144431.1|  PREDICTED: syntaxin-18                           58.2    7e-08    
ref|NP_001089679.2|  syntaxin 18                                      62.0    8e-08    Xenopus laevis [clawed frog]
ref|XP_003464396.1|  PREDICTED: syntaxin-18 isoform X1                65.1    8e-08    
ref|XP_008053512.1|  PREDICTED: syntaxin-18                           58.2    8e-08    
ref|XP_005554523.1|  PREDICTED: syntaxin-18 isoform X3                57.4    9e-08    
gb|KFR12102.1|  Syntaxin-18                                           57.8    9e-08    
ref|XP_007650021.1|  PREDICTED: syntaxin-18 isoform X3                57.0    1e-07    
ref|XP_006163252.1|  PREDICTED: syntaxin-18 isoform X2                61.6    1e-07    
ref|XP_007624173.1|  PREDICTED: syntaxin-18 isoform X2                57.0    1e-07    
ref|XP_005428123.1|  PREDICTED: syntaxin-18                           57.4    1e-07    
ref|XP_009961042.1|  PREDICTED: syntaxin-18                           56.6    1e-07    
gb|EMC83028.1|  Syntaxin-18                                           57.4    1e-07    
ref|NP_001276464.1|  syntaxin-18 isoform 2                            61.2    1e-07    
gb|EDM00013.1|  syntaxin 18, isoform CRA_a                            61.6    1e-07    
ref|XP_009633812.1|  PREDICTED: syntaxin-18                           57.4    2e-07    
gb|KFV70142.1|  Syntaxin-18                                           57.0    2e-07    
ref|XP_009902532.1|  PREDICTED: syntaxin-18                           56.6    2e-07    
ref|XP_002193663.2|  PREDICTED: syntaxin-18                           57.0    2e-07    Taeniopygia guttata
ref|XP_003773438.1|  PREDICTED: syntaxin-18                           55.5    2e-07    
ref|XP_005045515.1|  PREDICTED: syntaxin-18 isoform X2                56.2    3e-07    
ref|XP_005045514.1|  PREDICTED: syntaxin-18 isoform X1                56.2    3e-07    
ref|XP_006128253.1|  PREDICTED: syntaxin-18 isoform X1                60.5    3e-07    
gb|AFW58941.1|  hypothetical protein ZEAMMB73_097097                  59.7    3e-07    
ref|XP_006893642.1|  PREDICTED: syntaxin-18                           55.5    3e-07    
gb|KFR03869.1|  Syntaxin-18                                           57.8    4e-07    
ref|XP_008249508.1|  PREDICTED: syntaxin-18                           63.2    4e-07    
ref|XP_009469457.1|  PREDICTED: syntaxin-18                           57.4    4e-07    
ref|XP_008938289.1|  PREDICTED: syntaxin-18                           55.8    4e-07    
ref|XP_005962220.1|  PREDICTED: syntaxin-18                           55.1    4e-07    
ref|XP_008149105.1|  PREDICTED: syntaxin-18                           62.8    4e-07    
ref|XP_010343585.1|  PREDICTED: syntaxin-18 isoform X2                54.7    4e-07    
ref|XP_007437315.1|  PREDICTED: syntaxin-18 isoform X1                55.1    5e-07    
ref|XP_009813696.1|  PREDICTED: syntaxin-18                           55.1    6e-07    
ref|XP_007437316.1|  PREDICTED: syntaxin-18 isoform X2                53.9    1e-06    
ref|XP_006043890.1|  PREDICTED: syntaxin-18 isoform X2                53.5    1e-06    
ref|XP_007075848.1|  PREDICTED: syntaxin-18                           53.5    1e-06    
ref|XP_010804616.1|  PREDICTED: syntaxin-18 isoform X3                53.5    2e-06    
ref|XP_010804615.1|  PREDICTED: syntaxin-18 isoform X2                52.8    2e-06    
ref|XP_009054214.1|  hypothetical protein LOTGIDRAFT_117319           56.6    3e-06    
ref|XP_004449320.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-18      60.1    3e-06    
ref|XP_009083398.1|  PREDICTED: syntaxin-18                           59.3    3e-06    
ref|XP_005707987.1|  syntaxin 18                                      47.8    3e-06    
ref|XP_007496804.1|  PREDICTED: syntaxin-18 isoform X2                60.1    4e-06    
gb|EFN77762.1|  Syntaxin-18                                           52.8    5e-06    
ref|XP_010804614.1|  PREDICTED: syntaxin-18 isoform X1                51.2    8e-06    
ref|XP_003205960.2|  PREDICTED: syntaxin-18                           58.9    8e-06    
ref|XP_003776475.2|  PREDICTED: syntaxin-18-like                      56.6    1e-05    
ref|XP_005248030.1|  PREDICTED: syntaxin-18 isoform X3                56.6    1e-05    
gb|KDD74317.1|  hypothetical protein H632_c1405p0                     58.2    1e-05    
gb|KFQ84029.1|  Syntaxin-18                                           57.4    1e-05    
ref|XP_008626868.1|  PREDICTED: syntaxin-18                           58.2    1e-05    
ref|XP_009577726.1|  PREDICTED: syntaxin-18                           56.6    3e-05    
gb|KFP66829.1|  Syntaxin-18                                           56.6    3e-05    
gb|EAW82429.1|  syntaxin 18, isoform CRA_c                            56.2    3e-05    
ref|XP_003411407.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-18      57.0    3e-05    
gb|ERE89833.1|  syntaxin-18-like protein                              56.6    3e-05    
ref|XP_006985679.1|  PREDICTED: syntaxin-18 isoform X3                56.6    3e-05    
ref|XP_009702120.1|  PREDICTED: syntaxin-18                           56.6    3e-05    
ref|XP_005019516.1|  PREDICTED: syntaxin-18                           56.2    4e-05    
ref|XP_005554522.1|  PREDICTED: syntaxin-18 isoform X2                56.2    4e-05    
gb|EWM27197.1|  SNARE-complex protein Syntaxin-18 like protein        55.5    4e-05    
ref|XP_003356904.1|  PREDICTED: syntaxin-18 isoform X1                53.9    5e-05    
gb|AAH21362.1|  Stx18 protein                                         55.8    6e-05    
ref|XP_009099670.1|  PREDICTED: syntaxin-18                           55.8    6e-05    
ref|XP_009204783.1|  PREDICTED: syntaxin-18 isoform X2                55.8    7e-05    
ref|NP_001276465.1|  syntaxin-18 isoform 3                            55.5    7e-05    
ref|XP_010581761.1|  PREDICTED: syntaxin-18 isoform X2                55.5    8e-05    
ref|XP_002746046.1|  PREDICTED: syntaxin-18                           47.0    9e-05    
gb|EDM00015.1|  syntaxin 18, isoform CRA_c                            55.1    1e-04    
ref|XP_002116781.1|  hypothetical protein TRIADDRAFT_60762            38.5    1e-04    
ref|XP_005674399.1|  PREDICTED: syntaxin-18-like                      55.1    1e-04    
ref|XP_005068889.1|  PREDICTED: syntaxin-18 isoform X2                54.7    1e-04    
ref|XP_010010911.1|  PREDICTED: syntaxin-18                           53.1    2e-04    
ref|XP_008522519.1|  PREDICTED: syntaxin-18                           52.4    2e-04    
ref|XP_002426274.1|  syntaxin-18, putative                            48.1    2e-04    
gb|KFP77762.1|  Syntaxin-18                                           52.4    2e-04    
gb|KFQ07413.1|  Syntaxin-18                                           52.0    3e-04    
gb|KFZ50044.1|  Syntaxin-18                                           52.0    3e-04    
ref|XP_009945646.1|  PREDICTED: syntaxin-18                           52.4    3e-04    
ref|XP_009500446.1|  PREDICTED: syntaxin-18-like                      51.6    3e-04    
ref|XP_010301199.1|  PREDICTED: syntaxin-18-like                      52.0    3e-04    
gb|KFQ42236.1|  Syntaxin-18                                           51.2    5e-04    
ref|XP_009871306.1|  PREDICTED: syntaxin-18                           51.6    6e-04    
ref|XP_003388945.1|  PREDICTED: syntaxin-18-like                      52.8    6e-04    
ref|XP_010162304.1|  PREDICTED: syntaxin-18-like                      52.0    7e-04    



>ref|XP_004237813.1| PREDICTED: syntaxin-81 [Solanum lycopersicum]
 ref|XP_010320109.1| PREDICTED: syntaxin-81 [Solanum lycopersicum]
Length=317

 Score =   388 bits (997),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 194/266 (73%), Positives = 222/266 (83%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDRTEDFKD  HR+A+SLGYDE              SKTAA+LASFI+HKPRQ+S 
Sbjct  1     MSKVRDRTEDFKDVAHRSALSLGYDE--------------SKTAALLASFIMHKPRQKSG  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVTIF+KSCKEQIDVL+N
Sbjct  47    FTRAALKTLESIGTLEQFLMKHKKDYVDLHRTTEQERDSIEHEVTIFVKSCKEQIDVLRN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+++A SKGW+G KGDN NADT+AHKHGVVLILSEKLHSVSSQFD LRA+RFQDAINR
Sbjct  107   SINEEDANSKGWLGLKGDNLNADTIAHKHGVVLILSEKLHSVSSQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + T KS+ +E S SSNLD   + DSE     + ++ PIRVQEQ LDDETRALQ
Sbjct  167   VTPRRKRKNTTKSNAAETSVSSNLDPNMKRDSEGLGDPDTQAAPIRVQEQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD+VQ+TETKMVEMSALNHL
Sbjct  227   VELNSLLDSVQETETKMVEMSALNHL  252


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT+NVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYEQAVEATQNVELGNKELSQAIQRN  292



>ref|XP_009760959.1| PREDICTED: syntaxin-81-like [Nicotiana sylvestris]
 ref|XP_009760960.1| PREDICTED: syntaxin-81-like [Nicotiana sylvestris]
 ref|XP_009760961.1| PREDICTED: syntaxin-81-like [Nicotiana sylvestris]
 ref|XP_009760962.1| PREDICTED: syntaxin-81-like [Nicotiana sylvestris]
 ref|XP_009760963.1| PREDICTED: syntaxin-81-like [Nicotiana sylvestris]
Length=317

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/266 (72%), Positives = 222/266 (83%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+KIRDRTEDFKD   R+A+SLGYDE              SKTAA+LASFI+HKPRQRS 
Sbjct  1     MSKIRDRTEDFKDAARRSALSLGYDE--------------SKTAALLASFIMHKPRQRSG  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AA+KTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVT+F+KSCKEQIDVLKN
Sbjct  47    FTRAAVKTLESIGALEQFLMKHKKDYVDLHRTTEQERDSIEHEVTVFVKSCKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN++ A SKGW+GFKGDN NADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQDAINR
Sbjct  107   SINEENAHSKGWLGFKGDNLNADTIAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + + KS+ +E S SS+LD   + DSE RD +  ++ P+RVQEQ LDDETRALQ
Sbjct  167   VTPRRKRKNSTKSNAAETSVSSSLDPDMKRDSEIRDSDISQAAPVRVQEQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD+VQ+ ETKMVEMSALNHL
Sbjct  227   VELNSLLDSVQEIETKMVEMSALNHL  252


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYEQAVEATKNVELGNKELSQAIQRN  292



>ref|XP_006363439.1| PREDICTED: syntaxin-81-like [Solanum tuberosum]
Length=317

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/266 (72%), Positives = 221/266 (83%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDRTEDFKD  HR+A+SLGY+E              SKTAA+LASFI+HKPRQRS 
Sbjct  1     MSKVRDRTEDFKDVAHRSALSLGYNE--------------SKTAALLASFIMHKPRQRSG  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVTIF+KSCKEQIDVL+N
Sbjct  47    FTRAALKTLESIGTLEQFLMKHKKDYVDLHRTTEQERDSIEHEVTIFVKSCKEQIDVLRN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+++A SKGW+G KGDN NADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQDAINR
Sbjct  107   SINEEDANSKGWLGLKGDNLNADTIAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + T KS+ +E S SS+LD   + D E     + ++ PIRVQEQ LDDETRALQ
Sbjct  167   VTPRRKRKNTTKSNAAETSASSSLDPNMKRDFEGLGDPDTQAAPIRVQEQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD+VQ+TETKMVEMSALNHL
Sbjct  227   VELNSLLDSVQETETKMVEMSALNHL  252


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEAT+NVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYDQAVEATQNVELGNKELSQAIQRN  292



>ref|XP_009594626.1| PREDICTED: syntaxin-81 [Nicotiana tomentosiformis]
Length=317

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/266 (72%), Positives = 221/266 (83%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+KIRDRTEDFKD   R+A+SLGYDE              SKTA +LASFI+HKPRQRS 
Sbjct  1     MSKIRDRTEDFKDAARRSALSLGYDE--------------SKTAVLLASFIMHKPRQRSG  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVT+F+KSCKEQIDVLKN
Sbjct  47    FTRAALKTLESIGALEQFLMKHKKDYVDLHRTTEQERDSIEHEVTVFVKSCKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+++A SKGW+GFKGDN NADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQDAINR
Sbjct  107   SINEEDAHSKGWLGFKGDNLNADTIAHKHGVVLILSEKLHSVTSQFDKLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + + KS+ +E S SS+ D   + DSE RD +  ++ PIRVQEQ LD+ETRALQ
Sbjct  167   VTPRRKRKNSTKSNAAEASVSSSFDPDMKRDSEIRDSDISQAAPIRVQEQLLDNETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD VQ+TETKMVEMSALNHL
Sbjct  227   VELNSLLDYVQETETKMVEMSALNHL  252


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYEQAVEATKNVELGNKELSQAIQRN  292



>ref|XP_006343391.1| PREDICTED: syntaxin-81-like [Solanum tuberosum]
Length=317

 Score =   380 bits (975),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/266 (72%), Positives = 222/266 (83%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDRTEDFKD   R+A+SLGYDE              SKTAA+LASFI+HKPRQRS 
Sbjct  1     MSKVRDRTEDFKDVARRSALSLGYDE--------------SKTAALLASFIMHKPRQRSG  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F +AALKTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEH+VTIF+KSCKEQIDVL+N
Sbjct  47    FIRAALKTLESIGTLEQFLMKHKKDYVDLHRTTEQERDSIEHDVTIFVKSCKEQIDVLRN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+++A SKGW+G KGDN NADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQDAINR
Sbjct  107   SINEEDANSKGWLGLKGDNLNADTIAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + T KS+ +E S SS+LD   + DSE RD +  ++ P+RVQEQ LDDETRALQ
Sbjct  167   VTPRRKRKSTTKSNAAEASASSSLDPDMKRDSEVRDSDVSQAAPLRVQEQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD+VQ+TETKMVEMSALNHL
Sbjct  227   VELNSLLDSVQETETKMVEMSALNHL  252


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT+NVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYEQAVEATQNVELGNKELSQAIQRN  292



>ref|XP_004234608.1| PREDICTED: syntaxin-81-like [Solanum lycopersicum]
Length=337

 Score =   379 bits (972),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/267 (70%), Positives = 220/267 (82%), Gaps = 14/267 (5%)
 Frame = +2

Query  1055  GMAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRS  1234
             G++K+RDRTEDFKD   R+A+SLGYDE              SKTAA+LASFI+HKPRQR 
Sbjct  20    GVSKVRDRTEDFKDVARRSALSLGYDE--------------SKTAALLASFIMHKPRQRL  65

Query  1235  SFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLK  1414
              FT+AA+KTLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVTIF+KSCKEQIDVL+
Sbjct  66    GFTRAAIKTLESIGTLEQFLMKHKKDYVDLHRTTEQERDSIEHEVTIFVKSCKEQIDVLR  125

Query  1415  NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
             NSIN+++A SKGW+G KGDN NADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQDAIN
Sbjct  126   NSINEEDANSKGWLGLKGDNLNADTIAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAIN  185

Query  1595  RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             RV PRR  + T KS+ +E S S +LD   + DSE RD +  ++ P+RVQEQ LDDETRAL
Sbjct  186   RVTPRRNRKSTTKSNAAEASASISLDPDMKRDSEVRDNDVSQAAPMRVQEQLLDDETRAL  245

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL  LLD+VQ+TET MVEMSALNHL
Sbjct  246   QVELNSLLDSVQETETNMVEMSALNHL  272


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT+NVELGNKEL++AIQRN
Sbjct  278   LQQAQQIELLYEQAVEATQNVELGNKELSQAIQRN  312



>gb|EYU30482.1| hypothetical protein MIMGU_mgv1a010233mg [Erythranthe guttata]
 gb|EYU30483.1| hypothetical protein MIMGU_mgv1a010233mg [Erythranthe guttata]
Length=318

 Score =   370 bits (950),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/267 (68%), Positives = 220/267 (82%), Gaps = 15/267 (6%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK+RDRTEDFKD   R A++LGY+E              SKTAAI+ASFI+HK  +RSS
Sbjct  1     MAKVRDRTEDFKDAARRAALNLGYNE--------------SKTAAIMASFIMHKSWERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL TLESIG LE+FL+KHKKDYVD +RTTEQERDSIEHEVT+FIK+CKEQIDVLKN
Sbjct  47    FTKAALTTLESIGALEQFLMKHKKDYVDAHRTTEQERDSIEHEVTVFIKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+E  SKGW+G + DN NADT+AHKHGVVLILSEKLHSV+SQFD LRALRFQ+AINR
Sbjct  107   SINDEETNSKGWLGIRSDNLNADTIAHKHGVVLILSEKLHSVTSQFDQLRALRFQEAINR  166

Query  1598  VAPRRKPRRT-GKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             V PRRKP+R+   ++ +E +++ N+   + ++SE R  +++++EPIR+Q+Q LDDETR L
Sbjct  167   VTPRRKPKRSVTTNNNAESTSTGNMGPTEANNSEVRQTDDVQAEPIRMQQQLLDDETRTL  226

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL  +LDAVQ+TETKMVEMSALNHL
Sbjct  227   QVELASMLDAVQETETKMVEMSALNHL  253


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  259   LQQAQQIEFLYEQAVEATKNVELGNKELSQAIQRN  293



>ref|XP_006435564.1| hypothetical protein CICLE_v10032191mg [Citrus clementina]
 ref|XP_006435565.1| hypothetical protein CICLE_v10032191mg [Citrus clementina]
 ref|XP_006486454.1| PREDICTED: syntaxin-81-like isoform X1 [Citrus sinensis]
 ref|XP_006486455.1| PREDICTED: syntaxin-81-like isoform X2 [Citrus sinensis]
 gb|ESR48804.1| hypothetical protein CICLE_v10032191mg [Citrus clementina]
 gb|ESR48805.1| hypothetical protein CICLE_v10032191mg [Citrus clementina]
Length=309

 Score =   367 bits (943),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/266 (69%), Positives = 213/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD    TAVSLGYDE              SK AAI+ASFI+HKPR+RSS
Sbjct  1     MARIRDRTEDFKDVARHTAVSLGYDE--------------SKLAAIMASFIIHKPRERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESIG LE+F+L H+KDYV+  RTTEQERDSIEHEVT FIK+CKEQID+L+N
Sbjct  47    FTKAALKTLESIGALEQFILNHRKDYVEMQRTTEQERDSIEHEVTAFIKTCKEQIDILQN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G KGDNSNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQDAINR
Sbjct  107   SINDDEANSKGWLGLKGDNSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R         + S + D    + S+ R+ +E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   AMPRRKLKR--------ETVSKSADISTPNKSDIRELDEIQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVE+SALNHL
Sbjct  219   VELTSLLDAVQQTETKMVEVSALNHL  244


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LY+QAVEATKNVELGNKEL++AI+RN
Sbjct  250   LHQAQQIEHLYEQAVEATKNVELGNKELSQAIRRN  284



>gb|KDO69261.1| hypothetical protein CISIN_1g0217001mg [Citrus sinensis]
 gb|KDO69262.1| hypothetical protein CISIN_1g0217001mg [Citrus sinensis]
Length=309

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/266 (69%), Positives = 213/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD    TAVSLGYDE              SK AAI+ASFI+HKPR+RSS
Sbjct  1     MARIRDRTEDFKDVARHTAVSLGYDE--------------SKLAAIMASFIIHKPRERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESIG LE+F+L H+KDYV+  RTTEQERDSIEHEVT FIK+CKEQID+L+N
Sbjct  47    FTKAALKTLESIGALEQFILNHRKDYVEMQRTTEQERDSIEHEVTAFIKTCKEQIDILQN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G KGDNSNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQDAINR
Sbjct  107   SINDDEANSKGWLGRKGDNSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R         + S + D    + S+ R+ +E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   AMPRRKLKR--------ETVSKSADISTPNKSDIRELDEIQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVE+SALNHL
Sbjct  219   VELTSLLDAVQQTETKMVEVSALNHL  244


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LY+QAVEATKNVELGNKEL++AI+RN
Sbjct  250   LHQAQQIEHLYEQAVEATKNVELGNKELSQAIRRN  284



>ref|XP_007218719.1| hypothetical protein PRUPE_ppa009021mg [Prunus persica]
 gb|EMJ19918.1| hypothetical protein PRUPE_ppa009021mg [Prunus persica]
Length=309

 Score =   364 bits (935),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 212/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD V  +A+SLGY+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRMEDFKDAVRHSALSLGYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKT+ESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTMESIGALEQFMLKHRKDYVDLHRTTEQERDSIEHEVSAFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+SQFD LRA+RFQD INR
Sbjct  107   SINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSQFDKLRAIRFQDTINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   S  ++ S S+NL        E R+PNEL+ EP+ VQ+Q LDDETRALQ
Sbjct  167   ATPRRKLKRIANSEPADASNSNNL--------ELREPNELQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELTNLLDAVQQTETKMVEMSALNHL  244


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKE++KAIQRN
Sbjct  250   LQQAQQIEQLYDQAVEATKNVELGNKEISKAIQRN  284



>gb|KDO66408.1| hypothetical protein CISIN_1g039000mg, partial [Citrus sinensis]
Length=262

 Score =   362 bits (929),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/266 (68%), Positives = 212/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD V  TAVSLGYDE              SK AAI+ASFI+HKPR+RSS
Sbjct  1     MARIRDRTEDFKDVVRHTAVSLGYDE--------------SKLAAIMASFIIHKPRERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLES+G LE+F+L H+KDYV+ +RT+EQERDSIEHEVT FIK+CKE+ID+L+N
Sbjct  47    FTKAALKTLESVGALEQFILNHRKDYVEMHRTSEQERDSIEHEVTAFIKTCKEKIDILQN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G K D SNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQDAINR
Sbjct  107   SINDDEANSKGWLGLKVDRSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R         + S   D    + S+ R+ +E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   AMPRRKLKR--------ETVSKYADTSNPNKSDMRELDEIQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELTSLLDAVQQTETKMVEMSALNHL  244



>ref|XP_011084953.1| PREDICTED: syntaxin-81 [Sesamum indicum]
Length=317

 Score =   363 bits (933),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 213/266 (80%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M K+RDRTEDFKD   R A++LGY+E              SKTAAI+ASFI+HK  +RS+
Sbjct  1     MTKVRDRTEDFKDAARRAALNLGYNE--------------SKTAAIMASFIMHKSWERSA  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA  TLESIG LE+FL KHKKDYVD +RTTEQERDSIEHEVT+FIKSCKEQIDVLKN
Sbjct  47    FTKAAFTTLESIGALEQFLQKHKKDYVDHHRTTEQERDSIEHEVTVFIKSCKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA SKGW+G + D  NADT+AHKHGVVLILSEKLHSV+SQFD LRALRFQDAINR
Sbjct  107   SINDEEANSKGWLGIRSDKMNADTIAHKHGVVLILSEKLHSVTSQFDQLRALRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK +R   +   + STS N++ R+  D E R  +++++EP+R Q+Q LDDETRALQ
Sbjct  167   VTPRRKLKRDVTTDVVDSSTSGNVEPREVKDLEVRQTDDIQAEPVRFQQQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  +LDAVQ+TETKMVEMSALNHL
Sbjct  227   VELASMLDAVQETETKMVEMSALNHL  252


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIEYLY+QAVEATKNVELGNKEL++AIQRN
Sbjct  258   LQQAQQIEYLYEQAVEATKNVELGNKELSQAIQRN  292



>ref|XP_008232847.1| PREDICTED: syntaxin-81 isoform X1 [Prunus mume]
Length=309

 Score =   363 bits (932),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 211/266 (79%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD V  +A+SLGY E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRMEDFKDAVRHSALSLGYSE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKT+ESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTMESIGALEQFMLKHRKDYVDLHRTTEQERDSIEHEVSAFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+SQFD LRA+RFQD INR
Sbjct  107   SINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSQFDKLRAIRFQDTINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   S  ++ S S+NL        E R+PNEL+ EP+ VQ+Q LDDETRALQ
Sbjct  167   ATPRRKLKRIANSEPADASNSNNL--------ELREPNELQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELTNLLDAVQQTETKMVEMSALNHL  244


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKE++KAIQRN
Sbjct  250   LQQAQQIEQLYDQAVEATKNVELGNKEISKAIQRN  284



>emb|CDO97362.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   363 bits (932),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/266 (69%), Positives = 211/266 (79%), Gaps = 14/266 (5%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDF+D V R+AVSLG+ E              +KTAAIL+SFI+HKPR+R+S
Sbjct  1     MAKARDRTEDFRDAVRRSAVSLGFTE--------------AKTAAILSSFIMHKPRERTS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KAALKTL SI  LE FL+KHKKDY+D +R TEQERDSIEHEVT+FIK+CKEQIDVLKN
Sbjct  47    FMKAALKTLGSIEALEHFLMKHKKDYLDQHRITEQERDSIEHEVTVFIKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+E  S+GW+G KGDN NADT+AHKHGVVLILSEKLHSV+S FD LRA+RFQDAINR
Sbjct  107   SINDEETNSRGWLGIKGDNLNADTIAHKHGVVLILSEKLHSVTSHFDKLRAVRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK R+ G     E++ SSN+  R+  D E R+  E +  PIRVQEQ LDDETRALQ
Sbjct  167   VTPRRKRRQAGTEEVKEVARSSNVGPRETYDKEVRESEEAQPGPIRVQEQLLDDETRALQ  226

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLDA Q+TE KMVEMSALNHL
Sbjct  227   VELSSLLDAAQETEKKMVEMSALNHL  252


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  258   LQQAQQIELLYEQAVEATKNVELGNKELSQAIQRN  292



>ref|XP_009350599.1| PREDICTED: syntaxin-81-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009350600.1| PREDICTED: syntaxin-81-like isoform X1 [Pyrus x bretschneideri]
Length=309

 Score =   362 bits (930),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/266 (67%), Positives = 214/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD VH +A+S+GY+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRIEDFKDAVHHSAISMGYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTLESIGTLEQFMLKHRKDYVDLHRTTEQERDSIEHEVSTFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEAKSKGW+G + D SNADT+AHKHG VLILSE+LHSV+S+FD LRA+R QD+IN+
Sbjct  107   SINDDEAKSKGWLGIRTDYSNADTIAHKHGAVLILSERLHSVTSRFDQLRAIRIQDSINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   + +++ S S+NL        E R+PNE + EP+ VQ+Q LDDETRALQ
Sbjct  167   TTPRRKLKRIKTTESADTSNSNNL--------ELREPNEFQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELTGLLDAVQ+TETKMVEMSALNHL
Sbjct  219   VELTGLLDAVQETETKMVEMSALNHL  244


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEAT NVELGNKE++KAIQRN
Sbjct  250   LQQAHQIEQLYDQAVEATTNVELGNKEISKAIQRN  284



>ref|XP_006470497.1| PREDICTED: syntaxin-81-like isoform X1 [Citrus sinensis]
 ref|XP_006470498.1| PREDICTED: syntaxin-81-like isoform X2 [Citrus sinensis]
 ref|XP_006470499.1| PREDICTED: syntaxin-81-like isoform X3 [Citrus sinensis]
Length=309

 Score =   362 bits (929),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/266 (68%), Positives = 212/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD V  TAVSLGYDE              SK AAI+ASFI+HKPR+RSS
Sbjct  1     MARIRDRTEDFKDVVRHTAVSLGYDE--------------SKLAAIMASFIIHKPRERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLES+G LE+F+L H+KDYV+ +RT+EQERDSIEHEVT FIK+CKE+ID+L+N
Sbjct  47    FTKAALKTLESVGALEQFILNHRKDYVEMHRTSEQERDSIEHEVTAFIKTCKEKIDILQN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G K D SNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQDAINR
Sbjct  107   SINDDEANSKGWLGLKVDRSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R         + S   D    + S+ R+ +E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   AMPRRKLKR--------ETVSKYADTSNPNKSDMRELDEIQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELTSLLDAVQQTETKMVEMSALNHL  244


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QA+QIE+LY+QAVEATKNVELGNKEL++AI+RN
Sbjct  250   LHQAKQIEHLYEQAVEATKNVELGNKELSQAIRRN  284



>ref|XP_008359732.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
 ref|XP_008359733.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
 ref|XP_008359734.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
 ref|XP_008359735.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
 ref|XP_008359736.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
 ref|XP_008359737.1| PREDICTED: syntaxin-81-like isoform X1 [Malus domestica]
Length=309

 Score =   362 bits (929),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 214/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD V  +A+S+GY+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRMEDFKDAVRHSAISMGYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV  FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEHEVGAFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+S+FD LRA+RFQD+IN+
Sbjct  107   SINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSRFDQLRAIRFQDSINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRKP+R   S++++ S S+NL        E R+PNE + EP+ VQ+Q LDDETRALQ
Sbjct  167   ATPRRKPKRIKTSASTDTSNSNNL--------ELREPNEFQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  219   VELTSLLDAVQETETKMVEMSALNHL  244


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEATKNVELGNKE++KAIQRN
Sbjct  250   LQQAHQIEQLYDQAVEATKNVELGNKEISKAIQRN  284



>ref|XP_002316241.1| syntaxin 81 family protein [Populus trichocarpa]
 gb|EEF02412.1| syntaxin 81 family protein [Populus trichocarpa]
Length=311

 Score =   362 bits (929),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 214/266 (80%), Gaps = 20/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V  TAVSLGY+E              +K AAI+ASFI+HKPRQRS 
Sbjct  1     MAKIRDRTEDFKDAVRHTAVSLGYNE--------------AKLAAIMASFIIHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIE EVT FIK+CKEQID+LK+
Sbjct  47    FTKAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEQEVTAFIKACKEQIDILKD  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN++EA +KGW+G K D SNADT+AHKHGVVLILSEKLHSV+++FD LRA+RFQDAIN+
Sbjct  107   SINNEEANTKGWLGIKADTSNADTIAHKHGVVLILSEKLHSVTARFDQLRAIRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R           +S++D  + ++ +  +P+E++ EP+RVQ+Q LDDETRALQ
Sbjct  167   RIPRRKVNRAAN------KNTSSVDSSKTNNLDFMEPDEIQPEPLRVQQQLLDDETRALQ  220

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  221   VELTSLLDAVQETETKMVEMSALNHL  246


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++A+QRN
Sbjct  252   LQQAQQIELLYEQAVEATKNVELGNKELSQAVQRN  286



>ref|XP_006446367.1| hypothetical protein CICLE_v10016032mg [Citrus clementina]
 gb|ESR59607.1| hypothetical protein CICLE_v10016032mg [Citrus clementina]
Length=309

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 212/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD V  TAVSLGYDE              SK AAI+ASFI+HKPR+RSS
Sbjct  1     MARIRDRTEDFKDVVRHTAVSLGYDE--------------SKLAAIMASFIIHKPRERSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLES+G L++F+L H+KDYV+ +RT+EQERDSIEHEVT FIK+CKE+ID+L+N
Sbjct  47    FTKAALKTLESVGALKQFILNHRKDYVEMHRTSEQERDSIEHEVTAFIKTCKEKIDILQN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G K D SNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQDAINR
Sbjct  107   SINDDEANSKGWLGLKVDRSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R         + S   D    + S+ R+ +E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   AMPRRKLKR--------ETVSKYADTSNPNKSDMRELDEIQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELTSLLDAVQQTETKMVEMSALNHL  244


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QA+QIE+LY+QAVEATKNVELGNK+L++AI+RN
Sbjct  250   LHQAKQIEHLYEQAVEATKNVELGNKQLSQAIRRN  284



>ref|XP_009375853.1| PREDICTED: syntaxin-81 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375854.1| PREDICTED: syntaxin-81 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375855.1| PREDICTED: syntaxin-81 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375856.1| PREDICTED: syntaxin-81 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375857.1| PREDICTED: syntaxin-81 isoform X1 [Pyrus x bretschneideri]
Length=309

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/266 (67%), Positives = 214/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD V ++A+S+GY+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRMEDFKDAVRQSAISMGYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTLESIGALEQFMLKHQKDYVDLHRTTEQERDSIEHEVSAFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
              INDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+S+FD LRA+RFQD+IN+
Sbjct  107   RINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSRFDQLRAIRFQDSINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRKP+R   S++++ S S+N         E R+PNE + EP+ VQ+Q LDDETRALQ
Sbjct  167   ATPRRKPKRIKTSASTDTSNSNNF--------ELREPNEFQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  219   VELTSLLDAVQETETKMVEMSALNHL  244


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEATKNVELGNKE++KAI+RN
Sbjct  250   LQQAHQIEQLYDQAVEATKNVELGNKEISKAIERN  284



>gb|KDP26062.1| hypothetical protein JCGZ_21095 [Jatropha curcas]
Length=308

 Score =   357 bits (917),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 209/266 (79%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFKD V  TAVS GYDE              SK AAILASFI+HKPRQR  
Sbjct  1     MARVRDRTEDFKDAVRHTAVSSGYDE--------------SKLAAILASFIIHKPRQRLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL TLESI  LE+F++KH+KDYVD +RTTEQERDSIEHEV  FIK+CKEQIDVLKN
Sbjct  47    FTKAALTTLESISTLEQFIIKHRKDYVDLHRTTEQERDSIEHEVMAFIKTCKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN++EA +KGW+  +G +SN DTVAHKHGVVLILSEKLHSVS+QFD LRA+RFQDAIN+
Sbjct  107   SINNEEASAKGWLSIRG-SSNTDTVAHKHGVVLILSEKLHSVSAQFDQLRAVRFQDAINK  165

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRKP R            S+ D  + ++SE R+P+E++++P+RVQ+Q LDDETRALQ
Sbjct  166   RMPRRKPNRVAN--------PSSTDSSKMNNSEPREPDEIQTDPLRVQQQLLDDETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLDA QQTETKMVEMSALNHL
Sbjct  218   VELASLLDAAQQTETKMVEMSALNHL  243


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  249   LQQAQQIEHLYEQAVEATKNVELGNKELSQAIQRN  283



>ref|XP_010543751.1| PREDICTED: syntaxin-81 [Tarenaya hassleriana]
Length=309

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 213/266 (80%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K RDR EDFKD+V ++AVS+GY+E              SK AA +ASFI+HK ++RS 
Sbjct  1     MSKFRDRMEDFKDSVRKSAVSMGYNE--------------SKLAATMASFIIHKTKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKA+LKTLESI  LE+F+LKH+KDYVD +RTTEQERDSIEHEVTIFIK+CKEQID+LKN
Sbjct  47    FTKASLKTLESIKELEQFMLKHRKDYVDLHRTTEQERDSIEHEVTIFIKACKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI+++E  S  W+G K D+SNADT+AHKHGVVLILSEKLHSV++QFD LRA+RFQD INR
Sbjct  107   SISNEETNSTSWLGLKADSSNADTIAHKHGVVLILSEKLHSVTAQFDQLRAIRFQDTINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRKP+R   S   + ++S NL        E+R+P EL+S+P+RVQ++ LDDETRALQ
Sbjct  167   AIPRRKPKRVANSVQPDAASSRNL--------ESREPEELQSQPLRVQQELLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLDAVQQTETKMVEMSALNHL
Sbjct  219   VELSNLLDAVQQTETKMVEMSALNHL  244


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEATKNVELGNKE+++AIQRN
Sbjct  250   LQQAQQIEFLYEQAVEATKNVELGNKEISQAIQRN  284



>ref|XP_011036017.1| PREDICTED: syntaxin-81-like isoform X1 [Populus euphratica]
 ref|XP_011036018.1| PREDICTED: syntaxin-81-like isoform X1 [Populus euphratica]
Length=314

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 215/266 (81%), Gaps = 17/266 (6%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V  TAVSLGY+E              SK AAI+ASFI+HKPRQRS 
Sbjct  1     MAKIRDRTEDFKDAVRHTAVSLGYNE--------------SKLAAIMASFIVHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIE EVT FIK+CKEQID+LK+
Sbjct  47    FTKAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEQEVTAFIKACKEQIDILKD  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA +KGW+G K D SN DT+AHKHGVVLILSEKLHSV+++FD LRA+RFQDAIN+
Sbjct  107   SINDEEASTKGWLGIKADTSNTDTIAHKHGVVLILSEKLHSVTARFDQLRAIRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R    +TS + +SS     + ++ E ++P+E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   RIPRRKLNRAANKNTSSVGSSS---SSKTNNLEFKEPDEIQPEPLGVQQQLLDDETRALQ  223

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  224   VELTSLLDAVQETETKMVEMSALNHL  249


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++A+QRN
Sbjct  255   LQQAQQIELLYDQAVEATKNVELGNKELSQAVQRN  289



>ref|XP_011036019.1| PREDICTED: syntaxin-81-like isoform X2 [Populus euphratica]
Length=290

 Score =   356 bits (913),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 215/266 (81%), Gaps = 17/266 (6%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V  TAVSLGY+E              SK AAI+ASFI+HKPRQRS 
Sbjct  1     MAKIRDRTEDFKDAVRHTAVSLGYNE--------------SKLAAIMASFIVHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIE EVT FIK+CKEQID+LK+
Sbjct  47    FTKAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEQEVTAFIKACKEQIDILKD  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA +KGW+G K D SN DT+AHKHGVVLILSEKLHSV+++FD LRA+RFQDAIN+
Sbjct  107   SINDEEASTKGWLGIKADTSNTDTIAHKHGVVLILSEKLHSVTARFDQLRAIRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R    +TS + +SS     + ++ E ++P+E++ EP+ VQ+Q LDDETRALQ
Sbjct  167   RIPRRKLNRAANKNTSSVGSSS---SSKTNNLEFKEPDEIQPEPLGVQQQLLDDETRALQ  223

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  224   VELTSLLDAVQETETKMVEMSALNHL  249



>ref|XP_008375891.1| PREDICTED: syntaxin-81 [Malus domestica]
 ref|XP_008375892.1| PREDICTED: syntaxin-81 [Malus domestica]
Length=309

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 211/266 (79%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD V  +A+S+ Y+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRIEDFKDAVRHSAISMSYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTLESIGTLEQFMLKHRKDYVDLHRTTEQERDSIEHEVSTFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+S+FD LRA+R QD+IN+
Sbjct  107   SINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSRFDQLRAIRIQDSINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   + +++ S S+NL        E R+PNE + EP+ VQ+Q LDDETRALQ
Sbjct  167   ATPRRKLKRIKTTESADTSNSNNL--------ELREPNEFQPEPLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELTGLLDAVQ+TETKM EMSALNHL
Sbjct  219   VELTGLLDAVQETETKMAEMSALNHL  244


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEAT NVE GNKE++KAIQRN
Sbjct  250   LQQAHQIEQLYDQAVEATTNVEFGNKEISKAIQRN  284



>ref|XP_010658487.1| PREDICTED: syntaxin-81 [Vitis vinifera]
 ref|XP_010658488.1| PREDICTED: syntaxin-81 [Vitis vinifera]
 ref|XP_010658489.1| PREDICTED: syntaxin-81 [Vitis vinifera]
 emb|CBI31550.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   354 bits (909),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 216/266 (81%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V +TA+SLGY+E              SK A+IL+SFI+HKP QR+S
Sbjct  1     MAKIRDRTEDFKDVVRQTALSLGYNE--------------SKMASILSSFIIHKPLQRTS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESI  LE+F+++H+KDYVD +RTTEQERDSIEHEVTIFIK+CK+QID+LKN
Sbjct  47    FTKAALKTLESIRTLEQFIMQHRKDYVDMHRTTEQERDSIEHEVTIFIKACKDQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI+ +EA S+GW+G +GD+SNADT+AHKHGVVLILSE+LHSV++QFD LRA RFQDAINR
Sbjct  107   SISGEEANSRGWLGIRGDHSNADTIAHKHGVVLILSERLHSVTAQFDQLRARRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PR+K  R   S+ +EI  S N        SE R+P+E + EP+RVQ+Q LDDETRALQ
Sbjct  167   RIPRKKMNRVSSSNATEIPKSIN--------SELREPDEPQPEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLDAVQ+TET+MVEMSALNHL
Sbjct  219   VELSSLLDAVQETETQMVEMSALNHL  244


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT NVELGNKEL++AIQRN
Sbjct  250   LQQAQQIELLYEQAVEATSNVELGNKELSQAIQRN  284



>ref|XP_002523004.1| Syntaxin-81, putative [Ricinus communis]
 gb|EEF39434.1| Syntaxin-81, putative [Ricinus communis]
Length=309

 Score =   348 bits (892),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 207/266 (78%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+IRDRTEDFKD V  TAVSLGY+E              SK AAI+ASFI+HKPRQRS 
Sbjct  1     MARIRDRTEDFKDAVRHTAVSLGYNE--------------SKLAAIMASFIIHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL TL SI  LE+F+LKH+KDYVD +RTTEQERDSIE EV  FIK+CKEQID LK+
Sbjct  47    FTKAALTTLGSIETLEQFILKHRKDYVDLHRTTEQERDSIEQEVMAFIKACKEQIDFLKD  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA +KGW+G + D+SNADTVAH+HGVVLILSEKLH V++QFD LRA RFQDAIN+
Sbjct  107   SINDEEANTKGWLGIRTDSSNADTVAHEHGVVLILSEKLHFVTAQFDQLRARRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRKP R            S +D  + ++S+ R+P+E++SEP+ +Q+Q LDDETRALQ
Sbjct  167   RIPRRKPNRV--------VNPSPIDSSKMNNSDRREPDEIQSEPLSIQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
              ELT LLDA QQTETK+VEMSALNHL
Sbjct  219   AELTSLLDAAQQTETKIVEMSALNHL  244


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QA+EATKNV+LGNKEL++AIQRN
Sbjct  250   LQQAQQIEVLYEQAIEATKNVQLGNKELSQAIQRN  284



>gb|AFK37975.1| unknown [Lotus japonicus]
Length=309

 Score =   347 bits (889),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 205/266 (77%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V  +A SLGYDE              +K A+ILASFI+HKP QRS 
Sbjct  1     MAKARDRTEDFKDAVRHSARSLGYDE--------------AKLASILASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KAALKTLESIG LE+FLLKH+KDY D +RTTEQERDSIE EV+ FIK+C+EQIDVLKN
Sbjct  47    FYKAALKTLESIGELEQFLLKHRKDYTDLHRTTEQERDSIEQEVSAFIKTCQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN++E  SKGW+G     +NADT+AHKHGVVLILSE+LH V++QFD LRA+RFQDAINR
Sbjct  107   SINNEEETSKGWLGTATAKANADTIAHKHGVVLILSERLHPVTAQFDQLRAVRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  + +T+        +  +  D E R+P+ELRSEP+RVQ+Q LDDETRALQ
Sbjct  167   ATPRRKLNRVTRKNTT--------ETSESGDMELREPDELRSEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELTNLLDTVQETETKMVEMSALNHL  244


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE+LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  250   LQQAHQIEHLYEQAVEATKNVELGNKELSQAIQRN  284



>gb|AFK47396.1| unknown [Lotus japonicus]
Length=306

 Score =   345 bits (885),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 201/266 (76%), Gaps = 25/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V ++A SLGYDE              +K A+ILASFI+HKP QRS 
Sbjct  1     MAKARDRTEDFKDAVRQSARSLGYDE--------------AKLASILASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KAALKTLESIG LE+FLLKH+KDY D +RTTEQERDSIE EV+ FIK+C+EQIDVLKN
Sbjct  47    FYKAALKTLESIGELEQFLLKHRKDYTDLHRTTEQERDSIEQEVSAFIKTCQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+ E  SKGW+G     +NADT+AHKHGVVLILSE+LH V++QFD LRA+RFQDAINR
Sbjct  107   SINNVEENSKGWLGIATAKANADTIAHKHGVVLILSERLHPVTAQFDQLRAVRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +            D  +  D E R+P+ELRSEP+RVQ+Q LDDETR LQ
Sbjct  167   ATPRRKLSRVTRK-----------DSTESRDMELREPDELRSEPLRVQQQLLDDETRVLQ  215

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  216   VELTNLLDTVQETETKMVEMSALNHL  241


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIEYLY+QAVEATKNVE GNKEL++AIQRN
Sbjct  247   LQQAHQIEYLYEQAVEATKNVEFGNKELSQAIQRN  281



>gb|KEH27041.1| syntaxin-81 protein [Medicago truncatula]
Length=309

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 202/266 (76%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V ++A SLGYDE              +K A+ILASFI+HKP QRS 
Sbjct  1     MAKARDRTEDFKDAVRQSARSLGYDE--------------AKLASILASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTLESIG L+ FLLKH+KDY D +RTTE ERDSIE EV+ FIK+C+EQIDVLKN
Sbjct  47    FTKAAFKTLESIGELDHFLLKHRKDYTDLHRTTEHERDSIEQEVSAFIKTCQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN++E  SKGW+G     +NADT+AHKHGVVLILSE+LHSV++QFD LRA+RFQDAINR
Sbjct  107   SINNEEENSKGWLGITTAKANADTIAHKHGVVLILSERLHSVTAQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  K          + +     D E R+P+ELRSEPIRVQ+Q LDDETRALQ
Sbjct  167   AIPRRKLNRITK--------KDSTETSNSGDVELREPDELRSEPIRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELSSLLDTVQETETKMVEMSALNHL  244


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  250   LQQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  284



>ref|XP_004512932.1| PREDICTED: syntaxin-81-like [Cicer arietinum]
Length=309

 Score =   344 bits (882),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 203/266 (76%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V ++A SLGYDE              +K A+ILASFI+HKP QRS 
Sbjct  1     MAKARDRTEDFKDAVRQSARSLGYDE--------------AKLASILASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F+KAA KTLESIG LE FLL+H+KDY D +RTTE+ERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FSKAAFKTLESIGELELFLLRHRKDYTDLHRTTEKERDSIEHEVSAFIKTCQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN +E  SKGW+G     +NADT+AHKHGVVLILSE+LHSV+SQFD LRA+RFQDAINR
Sbjct  107   SINHEEESSKGWLGITTAKANADTIAHKHGVVLILSERLHSVTSQFDQLRAVRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  K          + +  +  D E  +P+ELRSEP+RVQ+Q LDDETRALQ
Sbjct  167   AIPRRKLNRVTK--------KDSTETSKSGDVELSEPDELRSEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELSSLLDTVQETETKMVEMSALNHL  244


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  250   LQQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  284



>ref|NP_001239902.1| uncharacterized protein LOC100801587 [Glycine max]
 gb|ACU20852.1| unknown [Glycine max]
Length=309

 Score =   344 bits (882),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 204/266 (77%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M K RDRTEDFKD V  TA SLGYDE              +K A+++ASFI+HKP Q+S 
Sbjct  1     MGKARDRTEDFKDAVRHTARSLGYDE--------------AKLASVMASFIIHKPPQKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F+KAALKTLESIG L++FLLKH+KDY D +RTTE+ERDSIEHEV+ FIK+C+EQID+LKN
Sbjct  47    FSKAALKTLESIGELDQFLLKHRKDYTDLHRTTEKERDSIEHEVSTFIKTCQEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN +E  SKGW+G     SNAD +AHKHGVVLILSE+LHSV++QFD LRA+RFQDAIN+
Sbjct  107   SINQEEETSKGWLGIATTKSNADIIAHKHGVVLILSERLHSVTAQFDQLRAVRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +        + + +  + SD E R+P ELR+EP+RVQ+Q LDDETRALQ
Sbjct  167   AIPRRKLNRVAR--------NDSAETSKSSDMELREPEELRAEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELTSLLDTVQETETKMVEMSALNHL  244


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LYDQAVEAT NVELGNKEL++AIQRN
Sbjct  250   LHQAQQIEHLYDQAVEATNNVELGNKELSQAIQRN  284



>ref|XP_008441427.1| PREDICTED: syntaxin-81 [Cucumis melo]
 ref|XP_008441428.1| PREDICTED: syntaxin-81 [Cucumis melo]
Length=308

 Score =   343 bits (880),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 205/266 (77%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V   A+SLGY+E              SK AAI+ASFI+ KPRQRS 
Sbjct  1     MAKFRDRTEDFKDVVRHCAISLGYNE--------------SKLAAIMASFIIQKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KAALKTLESIG LEEF+LKH+KDYVD YRTT+QERD+IEHEV  FIK+C+EQ+D+LKN
Sbjct  47    FIKAALKTLESIGALEEFMLKHQKDYVDMYRTTDQERDNIEHEVAAFIKACQEQLDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+D+A SKGW+G + D+SNADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQD I++
Sbjct  107   SINEDDAHSKGWLGPRTDDSNADTIAHKHGVVLILSEKLHSVTSQFDKLRAIRFQDIISK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  +  K          + +  + S++E R+P+    +P+R Q Q LDDETRALQ
Sbjct  167   AVPRRKLNQVNK--------PRSANTTEYSNTELREPDNFEHQPVRAQ-QLLDDETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  218   VELTSLLDAVQETETKMVEMSALNHL  243


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIEYLY+QAVEATKNVELGNKELT+AIQRN
Sbjct  249   LQQAQQIEYLYEQAVEATKNVELGNKELTQAIQRN  283



>ref|XP_003543163.1| PREDICTED: syntaxin-81-like [Glycine max]
 gb|KHN32036.1| Syntaxin-81 [Glycine soja]
Length=309

 Score =   343 bits (880),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 202/266 (76%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M K RDRTEDFKD V  TA SLGYDE              +K A+++ASFI+HKP QRS 
Sbjct  1     MGKARDRTEDFKDAVRHTARSLGYDE--------------AKLASVMASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F+KAALKTLESIG L++FLLKH+KDY D +RTTE+ERDSIEHEV+ FIK+C+EQID+LKN
Sbjct  47    FSKAALKTLESIGELDQFLLKHRKDYTDLHRTTEKERDSIEHEVSTFIKTCQEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN +E  SK W+G     SNADT+AHKHGVVLILSE+LHSV++QFD LRA+RFQDAIN+
Sbjct  107   SINQEEETSKHWLGIATTKSNADTIAHKHGVVLILSERLHSVTAQFDQLRAVRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +          + +  +  D E R+P ELRSEP+RVQ+Q LDDETRALQ
Sbjct  167   AIPRRKLNRVAR--------KDSAETSKSGDMELREPEELRSEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELTSLLDTVQETETKMVEMSALNHL  244


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  250   LHQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  284



>ref|XP_004138436.1| PREDICTED: syntaxin-81-like [Cucumis sativus]
 ref|XP_004165357.1| PREDICTED: syntaxin-81-like [Cucumis sativus]
 gb|KGN45766.1| hypothetical protein Csa_6G009450 [Cucumis sativus]
Length=308

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 204/266 (77%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRTEDFKD V   A+SLGY+E              SK AAI+ASFI+ KPRQRS 
Sbjct  1     MAKFRDRTEDFKDVVRHCAISLGYNE--------------SKLAAIMASFIIQKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KAALKTLESIG LEEF+LKH+KDYVD YRTT+QERD+IEHEV  FIK+C+EQ+D+LKN
Sbjct  47    FIKAALKTLESIGALEEFMLKHQKDYVDMYRTTDQERDNIEHEVAAFIKACQEQLDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+D+A SKGW+G + D+SNADT+AHKHGVVLILSEKLHSV+SQFD LRA+RFQD I++
Sbjct  107   SINEDDAHSKGWLGPRTDDSNADTIAHKHGVVLILSEKLHSVTSQFDKLRAIRFQDIISK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  +  K  ++     +N        +E R+P+    +P+R Q Q LDDETRALQ
Sbjct  167   AVPRRKLNQVNKPRSANTPEYNN--------TELREPDNFEHQPVRAQ-QLLDDETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  218   VELTSLLDAVQETETKMVEMSALNHL  243


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEATKNVELGNKELT+AIQRN
Sbjct  249   LQQAQQIEHLYEQAVEATKNVELGNKELTQAIQRN  283



>ref|XP_010247832.1| PREDICTED: syntaxin-81-like isoform X1 [Nelumbo nucifera]
 ref|XP_010247833.1| PREDICTED: syntaxin-81-like isoform X1 [Nelumbo nucifera]
 ref|XP_010247834.1| PREDICTED: syntaxin-81-like isoform X1 [Nelumbo nucifera]
 ref|XP_010247835.1| PREDICTED: syntaxin-81-like isoform X1 [Nelumbo nucifera]
Length=311

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 211/268 (79%), Gaps = 24/268 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+ RDRTEDFKDTV   A+SLGY+E              SKTAAILASFI+HKPRQRS+
Sbjct  1     MARSRDRTEDFKDTVRSIALSLGYNE--------------SKTAAILASFIMHKPRQRST  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL+TLESI  LE+F+LKH+KDYVD +RTTEQERDSIEHEV++FIK+CKEQID+LKN
Sbjct  47    FTKAALRTLESIKTLEQFILKHRKDYVDPHRTTEQERDSIEHEVSVFIKTCKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+D++   KSK W+  + DNS+ D VAHKHGVVLILSEKLHS++SQFD LRA+RFQDA+
Sbjct  107   RIHDEDTSGKSKAWLTMRSDNSHVDIVAHKHGVVLILSEKLHSITSQFDQLRAIRFQDAV  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             N+  PRRK  +   S++  I+        + + SE ++P+EL SE  RVQ+QFLDDETRA
Sbjct  167   NKAMPRRKMHQVTNSNSPIIT--------KSNQSEVKEPDELPSEHQRVQQQFLDDETRA  218

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   LQVELTNLLDTVQETETKMVEMSALNHL  246


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQ QQIE LY+QAVEATKNVE+GNKE+++A+QRN
Sbjct  252   LQQTQQIELLYEQAVEATKNVEMGNKEISQAVQRN  286



>ref|XP_011039007.1| PREDICTED: syntaxin-81-like [Populus euphratica]
Length=313

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 209/266 (79%), Gaps = 18/266 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD +  +A+SLGY+E              S+ AAI+ASFI+HKPRQRS 
Sbjct  1     MAKIRDRTEDFKDALRHSAISLGYNE--------------SRLAAIMASFIIHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AALKTLESIG LE+F+LKH+KDY D +RTTEQERDSIE EVT FIK+CKEQID+LKN
Sbjct  47    FTIAALKTLESIGALEQFMLKHRKDYADLHRTTEQERDSIEQEVTAFIKACKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+ A +KGW+G K   SNADT+AHKHGVVLILSEKLHSV+++FD LRA+RFQDAIN+
Sbjct  107   SINDEAANTKGWLGIKAHTSNADTIAHKHGVVLILSEKLHSVTARFDQLRAIRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  +         + ++ +D  + ++ E  +P++++ E +RVQ+Q LDDETRALQ
Sbjct  167   RIPRRKLNQAAN----THTNTTTVDSSKTNNLEFSEPDDIQPESLRVQQQVLDDETRALQ  222

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LL+AVQ+TETKM+EMSALNHL
Sbjct  223   VELTSLLEAVQETETKMLEMSALNHL  248


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++A+QRN
Sbjct  254   LQQAQQIELLYEQAVEATKNVELGNKELSQAVQRN  288



>ref|XP_007152765.1| hypothetical protein PHAVU_004G157700g [Phaseolus vulgaris]
 gb|ESW24759.1| hypothetical protein PHAVU_004G157700g [Phaseolus vulgaris]
Length=309

 Score =   340 bits (873),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 204/266 (77%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M K RDRTEDFKD V  TA SLGYDE              +K A+I+ASFI+HKP QRS 
Sbjct  1     MGKARDRTEDFKDAVRHTAHSLGYDE--------------AKLASIMASFIIHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F+KAALKTLESIG L++FLLKH+KDY D +RTTE+ERD IEHEV+ FIK+C+EQID+LKN
Sbjct  47    FSKAALKTLESIGELDQFLLKHRKDYTDLHRTTEKERDGIEHEVSTFIKTCQEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN +E  SKGW+G     SNADT+AHKHGVVLILSE+LH+V++QFD LRA+RFQDAIN+
Sbjct  107   SINQEEEHSKGWLGIAATKSNADTIAHKHGVVLILSERLHTVTAQFDQLRAVRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +  ++E S S  +        E R+P ELR+EP+RVQ+Q LDDETRALQ
Sbjct  167   AMPRRKLNRVTRKDSAETSKSDGM--------ELREPEELRAEPLRVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   VELTTLLDTVQETETKMVEMSALNHL  244


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LY+QAVEAT NVELGNKEL++AI+RN
Sbjct  250   LHQAQQIEHLYEQAVEATTNVELGNKELSQAIKRN  284



>ref|XP_007010755.1| Syntaxin of plants 81 isoform 1 [Theobroma cacao]
 gb|EOY19565.1| Syntaxin of plants 81 isoform 1 [Theobroma cacao]
Length=308

 Score =   338 bits (867),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 207/266 (78%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD V  TA+S GY E              SK AAI+ASFI+HKP Q + 
Sbjct  1     MSRFRDRTEDFKDAVRHTAISSGYSE--------------SKLAAIMASFIIHKPWQTTP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTK+ALKTLESIG L++F+ KH+KDYVD +RTTEQE+DSIE EVT FIK+CK+QIDVLKN
Sbjct  47    FTKSALKTLESIGALDQFMSKHRKDYVDLHRTTEQEKDSIEQEVTAFIKACKDQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA SKGW+G + D SNADT+AHKHGVVLILSEKLHSV++QFD LRA+RFQDAINR
Sbjct  107   SINDEEATSKGWLGIR-DTSNADTIAHKHGVVLILSEKLHSVTAQFDQLRAIRFQDAINR  165

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   S++ + S   NLD         R+ NEL+ E +RVQ++ LD+ETRALQ
Sbjct  166   ATPRRKLKRVVDSNSLDTSKPVNLD--------LRETNELQPESLRVQQELLDNETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKMVEMSALNHL
Sbjct  218   VELTSLLDAVQETETKMVEMSALNHL  243


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  249   LQQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  283



>gb|KHG28837.1| Syntaxin-81 -like protein [Gossypium arboreum]
Length=308

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 211/266 (79%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD V ++A+S G++E              SK AAI+ASFI+HKPRQR+ 
Sbjct  1     MSRFRDRTEDFKDAVRQSAISSGFNE--------------SKLAAIMASFIIHKPRQRTP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F K+ALKTLESIG L++FLLKH+KDYVD +RTTEQERDSIEHEVT F+K+CKEQIDVLKN
Sbjct  47    FLKSALKTLESIGALDQFLLKHRKDYVDRHRTTEQERDSIEHEVTAFVKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
              IND+EA SKGW+G + D+SNADT+AHKHGVVLILSEKLHSV++QFD +RA+RFQ+AINR
Sbjct  107   CINDEEASSKGWLGIR-DSSNADTIAHKHGVVLILSEKLHSVTAQFDQMRAVRFQEAINR  165

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK ++   S++ + S   NL+ R+  +++         EP+RVQ++ LDDETRALQ
Sbjct  166   AMPRRKLKKVVDSNSIDTSKPLNLEHRETYENQP--------EPLRVQQELLDDETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ TETKMVEMSALNHL
Sbjct  218   VELTSLLDAVQDTETKMVEMSALNHL  243


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  249   LQQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  283



>ref|XP_010247310.1| PREDICTED: syntaxin-81-like isoform X2 [Nelumbo nucifera]
 ref|XP_010247311.1| PREDICTED: syntaxin-81-like isoform X2 [Nelumbo nucifera]
 ref|XP_010247312.1| PREDICTED: syntaxin-81-like isoform X2 [Nelumbo nucifera]
 ref|XP_010247313.1| PREDICTED: syntaxin-81-like isoform X2 [Nelumbo nucifera]
Length=311

 Score =   337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 209/268 (78%), Gaps = 24/268 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+ RDRTEDFKDTV   A+SLGY+E              SKTAA LASFI+HKPRQRS+
Sbjct  1     MARSRDRTEDFKDTVRSIALSLGYNE--------------SKTAATLASFIMHKPRQRST  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL+TLESI  LE+F++KH KDYVD +R TEQERDSIEHEV++FIK+CKEQID+LKN
Sbjct  47    FTKAALRTLESIKTLEQFIMKHWKDYVDPHRATEQERDSIEHEVSVFIKTCKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+D++   KSK W+  + DNS+ D VAHKHGVVLILSEKLHSV+SQFD LRA+RFQDA+
Sbjct  107   RIHDEDTSGKSKAWLSMRSDNSHVDIVAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAV  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             N+  PRRK  +   S++  IS        + + SE ++P+EL SE +RVQ+QFLDDETRA
Sbjct  167   NKAIPRRKMHQVTNSNSPIIS--------KSNHSEVKEPDELPSEHLRVQQQFLDDETRA  218

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLD VQ+TETKMVEMSALNHL
Sbjct  219   LQVELTNLLDTVQETETKMVEMSALNHL  246


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT NVE+GNKEL++A+QRN
Sbjct  252   LQQAQQIELLYEQAVEATNNVEMGNKELSQAMQRN  286



>ref|XP_010247309.1| PREDICTED: syntaxin-81-like isoform X1 [Nelumbo nucifera]
Length=335

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 209/268 (78%), Gaps = 24/268 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+ RDRTEDFKDTV   A+SLGY+E              SKTAA LASFI+HKPRQRS+
Sbjct  25    MARSRDRTEDFKDTVRSIALSLGYNE--------------SKTAATLASFIMHKPRQRST  70

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL+TLESI  LE+F++KH KDYVD +R TEQERDSIEHEV++FIK+CKEQID+LKN
Sbjct  71    FTKAALRTLESIKTLEQFIMKHWKDYVDPHRATEQERDSIEHEVSVFIKTCKEQIDILKN  130

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+D++   KSK W+  + DNS+ D VAHKHGVVLILSEKLHSV+SQFD LRA+RFQDA+
Sbjct  131   RIHDEDTSGKSKAWLSMRSDNSHVDIVAHKHGVVLILSEKLHSVTSQFDQLRAIRFQDAV  190

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             N+  PRRK  +   S++  IS        + + SE ++P+EL SE +RVQ+QFLDDETRA
Sbjct  191   NKAIPRRKMHQVTNSNSPIIS--------KSNHSEVKEPDELPSEHLRVQQQFLDDETRA  242

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLD VQ+TETKMVEMSALNHL
Sbjct  243   LQVELTNLLDTVQETETKMVEMSALNHL  270


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT NVE+GNKEL++A+QRN
Sbjct  276   LQQAQQIELLYEQAVEATNNVEMGNKELSQAMQRN  310



>ref|XP_010091565.1| hypothetical protein L484_002138 [Morus notabilis]
 gb|EXB44792.1| hypothetical protein L484_002138 [Morus notabilis]
Length=297

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 210/289 (73%), Gaps = 45/289 (16%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK+RDRTEDFKD V  TA+SLGYDE              SK AAILA+FI+HK RQRS 
Sbjct  1     MAKVRDRTEDFKDAVRHTALSLGYDE--------------SKLAAILANFIIHKRRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHE-----------------  1366
             FTKAALKTLESIG LE F+LKH+KDYVD +RTTEQERDSIEHE                 
Sbjct  47    FTKAALKTLESIGTLEHFMLKHRKDYVDLHRTTEQERDSIEHECLKIAWSSGIGGFGWDG  106

Query  1367  ------VTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSE  1528
                   V+ FIK+C+EQIDVLKNSIND+E  SKGW G + D  NADTVAHKHGVVL LSE
Sbjct  107   VWERLPVSAFIKACQEQIDVLKNSINDEEDTSKGWFGIRADKFNADTVAHKHGVVLSLSE  166

Query  1529  KLHSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDP  1708
             +LHSV+SQFD LRA+RFQDAI++  PRRK +   KSS+ + S S+NLD         R+ 
Sbjct  167   RLHSVTSQFDQLRAIRFQDAISKATPRRKFKPVVKSSSEDASKSNNLD--------VREL  218

Query  1709  NELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             ++ R EP++VQ+Q LDDETRALQVEL+ LLDAVQQTETKMVEMSALNHL
Sbjct  219   DQFRPEPLKVQQQLLDDETRALQVELSSLLDAVQQTETKMVEMSALNHL  267



>ref|XP_006393000.1| hypothetical protein EUTSA_v10011542mg [Eutrema salsugineum]
 gb|ESQ30286.1| hypothetical protein EUTSA_v10011542mg [Eutrema salsugineum]
Length=402

 Score =   338 bits (866),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/270 (63%), Positives = 206/270 (76%), Gaps = 22/270 (8%)
 Frame = +2

Query  1046  FL*GMAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPR  1225
             FL  M++ RDRTEDFKD+V + AVS GY+E              SK A+ +ASFI+HKP+
Sbjct  90    FLYKMSRFRDRTEDFKDSVRKAAVSNGYNE--------------SKVASTMASFIIHKPK  135

Query  1226  QRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQID  1405
             +RS FTKAA KTLESI  L++F+LKH+KDYVD +RTTEQE+DSIE E+T FIK+CKEQID
Sbjct  136   ERSPFTKAAFKTLESIKELDQFMLKHRKDYVDMHRTTEQEKDSIEQEITAFIKACKEQID  195

Query  1406  VLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQD  1585
             +LKNSI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD
Sbjct  196   ILKNSIRNEEANSKGWLGLAADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQD  255

Query  1586  AINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDET  1765
              INR  PRRKP+R  K +T   +T +N         E+ +PNE  ++P RVQ+Q LDDET
Sbjct  256   IINRAMPRRKPKRIAKEATPVNATLAN--------PESIEPNEFPAQPRRVQQQLLDDET  307

Query  1766  RALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             +ALQVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  308   QALQVELSNLLDGARQTETKMVEMSALNHL  337


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  343   LQQAQQIEFLYDQAVEATKNVELGNKELSQAIQRN  377



>ref|XP_002891655.1| hypothetical protein ARALYDRAFT_892151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67914.1| hypothetical protein ARALYDRAFT_892151 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 208/267 (78%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V ++AVS+GY+E              SK A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKSAVSIGYNE--------------SKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTL+SI  LE+F+LKH+KDYVD +RTTEQE+DSIE E+T FIK+CKEQID+LKN
Sbjct  47    FTKAAFKTLDSIKELEQFMLKHRKDYVDLHRTTEQEKDSIEQEITAFIKACKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRV-QEQFLDDETRAL  1774
               PRRKP+R  K +   I+T +N        SE+  P+E++++P RV Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRIIKEANPIITTLAN--------SESIKPDEIQAQPRRVQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIELLYDQAVEATKNVELGNKELSQAIQRN  285



>ref|XP_010690321.1| PREDICTED: syntaxin-81 [Beta vulgaris subsp. vulgaris]
Length=308

 Score =   332 bits (851),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 205/266 (77%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V R AVSL YDE              SK AAI+ASFI+HKPR+R+ 
Sbjct  1     MAKIRDRTEDFKDAVRREAVSLEYDE--------------SKVAAIMASFIIHKPRERTQ  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F KA+LKTLESIG L++FL+KHK+DYVD +RTTEQERDSIE EVT F+K C++QIDVLK 
Sbjct  47    FMKASLKTLESIGELDQFLMKHKRDYVDLHRTTEQERDSIEQEVTSFVKLCQKQIDVLKA  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+EA SKGW+G +   SNADT+AHKHGVVLILSEKLHSV+S+FD LRA+RFQD +NR
Sbjct  107   SINDEEANSKGWLGIRM-ASNADTIAHKHGVVLILSEKLHSVTSEFDRLRAIRFQDVLNR  165

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +SS ++   S +L        E ++P+E+   P RVQEQ LDD+TRALQ
Sbjct  166   ATPRRKRNRIPESSATDHLKSKHL--------ENKEPDEVEPSPQRVQEQLLDDDTRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL+ LLDA QQTETKMVEMSALNHL
Sbjct  218   VELSNLLDAAQQTETKMVEMSALNHL  243


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEAT+NVELGNKEL++AIQRN
Sbjct  249   LQQAQQIEHLYEQAVEATQNVELGNKELSQAIQRN  283



>ref|XP_004306866.1| PREDICTED: syntaxin-81-like [Fragaria vesca subsp. vesca]
Length=309

 Score =   330 bits (846),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 202/266 (76%), Gaps = 22/266 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDR EDFKD V + A+S GY+E              SK AA++A FI+H PRQRS 
Sbjct  1     MAKFRDRMEDFKDAVRQAAISSGYNE--------------SKLAAVMAKFIIHPPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AA KTLESIG LE+F+LKH+KDYVD +RTTE ERDSIE EV+ FIK C+EQI VLKN
Sbjct  47    FTRAAYKTLESIGALEQFMLKHRKDYVDRHRTTEHERDSIEQEVSAFIKVCQEQISVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEAKSKGW+G + D+SNADT+AHKHGVVLILSE+LHSV+S++D LR++RFQD  +R
Sbjct  107   SINDDEAKSKGWLGIRVDHSNADTIAHKHGVVLILSERLHSVTSRYDQLRSIRFQDTFSR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  K  + + S+S+NL        E R+P   +++ + VQ+Q LDDETRALQ
Sbjct  167   ATPRRKLNRIPKKESEDTSSSNNL--------EVREPEAYQAQSLTVQQQLLDDETRALQ  218

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TE KMVEMSALNHL
Sbjct  219   VELTSLLDAVQETENKMVEMSALNHL  244


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQ +QIE LYDQAVEAT NV+LGNKEL+KAIQRN
Sbjct  250   LQQREQIEQLYDQAVEATHNVDLGNKELSKAIQRN  284



>ref|XP_010500758.1| PREDICTED: syntaxin-81 [Camelina sativa]
Length=310

 Score =   329 bits (844),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 205/267 (77%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V + AVS+GY+E              SK AA +ASFI+HKP++R  
Sbjct  1     MSRFRDRTEDFKDSVRKAAVSIGYNE--------------SKVAATMASFIMHKPKERLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AA KTLESI  L++F+LKH+KDYVD +RTTEQE+DSIE E T+FIK+CKEQID+LKN
Sbjct  47    FTRAAFKTLESIRELDQFMLKHRKDYVDMHRTTEQEKDSIEQETTLFIKTCKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIR-VQEQFLDDETRAL  1774
               PRRKP+R  K +    +T +N        SE+ +P+E++++P R  Q+Q LDDET+AL
Sbjct  167   ATPRRKPKRIVKEANPINTTLAN--------SESIEPDEIQAQPRREQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIEVLYDQAVEATKNVELGNKELSQAIQRN  285



>ref|XP_010067483.1| PREDICTED: syntaxin-81 [Eucalyptus grandis]
 ref|XP_010067484.1| PREDICTED: syntaxin-81 [Eucalyptus grandis]
 ref|XP_010067485.1| PREDICTED: syntaxin-81 [Eucalyptus grandis]
 gb|KCW65627.1| hypothetical protein EUGRSUZ_G03020 [Eucalyptus grandis]
 gb|KCW65628.1| hypothetical protein EUGRSUZ_G03020 [Eucalyptus grandis]
Length=308

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 203/266 (76%), Gaps = 23/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V ++A+S+GY+E              SK AA +ASFI+HK ++RS+
Sbjct  1     MAKIRDRTEDFKDAVRQSAISMGYNE--------------SKLAATMASFIIHKQQERSA  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESI  LE+F+ KH+KDYVD  RTTEQERDSIE EVT FIK+CKEQID+L+ 
Sbjct  47    FTKAALKTLESIQTLEQFMRKHRKDYVDPLRTTEQERDSIEQEVTAFIKTCKEQIDILQV  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++E K KGW+    + SNADT+AHK GVVLILSEKLHSV++QFD LRA+RFQDAINR
Sbjct  107   SITEEEKKLKGWLALSAEGSNADTIAHKQGVVLILSEKLHSVTAQFDQLRAIRFQDAINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRKP+++  S   + S           + E ++ NE+  E +RVQ+Q LDDETRALQ
Sbjct  167   VTPRRKPKQSASSIPVDNS---------NGNVEFKESNEVPGELLRVQQQHLDDETRALQ  217

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD+VQQTETKMVEMSALNHL
Sbjct  218   VELTSLLDSVQQTETKMVEMSALNHL  243


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEAT NV+LGNKEL +AIQRN
Sbjct  249   LQQAQQIEHLYDQAVEATHNVQLGNKELAQAIQRN  283



>ref|XP_008232848.1| PREDICTED: syntaxin-81 isoform X2 [Prunus mume]
Length=277

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 185/220 (84%), Gaps = 8/220 (4%)
 Frame = +2

Query  1196  LASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTI  1375
             +A FI+H PRQRS FT+AALKT+ESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ 
Sbjct  1     MAKFIIHAPRQRSPFTRAALKTMESIGALEQFMLKHRKDYVDLHRTTEQERDSIEHEVSA  60

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             FIK+C+EQIDVLKNSINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+SQF
Sbjct  61    FIKACQEQIDVLKNSINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSQF  120

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIR  1735
             D LRA+RFQD INR  PRRK +R   S  ++ S S+NL        E R+PNEL+ EP+ 
Sbjct  121   DKLRAIRFQDTINRATPRRKLKRIANSEPADASNSNNL--------ELREPNELQPEPLT  172

Query  1736  VQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             VQ+Q LDDETRALQVELT LLDAVQQTETKMVEMSALNHL
Sbjct  173   VQQQLLDDETRALQVELTNLLDAVQQTETKMVEMSALNHL  212


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKE++KAIQRN
Sbjct  218   LQQAQQIEQLYDQAVEATKNVELGNKEISKAIQRN  252



>ref|XP_008359738.1| PREDICTED: syntaxin-81-like isoform X2 [Malus domestica]
Length=277

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 187/220 (85%), Gaps = 8/220 (4%)
 Frame = +2

Query  1196  LASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTI  1375
             +A FI+H PRQRS FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV  
Sbjct  1     MAKFIIHAPRQRSPFTRAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEHEVGA  60

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             FIK+C+EQIDVLKNSINDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+S+F
Sbjct  61    FIKACQEQIDVLKNSINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSRF  120

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIR  1735
             D LRA+RFQD+IN+  PRRKP+R   S++++ S S+NL        E R+PNE + EP+ 
Sbjct  121   DQLRAIRFQDSINKATPRRKPKRIKTSASTDTSNSNNL--------ELREPNEFQPEPLT  172

Query  1736  VQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             VQ+Q LDDETRALQVELT LLDAVQ+TETKMVEMSALNHL
Sbjct  173   VQQQLLDDETRALQVELTSLLDAVQETETKMVEMSALNHL  212


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEATKNVELGNKE++KAIQRN
Sbjct  218   LQQAHQIEQLYDQAVEATKNVELGNKEISKAIQRN  252



>gb|KHN20725.1| Syntaxin-81 [Glycine soja]
Length=307

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 199/266 (75%), Gaps = 24/266 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M K RDRTEDFKD V  TA SLGYDE              +K A+++AS     P Q+S 
Sbjct  1     MGKARDRTEDFKDAVRHTARSLGYDE--------------AKLASVMASLFF-SP-QKSP  44

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F+KAALKTLESIG L++FLLKH+KDY D +RTTE+ERDSIEHEV+ FIK+C+EQID+LKN
Sbjct  45    FSKAALKTLESIGELDQFLLKHRKDYTDLHRTTEKERDSIEHEVSTFIKTCQEQIDILKN  104

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN +E  SKGW+G     SNAD +AHKHGVVLILSE+LHSV++QFD LRA+RFQDAIN+
Sbjct  105   SINQEEETSKGWLGIATTKSNADIIAHKHGVVLILSERLHSVTAQFDQLRAVRFQDAINK  164

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R  +        + + +  + SD E R+P ELR+EP+RVQ+Q LDDETRALQ
Sbjct  165   AIPRRKLNRVAR--------NDSAETSKSSDMELREPEELRAEPLRVQQQLLDDETRALQ  216

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  217   VELTSLLDTVQETETKMVEMSALNHL  242


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LYDQAVEAT NVELGNKEL++AIQRN
Sbjct  248   LHQAQQIEHLYDQAVEATNNVELGNKELSQAIQRN  282



>gb|KFK35826.1| hypothetical protein AALP_AA4G042200 [Arabis alpina]
Length=311

 Score =   325 bits (832),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 202/267 (76%), Gaps = 22/267 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V + AVS GY+E              SK A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKAAVSNGYNE--------------SKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTLESI  L++F+LKH+KDYVD +RTTEQE+DSIE E+T FIK+CKEQID+LKN
Sbjct  47    FTKAAFKTLESIKELDQFMLKHRKDYVDLHRTTEQEKDSIEQEITAFIKACKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++E  SKGW+G   DN N DT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEETNSKGWLGLAADNFNTDTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRV-QEQFLDDETRAL  1774
               PRRKP+R  K  +   + +  +        E+ +P+E++++P RV Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRIIKEPSPSGNATLPI-------PESIEPDEIQAQPRRVQQQQLLDDETQAL  219

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  220   QVELSNLLDGARQTETKMVEMSALNHL  246


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  252   LQQAQQIEFLYDQAVEATKNVELGNKELSQAIQRN  286



>ref|XP_009375858.1| PREDICTED: syntaxin-81 isoform X2 [Pyrus x bretschneideri]
Length=277

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 186/220 (85%), Gaps = 8/220 (4%)
 Frame = +2

Query  1196  LASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTI  1375
             +A FI+H PRQRS FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ 
Sbjct  1     MAKFIIHAPRQRSPFTRAALKTLESIGALEQFMLKHQKDYVDLHRTTEQERDSIEHEVSA  60

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             FIK+C+EQIDVLKN INDDEA SKGW+G + D SNADT+AHKHGVVLILSE+LHSV+S+F
Sbjct  61    FIKACQEQIDVLKNRINDDEANSKGWLGIRTDYSNADTIAHKHGVVLILSERLHSVTSRF  120

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIR  1735
             D LRA+RFQD+IN+  PRRKP+R   S++++ S S+N         E R+PNE + EP+ 
Sbjct  121   DQLRAIRFQDSINKATPRRKPKRIKTSASTDTSNSNNF--------ELREPNEFQPEPLT  172

Query  1736  VQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             VQ+Q LDDETRALQVELT LLDAVQ+TETKMVEMSALNHL
Sbjct  173   VQQQLLDDETRALQVELTSLLDAVQETETKMVEMSALNHL  212


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEATKNVELGNKE++KAI+RN
Sbjct  218   LQQAHQIEQLYDQAVEATKNVELGNKEISKAIERN  252



>ref|XP_002311197.1| syntaxin 81 family protein [Populus trichocarpa]
 gb|EEE88564.1| syntaxin 81 family protein [Populus trichocarpa]
Length=301

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 199/266 (75%), Gaps = 30/266 (11%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V   A+SLGY+E              ++  AI+ASFI+HKPRQRS 
Sbjct  1     MAKIRDRTEDFKDAVRHIAISLGYNE--------------TRLTAIMASFIIHKPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIE EVT FIK+CKEQID+LKN
Sbjct  47    FTRAALKTLESIGALEQFMLKHRKDYVDLHRTTEQERDSIEQEVTAFIKACKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIND+ A +KGW+G K D S  DT+AHKHGVVLILSEKLHSV+++FD LRA+RFQDAIN+
Sbjct  107   SINDEAANTKGWLGIKADTSTTDTIAHKHGVVLILSEKLHSVTARFDQLRAIRFQDAINK  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  R         + ++ +D  + ++ E  +P++++ E +RVQ+          Q
Sbjct  167   RIPRRKLNRAAN------TNTTTVDSSKTNNLEFSEPDDIQPESLRVQQ----------Q  210

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LL+AVQ+TETKM+EMSALNHL
Sbjct  211   VELTSLLEAVQETETKMLEMSALNHL  236


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEATKNVELGNKEL++AIQRN
Sbjct  242   LQQAQQIELLYEQAVEATKNVELGNKELSQAIQRN  276



>ref|XP_010479670.1| PREDICTED: syntaxin-81-like [Camelina sativa]
Length=314

 Score =   320 bits (820),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 206/271 (76%), Gaps = 27/271 (10%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V + AVS+GY+E              SK A+ +ASFI+HKP++R  
Sbjct  1     MSRFRDRTEDFKDSVRKAAVSIGYNE--------------SKVASTMASFIIHKPKERLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AA KTLESI  L++F+LKH+KDYVD +RTTE+E+DSIE E ++FIK+CKEQID+LKN
Sbjct  47    FTRAAFKTLESIRELDQFMLKHRKDYVDMHRTTEEEKDSIEQETSLFIKTCKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRV-----QEQFLDDE  1762
               PRRKP+R  K +    +T +N        SE+ +P+E++++P RV     Q+Q LDDE
Sbjct  167   ATPRRKPKRIVKEANPINTTLAN--------SESIEPDEIQAQPRRVQQQQQQQQLLDDE  218

Query  1763  TRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             T+ALQVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   TQALQVELSNLLDGARQTETKMVEMSALNHL  249


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  255   LQQAQQIEVLYDQAVEATKNVELGNKELSQAIQRN  289



>ref|XP_009593496.1| PREDICTED: syntaxin-81-like [Nicotiana tomentosiformis]
Length=260

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 192/266 (72%), Gaps = 42/266 (16%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+KIRDRTEDFKD   R+A+SLGYDE                                  
Sbjct  1     MSKIRDRTEDFKDAARRSALSLGYDE----------------------------------  26

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
                     LESIG LE+FL+K+KKDYVD +  TEQERDSIEHEVT+F+KSCKEQIDVLKN
Sbjct  27    --------LESIGALEQFLMKYKKDYVDLHSITEQERDSIEHEVTVFVKSCKEQIDVLKN  78

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SIN+++A SKGW+GFKGDN NADT+AHKHGVVLILSEKLHSV  QFD LRA+RFQDAINR
Sbjct  79    SINEEDAHSKGWLGFKGDNLNADTIAHKHGVVLILSEKLHSVMLQFDQLRAIRFQDAINR  138

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
             V PRRK + + KS+ +E S SS+ D   + DSE RD +  ++ PIRVQEQ LDDETRALQ
Sbjct  139   VTPRRKRKNSTKSNATETSVSSSFDPDMKRDSEIRDSDISQAAPIRVQEQLLDDETRALQ  198

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VEL  LLD+VQ+TETKMVEMSALNHL
Sbjct  199   VELNSLLDSVQETETKMVEMSALNHL  224



>ref|XP_009350601.1| PREDICTED: syntaxin-81-like isoform X2 [Pyrus x bretschneideri]
Length=288

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 197/266 (74%), Gaps = 43/266 (16%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+K+RDR EDFKD VH +A+S+GY+E              SK AAI+A FI+H PRQRS 
Sbjct  1     MSKVRDRIEDFKDAVHHSAISMGYNE--------------SKLAAIMAKFIIHAPRQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESIG LE+F+LKH+KDYVD +RTTEQERDSIEHEV+ FIK+C+EQIDVLKN
Sbjct  47    FTRAALKTLESIGTLEQFMLKHRKDYVDLHRTTEQERDSIEHEVSTFIKACQEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SINDDEAKSK                     VLILSE+LHSV+S+FD LRA+R QD+IN+
Sbjct  107   SINDDEAKSK---------------------VLILSERLHSVTSRFDQLRAIRIQDSINK  145

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK +R   + +++ S S+NL        E R+PNE + EP+ VQ+Q LDDETRALQ
Sbjct  146   TTPRRKLKRIKTTESADTSNSNNL--------ELREPNEFQPEPLTVQQQLLDDETRALQ  197

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELTGLLDAVQ+TETKMVEMSALNHL
Sbjct  198   VELTGLLDAVQETETKMVEMSALNHL  223


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA QIE LYDQAVEAT NVELGNKE++KAIQRN
Sbjct  229   LQQAHQIEQLYDQAVEATTNVELGNKEISKAIQRN  263



>ref|XP_010462009.1| PREDICTED: syntaxin-81-like [Camelina sativa]
Length=312

 Score =   315 bits (807),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 201/269 (75%), Gaps = 25/269 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V + AVS+GY+E              SK AA +ASFI+HKP++R  
Sbjct  1     MSRFRDRTEDFKDSVRKAAVSIGYNE--------------SKVAATMASFIIHKPKERLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AA KTLESI  L++F+LKH+KDYVD +RTTEQE+DSIE E T+FIK+CKEQID+LKN
Sbjct  47    FTRAAFKTLESIRELDQFMLKHRKDYVDMHRTTEQEKDSIEQETTLFIKTCKEQIDILKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL---RSEPIRVQEQFLDDETR  1768
               PRRKP+R  K +    +T +N        SE+ +P+E+        + Q+Q LDDET+
Sbjct  167   ATPRRKPKRIVKEANPINTTLAN--------SESIEPDEIQAQPRRVQQQQQQLLDDETQ  218

Query  1769  ALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             ALQVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   ALQVELSNLLDGARQTETKMVEMSALNHL  247


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  253   LQQAQQIEVLYDQAVEATKNVELGNKELSQAIQRN  287



>ref|XP_010927380.1| PREDICTED: syntaxin-81-like [Elaeis guineensis]
Length=310

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/270 (60%), Positives = 194/270 (72%), Gaps = 29/270 (11%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA +RDRTEDFKD V  +A+SLGY E              SK AAILASFI+HKP QRS 
Sbjct  1     MASVRDRTEDFKDVVRASALSLGYTE--------------SKLAAILASFIMHKPPQRSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESI  LE F++KH+KDYVD +R TEQERD+IEHEV +F+K+CK+QID+LKN
Sbjct  47    FTKAALKTLESITELERFIIKHRKDYVDMHRITEQERDNIEHEVGVFVKACKDQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+D+E    S+ W+  + D S+AD VAHKHGVVLILSE+LH V+++FD LR++RFQDAI
Sbjct  107   RIHDEEKNGNSRTWLHIRDDTSHADMVAHKHGVVLILSERLHLVTARFDQLRSMRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE--LRSEPIRVQEQFLDDET  1765
             NR  PRRK  R             N    + S  E     E  L S P++VQ+Q LDDET
Sbjct  167   NRAMPRRKMHRIA-----------NSKSFEASKPELTGLGEQMLPSGPVKVQDQLLDDET  215

Query  1766  RALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             RALQVELT LLDAVQ+TETKMVEMSALNHL
Sbjct  216   RALQVELTSLLDAVQETETKMVEMSALNHL  245


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QA+EATKNVE GNKEL++AIQRN
Sbjct  251   LQQAQQIEHLYEQAIEATKNVEQGNKELSQAIQRN  285



>gb|AAM63632.1| unknown [Arabidopsis thaliana]
Length=310

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 199/267 (75%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V ++AVS+GY+E              SK A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKSAVSIGYNE--------------SKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTL+SI  LE F+LKH+KDYVD +RTTEQE+DSIE EV  FIK+CKEQID+L N
Sbjct  47    FTKAAFKTLDSIKELELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDILIN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NAD++AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADSIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K +T   +T  N        SE+ +P+E+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRVIKEATPINTTLGN--------SESIEPDEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIEFLYDQAVEATKNVELGNKELSQAIQRN  285



>emb|CDY22868.1| BnaA06g02090D [Brassica napus]
Length=909

 Score =   310 bits (793),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 199/267 (75%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V ++A+S GY E              +K A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKSAISDGYTE--------------AKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESI  L++F++KH+KDYVD +RTTE E+DSIE E+T FIK+CKEQIDVLKN
Sbjct  47    FTRAALKTLESIKELDQFMMKHRKDYVDMHRTTEHEKDSIEQEITAFIKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLAADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K ++   +T +N         E  +PNE+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRITKEASPVNATLAN--------PEPIEPNEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 66.2 bits (160),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIEVLYDQAVEATKNVELGNKELSQAIQRN  285



>ref|XP_009147733.1| PREDICTED: syntaxin-81 [Brassica rapa]
Length=310

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 199/267 (75%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V ++A+S GY E              +K A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKSAISDGYTE--------------AKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESI  L++F++KH+KDYVD +RTTE E+DSIE E+T FIK+CKEQIDVLKN
Sbjct  47    FTRAALKTLESIKELDQFMMKHRKDYVDMHRTTEHEKDSIEQEITAFIKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADT+AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLAADNFNADTIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K ++   +T +N         E  +P+E+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRITKEASPVNATLAN--------PEPVEPDEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIEVLYDQAVEATKNVELGNKELSQAIQRN  285



>ref|NP_564597.1| syntaxin-81 [Arabidopsis thaliana]
 sp|P59277.2|SYP81_ARATH RecName: Full=Syntaxin-81; Short=AtSYP81 [Arabidopsis thaliana]
 gb|AAO22733.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42346.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32709.1| syntaxin-81 [Arabidopsis thaliana]
Length=310

 Score =   307 bits (786),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 198/267 (74%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V  +AVS+GY+E              SK A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRNSAVSIGYNE--------------SKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTL+SI  LE F+LKH+KDYVD +RTTEQE+DSIE EV  FIK+CKEQID+L N
Sbjct  47    FTKAAFKTLDSIKELELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDILIN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NAD++AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADSIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K +T   +T  N        SE+ +P+E+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRVIKEATPINTTLGN--------SESIEPDEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 68.2 bits (165),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  251   LQQAQQIEFLYDQAVEATKNVELGNKELSQAIQRN  285



>emb|CDY33863.1| BnaC06g04900D [Brassica napus]
Length=911

 Score =   307 bits (787),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 198/267 (74%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V + A+S GY E              +K A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRKAAISDGYTE--------------AKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT+AALKTLESI  L++F++KH+KDYVD +RTTE E+DSIE E+T FIK+CKEQIDVLKN
Sbjct  47    FTRAALKTLESIKELDQFMMKHRKDYVDMHRTTEHEKDSIEQEITAFIKACKEQIDVLKN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NADTVAHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLAADNFNADTVAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K ++   +T +N         E  +P+E+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRITKEASPVNATLAN--------PEPIEPDEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245


 Score = 60.1 bits (144),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQ  1953
             LQQA+QIE LYDQAVEATKNVELGNKEL++AIQ
Sbjct  251   LQQAKQIEVLYDQAVEATKNVELGNKELSQAIQ  283



>gb|EPS69472.1| hypothetical protein M569_05295 [Genlisea aurea]
Length=304

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 196/268 (73%), Gaps = 31/268 (12%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFKD V R A++L Y+E              SK A+++ASFI+ +  ++SS
Sbjct  1     MSRVRDRTEDFKDEVRRAAMNLEYNE--------------SKIASMMASFIMPRNLEKSS  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL T ESI  LE+FL+KHKKDY+D +RTTE+ERDSIEHEVT+FIK+CK++ID L  
Sbjct  47    FTKAALTTAESIRELEQFLMKHKKDYIDPHRTTEKERDSIEHEVTVFIKACKDRIDFLLK  106

Query  1418  SIN--DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
             S+N  ++E  SKGW+G +  +S+ADT+AHKHGVVLILSEKLHSV+S FDHLR L FQDAI
Sbjct  107   SVNEEEEEENSKGWLGIRNQSSSADTIAHKHGVVLILSEKLHSVTSTFDHLRGLLFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NRVAPRRKP+ +                   + + +   N+ ++EP R Q+Q +DDETRA
Sbjct  167   NRVAPRRKPKPSAII---------------DAAANSGQVNDTQAEPTRFQQQLIDDETRA  211

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVEL G+LDAV  TETKM+EMSALNHL
Sbjct  212   LQVELAGMLDAVGVTETKMIEMSALNHL  239


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEATKNVELGNKEL++AI RN
Sbjct  245   LQQAQQIEHLYEQAVEATKNVELGNKELSEAIGRN  279



>ref|XP_006857303.1| hypothetical protein AMTR_s00067p00058500 [Amborella trichopoda]
 gb|ERN18770.1| hypothetical protein AMTR_s00067p00058500 [Amborella trichopoda]
Length=335

 Score =   294 bits (753),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 195/269 (72%), Gaps = 25/269 (9%)
 Frame = +2

Query  1055  GMAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRS  1234
              MAKI+DRT  +K+TVH  A+SLGY+E              S+ AAI AS IL +P ++S
Sbjct  25    AMAKIKDRTRVYKETVHDVALSLGYNE--------------SQMAAISASLILPRPCEKS  70

Query  1235  SFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLK  1414
              F KAALKTLESI  LE F++KH+KDYVD +RT EQERDSIEHEV++FIK+CK+QID L+
Sbjct  71    PFIKAALKTLESIAELERFIVKHRKDYVDLHRTIEQERDSIEHEVSVFIKTCKDQIDCLR  130

Query  1415  NSI--NDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDA  1588
             NSI   +++ KS+ W+  + DNS+AD +AH+HGVVLILSE+LH+V++QFD LRA+RFQDA
Sbjct  131   NSIYNENNKVKSRKWLSIQEDNSHADIIAHRHGVVLILSERLHAVTAQFDQLRAIRFQDA  190

Query  1589  INRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETR  1768
             +NR  PRR   +            SNL    + +    +  EL+ EP+R+++Q LDDET+
Sbjct  191   VNRAMPRRLRNKVPD---------SNLSHSFRPEVSELEEKELQPEPLRIKQQILDDETQ  241

Query  1769  ALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              LQVEL+ LLDAVQ+TETKMVEMSALNHL
Sbjct  242   TLQVELSSLLDAVQETETKMVEMSALNHL  270


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QAVEAT NVE GN EL+KAI+RN
Sbjct  276   LQQAQQIEHLYEQAVEATNNVERGNTELSKAIERN  310



>pir||D96556 hypothetical protein F19C24.5 [imported] - Arabidopsis thaliana
 gb|AAG50888.1|AC025294_26 hypothetical protein [Arabidopsis thaliana]
Length=896

 Score =   308 bits (788),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 198/267 (74%), Gaps = 23/267 (9%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M++ RDRTEDFKD+V  +AVS+GY+E              SK A+ +ASFI+HKP++RS 
Sbjct  1     MSRFRDRTEDFKDSVRNSAVSIGYNE--------------SKVASTMASFIIHKPKERSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA KTL+SI  LE F+LKH+KDYVD +RTTEQE+DSIE EV  FIK+CKEQID+L N
Sbjct  47    FTKAAFKTLDSIKELELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDILIN  106

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
             SI ++EA SKGW+G   DN NAD++AHKHGVVLILSEKLHSV++QFD LRA RFQD INR
Sbjct  107   SIRNEEANSKGWLGLPADNFNADSIAHKHGVVLILSEKLHSVTAQFDQLRATRFQDIINR  166

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL-RSEPIRVQEQFLDDETRAL  1774
               PRRKP+R  K +T   +T  N        SE+ +P+E+        Q+Q LDDET+AL
Sbjct  167   AMPRRKPKRVIKEATPINTTLGN--------SESIEPDEIQAQPRRLQQQQLLDDETQAL  218

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVEL+ LLD  +QTETKMVEMSALNHL
Sbjct  219   QVELSNLLDGARQTETKMVEMSALNHL  245



>ref|XP_002448341.1| hypothetical protein SORBIDRAFT_06g025460 [Sorghum bicolor]
 gb|EES12669.1| hypothetical protein SORBIDRAFT_06g025460 [Sorghum bicolor]
Length=317

 Score =   289 bits (739),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 198/268 (74%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S+
Sbjct  1     MARVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSA  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE F++KH++DYVD +RTTEQERDSIEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELESFIVKHRRDYVDLHRTTEQERDSIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+++E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQDAI
Sbjct  107   RIHEEEKNGSGKTWLGTRDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSMRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +      S+ SNL    QSD       E+ + P+RVQEQ LDDET+A
Sbjct  167   NRRMPRKKIQKRPE-IKPAESSKSNL--VLQSDVSKIVEQEVSTAPMRVQEQLLDDETKA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   LQVELTSLLDAVQETETKMIEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>gb|ABA95851.1| Syntaxin 81, putative [Oryza sativa Japonica Group]
Length=274

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 196/267 (73%), Gaps = 18/267 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDR EDFK++V   A+  GY E              S+ AA+++SFI+ KP  +  
Sbjct  1     MSRVRDRAEDFKESVRVAALGHGYTE--------------SQLAALMSSFIIRKPPPKLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEV++F+K+CKEQID+LKN
Sbjct  47    FTKAAIKTLESIRELEKFIVKHRKDYVDMHRTTEQERDNIEHEVSVFVKACKEQIDILKN  106

Query  1418  SINDDEAKS-KGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
              I++++  S K W+G   ++S  D +AH+HGVVLILSE+LHSV++QFD LR +RFQDAIN
Sbjct  107   RIHEEKGGSTKTWLGTSDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRTMRFQDAIN  166

Query  1595  RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             R  PR   +R  K   ++ +  S  +   +SD    +  E+ + P+RVQEQ LDDETRAL
Sbjct  167   RAMPR---KRIQKKRETKAAEPSKPNLVLKSDVSKVEDQEVSTAPLRVQEQLLDDETRAL  223

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   QVELTNLLDAVQETETKMIEMSALNHL  250



>ref|NP_001132043.1| uncharacterized protein LOC100193453 [Zea mays]
 gb|ACF80723.1| unknown [Zea mays]
 gb|AFW59189.1| hypothetical protein ZEAMMB73_972004 [Zea mays]
Length=317

 Score =   287 bits (735),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 197/268 (74%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S 
Sbjct  1     MARVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTL+SI  LE F++KH++DYVD +R+TEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLQSIRELERFIVKHRRDYVDLHRSTEQERDNIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+ +E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFDHLR++RFQDAI
Sbjct  107   RIHKEEKNGSGKTWLGTRDESSRVDLIAHQHGVVLILSERLHSVTAQFDHLRSIRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +       + SNL  +  SD      +E+ + P+RVQEQ LDDET+A
Sbjct  167   NRAMPRKKIQKRPE-IKPAEPSKSNLVLK--SDVSKVVDHEVSTTPMRVQEQLLDDETKA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   LQVELTSLLDAVQETETKMIEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>gb|EEC68882.1| hypothetical protein OsI_37514 [Oryza sativa Indica Group]
 gb|EEE52789.1| hypothetical protein OsJ_35261 [Oryza sativa Japonica Group]
Length=316

 Score =   287 bits (735),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 196/267 (73%), Gaps = 18/267 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDR EDFK++V   A+  GY E              S+ AA+++SFI+ KP  +  
Sbjct  1     MSRVRDRAEDFKESVRVAALGHGYTE--------------SQLAALMSSFIIRKPPPKLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEV++F+K+CKEQID+LKN
Sbjct  47    FTKAAIKTLESIRELEKFIVKHRKDYVDMHRTTEQERDNIEHEVSVFVKACKEQIDILKN  106

Query  1418  SINDDEAKS-KGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
              I++++  S K W+G   ++S  D +AH+HGVVLILSE+LHSV++QFD LR +RFQDAIN
Sbjct  107   RIHEEKGGSTKTWLGTSDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRTMRFQDAIN  166

Query  1595  RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             R  PR   +R  K   ++ +  S  +   +SD    +  E+ + P+RVQEQ LDDETRAL
Sbjct  167   RAMPR---KRIQKKRETKAAEPSKPNLVLKSDVSKVEDQEVSTAPLRVQEQLLDDETRAL  223

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   QVELTNLLDAVQETETKMIEMSALNHL  250


 Score = 63.2 bits (152),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  256   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  290



>ref|XP_008778974.1| PREDICTED: syntaxin-81, partial [Phoenix dactylifera]
Length=284

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 177/230 (77%), Gaps = 15/230 (7%)
 Frame = +2

Query  1178  SKTAAILASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSI  1357
             SK AAILASFI+HKP QRS FTKAALKTLESI  LE F++KH+KDYVD +R TEQERD+I
Sbjct  1     SKLAAILASFIMHKPPQRSPFTKAALKTLESIAELERFIVKHQKDYVDLHRITEQERDNI  60

Query  1358  EHEVTIFIKSCKEQIDVLKNSINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEK  1531
             EHEV +F+K+CK+QID+LKN I+D+E    SK W+  + D S+AD VAH+HGVVLILSE+
Sbjct  61    EHEVGVFVKACKDQIDILKNRIHDEEKNGNSKTWLRIRDDTSHADMVAHRHGVVLILSER  120

Query  1532  LHSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPN  1711
             LHSV+++FD LR++RFQDAINR  PRRK  R   S +            + S  E  D  
Sbjct  121   LHSVTARFDRLRSIRFQDAINRAMPRRKMPRIADSKSF-----------EASKPELTDLG  169

Query  1712  E--LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             E  L S P++VQ+Q LDDETRALQVELTGLLDAVQ+TETKMVEMSALNHL
Sbjct  170   EQMLPSGPVKVQDQLLDDETRALQVELTGLLDAVQETETKMVEMSALNHL  219


 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LY+QA+EATKNVE GNKEL++A+QRN
Sbjct  225   LQQAQQIEHLYEQAIEATKNVEQGNKELSQAVQRN  259



>ref|NP_001053389.1| Os04g0530400 [Oryza sativa Japonica Group]
 emb|CAD41209.2| OSJNBa0074L08.20 [Oryza sativa Japonica Group]
 emb|CAE03862.2| OSJNBa0081C01.8 [Oryza sativa Japonica Group]
 dbj|BAF15303.1| Os04g0530400 [Oryza sativa Japonica Group]
 dbj|BAG90509.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77689.1| hypothetical protein OsI_16746 [Oryza sativa Indica Group]
 gb|EEE61388.1| hypothetical protein OsJ_15559 [Oryza sativa Japonica Group]
Length=316

 Score =   286 bits (733),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 195/267 (73%), Gaps = 18/267 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+  GY E              S+ A +++SFI+ KP  +  
Sbjct  1     MSRVRDRTEDFKESVRVAALGHGYTE--------------SQLAVLMSSFIIRKPAPKLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEV++F+K+CKEQID+LKN
Sbjct  47    FTKAAIKTLESIRELEKFIVKHRKDYVDLHRTTEQERDNIEHEVSVFVKACKEQIDILKN  106

Query  1418  SINDDEAKS-KGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
              I++++  S K W+G   ++S  D +AH+HGVVLILSE+LHSV+ QFD LR +RFQDAIN
Sbjct  107   RIHEEKGGSTKTWLGTSDESSRLDLIAHQHGVVLILSERLHSVTVQFDRLRTMRFQDAIN  166

Query  1595  RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             R  PR   +R  K   ++ +  S  +   +SD    +  E+ + P+RVQEQ LDDETRAL
Sbjct  167   RAMPR---KRIQKKRETKAAEPSKPNLVLKSDVSKVEDQEVSTAPLRVQEQLLDDETRAL  223

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   QVELTNLLDAVQETETKMIEMSALNHL  250


 Score = 63.2 bits (152),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  256   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  290



>ref|XP_004976323.1| PREDICTED: syntaxin-81-like [Setaria italica]
Length=317

 Score =   285 bits (730),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 196/268 (73%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK+ V   A+S GY E              ++ AA+ +SFI+ KP  +S 
Sbjct  1     MSRVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALTSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE F++KH++DYVD +RTTEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELERFIVKHRRDYVDLHRTTEQERDNIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+++E    +K W+G + ++S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQDAI
Sbjct  107   RIHEEEKNGGAKTWLGTRDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSMRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +       + SNL  +  SD       E+ + P+RVQEQ LDDETRA
Sbjct  167   NRAMPRKKIQKKPE-IKPAEPSKSNLVLK--SDVSKIGDQEVSTAPMRVQEQLLDDETRA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   LQVELTSLLDAVQETETKMMEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>ref|NP_001146627.1| Syntaxin 81 [Zea mays]
 gb|ACF83067.1| unknown [Zea mays]
 gb|ACG33097.1| syntaxin 81 [Zea mays]
 gb|AFW58940.1| Syntaxin 81 [Zea mays]
Length=316

 Score =   285 bits (730),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 190/268 (71%), Gaps = 20/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S 
Sbjct  1     MSRVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE F++KH++DYVD +R TEQERD+IEHE+ +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELERFIVKHRRDYVDLHRITEQERDNIEHEIGVFVKACKEQIDILKN  106

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I ++E    G  W+G +  +S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQDAI
Sbjct  107   RIQEEEKNGSGKTWLGTRDGSSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSMRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+  +R  K       +S  L    +SD       E  + P+RVQEQ LDDET+A
Sbjct  167   NRAMPRKNQKRPEKKPAEPSKSSLVL----KSDVSKIVDQEASTAPMRVQEQLLDDETKA  222

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  223   LQVELTSLLDAVQETETKMIEMSALNHL  250


 Score = 63.2 bits (152),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  256   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  290



>dbj|BAK00323.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=317

 Score =   285 bits (728),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 195/268 (73%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+S GY E              S+ AA+++SFI+ KP  +S 
Sbjct  1     MSRVRDRTEDFKESVRVAALSHGYTE--------------SQLAALMSSFIIRKPLPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F  AA+KTLESI  LE+F++KH++DYVD +RTTEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FINAAVKTLESIRELEKFIVKHRRDYVDMHRTTEQERDTIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I++DE   ++  W+G + + S  D +AH+HGVVLILSE+LHSV++QFD LR+LRFQ+AI
Sbjct  107   RIHEDERNRRANTWLGTRDETSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSLRFQEAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K     K    + +  S  D   +SD    +  E+ + P+RVQEQ LDDETRA
Sbjct  167   NRAMPRKK---IEKRPEIKPTEPSKSDLVLKSDVSKVEDREVSTAPLRVQEQLLDDETRA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQ+ELT LLD VQ+TETKM+EMSALNHL
Sbjct  224   LQMELTNLLDTVQETETKMIEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>ref|XP_006652554.1| PREDICTED: syntaxin-81-like [Oryza brachyantha]
Length=316

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 198/267 (74%), Gaps = 18/267 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+  GY E              S+ AA+++SFI+ KP  +  
Sbjct  1     MSRVRDRTEDFKESVRVAALDHGYTE--------------SQLAALMSSFIIRKPTPKLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIKELEKFIVKHRKDYVDLHRTTEQERDNIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDEA-KSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
              I+++++  +K W+G   ++S  D +AH+HGVVLILSE+LHSV++QFD LR +RFQDAIN
Sbjct  107   RIHEEKSGNAKTWLGTSDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRTMRFQDAIN  166

Query  1595  RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRAL  1774
             R  PR++ +R  + + +   +  NL  +  SD    +  E+ + P+RVQEQ LDDETRAL
Sbjct  167   RAMPRKRIQR-KQETKAVGPSKPNLVLK--SDVSKVEEQEVCTAPLRVQEQLLDDETRAL  223

Query  1775  QVELTGLLDAVQQTETKMVEMSALNHL  1855
             QVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   QVELTNLLDAVQETETKMIEMSALNHL  250


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L+QAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  256   LRQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  290



>gb|EMT31924.1| hypothetical protein F775_28929 [Aegilops tauschii]
Length=270

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 196/268 (73%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+S GY E              S+ AA+++SFI+ KP  +S 
Sbjct  1     MSRVRDRTEDFKESVRVAALSHGYTE--------------SQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE+F++KH++DYVD +RTTEQERD+IEHEV IF+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELEKFIVKHRRDYVDMHRTTEQERDNIEHEVGIFVKACKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I +DE   ++  W+G + + S  D +AH+HGVVLILSE+LHSV++QFD LR+LRFQ+AI
Sbjct  107   RILEDERNRRANTWLGTRDETSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSLRFQEAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NRV PR+K  +          + SNL  +  SD    +  E+ + P+RVQEQ LDDETRA
Sbjct  167   NRVMPRKK-IKKKPDIKPTEPSKSNLVLK--SDVSKVEDREVSTVPLRVQEQLLDDETRA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQ+ELT LLD VQ+TETKM+EMSALNHL
Sbjct  224   LQMELTNLLDTVQETETKMIEMSALNHL  251



>ref|XP_002446837.1| hypothetical protein SORBIDRAFT_06g023420 [Sorghum bicolor]
 gb|EES11165.1| hypothetical protein SORBIDRAFT_06g023420 [Sorghum bicolor]
Length=317

 Score =   284 bits (727),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 194/268 (72%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S+
Sbjct  1     MSRVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSA  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE F++KH++DYVD +RTTEQERD+IEHE+ +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELERFIVKHRRDYVDLHRTTEQERDNIEHEIGVFVKACKEQIDILKN  106

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+++E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQDAI
Sbjct  107   RIHEEEKNGSGKTWLGTRDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSMRFQDAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K     K    + +  S  +   +SD       E+   P+RVQEQ LDDET+A
Sbjct  167   NRAMPRKK---ILKRPEIKPAEPSKSNLVLKSDVSKIVDQEVSPAPMRVQEQLLDDETKA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   LQVELTSLLDAVQETETKMIEMSALNHL  251


 Score = 62.4 bits (150),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQ++YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQVQYLYDQAVEATNNVERGNKELSQAIQRN  291



>gb|EMS47984.1| hypothetical protein TRIUR3_08168 [Triticum urartu]
Length=317

 Score =   283 bits (725),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 196/268 (73%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+S GY E              S+ AA+++SFI+ KP  +S 
Sbjct  1     MSRVRDRTEDFKESVRVAALSHGYTE--------------SQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KTLESI  LE+F++KH++DYVD +RTTEQERD+IEHEV IF+K+CKEQID+LKN
Sbjct  47    FTNAAIKTLESIRELEKFIVKHRRDYVDMHRTTEQERDNIEHEVGIFVKACKEQIDILKN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I +DE   ++  W+G + + S  D +AH+HGVVLILSE+LHSV++QFD LR+LRFQ+AI
Sbjct  107   RILEDERNRRANTWLGTRDETSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSLRFQEAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NRV PR+K  +          + SNL  +  SD    +  E+ + P+RVQEQ LDDETRA
Sbjct  167   NRVMPRKK-IKKKPEIKPTEPSKSNLVLK--SDVSKVEDREVSTAPLRVQEQLLDDETRA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQ+ELT LLD VQ+TETKM+EMSALNHL
Sbjct  224   LQMELTNLLDTVQETETKMIEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>ref|XP_009383722.1| PREDICTED: syntaxin-81 [Musa acuminata subsp. malaccensis]
Length=314

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 188/268 (70%), Gaps = 21/268 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAK RDRT+DFKD +  TA SLGY+E              SK AA+LASFILHKP ++S 
Sbjct  1     MAKSRDRTDDFKDAIRATAPSLGYNE--------------SKLAAVLASFILHKPVEKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESI  LE F++KH+KDYVD +R TEQERD+IEHEV IF+KSC++QI++L+N
Sbjct  47    FTKAALKTLESISELECFIIKHRKDYVDMHRITEQERDNIEHEVVIFVKSCRDQINILQN  106

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I  +E    +K W+  + DN NAD VAHKHGVVLILSE+LHSVS QFD LR++R Q+A+
Sbjct  107   MICTEEKSTNTKSWLHRRDDNINADVVAHKHGVVLILSERLHSVSVQFDRLRSIRSQEAL  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PRRK  R         ++S  L +   S        E  S  +RVQ+Q +DDETRA
Sbjct  167   NRAMPRRKINRV-----IHSTSSEQLSEPSASSLPELGGQEPTSRALRVQDQLMDDETRA  221

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVEL+ LLDAVQ+ ETK VE+S L+HL
Sbjct  222   LQVELSSLLDAVQEAETKTVEISVLSHL  249


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQA+QIE+LY+QAVEAT NVE GNKEL++AI+RN
Sbjct  255   LQQAEQIEHLYEQAVEATNNVEQGNKELSQAIKRN  289



>gb|ACG31789.1| syntaxin 81 [Zea mays]
 gb|AFW59190.1| syntaxin 81 [Zea mays]
Length=315

 Score =   280 bits (715),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 195/268 (73%), Gaps = 21/268 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S 
Sbjct  1     MARVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KT  SI  LE F++KH++DYVD +R+TEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKT--SIRELERFIVKHRRDYVDLHRSTEQERDNIEHEVGVFVKACKEQIDILKN  104

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+ +E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFDHLR++RFQDAI
Sbjct  105   RIHKEEKNGSGKTWLGTRDESSRVDLIAHQHGVVLILSERLHSVTAQFDHLRSIRFQDAI  164

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +       + SNL  +  SD      +E+ + P+RVQEQ LDDET+A
Sbjct  165   NRAMPRKKIQKRPE-IKPAEPSKSNLVLK--SDVSKVVDHEVSTTPMRVQEQLLDDETKA  221

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  222   LQVELTSLLDAVQETETKMIEMSALNHL  249


 Score = 63.2 bits (152),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  255   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  289



>gb|ACG35270.1| syntaxin 81 [Zea mays]
Length=315

 Score =   278 bits (710),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 194/268 (72%), Gaps = 21/268 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S 
Sbjct  1     MARVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KT  SI  LE F++KH++DYVD +RTTEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKT--SIRELERFIVKHRRDYVDLHRTTEQERDNIEHEVGVFVKACKEQIDILKN  104

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+ +E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQDAI
Sbjct  105   RIHKEEKNGSGKTWLGTRDESSRVDLIAHQHGVVLILSERLHSVTAQFDRLRSIRFQDAI  164

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +       + SNL  +  SD      +E+ + P+RVQEQ LDDET+A
Sbjct  165   NRAMPRKKIQKRPE-IKPAEPSKSNLVLK--SDVSKVVDHEVSTTPMRVQEQLLDDETKA  221

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  222   LQVELTSLLDAVQETETKMIEMSALNHL  249


 Score = 63.2 bits (152),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  255   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  289



>ref|XP_003580197.1| PREDICTED: syntaxin-81 [Brachypodium distachyon]
Length=317

 Score =   276 bits (705),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 192/268 (72%), Gaps = 19/268 (7%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M + RDRTEDFK++V   A++ GY E              ++ AA++++FI+ KP  +S 
Sbjct  1     MTRARDRTEDFKESVRVAALAHGYTE--------------AQLAALMSAFIIRKPNPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTKAAIKTLESIRELEKFIVKHRKDYVDTHRTTEQERDTIEHEVGVFVKACKEQIDILKN  106

Query  1418  SINDDEAK--SKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I++DE    +K W+  + + S  D +AH+HGVVLILSE+LHSV++QFD LR++RFQ+AI
Sbjct  107   RIHEDEKNRSAKTWLSTRDEGSRLDLIAHQHGVVLILSERLHSVTAQFDRLRSMRFQEAI  166

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  P RK  +         S+ SNL    QSD       E+ + P+RVQEQ LDDETRA
Sbjct  167   NRAMP-RKKIKKKPEIKPAESSKSNL--VLQSDVSRVGDQEVSTAPLRVQEQLLDDETRA  223

Query  1772  LQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LQVEL  LLD VQ+TETKM+EMSALNHL
Sbjct  224   LQVELGNLLDTVQETETKMIEMSALNHL  251


 Score = 63.2 bits (152),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  257   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  291



>emb|CAJ86206.1| B1011H02.1 [Oryza sativa Indica Group]
Length=345

 Score =   272 bits (696),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/296 (50%), Positives = 195/296 (66%), Gaps = 47/296 (16%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             M+++RDRTEDFK++V   A+  GY E              S+ A +++SFI+ KP  +  
Sbjct  1     MSRVRDRTEDFKESVRVAALGHGYTE--------------SQLAVLMSSFIIRKPAPKLP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVT---------------  1372
             FTKAA+KTLESI  LE+F++KH+KDYVD +RTTEQERD+IEHEVT               
Sbjct  47    FTKAAIKTLESIRELEKFIVKHRKDYVDLHRTTEQERDNIEHEVTLGHQHYSAIMLKHIL  106

Query  1373  --------------IFIKSCKEQIDVLKNSINDDEAKS-KGWIGFKGDNSNADTVAHKHG  1507
                           +F+K+CKEQID+LKN I++++  S K W+G   ++S  D +AH+HG
Sbjct  107   CNMVDEFIENLILSVFVKACKEQIDILKNRIHEEKGGSTKTWLGTSDESSRLDLIAHQHG  166

Query  1508  VVLILSEKLHSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQS  1687
             VVLILSE+LHSV+ QFD LR +RFQDAINR  PR+   R  K   ++ +  S  +   +S
Sbjct  167   VVLILSERLHSVTVQFDRLRTMRFQDAINRAMPRK---RIQKKRETKAAEPSKPNLVLKS  223

Query  1688  DSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             D    +  E+ + P+RVQEQ LDDETRALQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  224   DVSKVEDQEVSTAPLRVQEQLLDDETRALQVELTNLLDAVQETETKMIEMSALNHL  279


 Score = 63.2 bits (152),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  285   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  319



>gb|AFW59191.1| hypothetical protein ZEAMMB73_972004 [Zea mays]
Length=347

 Score =   263 bits (671),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 195/300 (65%), Gaps = 53/300 (18%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA++RDRTEDFK+ V   A+S GY E              ++ AA+++SFI+ KP  +S 
Sbjct  1     MARVRDRTEDFKEAVRVAALSHGYTE--------------AQLAALMSSFIIRKPSPKSP  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FT AA+KT  SI  LE F++KH++DYVD +R+TEQERD+IEHEV +F+K+CKEQID+LKN
Sbjct  47    FTNAAIKT--SIRELERFIVKHRRDYVDLHRSTEQERDNIEHEVGVFVKACKEQIDILKN  104

Query  1418  SINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAI  1591
              I+ +E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++QFDHLR++RFQDAI
Sbjct  105   RIHKEEKNGSGKTWLGTRDESSRVDLIAHQHGVVLILSERLHSVTAQFDHLRSIRFQDAI  164

Query  1592  NRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRA  1771
             NR  PR+K ++  +       + SNL  +  SD      +E+ + P+RVQEQ LDDET+A
Sbjct  165   NRAMPRKKIQKRPE-IKPAEPSKSNLVLK--SDVSKVVDHEVSTTPMRVQEQLLDDETKA  221

Query  1772  L--------------------------------QVELTGLLDAVQQTETKMVEMSALNHL  1855
             L                                QVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  222   LQVVCGCYMNYSLVKNLAILLNYHASCVSWNSSQVELTSLLDAVQETETKMIEMSALNHL  281


 Score = 62.8 bits (151),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  287   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  321



>ref|XP_007010756.1| Syntaxin of plants 81 isoform 2 [Theobroma cacao]
 gb|EOY19566.1| Syntaxin of plants 81 isoform 2 [Theobroma cacao]
Length=244

 Score =   257 bits (657),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 9/186 (5%)
 Frame = +2

Query  1298  KHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNS  1477
             KH+KDYVD +RTTEQE+DSIE EVT FIK+CK+QIDVLKNSIND+EA SKGW+G + D S
Sbjct  3     KHRKDYVDLHRTTEQEKDSIEQEVTAFIKACKDQIDVLKNSINDEEATSKGWLGIR-DTS  61

Query  1478  NADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseist  1657
             NADT+AHKHGVVLILSEKLHSV++QFD LRA+RFQDAINR  PRRK +R   S++ + S 
Sbjct  62    NADTIAHKHGVVLILSEKLHSVTAQFDQLRAIRFQDAINRATPRRKLKRVVDSNSLDTSK  121

Query  1658  ssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEM  1837
               NLD         R+ NEL+ E +RVQ++ LD+ETRALQVELT LLDAVQ+TETKMVEM
Sbjct  122   PVNLD--------LRETNELQPESLRVQQELLDNETRALQVELTSLLDAVQETETKMVEM  173

Query  1838  SALNHL  1855
             SALNHL
Sbjct  174   SALNHL  179


 Score = 67.4 bits (163),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+LYDQAVEATKNVELGNKEL++AIQRN
Sbjct  185   LQQAQQIEHLYDQAVEATKNVELGNKELSQAIQRN  219



>gb|AFW59193.1| hypothetical protein ZEAMMB73_972004 [Zea mays]
Length=285

 Score =   259 bits (661),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 172/222 (77%), Gaps = 5/222 (2%)
 Frame = +2

Query  1196  LASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTI  1375
             ++SFI+ KP  +S FT AA+KTL+SI  LE F++KH++DYVD +R+TEQERD+IEHEV +
Sbjct  1     MSSFIIRKPSPKSPFTNAAIKTLQSIRELERFIVKHRRDYVDLHRSTEQERDNIEHEVGV  60

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKG--WIGFKGDNSNADTVAHKHGVVLILSEKLHSVSS  1549
             F+K+CKEQID+LKN I+ +E    G  W+G + ++S  D +AH+HGVVLILSE+LHSV++
Sbjct  61    FVKACKEQIDILKNRIHKEEKNGSGKTWLGTRDESSRVDLIAHQHGVVLILSERLHSVTA  120

Query  1550  QFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEP  1729
             QFDHLR++RFQDAINR  PR+K ++  +       + SNL  +  SD      +E+ + P
Sbjct  121   QFDHLRSIRFQDAINRAMPRKKIQKRPE-IKPAEPSKSNLVLK--SDVSKVVDHEVSTTP  177

Query  1730  IRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             +RVQEQ LDDET+ALQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  178   MRVQEQLLDDETKALQVELTSLLDAVQETETKMIEMSALNHL  219


 Score = 63.2 bits (152),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  225   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  259



>ref|XP_010247837.1| PREDICTED: syntaxin-81-like isoform X2 [Nelumbo nucifera]
Length=261

 Score =   249 bits (637),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 170/266 (64%), Gaps = 70/266 (26%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+ RDRTEDFKDTV   A+SLGY+E              SKTAAILASFI+HKPRQRS+
Sbjct  1     MARSRDRTEDFKDTVRSIALSLGYNE--------------SKTAAILASFIMHKPRQRST  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL+TLESI  LE+F+LKH+KDYVD +RTTEQERDSIEHEV I              
Sbjct  47    FTKAALRTLESIKTLEQFILKHRKDYVDPHRTTEQERDSIEHEVLI--------------  92

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
                                               LSEKLHS++SQFD LRA+RFQDA+N+
Sbjct  93    ----------------------------------LSEKLHSITSQFDQLRAIRFQDAVNK  118

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  +   S++  I+        + + SE ++P+EL SE  RVQ+QFLDDETRALQ
Sbjct  119   AMPRRKMHQVTNSNSPIIT--------KSNQSEVKEPDELPSEHQRVQQQFLDDETRALQ  170

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  171   VELTNLLDTVQETETKMVEMSALNHL  196


 Score = 60.5 bits (145),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQ QQIE LY+QAVEATKNVE+GNKE+++A+QRN
Sbjct  202   LQQTQQIELLYEQAVEATKNVEMGNKEISQAVQRN  236



>ref|XP_010247314.1| PREDICTED: syntaxin-81-like isoform X3 [Nelumbo nucifera]
Length=288

 Score =   248 bits (633),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 169/266 (64%), Gaps = 70/266 (26%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA+ RDRTEDFKDTV   A+SLGY+E              SKTAA LASFI+HKPRQRS+
Sbjct  28    MARSRDRTEDFKDTVRSIALSLGYNE--------------SKTAATLASFIMHKPRQRST  73

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAAL+TLESI  LE+F++KH KDYVD +R TEQERDSIEHE                 
Sbjct  74    FTKAALRTLESIKTLEQFIMKHWKDYVDPHRATEQERDSIEHE-----------------  116

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
                                            VLILSEKLHSV+SQFD LRA+RFQDA+N+
Sbjct  117   -------------------------------VLILSEKLHSVTSQFDQLRAIRFQDAVNK  145

Query  1598  VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQ  1777
               PRRK  +   S++  IS        + + SE ++P+EL SE +RVQ+QFLDDETRALQ
Sbjct  146   AIPRRKMHQVTNSNSPIIS--------KSNHSEVKEPDELPSEHLRVQQQFLDDETRALQ  197

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLD VQ+TETKMVEMSALNHL
Sbjct  198   VELTNLLDTVQETETKMVEMSALNHL  223


 Score = 60.5 bits (145),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE LY+QAVEAT NVE+GNKEL++A+QRN
Sbjct  229   LQQAQQIELLYEQAVEATNNVEMGNKELSQAMQRN  263



>emb|CAJ86385.1| OSIGBa0155K17.12 [Oryza sativa Indica Group]
Length=237

 Score =   181 bits (458),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 122/164 (74%), Gaps = 4/164 (2%)
 Frame = +2

Query  1367  VTIFIKSCKEQIDVLKNSINDDEAKS-KGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +++F+K+CKEQID+LKN I++++  S K W+G   ++S  D +AH+HGVVLILSE+LHSV
Sbjct  11    LSVFVKACKEQIDILKNRIHEEKGGSTKTWLGTSDESSRLDLIAHQHGVVLILSERLHSV  70

Query  1544  SSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRS  1723
             + QFD LR +RFQDAINR  PR+   R  K   ++ +  S  +   +SD    +  E+ +
Sbjct  71    TVQFDRLRTMRFQDAINRAMPRK---RIQKKRETKAAEPSKPNLVLKSDVSKVEDQEVST  127

Query  1724  EPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              P+RVQEQ LDDETRALQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  128   APLRVQEQLLDDETRALQVELTNLLDAVQETETKMIEMSALNHL  171


 Score = 62.8 bits (151),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  177   LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  211



>ref|XP_009144881.1| PREDICTED: LOW QUALITY PROTEIN: syntaxin-81, partial [Brassica 
rapa]
Length=254

 Score =   182 bits (463),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 129/180 (72%), Gaps = 18/180 (10%)
 Frame = +2

Query  1340  QERDSIEHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKG---DNSNADTVAH----  1498
             +E+DSIEHE+T FIK+CKEQID+LKNSI ++E+ SKGW+G      DN NADT+AH    
Sbjct  19    REKDSIEHEITAFIKACKEQIDILKNSIRNEESNSKGWLGLAAAAEDNFNADTIAHNTWR  78

Query  1499  KHGVVLILSEKLHSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQR  1678
             ++  VLILSEKLHSV++QFD LRA RFQD IN   PRRKP++  K +++  +T +N    
Sbjct  79    RNVCVLILSEKLHSVAAQFDQLRATRFQDIINXAMPRRKPKKVPKEASAVHTTLTN----  134

Query  1679  QQSDSEARDPNELRSEPIRV-QEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                  E  +P+E++++P R+ Q+Q LDDET+  +     LLD  +QTETKMVEMSALNHL
Sbjct  135   ----PEPIEPDEIQAQPGRIQQQQLLDDETQPFRX--VNLLDGARQTETKMVEMSALNHL  188


 Score = 51.6 bits (122),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI     QAVEATKNVELGN+EL++AI+RN
Sbjct  194   LQQAQQIRTAKMQAVEATKNVELGNRELSQAIKRN  228



>gb|ABR17175.1| unknown [Picea sitchensis]
Length=328

 Score =   179 bits (454),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 8/227 (4%)
 Frame = +2

Query  1181  KTAAILASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIE  1360
             K A ++ S +L +P+Q+S FT+AA KTLESI  L+ F++ HKKDY+  +RT E + D IE
Sbjct  41    KMAKVIESLMLRRPQQKSPFTQAAHKTLESIRTLQIFVVNHKKDYMVRHRTVEHDLDDIE  100

Query  1361  HEVTIFIKSCKEQIDVLKNSINDDEAKS--KGWIGFKGDNSNADTVAHKHGVVLILSEKL  1534
              +V + +++C+EQI++LK SI   E K     W+G +GD +NAD VAHKHGVVLILS+ L
Sbjct  101   RQVGVLVEACREQIEILKQSIESKERKGLIATWLGVQGDVANADVVAHKHGVVLILSQHL  160

Query  1535  HSVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE  1714
              S++S  D LR  RF++ I++   RR   R  K    E   S++       D E    N 
Sbjct  161   QSIASLLDQLRTARFREVIDKTMSRRMRHRRSKLKHPETPLSND-----SKDIEVIQRNS  215

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L   P  +Q+Q LD+ET+ALQVELT LL  VQ+TE  M+E+SAL++L
Sbjct  216   LVG-PKGIQKQILDEETQALQVELTNLLGTVQETERNMLEISALSNL  261


 Score = 51.2 bits (121),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  1858  QQAQQIEYLYDQAVEATKNVELGNKELTKAIQR  1956
             QQ QQI++LY+QAVEAT+N  +GNKELTKAIQ 
Sbjct  268   QQTQQIKHLYEQAVEATQNFGMGNKELTKAIQH  300



>ref|XP_002967975.1| hypothetical protein SELMODRAFT_145148 [Selaginella moellendorffii]
 gb|EFJ31322.1| hypothetical protein SELMODRAFT_145148 [Selaginella moellendorffii]
Length=306

 Score =   176 bits (446),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 152/263 (58%), Gaps = 29/263 (11%)
 Frame = +2

Query  1070  RDRTEDFKDTVHRTAVSLG-YDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSSFTK  1246
             RDRTE F+D V   A S+   DE                   I +S I+H+  +   FT 
Sbjct  6     RDRTEAFRDAVRAAAASIPQCDE-----------------VKIASSLIMHRTLELLPFTA  48

Query  1247  AALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             AAL+ L  I  +E F+L+ +KDY+D  R TE+ERD+IEHEV + +K+CK++ID LKNSI 
Sbjct  49    AALEILGHIRTMESFILERRKDYLDRQRCTEEERDNIEHEVGLSVKACKQRIDDLKNSIA  108

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRVAP  1606
                 K   W G      NAD  AH+HG+VL+LSEKLH+V++ FD LRA RFQ A+++  P
Sbjct  109   G--GKKSFWKG----AVNADLNAHQHGIVLMLSEKLHAVTTIFDALRASRFQKALDKTLP  162

Query  1607  RRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVEL  1786
             +R+P       ++     + L  R  + +     N    +P + Q   LD ETRALQ EL
Sbjct  163   KRRPH----LQSATAQLEAELSNRTAAATSFNRENLQELQPSQAQ-IVLDSETRALQEEL  217

Query  1787  TGLLDAVQQTETKMVEMSALNHL  1855
             + LLD  + TE KM+E+SALNHL
Sbjct  218   SNLLDTAEDTERKMLEVSALNHL  240


 Score = 50.8 bits (120),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
              QQ+QQIE LY QAVEAT+NV  GNKEL K I+RN
Sbjct  246   FQQSQQIELLYQQAVEATENVNKGNKELRKTIERN  280



>ref|XP_002963944.1| hypothetical protein SELMODRAFT_227430 [Selaginella moellendorffii]
 gb|EFJ34277.1| hypothetical protein SELMODRAFT_227430 [Selaginella moellendorffii]
Length=306

 Score =   175 bits (444),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 152/263 (58%), Gaps = 29/263 (11%)
 Frame = +2

Query  1070  RDRTEDFKDTVHRTAVSLG-YDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSSFTK  1246
             RDRTE F+D V   A S+   DE                   I +S I+H+  +   FT 
Sbjct  6     RDRTEAFRDAVRAAAASIPQCDE-----------------VKIASSLIMHRTLELLPFTA  48

Query  1247  AALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             AAL+ L  I  +E F+L+ +KDY+D  R TE+ERD+IEHEV + +K+CK++ID LKNSI 
Sbjct  49    AALEILGHIRTMESFILERRKDYLDRQRCTEEERDNIEHEVGLSVKACKQRIDDLKNSIA  108

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRVAP  1606
                 K   W G      NAD  AH+HG+VL+LSEKLH+V++ FD LRA RFQ A+++  P
Sbjct  109   G--GKKLFWKG----AVNADLNAHQHGIVLMLSEKLHAVTTIFDALRASRFQKALDKTLP  162

Query  1607  RRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVEL  1786
             +R+P       ++     + L  R  + +     N    +P + Q   LD ETRALQ EL
Sbjct  163   KRRPH----LQSATAQLEAELSNRTAAATSFNRENLQELQPSQAQ-IVLDSETRALQEEL  217

Query  1787  TGLLDAVQQTETKMVEMSALNHL  1855
             + LLD  + TE KM+E+SALNHL
Sbjct  218   SNLLDTAEDTERKMLEVSALNHL  240


 Score = 50.8 bits (120),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
              QQ+QQIE LY QAVEAT+NV  GNKEL K I+RN
Sbjct  246   FQQSQQIELLYQQAVEATENVNKGNKELRKTIERN  280



>ref|XP_001762254.1| Qa-SNARE, SYP8/Ufe1p/Syntaxin 18-type [Physcomitrella patens]
 gb|EDQ73046.1| Qa-SNARE, SYP8/Ufe1p/Syntaxin 18-type [Physcomitrella patens]
Length=316

 Score =   176 bits (446),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 160/269 (59%), Gaps = 22/269 (8%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA IRD T+ F++ V   AV+  YDE               K A I +S +LH    RS+
Sbjct  1     MASIRDLTQKFREAVRAAAVANNYDE--------------GKLAKITSSLMLHSTPPRST  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             F   A+K  ESI  L++F+  H KDY + +R+TEQ+RDSIE+EV +F+K+C++ I+ LKN
Sbjct  47    FYLTAIKIAESIRDLQKFVASHGKDYAEKHRSTEQDRDSIENEVGLFVKACRDSIEALKN  106

Query  1418  SINDDEAKSKG--WIGFKGDNS-NADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDA  1588
             SI  +E K+ G  W+   G  S N D +AH+HGVVLILSE+LH+++  FD LR++RF++ 
Sbjct  107   SIGMEEKKAYGSNWLQALGRGSPNTDCIAHQHGVVLILSEQLHAITEDFDKLRSIRFEET  166

Query  1589  INRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETR  1768
             + +   +R+           +   +  +    +D    +P  L S     ++Q +D ET 
Sbjct  167   VRKKMHKRRKGIENLPPPENVPAPAAYNDGYSNDWLKEEPRMLES-----RQQLMDQETE  221

Query  1769  ALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             ALQ ELT +++  Q+TE KM+E+SALN+L
Sbjct  222   ALQQELTEMMNMTQETERKMIELSALNYL  250


 Score = 43.1 bits (100),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L+QAQQIE +Y +A+EAT  +E GNKEL K  QRN
Sbjct  256   LRQAQQIESIYMKAMEATSFMEKGNKELAKTQQRN  290



>ref|XP_010923249.1| PREDICTED: syntaxin-81-like [Elaeis guineensis]
Length=154

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 111/173 (64%), Gaps = 24/173 (14%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MA IRDR  D KD V   A+ L Y E              SK AAILAS       QR+ 
Sbjct  1     MAIIRDRIVDLKDAVRIEALFLVYIE--------------SKLAAILAS-------QRTP  39

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             FTKAALKTLESI  LE F+LKH+KDYVD +R TEQERD+IEHEV +F+K+CK++ID+LKN
Sbjct  40    FTKAALKTLESITELERFILKHRKDYVDLHRITEQERDNIEHEVGVFVKACKDKIDILKN  99

Query  1418  SINDDE--AKSKGWIGFKGDNSNADTVAHKHGV-VLILSEKLHSVSSQFDHLR  1567
              I+D+E    SK W+  + D S+AD VAHKHGV  L+L+E   ++    D  R
Sbjct  100   RIHDEEKNGNSKTWLHIRDDTSHADMVAHKHGVEALVLNENFTNLFMGMDFCR  152



>ref|XP_010042815.1| PREDICTED: syntaxin-81-like, partial [Eucalyptus grandis]
Length=89

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 14/103 (14%)
 Frame = +2

Query  1058  MAKIRDRTEDFKDTVHRTAVSLGYDEFWQQIAVDHNDCL*SKTAAILASFILHKPRQRSS  1237
             MAKIRDRTEDFKD V ++A+S+GY+E              SK AA +ASFI+HK R+RS+
Sbjct  1     MAKIRDRTEDFKDAVRQSAISMGYNE--------------SKLAATMASFIIHKQRERSA  46

Query  1238  FTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHE  1366
             FTKAALKTLESI  LE+F+ KH+KDYVD  RTTEQERDSIE E
Sbjct  47    FTKAALKTLESIQTLEQFMRKHRKDYVDPLRTTEQERDSIEQE  89



>gb|ACL54417.1| unknown [Zea mays]
 gb|AFW58942.1| hypothetical protein ZEAMMB73_097097 [Zea mays]
Length=157

 Score = 97.4 bits (241),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +2

Query  1571  LRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQF  1750
             +RFQDAINR  PR+  +R  K       +S  L    +SD       E  + P+RVQEQ 
Sbjct  1     MRFQDAINRAMPRKNQKRPEKKPAEPSKSSLVL----KSDVSKIVDQEASTAPMRVQEQL  56

Query  1751  LDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             LDDET+ALQVELT LLDAVQ+TETKM+EMSALNHL
Sbjct  57    LDDETKALQVELTSLLDAVQETETKMIEMSALNHL  91


 Score = 63.2 bits (152),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  97    LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  131



>gb|KHN31601.1| Syntaxin-81 [Glycine soja]
Length=120

 Score = 84.0 bits (206),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  1694  EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             E R+P EL SEP+RVQ+Q LDDETRALQVELT LL+  Q+TET MVEMSALNHL
Sbjct  2     EFREPEELCSEPLRVQQQLLDDETRALQVELTSLLNTGQETETNMVEMSALNHL  55


 Score = 63.9 bits (154),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             L QAQQIE+LYDQAVEATKNVELGN EL++AIQRN
Sbjct  61    LHQAQQIEHLYDQAVEATKNVELGNIELSRAIQRN  95



>emb|CDX87839.1| BnaC06g09010D [Brassica napus]
Length=424

 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +2

Query  1232  SSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTI-FIKSCKEQIDV  1408
             SS   +  + LESI  L++F++KH+KDYVD +RTTE E+DSIEHE+T  FIK+CKEQID+
Sbjct  335   SSRASSTCELLESIKELDQFMMKHRKDYVDLHRTTEHEKDSIEHEITTAFIKACKEQIDI  394

Query  1409  LKNSINDDEAKSKGWIGFKG--DNSNA  1483
             LKNSI ++E+ SKGW+G     DN NA
Sbjct  395   LKNSIRNEESNSKGWLGLAAAEDNFNA  421



>ref|XP_003059240.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56372.1| predicted protein [Micromonas pusilla CCMP1545]
Length=305

 Score = 79.7 bits (195),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 115/236 (49%), Gaps = 30/236 (13%)
 Frame = +2

Query  1178  SKTAAILASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSI  1357
             ++  A +A+  L  P  RS   KAA   L  +  L  FL KH+ DY+   +  +  RD I
Sbjct  24    TRAEASVAAVGLPPPSARSPVLKAAHDALSLVRELRVFLAKHRVDYLRESKDADAVRDGI  83

Query  1358  EHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLH  1537
             E EV + +++C+  I +L++++ ++ A + G  G +       +VAH HGVVLI++E L 
Sbjct  84    ESEVRLSVRACQAHIAMLRSTV-EETASTPGREGTQ-------SVAHLHGVVLIVTEHLQ  135

Query  1538  SVSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNEL  1717
              V++ FD  R +RF+  ++            ++            +   S + A DP   
Sbjct  136   RVAALFDQCREVRFKSVLD------------EAERRRRRAPRAAARSAASANGAADPAPY  183

Query  1718  RSEPIRV--------QEQFLDDETRALQV--ELTGLLDAVQQTETKMVEMSALNHL  1855
               +            Q+Q +++ T   ++  EL GL D V++TE  ++EM+AL+ L
Sbjct  184   DDDTSASTSATTSHQQQQQMEERTSGNELVDELAGLADQVRRTEGAVLEMAALSSL  239


 Score = 43.5 bits (101),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  1858  QQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             QQA QIE LY QA+E+TK +E GN EL K I R 
Sbjct  246   QQATQIEALYTQAIESTKRIESGNVELRKTIARR  279



>ref|NP_001066186.2| Os12g0154400 [Oryza sativa Japonica Group]
 dbj|BAF29205.2| Os12g0154400, partial [Oryza sativa Japonica Group]
Length=92

 Score = 62.8 bits (151),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQI+YLYDQAVEAT NVE GNKEL++AIQRN
Sbjct  32    LQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRN  66


 Score = 50.4 bits (119),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  1778  VELTGLLDAVQQTETKMVEMSALNHL  1855
             VELT LLDAVQ+TETKM+EMSALNHL
Sbjct  1     VELTNLLDAVQETETKMIEMSALNHL  26



>emb|CDX87840.1| BnaC06g09020D [Brassica napus]
Length=677

 Score = 65.1 bits (157),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = +2

Query  1673  QRQQSDSEARDPNELRSEPIRVQEQ--FLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
             QR Q   EA +P+E++++P R+Q+Q   LDDET+ALQVEL+ LLD  +QTETKMVEMSAL
Sbjct  17    QRMQVLPEAIEPDEIQAQPRRIQQQQQLLDDETQALQVELSNLLDGARQTETKMVEMSAL  76

Query  1847  NHL  1855
             NHL
Sbjct  77    NHL  79


 Score = 45.1 bits (105),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 3/35 (9%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQAQQIE+       ATKNVELGNKEL++AI+RN
Sbjct  85    LQQAQQIEF---DTKNATKNVELGNKELSQAIKRN  116



>ref|XP_005648246.1| hypothetical protein COCSUDRAFT_41865 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23702.1| hypothetical protein COCSUDRAFT_41865 [Coccomyxa subellipsoidea 
C-169]
Length=272

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 8/112 (7%)
 Frame = +2

Query  1244  KAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSI  1423
             K+ L   +++  L  F+ +H++DYV   R +E ERD IE +V  +++SC   I  L+ S+
Sbjct  22    KSGLTEAKNVDALRAFVKEHQRDYVQSGRCSEAERDRIEEQVGRYMRSCTANIARLEASL  81

Query  1424  NDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRF  1579
               D+  ++G         N    AH+HGV LILSE+LH++ S FD  R++R+
Sbjct  82    GPDQPGARGL--------NPHMFAHRHGVALILSERLHAIGSSFDCCRSVRY  125



>ref|XP_001419559.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97852.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score = 68.2 bits (165),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 102/224 (46%), Gaps = 28/224 (13%)
 Frame = +2

Query  1217  KPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYR-----TTEQERDSIEHEVTIFI  1381
             +   R++   A  +T+ +        L+  + YV+ +R      +++ERD+ E E +  I
Sbjct  25    RANARANAKVATCETVRAYARTAAIALEATRTYVEEHRGRYKGASDRERDAFEAETSESI  84

Query  1382  KSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDH  1561
             + C+  +   ++++ +  A+  G +            AH HG+ LILSE L+ V+  FD 
Sbjct  85    RECQRCVASARDAVEN--ARDGGALA-----RAPQCAAHLHGIGLILSESLNDVARAFDK  137

Query  1562  LRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRV-  1738
             +R  RF   + R    R+ +R          T +  D      S A D    R+  +RV 
Sbjct  138   VRETRFAATLERAERERQRKRAA--------TRARYDDAGTGASGADDDGVARA--VRVE  187

Query  1739  -----QEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                  QEQ   +    L+ ELT LLD V+  E  ++EMSAL+ L
Sbjct  188   GVEMRQEQVHAERQDGLEEELTQLLDEVRMAEKNVIEMSALSSL  231


 Score = 37.4 bits (85),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1861  QAQQIEYLYDQAVEATKNVELGNKELTKAIQR  1956
             QA+QIE LY  A+E+++++++GN E+ K I R
Sbjct  239   QAEQIESLYQDAIESSRHLDMGNVEMKKTIAR  270



>emb|CBN81147.1| Syntaxin-18 [Dicentrarchus labrax]
Length=323

 Score = 75.5 bits (184),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 115/241 (48%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKRSRPKSGFSPKAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +         ++A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQV--------TSAQIKEHRGAVLDLIEMYLRGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPR------------RTGKsstseistssNLD  1672
                +   RA+R +  ++     R+AP    +            +T K  ++E S S  LD
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLAPEHHSKVEKTPEVEPTEEKTVKEESTEKSVSEVLD  200

Query  1673  QRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
                    E R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  
Sbjct  201   NPVNLWEEGRVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEISRLQE  256

Query  1853  L  1855
             +
Sbjct  257   I  257


 Score = 29.6 bits (65),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLQQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_008282715.1| PREDICTED: syntaxin-18 [Stegastes partitus]
Length=323

 Score = 75.5 bits (184),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 116/241 (48%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L+EFLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKRSRPKSGFSPKAKEVITNITKLKEFLLQHRKDYVSAGSLISSDLTRMTDSERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +         ++A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQV--------TSAQIKEHRGAVLDLVEMYLKGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPR------------RTGKsstseistssNLD  1672
                +   RA+R +  ++     R+AP +  R            +  K  +SE S S  LD
Sbjct  141   CKIYSEQRAIRVKRMVDKKRLSRLAPEQHSRVEKTVEAEPTQEKIVKEESSEKSVSEVLD  200

Query  1673  QRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
             +      E R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  
Sbjct  201   EPVNPWEEGRVEDELSPEEIQMFEQ----ENQRLISEMNSLVDEVRQIEGKVVEISRLQE  256

Query  1853  L  1855
             +
Sbjct  257   I  257


 Score = 29.3 bits (64),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLQQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_002502580.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63838.1| predicted protein [Micromonas sp. RCC299]
Length=304

 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = +2

Query  1190  AILASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEV  1369
             A++A   +  P  RS   K+A  TL  +  L  F+ +H+ DY+   + ++  RD IE EV
Sbjct  28    ALVAPRDMPPPSARSPVLKSAHDTLVLVRELRAFVTRHRADYLREGKDSDTVRDGIESEV  87

Query  1370  TIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSS  1549
              + +K+C+  I +LK+++ + EA         G       VAH HGVVLIL+E L  V++
Sbjct  88    RLSVKACQAHITMLKSTVQEVEA---------GKTEGVQGVAHMHGVVLILTEFLQRVAA  138

Query  1550  QFDHLRALRFQDAI  1591
              FD  R +RF+  +
Sbjct  139   SFDQCREVRFKKVL  152



>ref|NP_001019596.1| syntaxin-18 [Danio rerio]
 sp|Q4VBI7.1|STX18_DANRE RecName: Full=Syntaxin-18 [Danio rerio]
 gb|AAH95763.1| Zgc:112326 [Danio rerio]
Length=314

 Score = 75.1 bits (183),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 108/232 (47%), Gaps = 43/232 (19%)
 Frame = +2

Query  1217  KPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEHEVT  1372
             +PRQR SF+  A + + +I  L++FLL+H+KDYV+          R T+ ERD I+ +  
Sbjct  41    RPRQRDSFSCKAREVISNISKLKDFLLQHRKDYVNAGSVMSSEVSRMTDSERDQIDQDAQ  100

Query  1373  IFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQ  1552
             IF+++C E I  L++ ++  +              +     H+  V+ ++   L  V   
Sbjct  101   IFMRTCAEAISQLRSEMDKKQV-------------SMQVKDHRAAVLDLIDSYLKGVCKL  147

Query  1553  FDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQ----QSDSEARDPNELR  1720
             +   RA+R    + RV  +++  R             N ++RQ    ++D    D N   
Sbjct  148   YSEQRAVR----VKRVVDKKRLSRL-------EPEQINTEKRQSDGEENDKPVSDGNVDL  196

Query  1721  SEPIRVQE-------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              E  RV++       Q  + E + L  E+  LLD V+Q E K+VE+S L  +
Sbjct  197   WEENRVEDDLSPEEIQMFEQENQRLVGEMNSLLDEVRQIEGKVVEISRLQEI  248


 Score = 29.3 bits (64),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1846  EPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  251   EKVLQQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  288



>ref|XP_005844491.1| hypothetical protein CHLNCDRAFT_138844 [Chlorella variabilis]
 gb|EFN52389.1| hypothetical protein CHLNCDRAFT_138844 [Chlorella variabilis]
Length=332

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = +2

Query  1268  SIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSINDDEAKSK  1447
             ++  L ++L +H++DY    +  E ERD +E EV  +++SC   ID L+  +    A   
Sbjct  53    NVDALRQYLREHQRDYAQLGKLGEAERDRVEEEVGAYVRSCSANIDKLQQML---AAAPP  109

Query  1448  GWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQ  1582
             G    +    NAD VAH+ G VLILSE+L S ++ FD LR+LR+Q
Sbjct  110   GGSPAR-QPPNADMVAHRQGQVLILSERLRSAAALFDRLRSLRYQ  153



>ref|XP_009305912.1| PREDICTED: syntaxin-18 isoform X1 [Danio rerio]
Length=323

 Score = 75.1 bits (183),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 108/232 (47%), Gaps = 43/232 (19%)
 Frame = +2

Query  1217  KPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEHEVT  1372
             +PRQR SF+  A + + +I  L++FLL+H+KDYV+          R T+ ERD I+ +  
Sbjct  50    RPRQRDSFSCKAREVISNISKLKDFLLQHRKDYVNAGSVMSSEVSRMTDSERDQIDQDAQ  109

Query  1373  IFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQ  1552
             IF+++C E I  L++ ++  +              +     H+  V+ ++   L  V   
Sbjct  110   IFMRTCAEAISQLRSEMDKKQV-------------SMQVKDHRAAVLDLIDSYLKGVCKL  156

Query  1553  FDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQ----QSDSEARDPNELR  1720
             +   RA+R    + RV  +++  R             N ++RQ    ++D    D N   
Sbjct  157   YSEQRAVR----VKRVVDKKRLSRL-------EPEQINTEKRQSDGEENDKPVSDGNVDL  205

Query  1721  SEPIRVQE-------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              E  RV++       Q  + E + L  E+  LLD V+Q E K+VE+S L  +
Sbjct  206   WEENRVEDDLSPEEIQMFEQENQRLVGEMNSLLDEVRQIEGKVVEISRLQEI  257


 Score = 29.3 bits (64),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1846  EPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  260   EKVLQQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_010740429.1| PREDICTED: syntaxin-18 [Larimichthys crocea]
Length=323

 Score = 74.3 bits (181),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 69/241 (29%), Positives = 114/241 (47%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKRSRAKSGFSPKAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +         ++A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQV--------TSAQIREHRGAVLDLIEMYLRGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPR------------RTGKsstseistssNLD  1672
                +   RA+R +  ++     R+AP    R            +T K  ++E S     D
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLAPEHHSRVEKTPEVEPTEEKTVKEESTEKSVPEVPD  200

Query  1673  QRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
                    E+R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  
Sbjct  201   NPVNMWEESRVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEISRLQE  256

Query  1853  L  1855
             +
Sbjct  257   I  257


 Score = 28.9 bits (63),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLQQETEIDNIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_005918659.1| PREDICTED: syntaxin-18-like isoform X1 [Haplochromis burtoni]
Length=324

 Score = 74.3 bits (181),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 108/238 (45%), Gaps = 35/238 (15%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ +RD I+ 
Sbjct  34    IFKRSRPKSGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLSRMTDNDRDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +          +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQVM--------SAQIKEHRRAVLDLIETYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELR  1720
                +   RA+R +  +++    R  P   G          +  D  ++  SE    +E++
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLVPEHHGPVEKKVEVEPTEEDTVKEGSSEKTASSEVQ  200

Query  1721  SEPIRVQE-------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               P+ + E             Q  + E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   DNPVNLWEESRVEDELSPEEIQMFEQENQRLISEMNSLVDEVRQIEGKVVEISRLQEI  258


 Score = 28.9 bits (63),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  258   IFAEKVLQQEAEIDNIHQLVVGATENVKEGNEDIREAIKNN  298



>ref|XP_005731368.1| PREDICTED: syntaxin-18-like [Pundamilia nyererei]
Length=324

 Score = 73.9 bits (180),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 108/238 (45%), Gaps = 35/238 (15%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ +RD I+ 
Sbjct  34    IFKRSRPKSGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLSRMTDNDRDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +          +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQVM--------SAQIKEHRGAVLDLIETYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELR  1720
                +   RA+R +  +++    R  P   G          +  D  ++  SE    +E++
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLVPEHHGPVEKKVEVEPTEEDTVKEGSSEKTASSEVQ  200

Query  1721  SEPIRVQE-------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               P+ + E             Q  + E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   DNPVNLWEESRVEDELSPEEIQMFEQENQRLISEMNSLVDEVRQIEGKVVEISRLQEI  258


 Score = 28.9 bits (63),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  258   IFAEKVLQQEAEIDNIHQLVVGATENVKEGNEDIREAIKNN  298



>ref|XP_006629663.1| PREDICTED: syntaxin-18-like isoform X1 [Lepisosteus oculatus]
Length=328

 Score = 76.6 bits (187),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/246 (28%), Positives = 121/246 (49%), Gaps = 47/246 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             IL K R +S F+  A + + +I  L++FLL+H+KDYV        D+ R T+ ERD I+ 
Sbjct  34    ILKKTRLKSDFSTKAKEVISNITKLKDFLLQHRKDYVNAGSLISSDYTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C + I+ L+      EA  K          +A    H+  V+ ++ + L  V
Sbjct  94    DAQIFMRTCSDAINQLRT-----EADKKVM--------SAQVKEHRGAVLDLIEDYLKGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRR-------------KPRRTGKsstseistssNL  1669
                +   RA+R + A++     R+ P R             +P  + + +  + +T +N+
Sbjct  141   CKLYSEQRAIRVKRAVDKKRLLRLEPERHSKLLSSATEKSAQPDPSDEKTLKDNTTDTNV  200

Query  1670  DQRQQSD----SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEM  1837
              + Q+S      + +  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+
Sbjct  201   AEAQESGVGLWEDGKVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEI  256

Query  1838  SALNHL  1855
             S L  +
Sbjct  257   SRLQEI  262


 Score = 26.2 bits (56),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V  T+NV+ GN+++ +AI+ N
Sbjct  262   IFAEKVLHQETEIDNIHQLVVGTTENVKEGNEDIREAIKNN  302



>ref|XP_004545247.1| PREDICTED: syntaxin-18-like [Maylandia zebra]
Length=324

 Score = 73.6 bits (179),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 108/238 (45%), Gaps = 35/238 (15%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ +RD I+ 
Sbjct  34    IFKRSRPKSGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLSRMTDNDRDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ +          +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAEKQV--------ISAQIKEHRGAVLDLIETYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELR  1720
                +   RA+R +  +++    R  P   G          +  D  ++  SE    +E++
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLVPEHHGPVEKKVEVEPTEEDTVKEGSSEKTASSEVQ  200

Query  1721  SEPIRVQE-------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               P+ + E             Q  + E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   DNPVNLWEESRVEDELSPEEIQMFEQENQRLISEMNSLVDEVRQIEGKVVEISRLQEI  258


 Score = 28.9 bits (63),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  258   IFAEKVLQQEAEIDNIHQLVVGATENVKEGNEDIREAIKNN  298



>ref|XP_004069234.1| PREDICTED: syntaxin-18-like [Oryzias latipes]
Length=323

 Score = 72.8 bits (177),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 111/241 (46%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S FT+ A + + +I  L++FLL+H+KDY+        D  R T+ ERD I+ 
Sbjct  34    IFKRSRTKSGFTQRAKEVITNITKLKDFLLQHRKDYISAGSLISSDLTRMTDGERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+  +    A              A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRGEVEKQAAP-------------AQIKEHRGSVLDLVETYLKGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRR--KPRRTGKsstseistssNLDQRQQSDS---  1693
                +   RA+R +  ++     R+ P R  +P +T + + +E  T       +       
Sbjct  141   CKVYSEQRAIRVKRMVDKKRLSRLTPERSSRPEKTLEVAPTEEKTIIEESSEKSISEVQG  200

Query  1694  -------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
                    E R  +EL  E I++ EQ    E + L  E++ L+D V+Q E K+VE+S L  
Sbjct  201   SAVSLWEEGRVEDELSPEEIQMFEQ----ENQRLVSEMSSLVDEVRQIEGKVVEISRLQE  256

Query  1853  L  1855
             +
Sbjct  257   I  257


 Score = 29.3 bits (64),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLQQESEIDNIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_006784584.1| PREDICTED: syntaxin-18-like [Neolamprologus brichardi]
Length=324

 Score = 72.4 bits (176),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 107/238 (45%), Gaps = 35/238 (15%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ +RD I+ 
Sbjct  34    IFKRSRPKSGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLSRMTDNDRDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EAK +          +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRN-----EAKKQVM--------SAQIKEHRGAVLDLIETYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELR  1720
                +   RA+R +  +++    R  P              +  D  ++  SE    +E++
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLIPEHHSPVEKKVEVEPTQEDTVKEGSSEKTASSEVQ  200

Query  1721  SEPIRVQE-------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               P+ + E             Q  + E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   DNPVNLWEESRVEDELSPEEIQMFEKENQRLISEMNSLVDEVRQIEGKVVEISRLQEI  258


 Score = 28.9 bits (63),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  258   IFAEKVLQQEAEIDNIHQLVVGATENVKEGNEDIREAIKNN  298



>ref|XP_006277470.1| PREDICTED: syntaxin-18 isoform X1 [Alligator mississippiensis]
Length=333

 Score = 70.5 bits (171),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 113/244 (46%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR RS F+  A   + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  41    PRPRSDFSARARDVITNIGKLKDFLLQHRKDYINAYSHVMSEYVRMTDTERDQIDQDAQI  100

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+     D    +                H+  V+ ++ + L  V   +
Sbjct  101   FMRTCAEAIQQLRTEALKDVLPPQ-------------VKEHRAAVLDLVEDYLKRVCKLY  147

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKssts---eistssNLDQRQQSDS----------  1693
                RA+R +  +++    R +P ++ KS  +   E  + ++LD+ ++  +          
Sbjct  148   SEQRAIRVKRVVDKKRLSRLEPEKSNKSEAAFSPENVSKNSLDKSEEKPTSEENKEKNLT  207

Query  1694  ----------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  208   DAQTNFGLWGDGRGEDELSPEEIQMFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISR  263

Query  1844  LNHL  1855
             L  +
Sbjct  264   LQEI  267


 Score = 29.6 bits (65),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  267   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  307



>ref|XP_006629664.1| PREDICTED: syntaxin-18-like isoform X2 [Lepisosteus oculatus]
Length=329

 Score = 73.9 bits (180),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 71/247 (29%), Positives = 118/247 (48%), Gaps = 48/247 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             IL K R +S F+  A + + +I  L++FLL+H+KDYV        D+ R T+ ERD I+ 
Sbjct  34    ILKKTRLKSDFSTKAKEVISNITKLKDFLLQHRKDYVNAGSLISSDYTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C + I+ L+      EA  K          +A    H+  V+ ++ + L  V
Sbjct  94    DAQIFMRTCSDAINQLRT-----EADKKVM--------SAQVKEHRGAVLDLIEDYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQ-----------S  1687
                +   RA+R + A+++    R +P R  K  +S    S+  D   +           S
Sbjct  141   CKLYSEQRAIRVKRAVDKKRLLRLEPERHSKLLSSATEKSAQPDPSDEKTLKDNTTEITS  200

Query  1688  DSEARDP-----------NELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVE  1834
              SEA++            +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE
Sbjct  201   ASEAQESGVGLWEDGKVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVE  256

Query  1835  MSALNHL  1855
             +S L  +
Sbjct  257   ISRLQEI  263


 Score = 26.2 bits (56),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V  T+NV+ GN+++ +AI+ N
Sbjct  263   IFAEKVLHQETEIDNIHQLVVGTTENVKEGNEDIREAIKNN  303



>ref|XP_005715830.1| Syn18 [Chondrus crispus]
 emb|CDF36011.1| Syn18 [Chondrus crispus]
Length=302

 Score = 57.8 bits (138),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 102/215 (47%), Gaps = 22/215 (10%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--RTTEQERDSIEHEVTIFIKSCK  1393
             P  +  FT+ A++    I  ++ F+ K ++ Y DF      + ERD I+  V  F+++  
Sbjct  34    PSTQHEFTQLAVELTTRIAEMQTFVSKCQRRYEDFSPRGMKDAERDEIDSAVAQFLRTAM  93

Query  1394  EQIDVLK-NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRA  1570
              QIDVLK +++   E ++ G              AH+ GVV+IL+E L  VS   + LR 
Sbjct  94    AQIDVLKADAVRALEQRTGGSFP-----------AHQLGVVVILNEDLQGVSKLSEGLRG  142

Query  1571  LRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPIRVQEQF  1750
             +R + AI+      K + T K +       +   + ++      + ++   E + V EQ 
Sbjct  143   VRIRRAIS-----DKSKVTVKYNADVAREMAAERRERERREGGTEEDD---EGLAVLEQA  194

Query  1751  LDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              + E  AL  EL    + V++ E  + E++ LNH+
Sbjct  195   FERENEALVTELVETREQVREAERTVFEIANLNHV  229


 Score = 42.0 bits (97),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQR  1956
             L+QA++IE LY+ AVE+T+NVE GN+EL K  +R
Sbjct  235   LEQAREIETLYELAVESTENVERGNRELRKMKRR  268



>ref|XP_005798007.1| PREDICTED: syntaxin-18-like [Xiphophorus maculatus]
Length=323

 Score = 70.9 bits (172),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 109/241 (45%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  K R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKKSRPKSGFSLRAKEVITNITKLKDFLLQHRKDYVSAGSLISTDLSRMTDSERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +   F+++C E I  L++ +             +   ++A    H+  V+ ++   L  V
Sbjct  94    DAQTFMRTCSEAIKQLRSEV-------------EKQATSAQIKEHRVAVLDLIDMYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseist------------ssNLDQRQQ  1684
                +   RA+R +  +++    R  P   GK   + +                N  + Q 
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLAPEHPGKVEKTVVEEPAEEKVVKEESPEKNTSEVQD  200

Query  1685  SDS----EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
             S S    E R  +EL  E I++ EQ    E   L  E++ L+D V+Q E K+VE+S L  
Sbjct  201   SSSNLWEEGRVEDELSPEEIQMFEQ----ENLKLVSEMSNLVDEVRQIEGKVVEISRLQE  256

Query  1853  L  1855
             +
Sbjct  257   I  257


 Score = 28.5 bits (62),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLQQESDIDNIHQLVVGATENVKEGNEDIREAIKNN  297



>gb|AAH73006.1| LOC443606 protein, partial [Xenopus laevis]
Length=326

 Score = 69.3 bits (168),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/244 (26%), Positives = 113/244 (46%), Gaps = 46/244 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             +L + R R  F+  A + + +IG L++FLL+H+KDY++        +   T+ ERD I+ 
Sbjct  35    VLRRSRPRGEFSGKAREVITNIGKLKDFLLEHRKDYINACSYVASEYSCMTDTERDQIDQ  94

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVA-HKHGVVLILSEKLHS  1540
             +  IF+++C + I +L+                 G  S++  +  H++ V+  + + L  
Sbjct  95    DAQIFMRTCSDAIHLLRTE--------------AGKESHSVQIKEHRNAVLDFIEDYLKR  140

Query  1541  VSSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEA------  1699
             V   +   RA+R +  +++    R +P +  K+ TS    S  L     +D E+      
Sbjct  141   VCKLYSEQRAIRVKRTVDKKRLTRLEPEKINKTRTSHSVDSIPLKPLDTADDESIDKTAP  200

Query  1700  ------------RDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                         R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  201   QRNGTSSLWDDGRSEDELSPEEIQMFEQ----ENQRLVSEMNSLFDEVRQIEGKVVEISR  256

Query  1844  LNHL  1855
             L  +
Sbjct  257   LQEI  260


 Score = 30.0 bits (66),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ +++  V AT+N++ GN+++ +AI+ N
Sbjct  260   IFTEKVLQQETEIDNIHELVVGATENIKEGNEDIREAIKNN  300



>ref|XP_007554292.1| PREDICTED: syntaxin-18 [Poecilia formosa]
Length=338

 Score = 70.5 bits (171),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 113/241 (47%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  K R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  49    IFKKNRPKSGFSLRAKEVITNITKLKDFLLQHRKDYVSAGSLISTDLSRMTDSERDQIDQ  108

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +   F+++C E I  L++ +             +   ++A    H+  V+ ++   L  V
Sbjct  109   DAQTFMRTCSEAIKQLRSEV-------------EKQATSAQIKEHRVAVLDLVDVYLRGV  155

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRR--KPRRTG------KsstseistssNLDQRQQ  1684
                +   RA+R +  ++     R+AP    K ++T       +    E S   N+ + Q 
Sbjct  156   CKLYSEQRAIRVKRMVDKKRLSRLAPEHPGKVKKTAAEEPAEEKVVKEESPEKNMSEVQD  215

Query  1685  SD----SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
             S      E R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  
Sbjct  216   SALNLWEEGRVEDELSPEEIQMFEQ----ENQKLVSEMNNLVDEVRQIEGKVVEISRLQE  271

Query  1853  L  1855
             +
Sbjct  272   I  272


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  272   IFAEKVLQQETDIDNIHQLVVGATENVKEGNEDIREAIKNN  312



>ref|XP_007240750.1| PREDICTED: syntaxin-18 [Astyanax mexicanus]
Length=319

 Score = 69.7 bits (169),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 114/238 (48%), Gaps = 40/238 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             +L + R R  F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    LLKRSRTRPGFSCRAKEVISNITKLKDFLLQHRKDYVNASSLISADVNRMTDSERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C + I  L+      EA+  G         +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSDAIKQLRT-----EAEKPG--------ISAQVKEHRGAVLDLIDSYLKGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssNLDQRQQSDS-----  1693
                +   RA+R +  ++     R+ P +K  +  K  + E   +  L++  +  +     
Sbjct  141   CKLYSEQRAIRVKRVVDKKRLSRLEPEQKS-KVEKPQSEEEEKTPPLEENTEKPASDGGV  199

Query  1694  ----EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                 ++R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  200   ELWEDSRVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEISRLQEI  253


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  253   IFAEKVLQQETEIDNIHQLVVGATENVKEGNEDIREAIKNN  293



>ref|XP_010788627.1| PREDICTED: syntaxin-18 [Notothenia coriiceps]
Length=323

 Score = 70.1 bits (170),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 44/242 (18%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +  F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKRSRPKIGFSPKAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA  +         S+A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIRQLRN-----EAVKQV--------SSAQVKEHRGAVLDLIEVYLRGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDP  1708
                +   RA+R +  ++     R+AP     R GK+   E      + +     S +  P
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLAPEHHS-RVGKTPEKEPMEEKTVKEESSEKSVSEVP  199

Query  1709  N-------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
             N             EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L 
Sbjct  200   NNTLNLWEEGRVEDELSPEEIQMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEISRLQ  255

Query  1850  HL  1855
              +
Sbjct  256   EI  257


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  257   IFAEKVLHQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  297



>ref|XP_008407622.1| PREDICTED: syntaxin-18 [Poecilia reticulata]
Length=338

 Score = 69.7 bits (169),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/241 (27%), Positives = 107/241 (44%), Gaps = 42/241 (17%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  K R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  49    IFKKSRPKSGFSLRAKEVITNITKLKDFLLQHRKDYVSAGSLISTDLSRMTDSERDQIDQ  108

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +   F+++C E I  L+  +             +   ++A    H+  V+ ++   L  V
Sbjct  109   DAQTFMRTCSEAIRQLRCEV-------------EKQATSAQIKEHRVAVLDLVDMYLRGV  155

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseist------------ssNLDQRQQ  1684
                +   RA+R +  +++    R  P   GK   +                  N+ + Q 
Sbjct  156   CKLYSEQRAIRVKRMVDKKRLSRLAPEHPGKVEKTAAEEPAEEKVVKEESPEKNMSEVQD  215

Query  1685  SD----SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNH  1852
             S      E R  +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  
Sbjct  216   SSLNLWEEGRVEDELSPEEIQMFEQ----ENQKLVSEMNNLVDEVRQIEGKVVEISRLQE  271

Query  1853  L  1855
             +
Sbjct  272   I  272


 Score = 28.1 bits (61),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  272   IFAEKVLQQETDIDNIHQLVVGATENVKEGNEDIREAIKNN  312



>ref|XP_003441600.1| PREDICTED: syntaxin-18-like isoform 1 [Oreochromis niloticus]
Length=324

 Score = 70.1 bits (170),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 108/238 (45%), Gaps = 35/238 (15%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +S F+  A + + +I  L++FLL+H+KDYV        D  R T+ +RD I+ 
Sbjct  34    IFKRSRPKSGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLSRMTDNDRDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I +L++     EA+ +          +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKLLRS-----EAEKQVM--------SAQIKEHRGAVLDLIETYLKGV  140

Query  1544  SSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELR  1720
                +   RA+R +  +++    R  P              +  D  ++  SE    +E++
Sbjct  141   CKLYSEQRAIRVKRMVDKKRLSRLVPEHHSPVEKKVEVEPTEEDTIKEESSEKTTSSEVQ  200

Query  1721  SEPIRVQE-------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               P+ + E             Q  + E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   DNPVNLWEESRVEDELSPEEIQMFEQENQRLISEMNSLVDEVRQIEGKVVEISRLQEI  258


 Score = 27.3 bits (59),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  258   IFAEKVLHQEAEIDNIHQLVVGATENVKEGNEDIREAIKNN  298



>ref|NP_001239087.1| syntaxin-18 [Gallus gallus]
Length=333

 Score = 68.6 bits (166),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 111/244 (45%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
              R RS FT  A + + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  41    ARSRSDFTGRAREVISNIGKLKDFLLQHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  100

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C + I  L+   + D               +A    H+  V+  + + L  V   +
Sbjct  101   FMRTCADAIHQLRTEAHKDV-------------QSAQVKEHRTAVLDFIEDYLKRVCKLY  147

Query  1556  DHLRALRFQDAINR-----------------VAPRRKPRRTGKsstseistssNLDQR--  1678
                RA+R +  I++                 ++P +  + +   S  + S   N D+   
Sbjct  148   SEQRAIRVKRVIDKKRLSKLEPEQSHVTRSALSPEKFSQNSLDESEEKPSAEENKDRNLP  207

Query  1679  -QQSD----SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
               QS+     + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  208   DAQSNLGLWGDGKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISR  263

Query  1844  LNHL  1855
             L  +
Sbjct  264   LQEI  267


 Score = 28.5 bits (62),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  267   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  307



>ref|XP_007895508.1| PREDICTED: syntaxin-18 isoform X1 [Callorhinchus milii]
Length=330

 Score = 68.9 bits (167),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 115/257 (45%), Gaps = 66/257 (26%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             IL + R +  F+  A + + +I  L++FLL+H+KDY++        + R T+ ERD I+ 
Sbjct  33    ILRRGRPKGGFSSRAKEVVANISKLKDFLLEHRKDYINASSCFMSEYSRMTDTERDQIDQ  92

Query  1364  EVTIFIKSCKEQI-----DVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSE  1528
             +  IF+++C + I     + +KN I                  +     H+ GV+ +L  
Sbjct  93    DAQIFLRTCSDAIQQLRTEAIKNVI------------------SPQVKEHREGVLYLLEA  134

Query  1529  KLHSVSSQFDHLRALRFQDAIN-----RVAPRRK-------------PRRTGKsstseis  1654
              L SV   +   RA+R +  ++     R+AP +              P +T  S    I 
Sbjct  135   YLKSVCKVYSEQRAIRVKRLVDKKRLSRIAPEQHSKKPLVSSSELNLPSKTENSEEQVIK  194

Query  1655  tssNLDQRQQSDSEARD----------PNELRSEPIRVQEQFLDDETRALQVELTGLLDA  1804
               +N D   +S  E +D           +EL  E I++ EQ    E + L  ++  L+D 
Sbjct  195   DENNAD---KSIPEVQDNLGLWEDGKWEDELSPEEIQMFEQ----ENQRLLTDMNSLVDE  247

Query  1805  VQQTETKMVEMSALNHL  1855
             V+Q E K+VE+S L  +
Sbjct  248   VRQIEGKVVEISRLQEI  264


 Score = 27.7 bits (60),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ + I+ ++   V  T+NV+ GN+++ +AI+ N
Sbjct  264   IFTEKVLQQEKDIDNIHQLVVGTTENVKEGNEDIREAIKNN  304



>ref|XP_007895510.1| PREDICTED: syntaxin-18 isoform X2 [Callorhinchus milii]
Length=329

 Score = 68.6 bits (166),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/255 (25%), Positives = 114/255 (45%), Gaps = 63/255 (25%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             IL + R +  F+  A + + +I  L++FLL+H+KDY++        + R T+ ERD I+ 
Sbjct  33    ILRRGRPKGGFSSRAKEVVANISKLKDFLLEHRKDYINASSCFMSEYSRMTDTERDQIDQ  92

Query  1364  EVTIFIKSCKEQI-----DVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSE  1528
             +  IF+++C + I     + +KN I                  +     H+ GV+ +L  
Sbjct  93    DAQIFLRTCSDAIQQLRTEAIKNVI------------------SPQVKEHREGVLYLLEA  134

Query  1529  KLHSVSSQFDHLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssNLDQRQQSDS  1693
              L SV   +   RA+R +  ++     R+AP +  ++         S+  NL  + ++  
Sbjct  135   YLKSVCKVYSEQRAIRVKRLVDKKRLSRIAPEQHSKKP-----LVSSSELNLPSKTENSE  189

Query  1694  E--ARDPNELRSEPIRVQE-------------------QFLDDETRALQVELTGLLDAVQ  1810
             E   +D N  +S P  VQ+                   Q  + E + L  ++  L+D V+
Sbjct  190   EQVIKDENNDKSIP-EVQDNLGLWEDGKWEDELSPEEIQMFEQENQRLLTDMNSLVDEVR  248

Query  1811  QTETKMVEMSALNHL  1855
             Q E K+VE+S L  +
Sbjct  249   QIEGKVVEISRLQEI  263


 Score = 27.7 bits (60),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ + I+ ++   V  T+NV+ GN+++ +AI+ N
Sbjct  263   IFTEKVLQQEKDIDNIHQLVVGTTENVKEGNEDIREAIKNN  303



>emb|CAG01866.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=344

 Score = 67.4 bits (163),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 114/258 (44%), Gaps = 50/258 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +  F+  A + + +I  L++FLL+H+KDYV        DF R T+ ERD I+ 
Sbjct  29    IFKRNRLKGGFSPRAKEVVTNITKLKDFLLQHRKDYVSSRSLFSSDFTRMTDSERDQIDQ  88

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWI------GFKGDNSNADTVAHKH-------  1504
             +  IF+++C E I  L+N    + A    W         +   S   +VA K        
Sbjct  89    DAQIFMRTCSEAIRQLRN----EGASIFNWATNYLSSSVRPTASVIVSVAEKQVVLAQIK  144

Query  1505  ---GVVLILSEK-LHSVSSQFDHLRALRFQDAIN-----RVAPR------RKPRRTGKss  1639
                G VL L E  L  V   +   RA+R +  ++     R+ P       + P       
Sbjct  145   EHRGAVLDLIEMYLKGVCKLYSEQRAIRVKKIVDKKRTSRLTPEQHSLAAKTPELAKAEE  204

Query  1640  tseistssNLDQRQQSDS------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLD  1801
              S    SS     +  D+      E R+ +EL  E I++ EQ    E + L+ E+  L+D
Sbjct  205   KSAKEESSEKSVSEVQDATANLWEEGREEDELSPEEIQMFEQ----ENQRLESEMNNLVD  260

Query  1802  AVQQTETKMVEMSALNHL  1855
              V+Q E K+VE+S L  +
Sbjct  261   EVRQIEGKVVEISRLQEI  278


 Score = 28.5 bits (62),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  278   IFAEKVLQQEAEIDGIHQLVVGATENVKEGNEDIREAIKNN  318



>ref|XP_008494356.1| PREDICTED: syntaxin-18 isoform X2 [Calypte anna]
 ref|XP_008494357.1| PREDICTED: syntaxin-18 isoform X2 [Calypte anna]
 gb|KFP02637.1| Syntaxin-18 [Calypte anna]
Length=333

 Score = 67.4 bits (163),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 49/243 (20%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S FT  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF
Sbjct  42    RSKSDFTSRAREVVSHIGKLKDFLLQHRKDYINAYSHTMSEYVRMTDTERDQIDQDAQIF  101

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C + I  L+      EA        KG  S A    H+  V+ ++ + L  V   + 
Sbjct  102   MRTCADAIHQLRT-----EAP-------KGVQS-AQVKEHRTAVLDLIEDYLKRVCKLYS  148

Query  1559  HLRALRFQDAINRV-APRRKPRRT--GKsstseistssN-LDQRQQSDS-----------  1693
               RA+R +  I++    R +P ++   KS  S   ++ N LD  ++  S           
Sbjct  149   EQRAIRLKRVIDKKRLSRLEPEQSNVSKSPLSHEKSAQNPLDDSEEKLSAEESKERNLPD  208

Query  1694  ---------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                      + R  +EL  E I++ EQ    E + L  E+  LLD V+Q E K+VE+S L
Sbjct  209   VQSNLGLWGDGRGEDELSPEEIQMFEQ----ENQRLVGEMNNLLDEVRQIEGKVVEISRL  264

Query  1847  NHL  1855
               +
Sbjct  265   QEI  267


 Score = 28.5 bits (62),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  267   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  307



>ref|XP_005866201.1| PREDICTED: syntaxin-18 isoform X1 [Myotis brandtii]
Length=335

 Score = 66.2 bits (160),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 107/245 (44%), Gaps = 51/245 (21%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY+        ++ R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAHSHILSEYGRMTDAERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+N  +              +  +     H+  ++    + L  V   +
Sbjct  103   FMRTCSEAIQQLRNQAHK-------------ETHSQQVREHRSAILDFTQDYLRRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQSD-------------  1690
                RA+R +  ++  R+A + +P  T ++     S   +LD  Q S              
Sbjct  150   SEQRAIRVKRVVDKKRLA-KLEPEATARTREPGSSEEVSLDPSQDSGEKPVAEEHAEKIP  208

Query  1691  ----------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                        +++  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S
Sbjct  209   AEAQPELGSWGDSKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEIS  264

Query  1841  ALNHL  1855
              L  +
Sbjct  265   RLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_002740578.1| PREDICTED: syntaxin-18-like [Saccoglossus kowalevskii]
Length=319

 Score = 66.6 bits (161),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 105/236 (44%), Gaps = 34/236 (14%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             IL   RQ+S F   + + + SI  L +FL++H+K Y++          R T+ ERD I+ 
Sbjct  33    ILPHSRQKSEFVTKSKEVVNSITKLRDFLVEHRKAYINASSHLSLGVSRMTDSERDQIDT  92

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I   KN + +D    +                H+  V+ +L E L  V
Sbjct  93    DAHIFMRTCAETIKAFKNDVENDTVLPQ-------------VREHRQAVIDMLDEYLKGV  139

Query  1544  SSQFDHLRALRFQDA-----INRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDP  1708
                +   RA+R +       I R+ P ++  +      +  ST   +++ + +  +   P
Sbjct  140   CKIYSEQRAIRVKRVVDKKRIGRLTPEQRFSQEASLPPASASTPKTIEEGRTAPPKTL-P  198

Query  1709  NELRSEPIRVQEQFLDD-------ETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             + L      V+E    D       E + L  E+  L+D V+Q E K+VE++ L  +
Sbjct  199   DSLNVNQDEVEEDLSPDEILMFEQENQMLFNEMNSLVDEVKQIEGKVVEIAKLQEV  254


 Score = 28.9 bits (63),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  1855  LQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             LQQ + I  +  + VE T+N++ GN+E+ +AI+ N
Sbjct  260   LQQEKDIYTIETKVVETTENIKEGNEEIREAIKNN  294



>ref|XP_006106128.1| PREDICTED: syntaxin-18-like [Myotis lucifugus]
Length=335

 Score = 66.2 bits (160),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 106/245 (43%), Gaps = 51/245 (21%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY+        ++ R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAHSHILSEYGRMTDAERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+N  +              +  +     H+  ++    + L  V   +
Sbjct  103   FMRTCSEAIQQLRNQAHK-------------ETHSQQVREHRSAILDFTQDYLRRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQSD-------------  1690
                RA+R +  ++  R+A + +P  T ++     S   +LD  Q S              
Sbjct  150   SEQRAIRVKRVVDKKRLA-KLEPEATARTREPGSSEEVSLDPSQDSGEKPVAEEHAEKIP  208

Query  1691  ----------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                        + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S
Sbjct  209   AEAQPELGSWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEIS  264

Query  1841  ALNHL  1855
              L  +
Sbjct  265   RLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_008318646.1| PREDICTED: syntaxin-18 [Cynoglossus semilaevis]
Length=335

 Score = 66.2 bits (160),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 112/242 (46%), Gaps = 43/242 (18%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R ++ F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  45    IFKRNRPKNGFSPRAKEVITNITKLKDFLLQHRKDYVSAGSLISSDLTRMTDSERDQIDQ  104

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L+N     EA+ K         ++A    H+  V+ ++   L  V
Sbjct  105   DAQIFMRTCSEAIKQLRN-----EAEKKV--------TSAQIKEHRGVVLDLIGSYLKGV  151

Query  1544  SSQFDHLRALRFQDAIN-----RVAP---RRKPRRTGKsstseistssNLDQRQQSD---  1690
                +   RA+R +  ++     R+ P   +R  ++       E +      ++  SD   
Sbjct  152   CKLYSEQRAIRVKRMVDKKRLSRLTPEHHKRVEKQREVEPAEEKTVKEESSEKNVSDVPD  211

Query  1691  -------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
                     E    +EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L 
Sbjct  212   NTAEHLWEEGGVEDELSPEEIQMFEQ----ENQKLVSEMNSLVDEVRQIEGKVVEISRLQ  267

Query  1850  HL  1855
              +
Sbjct  268   EI  269


 Score = 28.9 bits (63),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I  ++   V AT+NV+ GN+++ +AI+ N
Sbjct  269   IFAEKVLQQESEINSIHQLVVGATENVKEGNEDIREAIKNN  309



>ref|XP_006877344.1| PREDICTED: syntaxin-18 [Chrysochloris asiatica]
Length=335

 Score = 66.2 bits (160),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 109/248 (44%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHITSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHREIHSQQVKE-----------------HRSTVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQ------  1684
                +   RA+R +  +++         P  KPR    S T+  + S + +++        
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPSTKPREATSSETASSNPSKDSEEKPAVEDSPG  205

Query  1685  -----------SDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                        S ++ +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   TLLPDAQPELGSWADGKGEDELSPEEIQMFEQ----ENQRLISEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_010581760.1| PREDICTED: syntaxin-18 isoform X1 [Haliaeetus leucocephalus]
Length=335

 Score = 66.6 bits (161),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 113/243 (47%), Gaps = 49/243 (20%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S FT  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF
Sbjct  44    RSKSDFTGRAREVISHIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIF  103

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C + I  L+                KG  S A    H+  V+  + + L  V   + 
Sbjct  104   MRTCADAIHQLRTE------------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYS  150

Query  1559  HLRALRFQDAINRV-APRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN---  1711
               RA+R +  I++    R +P ++   KS  S   +S N LD  ++  S  E++D N   
Sbjct  151   EQRAIRVKRVIDKKRLSRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNLPD  210

Query  1712  ---------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                            EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  211   AQSNLGLWGDGKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRL  266

Query  1847  NHL  1855
               +
Sbjct  267   QEI  269


 Score = 28.5 bits (62),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_004885844.1| PREDICTED: syntaxin-18 [Heterocephalus glaber]
 gb|EHB03655.1| Syntaxin-18 [Heterocephalus glaber]
Length=335

 Score = 65.9 bits (159),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 109/248 (44%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      IN  + K                  H+  V+    + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEINSQQVKE-----------------HRTAVLDFTEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDS---  1693
                +   RA+R +  +++         P  K R +  S     + S + +++  S +   
Sbjct  146   CKLYSEQRAIRVKRLVDKKRLSRLEPEPSAKARESASSEEVSETPSEDSEEKPASKAYPE  205

Query  1694  --------------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           ++R  +EL +E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KTVAKVGPELGAVGDSRGEDELSAEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_007063009.1| PREDICTED: syntaxin-18 [Chelonia mydas]
Length=302

 Score = 64.3 bits (155),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 108/228 (47%), Gaps = 37/228 (16%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S F+  A + + +IG L++FLL+H+K+Y++ Y        R T+ ERD I+ +  IF
Sbjct  29    RPKSDFSCRAREVITNIGKLKDFLLQHRKNYINAYSHLMSEYIRMTDPERDQIDQDAQIF  88

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTV-AHKHGVVLILSEKLHSVSSQF  1555
             +++C + I  L+   +               N  +  V  H+  V+  + + L  V   +
Sbjct  89    MRTCADAIQQLRTEAH--------------KNVQSPQVREHRAAVLDFIEDYLKRVCKLY  134

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDS-------EARDPN  1711
                RA+R +  +++    R +P ++ K    + +   N DQ     +       + +  +
Sbjct  135   SEQRAIRVKRMVDKKRLSRLEPEQSNK--AQKPAYEENKDQNLTDANSNFGLWGDGKGED  192

Query  1712  ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  193   ELSPEEIQMFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISRLQEI  236


 Score = 30.0 bits (66),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI++N
Sbjct  236   IFTEKVLQQDTEIDNIHQLVVGATENIKEGNEDIREAIKKN  276



>ref|XP_006216442.1| PREDICTED: syntaxin-18, partial [Vicugna pacos]
Length=311

 Score = 65.5 bits (158),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  19    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVVSEYGRMTDTERDQIDQDAQT  78

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  79    FMRTCSEAIQQLRAQAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  121

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  KPR +  S     + S + +++  ++    
Sbjct  122   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKPRESMSSEKVSQTLSKDSEEKSVTEEYPE  181

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  182   KIPAEAQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  237

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  238   EISRLQEI  245


 Score = 28.9 bits (63),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  245   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  285



>ref|XP_004624630.1| PREDICTED: syntaxin-18 [Octodon degus]
Length=335

 Score = 65.1 bits (157),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 111/248 (45%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssNLDQRQQSDSE----  1696
                +   RA+R +  ++     ++ P   P+    +S+ ++S + + D  ++   E    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPSPKARECASSEKVSETPSKDSEEKPAPEEYPE  205

Query  1697  ---------------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                            +R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KTVAKARPELGAVGDSRGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_001631010.1| predicted protein [Nematostella vectensis]
 gb|EDO38947.1| predicted protein [Nematostella vectensis]
Length=314

 Score = 59.7 bits (143),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 104/222 (47%), Gaps = 29/222 (13%)
 Frame = +2

Query  1232  SSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKS  1387
             S F K A     +I +L+EFL+KH+KDY+D +        + T+ ERD I+++  +++++
Sbjct  43    SDFGKRARDVRANITILKEFLVKHRKDYIDAFSHLSSEVSKMTDTERDQIDNDAQMYMRT  102

Query  1388  CKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLR  1567
             C   I +LKN     E   K  +  +  N+      H+  V+ +L E L  V   +   R
Sbjct  103   CHNSIKLLKN-----EVPKKVKVVCEQLNT------HRDNVIEMLEEYLKVVCKLYSEQR  151

Query  1568  ALRFQDA-----INRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARD-PNELRSEP  1729
             A+R + A     I+R+ P    RR             +  + ++S+SE +    E  S+P
Sbjct  152   AIRVKRAVDKKRISRLQPEH-TRRKHDLFAKAECMPGHAPKARESNSENKPLIGEEVSKP  210

Query  1730  IRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               V+E+   DE +        L    +Q E ++VE+S L  +
Sbjct  211   -DVEEELSPDEVQLFIAHSCHLF--CRQIEGRVVEISQLQEI  249


 Score = 34.3 bits (77),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  1846  EPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             E  LQQ+ QI+ +Y+ AV  T+NV+ GN+ + +AI+ N
Sbjct  252   EKVLQQSGQIDRIYETAVGTTENVKDGNEHIREAIKNN  289



>ref|XP_005485810.1| PREDICTED: syntaxin-18 [Zonotrichia albicollis]
Length=334

 Score = 65.1 bits (157),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/248 (26%), Positives = 109/248 (44%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
              R +S FT  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  +
Sbjct  42    ARSKSDFTSRAREVISHIGKLKDFLLQHRKDYINAYSHVMSEYVRMTDTERDQIDQDAQV  101

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C + I  L+                KG  S A    H+  V+  + + L  V   +
Sbjct  102   FMRTCADAIHQLRTE------------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLY  148

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQS---DSE----------  1696
                RA+R    + RV  +++  +     ++   +  + ++  QS   DSE          
Sbjct  149   SEQRAIR----VKRVIDKKRLSKLEPEQSNVSKSPLSAEKSSQSALEDSEEKLSAEESKD  204

Query  1697  ---------------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                            +R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  205   RNLPNAQSNLGLWGDSRGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVV  260

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  261   EISRLQEI  268


 Score = 28.5 bits (62),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_004579276.1| PREDICTED: syntaxin-18 [Ochotona princeps]
Length=335

 Score = 64.7 bits (156),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 107/245 (44%), Gaps = 50/245 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY+        D+ R T+ ERD I+ +  I
Sbjct  42    PRPKGDFSNRAREVISHIGKLRDFLLEHRKDYINAYSHILSDYGRMTDAERDQIDQDAQI  101

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +  E  S+                H+  V+  + + L  V   +
Sbjct  102   FMRTCSEAIQQLRTEAH-REVHSQ------------QVKEHRTAVLDFVEDYLKRVCKLY  148

Query  1556  DHLRALRFQDAINR-------VAPRRKPRR-TGKsstseistssNLDQRQQSD-------  1690
                RA+R +  +++         P  K R  T          S + +++  S+       
Sbjct  149   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKKVSQEPSKDWEEKSASEEAPEKTV  208

Query  1691  SEA----------RDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
             SEA          R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S
Sbjct  209   SEAQPESGTWGDGRGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEIS  264

Query  1841  ALNHL  1855
              L  +
Sbjct  265   RLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_010971283.1| PREDICTED: syntaxin-18 [Camelus bactrianus]
Length=335

 Score = 64.7 bits (156),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVVSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAQAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  KPR +  S     + S + +++  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKPRESMSSEKVSQTLSKDSEEKPVTEEYPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KIPAETQPGLGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_008831338.1| PREDICTED: syntaxin-18 [Nannospalax galili]
Length=334

 Score = 63.9 bits (154),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/243 (25%), Positives = 103/243 (42%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDAERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              D  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTEAHK-------------DIHSQQVKEHRTAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQSDSEA----------  1699
                RA+R +  ++  R++      +T    ++    S N  Q  +    A          
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPKTKTKESASEKVSPNTSQDPEEKPAAAEFPEKPLSE  209

Query  1700  -----------RDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                        +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   AQTELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 29.3 bits (64),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_003934719.1| PREDICTED: syntaxin-18 isoform X1 [Saimiri boliviensis boliviensis]
Length=336

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 102/245 (42%), Gaps = 50/245 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +S F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKSDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDSERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRS  1723
                +   RA+R +  +++    +       + T E ++S  + Q    DSE     E   
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNSTKTRESTSSEKVSQSPSKDSEENPATEEHP  205

Query  1724  EPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
             E I  +                      Q  + E + L  E+  L D V+Q E ++VE+S
Sbjct  206   EKILAEAQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEIS  265

Query  1841  ALNHL  1855
              L  +
Sbjct  266   RLQEI  270


 Score = 28.9 bits (63),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  270   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  310



>ref|XP_003973628.1| PREDICTED: syntaxin-18-like [Takifugu rubripes]
Length=322

 Score = 64.3 bits (155),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 105/242 (43%), Gaps = 45/242 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  + R +  F+  A + + +I  L++FLL+H+KDYV        D    T+ ERD I+ 
Sbjct  34    IFKRNRPKGGFSPRAKEVVTNITKLKDFLLQHRKDYVSAGSLISSDLTCMTDSERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEK-LHS  1540
             +  IF+++C E I  L+N        ++              +    GVVL L E  L  
Sbjct  94    DAQIFMRTCSEAIRQLRNEAEKQLVPAQ--------------IKEHRGVVLDLIEMYLKG  139

Query  1541  VSSQFDHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEAR------  1702
             V   +   RA+R +  +++   +R  R T +       T  ++   ++S  E        
Sbjct  140   VCKLYSEQRAIRVKRMVDK---KRMSRMTPEQHNLVAKTPQSVTSEEKSIKEETPEKSVS  196

Query  1703  -----------DPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
                        DP E +  P  +  Q  + E + L+ E+  L+D V+Q E K+VE+S L 
Sbjct  197   EVQDVTWTDPVDPVEDKLSPEEI--QMFEQENQRLESEMNNLVDEVRQIEGKVVEISRLQ  254

Query  1850  HL  1855
              +
Sbjct  255   EI  256


 Score = 28.9 bits (63),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  256   IFTEKVLQQEAEIDGIHQLVVGATENVKEGNEDIREAIKNN  296



>gb|ADO28217.1| syntaxin-18 [Ictalurus furcatus]
Length=318

 Score = 63.9 bits (154),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 114/236 (48%), Gaps = 37/236 (16%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             ++ + R ++SF+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    LVRRNRPKNSFSSKAKEVISNITKLKDFLLQHRKDYVNAGSLLSSDVTRMTDCERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C + I  L+      EA+ K  I       +A    H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSDAIKQLRT-----EAE-KTVI-------SAQMKEHRGAVLDLIEVYLKGV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPR-------RTGKsstseistssNLDQRQQS  1687
                +   RA+R +  ++     R+ P +K +        T ++ + E S     D     
Sbjct  141   CKLYSEQRAIRVKRVVDKKRLSRLEPEQKIKVEKSQSEDTERTVSEESSEKPTCDSGVDL  200

Query  1688  DSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               ++R  +EL  E I + EQ    E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  201   WEDSRVEDELSPEEIPMFEQ----ENQRLVSEMNSLVDEVRQIEGKVVEISRLQEI  252


 Score = 28.9 bits (63),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1846  EPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             E  LQQ  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  255   EKVLQQETEIDNIHQLVVGATENVKEGNEDIREAIKNN  292



>ref|XP_004669887.1| PREDICTED: syntaxin-18 [Jaculus jaculus]
Length=334

 Score = 64.3 bits (155),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 62/243 (26%), Positives = 106/243 (44%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        + T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGKMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+K+C E I  L+   +              D  +     H+  V+  + + L  V   +
Sbjct  103   FMKTCSEAIHQLRTEAHK-------------DIHSQQVKEHRTAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQ---------------  1684
                RA+R +  ++  R++       T + STS    + N  Q  +               
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKRESTSSEPVAENASQDSEEKPVTEEYPEKPLAE  209

Query  1685  ------SDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                   S  + +  +EL  E I++ EQ    E + L  E++ L D V+Q E K+VE+S L
Sbjct  210   AQPELGSWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMSNLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 28.9 bits (63),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDNIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_004617477.1| PREDICTED: syntaxin-18 [Sorex araneus]
Length=337

 Score = 66.2 bits (160),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/242 (24%), Positives = 103/242 (43%), Gaps = 43/242 (18%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR R  F+  A + +  IG L +FLL+H+KDY++ Y        + T+ ERD I+ +   
Sbjct  43    PRPRGDFSGRAREVISHIGKLRDFLLEHRKDYINAYSHVLSEHGKMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHK-------------ETHSQQVREHRSAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEA---RDPNELRS  1723
                RA+R +  +++    R +P    K+  +  S   +L   +  D +A     P +L +
Sbjct  150   SEQRAIRVKRVVDKKRLSRLEPEPNAKTRENASSEQVSLGPAKDPDEKAVAGEGPEKLPA  209

Query  1724  EPIRVQE------------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
             E +   E                  Q  + E + L  E+  L D V+Q E K+VE+S L 
Sbjct  210   EALPEPELGTWADGRAEDELSPEEIQMFEQENQRLVGEMNSLFDEVRQIEGKVVEISRLQ  269

Query  1850  HL  1855
              +
Sbjct  270   EM  271


 Score = 26.9 bits (58),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT++++ GN+++ +AI+ N
Sbjct  271   MFTEKVLQQEAEIDSIHQLVVGATESIKEGNEDIREAIKNN  311



>ref|XP_001364357.2| PREDICTED: syntaxin-18 isoform X1 [Monodelphis domestica]
Length=411

 Score = 63.5 bits (153),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY+        D+ R T+ ERD I+ +  I
Sbjct  119   PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSDYMRMTDTERDQIDQDAQI  178

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +  E  S+                H+  V+  + + L  V   +
Sbjct  179   FMRTCSEAIQQLRTEAH-KEVHSQ------------QVKEHRSAVLDFIEDYLKRVCKIY  225

Query  1556  DHLRALRFQDAIN-----RVAP----------------RRKPRRTGKsstseistssNLD  1672
                RA+R +  ++     R+ P                +     + + S +E +   NL 
Sbjct  226   SEQRAIRVKRVVDKKRLSRLEPDQSSKSTESSSSERVSQNSSEESEEKSITEENQDKNLK  285

Query  1673  QRQQS---DSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
             + Q +     + R  +EL  E I+V EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  286   ESQSNFGLWGDGRGEDELSPEEIQVFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISR  341

Query  1844  LNHL  1855
             L  +
Sbjct  342   LQEI  345


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  345   IFTEKVLQQETEIDNIHQLVVGATENIKEGNEDIREAIKNN  385



>ref|XP_007191023.1| PREDICTED: syntaxin-18 [Balaenoptera acutorostrata scammoni]
Length=335

 Score = 64.3 bits (155),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 102/242 (42%), Gaps = 45/242 (19%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHK-------------EIHSQQVKEHRSAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPI  1732
                RA+R +  +++    + +P R  K  T E  +S  + Q    DSE R   E   E I
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPERNTK--TRESMSSEKVSQNPSKDSEERPVTEEFPEKI  207

Query  1733  RVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
               +                      Q  + E + L  E+  L D V+Q E K+VE+S L 
Sbjct  208   PAEAQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQ  267

Query  1850  HL  1855
              +
Sbjct  268   EM  269


 Score = 28.5 bits (62),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   MFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_010879094.1| PREDICTED: syntaxin-18 [Esox lucius]
Length=333

 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 112/251 (45%), Gaps = 52/251 (21%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEH  1363
             I  K R ++ F+  A + + +I  L++FLL+H+KDYV        D  R T+ ERD I+ 
Sbjct  34    IFKKSRPKNGFSPKAKEVISNITKLKDFLLQHRKDYVNAGSLISSDLTRMTDNERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +  IF+++C E I  L++  +     ++                H+  V+ ++   L  V
Sbjct  94    DAQIFMRTCSEAIKQLRSEADKQVISTQ-------------IREHRSAVLDLIEMYLKGV  140

Query  1544  SSQFDHLRALRFQDAINR----------------------VAPRRKPRRTGKsstseist  1657
                +   RA+R +  ++R                      V P  + R+  + ++S    
Sbjct  141   CKLYSEQRAIRVKRVVDRKRLSRLEPERHHSHAAEERSPPVEPLSEGRQAKEENSSNNCE  200

Query  1658  ssNLDQRQQS-----DSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTET  1822
                 D ++ S     + + R  +EL  E +++ EQ    E + L  E++ L+D V+Q E 
Sbjct  201   RGVADLQENSMSLWEEGQGRVEDELSPEEMQMFEQ----ENQRLVSEMSSLVDEVRQIEG  256

Query  1823  KMVEMSALNHL  1855
             K+VE+S L  +
Sbjct  257   KVVEISRLQEI  267


 Score = 27.7 bits (60),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V AT+NV+ GN+++ +AI+ N
Sbjct  267   IFAEKVLMQETEIDSIHQLVVGATENVKEGNEDIREAIKNN  307



>ref|XP_005366016.1| PREDICTED: syntaxin-18 [Microtus ochrogaster]
Length=334

 Score = 63.9 bits (154),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/243 (24%), Positives = 105/243 (43%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             FI++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FIRTCSEAIQQLRTEAHK-------------EIHSQQVKEHRTAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV---------------APRRKPRRTGKsstseistssNLDQRQQSD  1690
                RA+R +  +++                 P  K  +     + E   +  L ++  ++
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKRKEPPSEKASQNASQDSEEKPAAEELPEKPLAE  209

Query  1691  SE--------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
             ++         R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   AQPELGTWADGRGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 28.5 bits (62),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDNIHQLVVGATENIKEGNEDIREAIKNN  308



>gb|AAH92152.1| Unknown (protein for IMAGE:6949850), partial [Xenopus laevis]
Length=328

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 113/250 (45%), Gaps = 52/250 (21%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             +L K   R  F+  A + + +IG L++FLL+H+KDY++        +   T+ ERD I+ 
Sbjct  31    LLRKRLPRGEFSGKAREVIINIGKLKDFLLEHRKDYINACSHVVSEYSCMTDTERDQIDQ  90

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVA-HKHGVVLILSEKLHS  1540
             +  IF+++C + I  L+                 G  S++  +  H++ V+  + + L  
Sbjct  91    DAQIFMRTCSDAIQQLRTE--------------AGKESHSLQIKEHRNAVLDFIEDYLKR  136

Query  1541  VSSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQ------RQQSDSE-  1696
             V   +   RA+R +  +++    R +P +  K+ +S    S  L Q      ++ +D E 
Sbjct  137   VCKLYSEQRAIRVKRTVDKKRLSRLEPEKINKTQSSRSEDSVPLKQLDTGAEKKSADDEN  196

Query  1697  -----------------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETK  1825
                               R  +EL  E I++ EQ    E + L  E+  L D V+Q E K
Sbjct  197   IDRTAPERNGTSSLWDDGRSEDELSPEEIQMFEQ----ENQRLVSEMNSLFDEVRQIEGK  252

Query  1826  MVEMSALNHL  1855
             +VE+S L  +
Sbjct  253   VVEISRLQEI  262


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ +++  V AT+N++ GN+++ +AI+ N
Sbjct  262   IFTEKVLQQETDIDNIHELVVGATENIKEGNEDIREAIKNN  302



>ref|XP_006004716.1| PREDICTED: syntaxin-18 isoform X1 [Latimeria chalumnae]
 ref|XP_006004717.1| PREDICTED: syntaxin-18 isoform X2 [Latimeria chalumnae]
 ref|XP_006004718.1| PREDICTED: syntaxin-18 isoform X3 [Latimeria chalumnae]
 ref|XP_006004719.1| PREDICTED: syntaxin-18 isoform X4 [Latimeria chalumnae]
Length=329

 Score = 65.1 bits (157),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/247 (25%), Positives = 110/247 (45%), Gaps = 48/247 (19%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             I+ K R RS F+  A + + +IG L++FLL+H+KDY++        + R T+ ERD I+ 
Sbjct  34    IIKKSRPRSGFSNRAKEVIANIGKLKDFLLEHRKDYINAGSYVMSEYSRMTDTERDQIDQ  93

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             +   F+++C + I  L+   N     S+                H+  ++ +  + L  V
Sbjct  94    DAQTFMRTCSDAIQHLRTEANKQVMSSQ-------------VKEHREAILDLTEDYLKRV  140

Query  1544  SSQFDHLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDP  1708
                +   RA+R +  ++     R+ P +  + +  S +   S +S     ++   E  + 
Sbjct  141   CKLYSEQRAIRVKRVVDKKRLARLEPEQHKKSSPSSLSDVASQNSVEGSEEKGKKEENND  200

Query  1709  N------------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVE  1834
             N                  EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE
Sbjct  201   NTPDMQDSLDLWEDGKVEDELSPEEIQMFEQ----ENQRLVSEMNNLVDEVRQIEGKVVE  256

Query  1835  MSALNHL  1855
             +S L  +
Sbjct  257   ISRLQEI  263


 Score = 27.3 bits (59),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  L Q  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  263   IFAEKVLHQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  303



>ref|XP_004847359.1| PREDICTED: syntaxin-18 [Heterocephalus glaber]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 109/248 (44%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+    + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFTEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDS---  1693
                +   RA+R +  +++         P  K R +  S     + S + +++  S +   
Sbjct  146   CKLYSEQRAIRVKRLVDKKRLSRLEPEPSAKARESASSEEVSETPSEDSEEKPASKAYPE  205

Query  1694  --------------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           ++R  +EL +E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KTVAKVGPELGAVGDSRGEDELSAEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_003985557.1| PREDICTED: syntaxin-18 [Felis catus]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/244 (24%), Positives = 106/244 (43%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +S F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKSDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAH-------------KEIHSQQVKEHRSAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         PR K R +  S       S + +++  ++        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPRTKTRESVSSEKVSRDPSQDSEEKSVTEEYPEKVPA  209

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  210   ESQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  265

Query  1844  LNHL  1855
             L  +
Sbjct  266   LQEI  269


 Score = 28.9 bits (63),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_001154387.1| PREDICTED: syntaxin-18 [Pan troglodytes]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|NP_058626.1| syntaxin-18 [Homo sapiens]
 ref|XP_003816527.1| PREDICTED: syntaxin-18 isoform X2 [Pan paniscus]
 sp|Q9P2W9.1|STX18_HUMAN RecName: Full=Syntaxin-18; AltName: Full=Cell growth-inhibiting 
gene 9 protein [Homo sapiens]
 dbj|BAA95213.1| syntaxin 18 [Homo sapiens]
 gb|AAH14613.1| Syntaxin 18 [Homo sapiens]
 gb|AAP35814.1| syntaxin 18 [Homo sapiens]
 gb|AAX42242.1| syntaxin 18 [synthetic construct]
 gb|EAW82428.1| syntaxin 18, isoform CRA_b [Homo sapiens]
 gb|AIC56509.1| STX18, partial [synthetic construct]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|NP_001016709.1| syntaxin 18 [Xenopus (Silurana) tropicalis]
Length=329

 Score = 62.8 bits (151),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 115/250 (46%), Gaps = 52/250 (21%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             +L + R R  F   A + + +IG L++FLL+H+KDY++        +   T+ ERD I+ 
Sbjct  32    VLRRSRPRGEFGGKAREVITNIGKLKDFLLEHRKDYINACSQVASEYSCMTDTERDQIDQ  91

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVA-HKHGVVLILSEKLHS  1540
             +  IF+++C + I  L+                 G  S++  +  H++ V+  + + L  
Sbjct  92    DAQIFMRTCSDAIQQLRTE--------------AGRESHSLQIKEHRNAVLDFIEDYLKR  137

Query  1541  VSSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseists-----------------sN  1666
             V   +   RA+R +  +++    R +P +  K+ +S+ + S                  N
Sbjct  138   VCKLYSEQRAIRVKRTVDKKRLSRLEPEKINKTQSSQTTDSIPLTHLNAAAEETPAGDEN  197

Query  1667  LDQ---RQQSDS----EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETK  1825
             +D+    Q   S    + R  +EL  E I++ EQ    E + L  E+  L D V+Q E K
Sbjct  198   IDRTASEQNGTSSLWDDGRSEDELSPEEIQMFEQ----ENQRLVSEMNSLFDEVRQIEGK  253

Query  1826  MVEMSALNHL  1855
             +VE+S L  +
Sbjct  254   VVEISRLQEI  263


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ +++  V AT+N++ GN+++ +AI+ N
Sbjct  263   IFTEKVLQQETDIDNIHELVVGATENIKEGNEDIREAIKNN  303



>gb|AAV38937.1| syntaxin 18 [Homo sapiens]
 gb|AAX41442.1| syntaxin 18 [synthetic construct]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_004038425.1| PREDICTED: syntaxin-18 [Gorilla gorilla gorilla]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|AAP36884.1| Homo sapiens syntaxin 18 [synthetic construct]
 gb|AAX29693.1| syntaxin 18 [synthetic construct]
Length=336

 Score = 63.2 bits (152),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|AAS47513.1| growth-inhibiting protein 9 [Homo sapiens]
Length=335

 Score = 63.2 bits (152),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 65/252 (26%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEAR  1702
                +   RA+R +  +++         P  K R +        ++S  + Q    DSE  
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSPSKDSEEN  197

Query  1703  DPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTE  1819
                E R E I  +                      Q  + E + L  E+  L D V+Q E
Sbjct  198   PATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIE  257

Query  1820  TKMVEMSALNHL  1855
              ++VE+S L  +
Sbjct  258   GRVVEISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKDN  309



>ref|XP_006985678.1| PREDICTED: syntaxin-18 isoform X2 [Peromyscus maniculatus bairdii]
Length=334

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 105/243 (43%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTEAHK-------------EIHSQQVKEHRTAVMDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV---------------APRRKPRRTGKsstseistssNLDQRQQSD  1690
                RA+R +  +++                 P  K  +     + E   +  L ++  ++
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKRKEPPSEKASQNASQDSEEKPATEELPEKPLAE  209

Query  1691  SE--------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
             ++         R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   AQPELGTWGDGRGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 29.3 bits (64),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_008565148.1| PREDICTED: syntaxin-18 [Galeopterus variegatus]
Length=335

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 105/248 (42%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S       S + +++  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQDPSKDSEEKPVTEEYPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                             +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   NTLAKARPELGTWGNGKGEDELSPEEIQMFEQ----ENQRLMGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_005300316.1| PREDICTED: syntaxin-18 [Chrysemys picta bellii]
Length=333

 Score = 60.8 bits (146),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 107/244 (44%), Gaps = 51/244 (21%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S F+  A + + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF
Sbjct  42    RPKSDFSCRAREVITNIGKLKDFLLQHRKDYINAYSHLMSEYIRMTDTERDQIDQDAQIF  101

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEK-LHSVSSQF  1555
             +++C + I  L+   +               N  +  V      VL  +E  L  V   +
Sbjct  102   MRTCADAIQQLRTEAH--------------KNVQSPQVREHRAAVLDFTEDYLKRVCKLY  147

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSD-----SEARDPN--  1711
                RA+R +  +++    R +P ++ K+           +  ++S+      E +D N  
Sbjct  148   SEQRAVRVKRMVDKKRLSRLEPEQSNKAQAPSFPEKIVQNSSEESNEKLAYEENKDQNLT  207

Query  1712  ----------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                             EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  208   DAHTNFGLWGDGKGEDELSPEEIQMFEQ----ENKRLVGEMNSLFDEVRQIEGKVVEISR  263

Query  1844  LNHL  1855
             L  +
Sbjct  264   LQEI  267


 Score = 31.2 bits (69),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AIQ+N
Sbjct  267   IFTEKVLQQDTEIDNIHQLVVGATENIKGGNEDIREAIQKN  307



>ref|XP_003496675.1| PREDICTED: syntaxin-18 isoform X1 [Cricetulus griseus]
 ref|XP_007624171.1| PREDICTED: syntaxin-18 isoform X1 [Cricetulus griseus]
 gb|EGV91623.1| Syntaxin-18 [Cricetulus griseus]
 gb|ERE89835.1| syntaxin-18-like protein [Cricetulus griseus]
Length=334

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/243 (24%), Positives = 106/243 (44%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSEYGRMTDAERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTEAHK-------------EIHSQQVKEHRTAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV---------------APRRKPRRTGKsstseistssNLDQRQQSD  1690
                RA+R +  +++                 P  K  +T    + E S +  L ++  ++
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKRKEPPSEKASQTASQDSEEKSAAEELPEKPVAE  209

Query  1691  SE--------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
             ++            +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   AQPELGTWGDGNGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 28.9 bits (63),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_006919057.1| PREDICTED: syntaxin-18 [Pteropus alecto]
Length=335

 Score = 63.5 bits (153),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 104/244 (43%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIVSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   + D    +                H+  VV  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRGQAHKDVPSQQ-------------VKEHRTAVVDFVEDYLKRVCRLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S       S + +++  ++        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRESMSSEKVSQDPSKDSEEKPVTEECPEKIPA  209

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  210   EAQPELGPWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLCDEVRQIEGKVVEISR  265

Query  1844  LNHL  1855
             L  +
Sbjct  266   LQEI  269


 Score = 28.1 bits (61),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEADIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_003800236.1| PREDICTED: syntaxin-18 [Otolemur garnettii]
Length=335

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIVSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S         + +++  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESISSEKVSQGPVKDSEEKPTTEEYPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KNSAEAQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_007451562.1| PREDICTED: syntaxin-18 [Lipotes vexillifer]
Length=335

 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTQAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R++  S     + S + ++R  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRQSMSSEKVSQNPSKDSEERPVTEEFPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KIPAEAQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_008494355.1| PREDICTED: syntaxin-18 isoform X1 [Calypte anna]
Length=359

 Score = 67.0 bits (162),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 49/243 (20%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S FT  A + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF
Sbjct  42    RSKSDFTSRAREVVSHIGKLKDFLLQHRKDYINAYSHTMSEYVRMTDTERDQIDQDAQIF  101

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C + I  L+      EA        KG  S A    H+  V+ ++ + L  V   + 
Sbjct  102   MRTCADAIHQLRT-----EAP-------KGVQS-AQVKEHRTAVLDLIEDYLKRVCKLYS  148

Query  1559  HLRALRFQDAINRV-APRRKPRRT--GKsstseistssN-LDQRQQSDS-----------  1693
               RA+R +  I++    R +P ++   KS  S   ++ N LD  ++  S           
Sbjct  149   EQRAIRLKRVIDKKRLSRLEPEQSNVSKSPLSHEKSAQNPLDDSEEKLSAEESKERNLPD  208

Query  1694  ---------EARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                      + R  +EL  E I++ EQ    E + L  E+  LLD V+Q E K+VE+S L
Sbjct  209   VQSNLGLWGDGRGEDELSPEEIQMFEQ----ENQRLVGEMNNLLDEVRQIEGKVVEISRL  264

Query  1847  NHL  1855
               +
Sbjct  265   QEI  267


 Score = 24.6 bits (52),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAI  1950
             +  E  LQQ   I+ ++   V AT+N++ GN+++ + I
Sbjct  267   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREVI  304



>ref|XP_004269676.1| PREDICTED: syntaxin-18 [Orcinus orca]
Length=335

 Score = 62.4 bits (150),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNS----INDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTQAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R++  S     + S + ++R  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRQSMSSEKVSQNPSKDSEERPVTEEFPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KIPAEAQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|KFM25556.1| Syntaxin-81 [Auxenochlorella protothecoides]
Length=356

 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 9/118 (8%)
 Frame = +2

Query  1229  RSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYRTTEQERDSIEHEVTIFIKSCKEQIDV  1408
             R++FTKAA +    I  L  FL  ++  Y    R +E E D +E E+   +++C   I  
Sbjct  43    RTAFTKAANEIAHDITALRRFLRVNQYAYAQIGRMSEAEGDRLEGEIGSIVRACSANIQR  102

Query  1409  LKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQ  1582
             L + + +         G    +   D  AH+ G VL LSE+L + ++ +D LRALR Q
Sbjct  103   LHSLLEE---------GAPAGDGTPDVAAHRAGAVLALSERLGATTAAYDRLRALRRQ  151



>ref|XP_007100894.1| PREDICTED: syntaxin-18 [Physeter catodon]
Length=335

 Score = 62.0 bits (149),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTQAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     + S + ++R  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESMSSEKVSQNPSKDSEERPVAEEFPG  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KIPAEAQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_010640119.1| PREDICTED: syntaxin-18 [Fukomys damarensis]
 gb|KFO25755.1| Syntaxin-18 [Fukomys damarensis]
Length=335

 Score = 61.6 bits (148),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 105/248 (42%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYR--------TTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L++FLL+H+KDY++ Y          T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIMSEYGGMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseis----------------  1654
                +   RA+R +  + +         P  K R +  S     +                
Sbjct  146   CKLYSEQRAIRVKRVVEKKRLSKLEPEPSAKARESASSEQVSETPSKDSEEKPATKAHPE  205

Query  1655  -tssNLDQRQQSDSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
              T +N+     +  +++  +EL  E I++ EQ    E + L  E+  L D V+Q E K+V
Sbjct  206   KTEANMRPELGASGDSKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_006128254.1| PREDICTED: syntaxin-18 isoform X2 [Pelodiscus sinensis]
Length=333

 Score = 60.8 bits (146),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/243 (25%), Positives = 107/243 (44%), Gaps = 49/243 (20%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +S F+  A + + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF
Sbjct  42    RPKSDFSCRAREVITNIGKLKDFLLQHRKDYINAYSHLMSEYIRMTDTERDQIDQDAQIF  101

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C + I  L+   +            KG  S      H+  V+  + + L  V   + 
Sbjct  102   MRTCADAIQQLRTEAH------------KGIQS-LQVKEHRAAVLDFIEDYLKRVCKLYS  148

Query  1559  HLRALRFQDAINR-----------------VAPRRKPRRTGKsstseistssNLDQRQQS  1687
               RA+R +  +++                   P +  R + + S  + +   N DQ    
Sbjct  149   EQRAIRVKRMVDKKRLSRLEPEQISKAQAPSFPEKTVRNSSEESEEKSAYEENKDQNLTD  208

Query  1688  D-------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                      + +  +EL  E +++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  209   AHTNFGIWGDGKGEDELSPEEVQMFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISRL  264

Query  1847  NHL  1855
               +
Sbjct  265   QEI  267


 Score = 30.0 bits (66),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI++N
Sbjct  267   IFTEKVLQQDTEIDNIHQLVVGATENIKEGNEDIREAIKKN  307



>ref|XP_006163251.1| PREDICTED: syntaxin-18 isoform X1 [Tupaia chinensis]
Length=335

 Score = 62.0 bits (149),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 106/243 (44%), Gaps = 49/243 (20%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTIF  1378
             R +  F+  A + +  IG L++FLL+H+KDY+        D+ R T+ ERD I+ +  IF
Sbjct  44    RPKGDFSNRAREVISHIGKLKDFLLEHRKDYINAYSHIMSDYGRMTDTERDQIDQDAQIF  103

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C E I  L+   +  E  S+                H+  VV  + + L  V   + 
Sbjct  104   MRTCSEAIQQLRTEAH-KEMHSR------------QVREHRAAVVEFIEDYLKRVCKLYS  150

Query  1559  HLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD---------  1690
               RA+R +  +++         P  K R +        + S + +++  ++         
Sbjct  151   EQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSCEKIAQNPSKDSEEKLATEEYPEKNLTE  210

Query  1691  --------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                      + +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  211   AQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  266

Query  1847  NHL  1855
               +
Sbjct  267   QEI  269


 Score = 29.3 bits (64),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|NP_001012151.1| syntaxin-18 [Rattus norvegicus]
 sp|Q68FW4.1|STX18_RAT RecName: Full=Syntaxin-18 [Rattus norvegicus]
 gb|AAH79183.1| Syntaxin 18 [Rattus norvegicus]
 gb|EDM00014.1| syntaxin 18, isoform CRA_b [Rattus norvegicus]
Length=334

 Score = 62.0 bits (149),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 104/243 (43%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++CK+ I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCKDAIQQLRTEAHK-------------EIHSQQVKEHRTAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARD--------  1705
                RA+R +  ++  R++       T +   +   +S N  Q  +    A D        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPHTKRKEPASEKSSHNASQDSEEKPAAEDLPEKPLAE  209

Query  1706  -------------PNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                           +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   SQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 29.3 bits (64),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_005148618.1| PREDICTED: syntaxin-18 [Melopsittacus undulatus]
Length=382

 Score = 62.8 bits (151),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 110/245 (45%), Gaps = 53/245 (22%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R R    +A    +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  +F
Sbjct  91    RDRPGPERAERSYISHIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQVF  150

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFD  1558
             +++C + I  L+   +            KG  S A    H+  V+  + + L  V   + 
Sbjct  151   MRTCADAIHQLRTEAH------------KGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYS  197

Query  1559  HLRALRFQDAIN-----RVAPRRKPRRTGKsstseistssN-LDQRQQ--SDSEARDPN-  1711
               RA+R +  I+     R+ P  +P    KS  S   +S N LD  ++  S  E++D N 
Sbjct  198   EQRAIRVKRVIDKKRLSRLEP--EPSSVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNL  255

Query  1712  -----------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                              EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S
Sbjct  256   PDAQSNFGLWGDGKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEIS  311

Query  1841  ALNHL  1855
              L  +
Sbjct  312   RLQEI  316


 Score = 28.1 bits (61),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  316   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  356



>ref|XP_008967786.1| PREDICTED: syntaxin-18 isoform X1 [Pan paniscus]
Length=342

 Score = 61.6 bits (148),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 105/259 (41%), Gaps = 72/259 (28%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L S+
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKSI  145

Query  1544  SSQFDHL-------RALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQ  1681
             S  F  +       RA+R +  +++         P  K R +        ++S  + Q  
Sbjct  146   SFSFKGVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------TSSEKVSQSP  197

Query  1682  QSDSEARDPNELRSEPIRVQE---------------------QFLDDETRALQVELTGLL  1798
               DSE     E R E I  +                      Q  + E + L  E+  L 
Sbjct  198   SKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLF  257

Query  1799  DAVQQTETKMVEMSALNHL  1855
             D V+Q E ++VE+S L  +
Sbjct  258   DEVRQIEGRVVEISRLQEI  276


 Score = 29.3 bits (64),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  276   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  316



>ref|NP_001247460.1| syntaxin-18 [Macaca mulatta]
 ref|XP_005554521.1| PREDICTED: syntaxin-18 isoform X1 [Macaca fascicularis]
 ref|XP_008016110.1| PREDICTED: syntaxin-18 [Chlorocebus sabaeus]
Length=335

 Score = 61.6 bits (148),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     S S + ++   ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEEHPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++V
Sbjct  206   KILAETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_010355880.1| PREDICTED: syntaxin-18 [Rhinopithecus roxellana]
Length=335

 Score = 61.2 bits (147),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     S S + ++   ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEEHPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++V
Sbjct  206   KILAETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|NP_001124885.1| syntaxin-18 [Pongo abelii]
 sp|Q5REB4.1|STX18_PONAB RecName: Full=Syntaxin-18 [Pongo abelii]
 emb|CAH89893.1| hypothetical protein [Pongo abelii]
Length=335

 Score = 61.2 bits (147),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     S S + ++   ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSRSPSKDSEENPATEERPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++V
Sbjct  206   KILAETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|NP_081235.2| syntaxin-18 isoform 1 [Mus musculus]
 sp|Q8VDS8.2|STX18_MOUSE RecName: Full=Syntaxin-18 [Mus musculus]
 dbj|BAE41033.1| unnamed protein product [Mus musculus]
 dbj|BAE41611.1| unnamed protein product [Mus musculus]
 gb|EDL37538.1| syntaxin 18, isoform CRA_c [Mus musculus]
Length=334

 Score = 61.2 bits (147),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/243 (24%), Positives = 102/243 (42%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV--------DFYRTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y+        D+ R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSDYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             FI++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FIRTCSEAIHQLRTEAHK-------------EIHSQQVKEHRTAVLDFVDDYLKRVCKLY  149

Query  1556  DHLRALRFQDAIN--RVAPRRKPRRTGKsstseistssNLDQRQQSDSEA----------  1699
                RA+R +  ++  R++       T +  ++      N  Q  +    A          
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPHTKRKDSTSEKAPQNASQDSEGKPAAEELPEKPLAE  209

Query  1700  -----------RDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
                        +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   SQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 29.3 bits (64),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_005408888.1| PREDICTED: syntaxin-18 [Chinchilla lanigera]
Length=335

 Score = 61.6 bits (148),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/247 (24%), Positives = 109/247 (44%), Gaps = 57/247 (23%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFYR--------TTEQERDSIEHEVTIF  1378
             R +  F+  A + +  IG L++FLL+H+KDY++ Y          T+ ERD I+ +  IF
Sbjct  44    RPKGDFSSRAREVISHIGKLKDFLLEHRKDYINAYSHIMSEYGTMTDTERDQIDQDAQIF  103

Query  1379  IKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVS  1546
             +++C E I  L+      I+  + K                  H+  V+  + + L  V 
Sbjct  104   MRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFVEDYLKRVC  146

Query  1547  SQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD-----  1690
               +   RA+R +  +++         PR K R +  S     + S +L+++  ++     
Sbjct  147   KLYSEQRAIRVKRVVDKKRLSKLEPEPRPKARESASSEKVSETPSKDLEEKPVTEEYPEK  206

Query  1691  ------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVE  1834
                         ++++  + L  E I++ EQ    E + L  E+  L D V+Q E K+VE
Sbjct  207   TVAKAQPELGALADSKGEDALSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVE  262

Query  1835  MSALNHL  1855
             +S L  +
Sbjct  263   ISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|ERE89834.1| syntaxin-18-like protein [Cricetulus griseus]
Length=341

 Score = 61.2 bits (147),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 110/238 (46%), Gaps = 31/238 (13%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSEYGRMTDAERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKS--KGWIGFKGDNSNADTVAHKHGVVLILSE-KL  1534
             F+++C E I  L+      I+  + K      + F  D   + + + K GV  + SE + 
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFVEDYLKSISFSSK-GVCKLYSEQRA  161

Query  1535  HSVSSQFDHLRALRFQDAIN---RVAPRRKPRRTGKsstseistssNLDQRQQSDSE---  1696
               V    D  R  + +   N   +  P  K  +T    + E S +  L ++  ++++   
Sbjct  162   IRVKRVVDKKRLSKLEPEPNTKRKEPPSEKASQTASQDSEEKSAAEELPEKPVAEAQPEL  221

Query  1697  -----ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                      +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  222   GTWGDGNGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRLQEI  275


 Score = 29.3 bits (64),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  275   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  315



>ref|XP_009272051.1| PREDICTED: syntaxin-18 [Aptenodytes forsteri]
Length=337

 Score = 62.0 bits (149),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 110/242 (45%), Gaps = 49/242 (20%)
 Frame = +2

Query  1226  QRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFI  1381
             Q  S   A  + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+
Sbjct  47    QSVSLLFAVAEEISHIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFM  106

Query  1382  KSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDH  1561
             ++C + I  L+                KG  S A    H+  V+  + + L  V   +  
Sbjct  107   RTCADAIHQLRTE------------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSE  153

Query  1562  LRALRFQDAINRV-APRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN----  1711
              RA+R +  I++    R +P ++   KS  S   +S N LD  ++  S  E+RD N    
Sbjct  154   QRAIRVKRVIDKKRLSRLEPEQSNVSKSPLSAEKSSQNPLDDSEEKLSAEESRDRNLPDA  213

Query  1712  --------------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
                           EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L 
Sbjct  214   QSNLGLWGDGKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQ  269

Query  1850  HL  1855
              +
Sbjct  270   EI  271


 Score = 28.1 bits (61),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  271   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  311



>ref|XP_004010040.1| PREDICTED: syntaxin-18 [Ovis aries]
 ref|XP_005681952.1| PREDICTED: syntaxin-18 [Capra hircus]
Length=335

 Score = 61.2 bits (147),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 102/242 (42%), Gaps = 45/242 (19%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHK-------------EIHSQQVKEHRTAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPI  1732
                RA+R +  +++    + +P    K  T E  +S  + Q    DSE +   E   E +
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNAK--TRESMSSEKVSQSPSKDSEEKPIPEEYPEKV  207

Query  1733  RVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
              V+                      Q  + E + L  E+  L D V+Q E K+VE+S L 
Sbjct  208   PVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQ  267

Query  1850  HL  1855
              +
Sbjct  268   EI  269


 Score = 28.9 bits (63),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_004383596.1| PREDICTED: syntaxin-18 [Trichechus manatus latirostris]
Length=335

 Score = 61.6 bits (148),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR R  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPRGDFSGRAREVVSHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRAEAHKEIHSQQVKE-----------------HRSAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S T   + S   +++  ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESISSETVSQNPSKESEEKPVTEEYPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           ++R   EL  E I+  EQ    E + L  ++  L D V+Q E K+V
Sbjct  206   KILPDTQPELGTWGDSRGEEELSPEEIQTFEQ----ENQRLIGQMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_006277471.1| PREDICTED: syntaxin-18 isoform X2 [Alligator mississippiensis]
Length=288

 Score = 60.8 bits (146),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 107/233 (46%), Gaps = 49/233 (21%)
 Frame = +2

Query  1253  LKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDV  1408
             L  + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C E I  
Sbjct  7     LNHITNIGKLKDFLLQHRKDYINAYSHVMSEYVRMTDTERDQIDQDAQIFMRTCAEAIQQ  66

Query  1409  LKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDA  1588
             L+     D    +                H+  V+ ++ + L  V   +   RA+R +  
Sbjct  67    LRTEALKDVLPPQ-------------VKEHRAAVLDLVEDYLKRVCKLYSEQRAIRVKRV  113

Query  1589  INRV-APRRKPRRTGKssts---eistssNLDQRQQSDS--------------------E  1696
             +++    R +P ++ KS  +   E  + ++LD+ ++  +                    +
Sbjct  114   VDKKRLSRLEPEKSNKSEAAFSPENVSKNSLDKSEEKPTSEENKEKNLTDAQTNFGLWGD  173

Query  1697  ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  174   GRGEDELSPEEIQMFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISRLQEI  222


 Score = 29.3 bits (64),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  222   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  262



>ref|XP_003898515.1| PREDICTED: syntaxin-18 isoform X1 [Papio anubis]
Length=335

 Score = 60.8 bits (146),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 106/248 (43%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSCRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     S S + ++   ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEEHPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++V
Sbjct  206   KILAETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_006043889.1| PREDICTED: syntaxin-18 isoform X1 [Bubalus bubalis]
Length=335

 Score = 60.8 bits (146),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 101/248 (41%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKDDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVVSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +            KG +S      H+  ++    + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAH------------KGIHSQ-QVKEHRTAILDFTEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE  1714
                RA+R +  +++         P  K R +         +S  + Q    DSE +   E
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------MSSEKVSQNPSKDSEEKPAPE  201

Query  1715  LRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMV  1831
                E + V+                      Q  + E + L  E+  L D V+Q E K+V
Sbjct  202   EYPEKVPVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E++ L  +
Sbjct  262   EITRLQEI  269


 Score = 28.9 bits (63),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_004770602.1| PREDICTED: syntaxin-18 [Mustela putorius furo]
 ref|XP_004801602.1| PREDICTED: syntaxin-18 [Mustela putorius furo]
Length=335

 Score = 60.8 bits (146),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 103/244 (42%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHK-------------EIYSQQVKEHRSAVLDFVEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S       S   +++  ++        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKARESTSSEKGSQHPSQESEEKPATEEYPEKVPA  209

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       E +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  210   ESQPELGTWGEGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  265

Query  1844  LNHL  1855
             L  +
Sbjct  266   LQEI  269


 Score = 28.9 bits (63),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_008683976.1| PREDICTED: syntaxin-18 isoform X1 [Ursus maritimus]
Length=335

 Score = 60.5 bits (145),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 107/245 (44%), Gaps = 51/245 (21%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSYAMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVL-ILSEKLHSVSSQ  1552
             F+++C E I  L+   + +               ++  V    GVVL  + + L  V   
Sbjct  103   FMRTCSEAIQQLRTQAHKE--------------IHSQQVKEHRGVVLDFIEDYLKRVFKL  148

Query  1553  FDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD-------  1690
             +   RA+R +  +++         P  K R +  S     + S + +++  ++       
Sbjct  149   YSEQRAIRVKRVVDKKRLSKLEPEPSTKTRESTSSEKVSRNPSEDSEEKPVTEEHPEKVP  208

Query  1691  ----------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                        + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S
Sbjct  209   AESQPELGTWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEIS  264

Query  1841  ALNHL  1855
              L  +
Sbjct  265   RLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_009684593.1| PREDICTED: syntaxin-18 [Struthio camelus australis]
Length=312

 Score = 61.6 bits (148),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/239 (25%), Positives = 103/239 (43%), Gaps = 53/239 (22%)
 Frame = +2

Query  1241  TKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKE  1396
             ++  L  + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C +
Sbjct  27    SECCLTMISNIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCAD  86

Query  1397  QIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALR  1576
              I  L+   +              D  +A    H+  V+  + + L  V   +   RA+R
Sbjct  87    AIHQLRTEAH-------------KDVQSAQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIR  133

Query  1577  FQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSE-------------------  1696
              +  I++    R +P ++    +    +   L Q    DSE                   
Sbjct  134   VKRVIDKKRLSRLEPEQSN--VSKSPLSPEKLSQNSLDDSEEKLSAEESNDRNLPDAHAN  191

Query  1697  ------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                    +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  192   LGSWGDGKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  246


 Score = 28.1 bits (61),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  246   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  286



>ref|XP_004432324.1| PREDICTED: syntaxin-18 [Ceratotherium simum simum]
Length=335

 Score = 60.8 bits (146),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 101/242 (42%), Gaps = 45/242 (19%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        + T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGKMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  VV  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHK-------------EIHSQQVKEHRSAVVDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQRQQSDSEARDPNELRSEPI  1732
                RA+R +  +++    + +P  + K  T E   S  + Q    DSE +   E   E I
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPSTK--TKESMLSEKVSQNPSKDSEEKPVTEEYPETI  207

Query  1733  RVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMVEMSALN  1849
               +                      Q  + E + L  E+  L D V+Q E K+VE+S L 
Sbjct  208   PAEAQPELRTWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEISRLQ  267

Query  1850  HL  1855
              +
Sbjct  268   EI  269


 Score = 28.9 bits (63),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|KFZ67080.1| Syntaxin-18, partial [Podiceps cristatus]
Length=279

 Score = 61.2 bits (147),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 106/227 (47%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L+EFLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKEFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRTGKss---tseistssNLDQRQQ--SDSEARDPN------------------E  1714
              R +P ++  S    + E S+ ++LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNGSKSPLSPEKSSQNSLDDSEEKLSAEESKDKNLPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_001917859.2| PREDICTED: LOW QUALITY PROTEIN: syntaxin-18 [Equus caballus]
Length=334

 Score = 60.5 bits (145),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 104/253 (41%), Gaps = 57/253 (23%)
 Frame = +2

Query  1205  FILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIE  1360
             F L  PR +  F+  A + +  IG L +FLL+H+KDY++ Y        + T+ ERD I+
Sbjct  37    FRLRSPRPKDDFSIRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGKMTDTERDQID  96

Query  1361  HEVTIFIKSCKEQIDVLK----NSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSE  1528
              +   F+++C E I  L+      I+  + K                  H+  V+  + +
Sbjct  97    QDAQTFMRTCSEAIQQLRAQAHKEIHSQQVKE-----------------HRSAVLDFIED  139

Query  1529  KLHSVSSQFDHLRALRFQDAIN-----RVAPR---------------RKPRRTGKsstse  1648
              L  V   +   RA+R +  ++     ++ P                + P +  +     
Sbjct  140   YLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTKESMFSEKVSQNPSKDSEEKPIT  199

Query  1649  istssNLDQRQQSD----SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQT  1816
                   +    Q +     + R  +EL  E I++ EQ    E + L  E+  L D V+Q 
Sbjct  200   EEYPEKIPAEAQPELGSWGDGRGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQI  255

Query  1817  ETKMVEMSALNHL  1855
             E K+VE+S L  +
Sbjct  256   EGKVVEISRLQEI  268


 Score = 28.9 bits (63),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>ref|XP_010226306.1| PREDICTED: syntaxin-18, partial [Tinamus guttatus]
 gb|KGL74149.1| Syntaxin-18, partial [Tinamus guttatus]
Length=281

 Score = 60.5 bits (145),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 107/232 (46%), Gaps = 51/232 (22%)
 Frame = +2

Query  1262  LESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+ 
Sbjct  1     ISNIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDAERDQIDQDAQIFMRTCADAIHQLRT  60

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
                            KG  S A    H+  V+  + + L  V   +   RA+R +  I++
Sbjct  61    E------------AHKGVQS-AQVKEHRTAVLDFVEDYLKRVCKLYSEQRAIRVKRVIDK  107

Query  1598  V-APRRKPRRTGKsst-----seistssNLDQRQQ--SDSEARDPN--------------  1711
                 R +P ++ KSS+          SS+LD  ++  S  E +D N              
Sbjct  108   KRLSRLEPEQSNKSSSPLSPEKLSQNSSSLDDPEEKLSAEETKDRNLPDAHSNLGLWGDG  167

Query  1712  ----ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                 EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  168   KGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  215


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  215   IFTEKVLQQETEIDNIHQLVVGATENIKEGNEDIREAIKNN  255



>ref|XP_010187713.1| PREDICTED: syntaxin-18, partial [Mesitornis unicolor]
 gb|KFQ27741.1| Syntaxin-18, partial [Mesitornis unicolor]
Length=279

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 104/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHITSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR---  1597
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1598  --------------VAPRRKPRRTGKsstseistssNLDQR---QQSD----SEARDPNE  1714
                           ++P + P+ +   S  ++S   + D+     QS+     + +  +E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSPQNSLDDSEEKLSAEESKDRNVPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>gb|EHH25743.1| Cell growth-inhibiting gene 9 protein [Macaca mulatta]
Length=335

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 104/241 (43%), Gaps = 49/241 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTEAHK-------------EIHSQQVKEHRTAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S     S S + ++   ++        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEEHPEKILA  209

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  210   ETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  265

Query  1844  L  1846
             L
Sbjct  266   L  266


 Score = 28.1 bits (61),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1846  EPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  272   EKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|KFM03808.1| Syntaxin-18, partial [Aptenodytes forsteri]
Length=279

 Score = 60.5 bits (145),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E+RD N                  E
Sbjct  111   SRLEPEQSNVSKSPLSAEKSSQNPLDDSEEKLSAEESRDRNLPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_007529279.1| PREDICTED: syntaxin-18 [Erinaceus europaeus]
Length=348

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 104/254 (41%), Gaps = 59/254 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYV------------------DFYRTTEQE  1345
             PR RS F+  A +    IG L +FLL+H+KDY+                  +F + T+ E
Sbjct  46    PRPRSDFSGRAREVTAHIGKLRDFLLEHRKDYIGVGVGIGIGMDACSHMTSEFGKMTDAE  105

Query  1346  RDSIEHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILS  1525
             RD I+ +   F+K+C E I  L+   +              +  +     H+  V+  + 
Sbjct  106   RDQIDQDAQTFMKTCSEAIQQLRAQAHK-------------ETHSQQVKEHRSAVLDFVE  152

Query  1526  EKLHSVSSQFDHLRALRFQDAINRV-----------------APRRKPRRTGKsstseis  1654
             + L SV   +   RA+R +  +++                  +P   P    K S     
Sbjct  153   DYLKSVCKLYSEQRAIRVKRVVDKKRLSRLQPEPSARTRESRSPENVPPPPAKDSEETPI  212

Query  1655  tssNLDQRQQSD-------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQ  1813
                  ++   +D        E+R  +EL  E I++ EQ    E + L  E++ L + V+Q
Sbjct  213   LEEQPEKAAAADQPELGRWGESRGEDELSPEEIQMFEQ----ENQRLIGEMSSLFEEVRQ  268

Query  1814  TETKMVEMSALNHL  1855
              E K+VE+S L  +
Sbjct  269   IEGKVVEISRLQEI  282


 Score = 28.1 bits (61),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  282   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  322



>ref|XP_007665754.1| PREDICTED: syntaxin-18 [Ornithorhynchus anatinus]
Length=385

 Score = 58.9 bits (141),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 98/230 (43%), Gaps = 56/230 (24%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKN---  1417
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  111   IGKLKDFLLEHRKDYINAYSHRMSEYMRMTDTERDQIDQDAQIFMRTCADAIQQLRTEAH  170

Query  1418  -SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN  1594
               I+  + K                  H+  V+  + + L  V   +   RA+R +  ++
Sbjct  171   KEIHSQQVKD-----------------HRTAVLGFVEDYLKRVCQLYSEQRAIRVKRVVD  213

Query  1595  -----RVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPN----------------  1711
                  R+ P +  +    SS       S   + + +  E RD N                
Sbjct  214   KKRLSRLEPEKSTKTEFASSEKSSQDPSEESEEKSATEENRDKNLTDPRSNFGLWGDGRS  273

Query  1712  --ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
               EL  E I+V EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  274   EDELSPEEIQVFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISRLQEI  319


 Score = 30.0 bits (66),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  +QQ  +I+ L+   V AT+N++ GN+++ +AI+ N
Sbjct  319   IFTEKVMQQETEIDTLHQLVVGATENIKEGNEDIREAIKNN  359



>ref|XP_003224195.1| PREDICTED: syntaxin-18 [Anolis carolinensis]
Length=338

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/250 (25%), Positives = 116/250 (46%), Gaps = 48/250 (19%)
 Frame = +2

Query  1199  ASFILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDS  1354
             A  +L + R RS F+  A + + +IG L++FLL+H+KDY++        F R T+ ERD 
Sbjct  40    ALLLLKRSRPRSDFSSRAREVVNNIGKLKDFLLQHRKDYINTYSHAMSEFVRMTDTERDQ  99

Query  1355  IEHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKL  1534
             I+ +   F+++C + I  L+   +              D  +     H+  V+  + + L
Sbjct  100   IDQDAQTFMRTCADAIQQLRTEAH-------------KDIHSPQVKQHREAVLDFIGDYL  146

Query  1535  HSVSSQFDHLRALRFQDAIN-----RVAPRRKPR-RTGKsstseistssNLDQRQQSD--  1690
               V   +   RA+R +  ++     R+ P +  + +T  S T+  ++S  L+++   +  
Sbjct  147   KRVCKLYSEQRAIRVKRVVDKKRLSRLEPEQSNKSKTSSSETTVQTSSDELEEKSVCEIS  206

Query  1691  ---------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETK  1825
                             +++  +EL  E I++ EQ    E + L  E+  L D V+Q E K
Sbjct  207   KDKNVIDEHANFGLWGDSKGEDELSPEEIQMFEQ----ENQRLVGEMNSLFDEVRQIEGK  262

Query  1826  MVEMSALNHL  1855
             +VE+S L  +
Sbjct  263   VVEISRLQEI  272



>gb|KFQ67893.1| Syntaxin-18, partial [Phaethon lepturus]
Length=279

 Score = 60.1 bits (144),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 104/233 (45%), Gaps = 61/233 (26%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGVQS-AQVKDHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPR-----RKPRRTGKsstseistssNLDQRQQ--SDSEARDPN-------------  1711
              R+ P      + P   GK      S+ ++LD  ++  S  E++D N             
Sbjct  111   SRLEPEQSNVSKSPFSPGK------SSQNSLDDSEEKLSAEESKDRNLPDAQSNLGLWGD  164

Query  1712  -----ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                  EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  165   GKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_010288612.1| PREDICTED: syntaxin-18 [Phaethon lepturus]
Length=395

 Score = 60.1 bits (144),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 105/233 (45%), Gaps = 61/233 (26%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+   +
Sbjct  120   IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTEAH  179

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  180   ------------KGVQS-AQVKDHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  226

Query  1595  -RVAPR-----RKPRRTGKsstseistssNLDQRQQ--SDSEARDPN-------------  1711
              R+ P      + P   GK      S+ ++LD  ++  S  E++D N             
Sbjct  227   SRLEPEQSNVSKSPFSPGK------SSQNSLDDSEEKLSAEESKDRNLPDAQSNLGLWGD  280

Query  1712  -----ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                  EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  281   GKGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  329


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  329   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  369



>ref|XP_010072337.1| PREDICTED: syntaxin-18, partial [Pterocles gutturalis]
 gb|KFV07369.1| Syntaxin-18, partial [Pterocles gutturalis]
Length=279

 Score = 60.1 bits (144),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L+EFLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKEFLLQHRKDYINAYNHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPRRK--------PRRTGKsstseistssNLDQRQ-------QSD----SEARDPNE  1714
              R+ P +         P ++ ++ + +     + ++ +       QS+     +++  +E
Sbjct  111   SRLEPEQSNVSKSPLFPEKSSQNPSDDSEEKLSAEESKDRNLPDAQSNLGLWGDSKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.1 bits (61),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_002923338.1| PREDICTED: syntaxin-18-like, partial [Ailuropoda melanoleuca]
 gb|EFB17458.1| hypothetical protein PANDA_012461 [Ailuropoda melanoleuca]
Length=306

 Score = 59.3 bits (142),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/245 (24%), Positives = 106/245 (43%), Gaps = 51/245 (21%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  14    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSYVMSEYGRMTDTERDQIDQDAQT  73

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVL-ILSEKLHSVSSQ  1552
             F+++C E I  L+   + +               ++  V     VVL  + + L  V   
Sbjct  74    FMRTCSEAIQQLRTQAHKE--------------IHSQQVKEHRSVVLDFIEDYLKRVCKL  119

Query  1553  FDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD-------  1690
             +   RA+R +  +++         P  K R +  S     + S + +++  ++       
Sbjct  120   YSEQRAIRVKRVVDKKRLSKLEPEPSTKTRESTSSEKVSQNPSQDSEEKPVTEEHPEKVP  179

Query  1691  ----------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                        + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S
Sbjct  180   AESQPELGTWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEIS  235

Query  1841  ALNHL  1855
              L  +
Sbjct  236   RLQEI  240


 Score = 29.3 bits (64),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  240   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  280



>ref|XP_005893263.1| PREDICTED: syntaxin-18 [Bos mutus]
 gb|ELR58191.1| Syntaxin-18 [Bos mutus]
Length=335

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/246 (24%), Positives = 99/246 (40%), Gaps = 53/246 (22%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKDDFSSRAREVISHIGKLRDFLLEHRKNYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+                KG +S      H+  V+    + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQ------------AHKGIHSQ-QVKEHRTAVLDFTEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE-------  1714
                RA+R +  ++      K R +         T  ++   + S S ++DP E       
Sbjct  150   SEQRAIRVKRVVD------KKRLSKLEPEPNTKTRESMSSEKVSQSPSKDPEEKPVPEEY  203

Query  1715  LRSEPIRVQE-------------------QFLDDETRALQVELTGLLDAVQQTETKMVEM  1837
                 P+  Q                    Q  + E + L  E+  L D V+Q E K+VE+
Sbjct  204   PEKVPVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEI  263

Query  1838  SALNHL  1855
             + L  +
Sbjct  264   TRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_004415941.1| PREDICTED: syntaxin-18 [Odobenus rosmarus divergens]
Length=335

 Score = 59.3 bits (142),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/244 (23%), Positives = 105/244 (43%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   + +    +                H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQAHKEMPSQQ-------------VKEHRSVVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S     + S + +++  ++        
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRESMSSEKVSQNPSQDSEEKPVTEEHPEKVPA  209

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  210   ESQPELGTWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  265

Query  1844  LNHL  1855
             L  +
Sbjct  266   LQEI  269


 Score = 29.3 bits (64),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_851021.1| PREDICTED: syntaxin-18 isoformX1 [Canis lupus familiaris]
Length=336

 Score = 59.3 bits (142),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/244 (23%), Positives = 104/244 (43%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  44    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQT  103

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  104   FMRTCSEAIQQLRTQAHK-------------EIHSQQVKEHRSAVLDFIEDYLKRVCKLY  150

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S     + S   +++  ++        
Sbjct  151   SEQRAIRVKRVVDKKRLSKLEPEPHTKTRESTSSEKVSQTPSQESEEKPVTEECPEKIPA  210

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  211   ESQPELGTWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  266

Query  1844  LNHL  1855
             L  +
Sbjct  267   LQEI  270


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  270   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  310



>ref|XP_010846094.1| PREDICTED: syntaxin-18, partial [Bison bison bison]
Length=334

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/246 (24%), Positives = 99/246 (40%), Gaps = 53/246 (22%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKDDFSSRAREVISHIGKLRDFLLEHRKNYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+                KG +S      H+  V+    + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQ------------AHKGIHSQ-QVKEHRTAVLDFTEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINRVAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE-------  1714
                RA+R +  ++      K R +         T  ++   + S S ++DP E       
Sbjct  150   SEQRAIRVKRVVD------KKRLSKLEPEPNTKTRESMSSEKVSQSPSKDPEEKPVPEEY  203

Query  1715  LRSEPIRVQE-------------------QFLDDETRALQVELTGLLDAVQQTETKMVEM  1837
                 P+  Q                    Q  + E + L  E+  L D V+Q E K+VE+
Sbjct  204   PEKVPVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVVEI  263

Query  1838  SALNHL  1855
             + L  +
Sbjct  264   TRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|KFU93737.1| Syntaxin-18, partial [Chaetura pelagica]
Length=279

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I+ L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAINQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPRR--------KPRRTGKsstseistssNLDQ---RQQSDSEA--------RDPNE  1714
              R+ P +         P ++ ++   +     + ++   R   D+++        +D +E
Sbjct  111   SRLEPEQSTVSKSPLSPEKSSQNPLDDSDEKLSAEESKDRNLHDTQSNLGLWGNGKDEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLIGEMNNLSDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_007510663.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18196.1| predicted protein [Bathycoccus prasinos]
Length=361

 Score = 53.1 bits (126),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 90/196 (46%), Gaps = 25/196 (13%)
 Frame = +2

Query  1337  EQERDSIEHEVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFK---GDNSNADTVAHKHG  1507
             EQ RDSIE E+   ++  +  ++  +  I + E K       +   G       VAH HG
Sbjct  102   EQIRDSIEREIVECVREMQNHVNRCEEIIKNGETKMMREESLRRSFGQKKRQQFVAHLHG  161

Query  1508  VVLILSEKLHSVSSQFDHLRALRFQDAINRVAPRRKPRRTG----------------Kss  1639
             + LI SEK+  V+   D +RA RF++   + A R + RR G                K  
Sbjct  162   IALITSEKIEEVAKTLDWMRARRFREQAEK-AKRLERRRGGDARVGVEAVAKDLMMVKKQ  220

Query  1640  tseistssNLDQRQQSDSEARDPNELRSE----PIRVQEQFLDDETRALQVELTGLLDAV  1807
             T+  +    ++    S  +  D +   SE      + +++F++D + AL  EL  +    
Sbjct  221   TAMPARRRTIENSNGSGDDVGDGSTRSSERRQNQQQQRQEFVND-SDALVAELVEVSRGT  279

Query  1808  QQTETKMVEMSALNHL  1855
             Q+ E+K+VE+SAL+ +
Sbjct  280   QRAESKIVELSALSSM  295


 Score = 35.0 bits (79),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1858  QQAQQIEYLYDQAVEATKNVELGNKELTKAIQR  1956
             +Q+QQIE +Y +A++ TK +++GN E+ K I R
Sbjct  302   KQSQQIEKIYTEALKTTKFLDVGNVEMRKTISR  334



>ref|XP_010001439.1| PREDICTED: syntaxin-18 [Chaetura pelagica]
Length=291

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I+ L+    
Sbjct  16    IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAINQLRTE--  73

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  74    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  122

Query  1595  -RVAPRR--------KPRRTGKsstseistssNLDQ---RQQSDSEA--------RDPNE  1714
              R+ P +         P ++ ++   +     + ++   R   D+++        +D +E
Sbjct  123   SRLEPEQSTVSKSPLSPEKSSQNPLDDSDEKLSAEESKDRNLHDTQSNLGLWGNGKDEDE  182

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  183   LSPEEIQMFEQ----ENQRLIGEMNNLSDEVRQIEGKVVEISRLQEI  225


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  225   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  265



>ref|XP_004715136.1| PREDICTED: syntaxin-18 [Echinops telfairi]
Length=336

 Score = 59.7 bits (143),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/245 (25%), Positives = 105/245 (43%), Gaps = 52/245 (21%)
 Frame = +2

Query  1223  RQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIF  1378
             R +  F+  A + +  IG L +FLL+H+KDY++ +        R T+ ERD I+ +  +F
Sbjct  44    RPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAHSHAMTECGRMTDAERDQIDQDAQLF  103

Query  1379  IKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVL-ILSEKLHSVSSQF  1555
             +++C E I  L+      EA            +++  V    GVVL  + + L  V   +
Sbjct  104   MRTCAEAIQQLRT-----EALRA---------ASSPQVKEHRGVVLDFIQDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  KPR            S + +++   +        
Sbjct  150   SEQRAVRVKRLVDKKRLSKLEPEPSTKPREPLSPEAVSQDPSRDSEEKPAPEDAPVEKHS  209

Query  1691  ----------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMS  1840
                        E R  +EL  E I++ EQ    E + L  E+  L + V+Q E K+VE+S
Sbjct  210   PDARPELGNWGEGRGEDELSPEEIQMFEQ----ENQRLVGEMNSLFEEVRQIEGKVVEIS  265

Query  1841  ALNHL  1855
              L  +
Sbjct  266   RLQEI  270


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  270   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  310



>ref|XP_009559831.1| PREDICTED: syntaxin-18, partial [Cuculus canorus]
 gb|KFO76632.1| Syntaxin-18, partial [Cuculus canorus]
Length=279

 Score = 59.3 bits (142),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 103/227 (45%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHVMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPRRK--------PRRTGKsstseistssNLDQRQQSD-----------SEARDPNE  1714
              R+ P +         P ++ ++   +     + ++ + ++            +++  +E
Sbjct  111   SRLEPEQSNMSKSPLPPEKSSQNPLEDSEEKLSAEESKDTNLPDAQSNLGLWGDSKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETEIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_005068888.1| PREDICTED: syntaxin-18 isoform X1 [Mesocricetus auratus]
Length=334

 Score = 58.9 bits (141),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 108/243 (44%), Gaps = 48/243 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +  I
Sbjct  43    PRPKGDFSSRAREVISHIGKLRDFLLEHRKEYINAYSHTMSEYGRMTDAERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  103   FMRTCSEAIQQLRTEAHK-------------EIHSQQVKEHRTAVLDFIEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAIN-----RVAP-----RRKP-----RRTGKsstseistssNLDQRQQSD  1690
                RA+R +  ++     ++ P     R++P      +     + E   +  L ++  ++
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKRKEPLSEKASQAASQDSEEKPAAEELPEKPLAE  209

Query  1691  SE--------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSAL  1846
             ++            +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L
Sbjct  210   AQPELGTWGDGSGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRL  265

Query  1847  NHL  1855
               +
Sbjct  266   QEI  268


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  268   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  308



>gb|EHH53557.1| Cell growth-inhibiting gene 9 protein [Macaca fascicularis]
Length=335

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 105/248 (42%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             P  +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +  I
Sbjct  43    PWPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI  102

Query  1376  FIKSCKEQIDVLKN----SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSV  1543
             F+++C E I  L+      I+  + K                  H+  V+  + + L  V
Sbjct  103   FMRTCSEAIQQLRTEAHKEIHSQQVKE-----------------HRTAVLDFIEDYLKRV  145

Query  1544  SSQFDHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD----  1690
                +   RA+R +  +++         P  K R +  S     S S + ++   ++    
Sbjct  146   CKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEEHPE  205

Query  1691  -------------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMV  1831
                           + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++V
Sbjct  206   KILAETQPELGTWGDGKGEDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVV  261

Query  1832  EMSALNHL  1855
             E+S L  +
Sbjct  262   EISRLQEI  269


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_006016840.1| PREDICTED: syntaxin-18 [Alligator sinensis]
Length=288

 Score = 58.5 bits (140),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/233 (25%), Positives = 107/233 (46%), Gaps = 49/233 (21%)
 Frame = +2

Query  1253  LKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDV  1408
             L  + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C E I  
Sbjct  7     LNHITNIGKLKDFLLQHRKDYINAYSHVMSEYVRMTDTERDQIDQDAQIFMRTCAEAIQQ  66

Query  1409  LKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDA  1588
             L+     +    +                H+  V+ ++ + L  V   +   RA+R +  
Sbjct  67    LRTEALKEVLPPQ-------------VKEHRAAVLDLVEDYLKRVCKLYSEQRAIRVKRV  113

Query  1589  INRV-APRRKPRRTGKssts---eistssNLDQRQQSDS--------------------E  1696
             +++    R +P ++ KS  +   E  + ++LD+ ++  +                    +
Sbjct  114   VDKKRLSRLEPEKSNKSEAAFSPENVSKNSLDKSEEKPTSEENKEKNLTDAQTNFGLWGD  173

Query  1697  ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
              R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  174   GRGEDELSPEEIQMFEQ----ENQRLVGEMNSLFDEVRQIEGKVVEISRLQEI  222


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  222   IFTEKVLQQETEIDSIHQLVVGATENIKEGNEDIREAIKNN  262



>ref|XP_005618639.1| PREDICTED: syntaxin-18 isoform X2 [Canis lupus familiaris]
Length=332

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/244 (23%), Positives = 104/244 (43%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+KDY++ Y        R T+ ERD I+ +   
Sbjct  44    PRPKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHIMSEYGRMTDTERDQIDQDAQT  103

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+   +              +  +     H+  V+  + + L  V   +
Sbjct  104   FMRTCSEAIQQLRTQAHK-------------EIHSQQVKEHRSAVLDFIEDYLKRVCKLY  150

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSD--------  1690
                RA+R +  +++         P  K R +  S     + S   +++  ++        
Sbjct  151   SEQRAIRVKRVVDKKRLSKLEPEPHTKTRESTSSEKVSQTPSQESEEKPVTEECPEKIPA  210

Query  1691  ---------SEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
                       + +  +EL  E I++ EQ    E + L  E+  L D V+Q E ++VE+S 
Sbjct  211   ESQPELGTWGDGKGDDELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGRVVEISR  266

Query  1844  LNHL  1855
             L  +
Sbjct  267   LQEI  270


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  270   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  310



>gb|KFP56174.1| Syntaxin-18, partial [Cathartes aura]
Length=279

 Score = 59.3 bits (142),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYARMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDKNLPDAQSNLGLLGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|NP_001093189.1| syntaxin-18 [Bos taurus]
 gb|AAI42215.1| STX18 protein [Bos taurus]
Length=335

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 100/248 (40%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKDDFSSRAREVISHIGKLRDFLLEHRKNYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+                KG +S      H+  V+    + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQ------------AHKGIHSQ-QVKEHRTAVLDFTEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE  1714
                RA+R +  +++         P  K R +         +S  + Q    DSE +   E
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------MSSEKVSQSPSKDSEEKPVPE  201

Query  1715  LRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMV  1831
                E + V+                      Q  + E + L  E+  L D V+Q E K+V
Sbjct  202   ENPEKVPVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E++ L  +
Sbjct  262   EITRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>gb|KFV19956.1| Syntaxin-18, partial [Tauraco erythrolophus]
Length=279

 Score = 59.3 bits (142),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 104/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRAE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGIQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPRRK--------PRRTGKsstseistssNLDQRQQSD-----------SEARDPNE  1714
              ++ P +         P ++ ++++ +     + ++ +  D            +++  +E
Sbjct  111   SKLEPEQNNVSKSPLPPEKSSQNASDDSEEKLSAEESEDKDLPDAQSNLGLWGDSKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_010115937.1| PREDICTED: syntaxin-18, partial [Chlamydotis macqueenii]
 gb|KFP40612.1| Syntaxin-18, partial [Chlamydotis macqueenii]
Length=279

 Score = 59.3 bits (142),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 106/227 (47%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P +T   KSS S   +S N LD  ++  S  E+++ N                  E
Sbjct  111   SRLEPEQTNVSKSSLSPEKSSQNPLDDSEEKLSAEESKEKNLPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_005243157.1| PREDICTED: syntaxin-18 [Falco peregrinus]
Length=348

 Score = 58.9 bits (141),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/227 (27%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  +F+++C + I  L+   +
Sbjct  73    IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQVFMRTCADAIHQLRTEAH  132

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  133   ------------KGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  179

Query  1604  PRRKPRRTGKsstseistssNLD-----QRQQSDSEARDPN------------------E  1714
              R +P ++  S++      S+L+     + + S  E++D N                  E
Sbjct  180   SRLEPEQSNVSTSPLFPEKSSLNPFDDSEEKLSAEESKDRNLPDAQSNVGLWGDGKGEDE  239

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  240   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  282


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  282   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  322



>gb|KFW70498.1| Syntaxin-18, partial [Pygoscelis adeliae]
Length=279

 Score = 59.3 bits (142),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 101/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1595  -RVAPRR-----------KPRRTGKsstseistssNLDQRQQSDSE--------ARDPNE  1714
              R+ P +           KP +     + E  ++     R   D++        ++  +E
Sbjct  111   SRLEPEQSNVSKSPLSAEKPSQNPLDDSEEKLSAEESSDRNLPDAQSNLGLWGDSKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_008919201.1| PREDICTED: syntaxin-18 [Manacus vitellinus]
Length=394

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 109/235 (46%), Gaps = 49/235 (21%)
 Frame = +2

Query  1247  AALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQI  1402
              + + +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  +F+++C + I
Sbjct  111   GSFELISHIGKLKDFLLQHRKDYINAYSHVMSEYGRMTDTERDQIDQDAQVFMRTCADAI  170

Query  1403  DVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQ  1582
               L+   +      +G +       +A    H+  V+  + + L  V   +   RA+R +
Sbjct  171   HQLRTEAH------RGVL-------SAQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVK  217

Query  1583  DAINRV-APRRKPRRTGKsstseistssNLD-----QRQQSDSEARDPN-----------  1711
               I++    R +P +T  S +   +  S+L+     + + S  E++D N           
Sbjct  218   RVIDKKRLSRLEPEQTNVSKSPLSTEKSSLNPLDDSEEKLSAEESKDRNLPDAQSNLGLW  277

Query  1712  -------ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                    EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  278   GDGKGEDELTPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  328


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  328   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  368



>ref|XP_009488135.1| PREDICTED: syntaxin-18, partial [Pelecanus crispus]
 gb|KFQ65180.1| Syntaxin-18, partial [Pelecanus crispus]
Length=279

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNLPDAQSNLGVWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>gb|KFP13188.1| Syntaxin-18, partial [Egretta garzetta]
Length=279

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNLPDAQSNLGLWGDSKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_009878842.1| PREDICTED: syntaxin-18, partial [Charadrius vociferus]
 gb|KGL89604.1| Syntaxin-18, partial [Charadrius vociferus]
Length=279

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNLPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_006766637.1| PREDICTED: syntaxin-18 [Myotis davidii]
Length=294

 Score = 58.2 bits (139),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 98/228 (43%), Gaps = 51/228 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L +FLL+H+KDY++        + R T+ ERD I+ +   F+++C E I  L+N  +
Sbjct  19    IGKLRDFLLEHRKDYINAHSHILSEYGRMTDAERDQIDQDAQTFMRTCSEAIQQLRNQAH  78

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN--RV  1600
                           +  +     H+  ++    + L  V   +   RA+R +  ++  R+
Sbjct  79    K-------------ETHSQQVREHRSAILDFTQDYLRRVCKLYSEQRAIRVKRVVDKKRL  125

Query  1601  APRRKPRRTGKsstseistssNLDQRQQ-----------------------SDSEARDPN  1711
             A + +P  T K+     S   +LD  Q                        S  + +  +
Sbjct  126   A-KLEPEATAKTREPRSSEEVSLDPSQDPGEKPVAEEHSEKIPAEAQPELGSWGDGKGED  184

Query  1712  ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  185   ELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRLQEI  228


 Score = 29.3 bits (64),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  228   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  268



>tpg|DAA28458.1| TPA: syntaxin 18 [Bos taurus]
Length=335

 Score = 58.5 bits (140),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/248 (24%), Positives = 100/248 (40%), Gaps = 57/248 (23%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTI  1375
             PR +  F+  A + +  IG L +FLL+H+K+Y++ Y        R T+ ERD I+ +   
Sbjct  43    PRPKDDFSSRAREVISHIGKLRDFLLEHRKNYINAYSHVMSEYGRMTDTERDQIDQDAQT  102

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C E I  L+                KG +S      H+  V+    + L  V   +
Sbjct  103   FMRTCSEAIQQLRTQ------------AHKGIHSQ-QVKEHRTAVLDFTEDYLKRVCKLY  149

Query  1556  DHLRALRFQDAINR-------VAPRRKPRRTGKsstseistssNLDQRQQSDSEARDPNE  1714
                RA+R +  +++         P  K R +         +S  + Q    DSE +   E
Sbjct  150   SEQRAIRVKRVVDKKRLSKLEPEPNTKTRES--------MSSEKVSQSPSKDSEEKPVPE  201

Query  1715  LRSEPIRVQE---------------------QFLDDETRALQVELTGLLDAVQQTETKMV  1831
                E + V+                      Q  + E + L  E+  L D V+Q E K+V
Sbjct  202   EYPEKVPVEAQPELGSWGDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGKVV  261

Query  1832  EMSALNHL  1855
             E++ L  +
Sbjct  262   EITRLQEI  269


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  269   IFTEKVLQQEAEIDNIHQLVVGATENIKEGNEDIREAIKNN  309



>ref|XP_009327170.1| PREDICTED: syntaxin-18 [Pygoscelis adeliae]
Length=291

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 101/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  16    IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  73

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  74    ----------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  122

Query  1595  -RVAPRR-----------KPRRTGKsstseistssNLDQRQQSDSE--------ARDPNE  1714
              R+ P +           KP +     + E  ++     R   D++        ++  +E
Sbjct  123   SRLEPEQSNVSKSPLSAEKPSQNPLDDSEEKLSAEESSDRNLPDAQSNLGLWGDSKGEDE  182

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  183   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  225


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  225   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  265



>gb|KFW09559.1| Syntaxin-18, partial [Eurypyga helias]
Length=279

 Score = 58.9 bits (141),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  4     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  61

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V   + + L  V   +   RA+R +  I++   
Sbjct  62    ----------AHKGIQS-AQVKEHRTAVTDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  110

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  111   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNVPDAQSNLGLWGDGKGEDE  170

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L+ +
Sbjct  171   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLHEI  213


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_010154600.1| PREDICTED: syntaxin-18, partial [Eurypyga helias]
Length=277

 Score = 58.5 bits (140),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+    
Sbjct  2     IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRTE--  59

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINRV-A  1603
                         KG  S A    H+  V   + + L  V   +   RA+R +  I++   
Sbjct  60    ----------AHKGIQS-AQVKEHRTAVTDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  108

Query  1604  PRRKPRRT--GKsstseistssN-LDQRQQ--SDSEARDPN------------------E  1714
              R +P ++   KS  S   +S N LD  ++  S  E++D N                  E
Sbjct  109   SRLEPEQSNVSKSPLSPEKSSQNPLDDSEEKLSAEESKDRNVPDAQSNLGLWGDGKGEDE  168

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L+ +
Sbjct  169   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLHEI  211


 Score = 28.5 bits (62),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  211   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  251



>ref|XP_005866202.1| PREDICTED: syntaxin-18 isoform X2 [Myotis brandtii]
Length=294

 Score = 58.2 bits (139),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 99/228 (43%), Gaps = 51/228 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L +FLL+H+KDY++        + R T+ ERD I+ +   F+++C E I  L+N  +
Sbjct  19    IGKLRDFLLEHRKDYINAHSHILSEYGRMTDAERDQIDQDAQTFMRTCSEAIQQLRNQAH  78

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN--RV  1600
                           +  +     H+  ++    + L  V   +   RA+R +  ++  R+
Sbjct  79    K-------------ETHSQQVREHRSAILDFTQDYLRRVCKLYSEQRAIRVKRVVDKKRL  125

Query  1601  APRRKPRRTGKsstseistssNLDQRQQSD-----------------------SEARDPN  1711
             A + +P  T ++     S   +LD  Q S                         +++  +
Sbjct  126   A-KLEPEATARTREPGSSEEVSLDPSQDSGEKPVAEEHAEKIPAEAQPELGSWGDSKGED  184

Query  1712  ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  185   ELSPEEIQMFEQ----ENQRLIGEMNSLFDEVRQIEGKVVEISRLQEI  228


 Score = 28.9 bits (63),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ  +I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  228   IFTEKVLQQEAEIDSIHQLVVGATENIKEGNEDIREAIKNN  268



>gb|KFV87074.1| Syntaxin-18, partial [Struthio camelus australis]
Length=279

 Score = 58.5 bits (140),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 100/232 (43%), Gaps = 53/232 (23%)
 Frame = +2

Query  1262  LESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKN  1417
             + +IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+ 
Sbjct  1     ISNIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRT  60

Query  1418  SINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAINR  1597
               +              D  +A    H+  V+  + + L  V   +   RA+R +  I++
Sbjct  61    EAH-------------KDVQSAQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDK  107

Query  1598  V-APRRKPRRTGKsstseistssNLDQRQQSDSE-------------------------A  1699
                 R +P ++    +    +   L Q    DSE                          
Sbjct  108   KRLSRLEPEQSN--VSKSPLSPEKLSQNSLDDSEEKLSAEESNDRNLPDAHANLGSWGDG  165

Query  1700  RDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             +  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  166   KGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  213


 Score = 28.5 bits (62),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  213   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  253



>ref|XP_005517901.1| PREDICTED: syntaxin-18 [Pseudopodoces humilis]
Length=334

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 109/244 (45%), Gaps = 49/244 (20%)
 Frame = +2

Query  1220  PRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEHEVTI  1375
              R +S FT  A + +  IG L++FLL+H+KDY++        F R T+ ERD I+ +  +
Sbjct  42    ARSKSDFTSRAREVISHIGKLKDFLLQHRKDYINAYSHIMSEFVRMTDTERDQIDQDAQV  101

Query  1376  FIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQF  1555
             F+++C + I  L+                KG  S A    H+  V+  + + L  V   +
Sbjct  102   FMRTCADAIHQLRTE------------AHKGVQS-AQVKEHRTAVLDFIEDYLKRVCKLY  148

Query  1556  DHLRALRFQDAIN-----RVAPR-----RKPRRTGK-----------sstseistssNLD  1672
                RA+R +  I+     ++ P      + P  T K             ++E S   NL 
Sbjct  149   SEQRAIRVKQVIDKKRLSKLEPEQSNVSKAPLSTEKFSQSPLEDSEEKLSAEESKDRNLP  208

Query  1673  QRQQS---DSEARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSA  1843
               Q +     + R  +EL  E I++ EQ    E + L  E+  L D V+Q E K+VE+S 
Sbjct  209   DAQSNLGLWGDGRGEDELSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISR  264

Query  1844  LNHL  1855
             L  +
Sbjct  265   LQEI  268



>ref|XP_009987899.1| PREDICTED: syntaxin-18, partial [Tauraco erythrolophus]
Length=464

 Score = 58.5 bits (140),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 105/227 (46%), Gaps = 49/227 (22%)
 Frame = +2

Query  1271  IGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDVLKNSIN  1426
             IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  L+   +
Sbjct  189   IGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQLRAEAH  248

Query  1427  DDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDAIN----  1594
                         KG  S A    H+  V+  + + L  V   +   RA+R +  I+    
Sbjct  249   ------------KGIQS-AQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVIDKKRL  295

Query  1595  -RVAPRRK--------PRRTGKsstseistssNLDQRQQSD-----------SEARDPNE  1714
              ++ P +         P ++ ++++ +     + ++ +  D            +++  +E
Sbjct  296   SKLEPEQNNVSKSPLPPEKSSQNASDDSEEKLSAEESEDKDLPDAQSNLGLWGDSKGEDE  355

Query  1715  LRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
             L  E I++ EQ    E + L  E+  L D V+Q E K+VE+S L  +
Sbjct  356   LSPEEIQMFEQ----ENQRLVGEMNNLFDEVRQIEGKVVEISRLQEI  398


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  398   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  438



>ref|XP_009934667.1| PREDICTED: syntaxin-18 [Opisthocomus hoazin]
Length=282

 Score = 58.5 bits (140),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 110/233 (47%), Gaps = 49/233 (21%)
 Frame = +2

Query  1253  LKTLESIGVLEEFLLKHKKDYVDFY--------RTTEQERDSIEHEVTIFIKSCKEQIDV  1408
             ++ +  IG L++FLL+H+KDY++ Y        R T+ ERD I+ +  IF+++C + I  
Sbjct  1     MQKISHIGKLKDFLLQHRKDYINAYSHIMSEYVRMTDTERDQIDQDAQIFMRTCADAIHQ  60

Query  1409  LKNSINDDEAKSKGWIGFKGDNSNADTVAHKHGVVLILSEKLHSVSSQFDHLRALRFQDA  1588
             L+      EA S    G +    +A    H+  V+  + + L  V   +   RA+R +  
Sbjct  61    LRT-----EAHS----GVQ----SAQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRV  107

Query  1589  INRV-APRRKPRRTGKsstseistssN---LDQRQQ--SDSEARDPN-------------  1711
             I++    R +P ++  S +      ++   LD  ++  S  E++D N             
Sbjct  108   IDKKRLSRLEPEQSNVSKSPLSPEKASQTPLDDSEEKLSAEESKDRNLPDAQSNLGLWGD  167

Query  1712  -----ELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETKMVEMSALNHL  1855
                  EL  E I++ EQ    E + L  E+  L+D V+Q E K+VE+S L  +
Sbjct  168   GKGEDELSPEEIQMFEQ----ENQRLVGEMNNLVDEVRQIEGKVVEISRLQEI  216


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAIQRN  1959
             +  E  LQQ   I+ ++   V AT+N++ GN+++ +AI+ N
Sbjct  216   IFTEKVLQQETDIDNIHQLVVGATENIKEGNEDIREAIKNN  256



>gb|AAI06216.1| MGC130640 protein [Xenopus laevis]
Length=372

 Score = 62.4 bits (150),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 113/250 (45%), Gaps = 52/250 (21%)
 Frame = +2

Query  1208  ILHKPRQRSSFTKAALKTLESIGVLEEFLLKHKKDYVD--------FYRTTEQERDSIEH  1363
             +L K   R  F+  A + + +IG L++FLL+H+KDY++        +   T+ ERD I+ 
Sbjct  32    LLRKRLPRGEFSGKAREVIINIGKLKDFLLEHRKDYINACSHVVSEYSCMTDTERDQIDQ  91

Query  1364  EVTIFIKSCKEQIDVLKNSINDDEAKSKGWIGFKGDNSNADTVA-HKHGVVLILSEKLHS  1540
             +  IF+++C + I  L+                 G  S++  +  H++ V+  + + L  
Sbjct  92    DAQIFMRTCSDAIQQLRTE--------------AGKESHSLQIKEHRNAVLDFIEDYLKR  137

Query  1541  VSSQFDHLRALRFQDAINRV-APRRKPRRTGKsstseistssNLDQ------RQQSDSE-  1696
             V   +   RA+R +  +++    R +P +  K+ +S    S  L Q      ++ +D E 
Sbjct  138   VCKLYSEQRAIRVKRTVDKKRLSRLEPEKINKTQSSRSEDSVPLKQLDTGAEKKSADDEN  197

Query  1697  -----------------ARDPNELRSEPIRVQEQFLDDETRALQVELTGLLDAVQQTETK  1825
                               R  +EL  E I++ EQ    E + L  E+  L D V+Q E K
Sbjct  198   IDRTAPERNGTSSLWDDGRSEDELSPEEIQMFEQ----ENQRLVSEMNSLFDEVRQIEGK  253

Query  1826  MVEMSALNHL  1855
             +VE+S L  +
Sbjct  254   VVEISRLQEI  263


 Score = 24.3 bits (51),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 11/38 (29%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  1837  VCIEPSLQQAQQIEYLYDQAVEATKNVELGNKELTKAI  1950
             +  E  LQQ   I+ +++  V AT+N++ GN+++ + +
Sbjct  263   IFTEKVLQQETDIDNIHELVVGATENIKEGNEDIRELV  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6784602512988