BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24830_g2_i9 len=803 path=[6263:0-211 19775:212-231 6495:232-271
1776:272-295 6558:296-329 1834:330-353 6615:354-533 195:534-572
17665:573-802]

Length=803
                                                                      Score     E

ref|XP_009770487.1|  PREDICTED: uncharacterized protein LOC104221184  82.0    1e-15   
ref|XP_009614603.1|  PREDICTED: uncharacterized protein LOC104107...  81.6    1e-15   
ref|XP_009614596.1|  PREDICTED: uncharacterized protein LOC104107...  82.0    1e-15   
ref|XP_004242361.1|  PREDICTED: uncharacterized protein LOC101261243  80.5    5e-15   
ref|XP_006352740.1|  PREDICTED: uncharacterized protein LOC102585732  79.7    6e-15   
emb|CDP03743.1|  unnamed protein product                              79.0    1e-14   
ref|XP_011083025.1|  PREDICTED: uncharacterized protein LOC105165646  77.8    4e-14   
gb|ACU19025.1|  unknown                                               76.6    8e-14   Glycine max [soybeans]
ref|XP_003521291.1|  PREDICTED: uncharacterized protein LOC100776685  76.6    8e-14   
gb|KDO60494.1|  hypothetical protein CISIN_1g042786mg                 75.5    1e-13   
ref|XP_006443838.1|  hypothetical protein CICLE_v10024115mg           75.9    1e-13   
ref|XP_006479541.1|  PREDICTED: uncharacterized protein LOC102615729  75.9    2e-13   
gb|KEH23927.1|  pollen Ole e I family allergen                        75.9    2e-13   
ref|XP_004289942.1|  PREDICTED: uncharacterized protein LOC101311235  75.1    3e-13   
ref|XP_007162546.1|  hypothetical protein PHAVU_001G161200g           74.3    4e-13   
ref|XP_009369482.1|  PREDICTED: uncharacterized protein LOC103958885  73.9    7e-13   
ref|XP_007199047.1|  hypothetical protein PRUPE_ppa018256mg           73.6    1e-12   
ref|XP_008235679.1|  PREDICTED: uncharacterized protein LOC103334480  73.2    1e-12   
ref|XP_002524607.1|  conserved hypothetical protein                   73.2    1e-12   Ricinus communis
ref|XP_008382864.1|  PREDICTED: uncharacterized protein LOC103445628  73.2    1e-12   
ref|XP_004493777.1|  PREDICTED: protodermal factor 1-like             72.8    2e-12   
ref|XP_009354948.1|  PREDICTED: uncharacterized protein LOC103946053  72.4    2e-12   
ref|XP_008372091.1|  PREDICTED: uncharacterized protein LOC103435469  70.9    7e-12   
ref|XP_002300776.2|  hypothetical protein POPTR_0002s03930g           70.1    1e-11   Populus trichocarpa [western balsam poplar]
gb|EYU17919.1|  hypothetical protein MIMGU_mgv1a016687mg              68.2    4e-11   
ref|XP_011028805.1|  PREDICTED: uncharacterized protein LOC105128717  68.6    5e-11   
gb|KDP26531.1|  hypothetical protein JCGZ_17689                       68.6    6e-11   
ref|XP_002278457.1|  PREDICTED: uncharacterized protein LOC100263547  64.3    1e-10   Vitis vinifera
ref|XP_010679301.1|  PREDICTED: uncharacterized protein LOC104894707  66.6    3e-10   
ref|XP_002307644.1|  hypothetical protein POPTR_0005s24600g           65.1    9e-10   Populus trichocarpa [western balsam poplar]
gb|KHG04833.1|  Uroporphyrinogen decarboxylase                        65.1    9e-10   
ref|XP_011004061.1|  PREDICTED: uncharacterized protein LOC105110658  64.7    1e-09   
ref|XP_011025980.1|  PREDICTED: uncharacterized protein LOC105126722  64.7    1e-09   
ref|XP_006857282.1|  hypothetical protein AMTR_s00067p00030870        64.7    1e-09   
ref|XP_010262324.1|  PREDICTED: uncharacterized protein LOC104600876  63.5    4e-09   
ref|XP_004148954.1|  PREDICTED: uncharacterized protein LOC101220310  63.2    5e-09   
ref|XP_010920481.1|  PREDICTED: uncharacterized protein LOC105044325  62.8    7e-09   
ref|XP_007050297.1|  Uncharacterized protein TCM_004033               61.6    2e-08   
ref|XP_008451248.1|  PREDICTED: uncharacterized protein LOC103492595  62.0    2e-08   
ref|XP_010540895.1|  PREDICTED: uncharacterized protein LOC104814517  62.0    2e-08   
ref|XP_008791598.1|  PREDICTED: uncharacterized protein LOC103708447  60.1    6e-08   
ref|XP_009413726.1|  PREDICTED: uncharacterized protein LOC103994975  56.6    1e-06   
ref|XP_006408976.1|  hypothetical protein EUTSA_v10002113mg           55.8    2e-06   
emb|CDY36764.1|  BnaA03g11220D                                        55.5    3e-06   
ref|XP_009132352.1|  PREDICTED: uncharacterized protein LOC103856964  56.2    3e-06   
emb|CDY11979.1|  BnaC03g14050D                                        55.1    3e-06   
gb|KFK40425.1|  hypothetical protein AALP_AA3G372100                  55.1    4e-06   
ref|XP_010467805.1|  PREDICTED: uncharacterized protein LOC104747808  54.3    6e-06   
ref|XP_010415612.1|  PREDICTED: uncharacterized protein LOC104701593  54.3    7e-06   
ref|XP_006298730.1|  hypothetical protein CARUB_v10014827mg           54.3    8e-06   
ref|XP_004976229.1|  PREDICTED: uncharacterized protein LOC101786121  54.7    9e-06   
ref|XP_002886285.1|  hypothetical protein ARALYDRAFT_480880           53.9    9e-06   
gb|AAM64424.1|  unknown                                               53.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565474.1|  uncharacterized protein                             53.9    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489026.1|  PREDICTED: uncharacterized protein LOC104766776  53.1    2e-05   
ref|XP_002446788.1|  hypothetical protein SORBIDRAFT_06g022650        53.1    3e-05   Sorghum bicolor [broomcorn]
tpg|DAA36981.1|  TPA: hypothetical protein ZEAMMB73_327282            52.0    3e-05   
ref|XP_006653600.1|  PREDICTED: uncharacterized protein LOC102709642  52.4    3e-05   
gb|ACG32677.1|  hypothetical protein                                  52.4    5e-05   Zea mays [maize]
ref|NP_001132608.1|  hypothetical protein precursor                   52.4    5e-05   Zea mays [maize]
dbj|BAJ87228.1|  predicted protein                                    52.0    7e-05   
gb|EMT14391.1|  hypothetical protein F775_15820                       51.6    8e-05   
ref|NP_001053317.1|  Os04g0517000                                     51.2    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037977.1|  PREDICTED: uncharacterized protein LOC104426571  50.1    1e-04   
gb|EMS55115.1|  hypothetical protein TRIUR3_30226                     51.2    2e-04   
emb|CAH67221.1|  OSIGBa0145M07.3                                      50.4    2e-04   Oryza sativa [red rice]



>ref|XP_009770487.1| PREDICTED: uncharacterized protein LOC104221184 [Nicotiana sylvestris]
Length=157

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WP+MV +MSTV   FGSR YERYR DLTLLEAA  NDD   +FA LVK+ST 
Sbjct  51   YWSSRRESWPKMVPQMSTVSKVFGSRAYERYRYDLTLLEAAGRNDDRDNIFAKLVKQSTA  110

Query  786  AL  791
            AL
Sbjct  111  AL  112



>ref|XP_009614603.1| PREDICTED: uncharacterized protein LOC104107478 isoform X2 [Nicotiana 
tomentosiformis]
Length=143

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WP+MV +MSTV   FGSR YERYR DLTLLEAA  NDD   +FA LVK+ST 
Sbjct  37   YWSSRRESWPKMVPQMSTVSKVFGSRAYERYRYDLTLLEAAGRNDDRDNIFARLVKQSTA  96

Query  786  AL  791
            AL
Sbjct  97   AL  98



>ref|XP_009614596.1| PREDICTED: uncharacterized protein LOC104107478 isoform X1 [Nicotiana 
tomentosiformis]
Length=165

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WP+MV +MSTV   FGSR YERYR DLTLLEAA  NDD   +FA LVK+ST 
Sbjct  59   YWSSRRESWPKMVPQMSTVSKVFGSRAYERYRYDLTLLEAAGRNDDRDNIFARLVKQSTA  118

Query  786  AL  791
            AL
Sbjct  119  AL  120



>ref|XP_004242361.1| PREDICTED: uncharacterized protein LOC101261243 [Solanum lycopersicum]
Length=167

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WP+MV + STV   FGSR YERYR DLTLLEAA  NDD   VFA LVK+ST 
Sbjct  61   YWSSRRESWPKMVPQTSTVSKIFGSRAYERYRYDLTLLEAAGRNDDGDNVFARLVKQSTA  120

Query  786  AL  791
            AL
Sbjct  121  AL  122



>ref|XP_006352740.1| PREDICTED: uncharacterized protein LOC102585732 [Solanum tuberosum]
Length=152

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WP+MV + STV   FGSR YERYR DLTLLEAA  NDD   VFA LVK+ST 
Sbjct  46   YWSSRRESWPKMVPQTSTVSKIFGSRAYERYRYDLTLLEAAGRNDDGDNVFARLVKQSTA  105

Query  786  AL  791
            AL
Sbjct  106  AL  107



>emb|CDP03743.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 49/67 (73%), Gaps = 6/67 (9%)
 Frame = +3

Query  609  KTHSPYWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDDV---FASLV  770
            K    YWSSR E+WP+MV +MSTV   FGSR +ER+R DLTLLEAA  +DD+   FA LV
Sbjct  52   KCTPQYWSSRAESWPKMVPQMSTVSNVFGSRAFERFRYDLTLLEAASRSDDLGNAFAGLV  111

Query  771  KESTTAL  791
            KEST AL
Sbjct  112  KESTAAL  118



>ref|XP_011083025.1| PREDICTED: uncharacterized protein LOC105165646 [Sesamum indicum]
Length=156

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 7/69 (10%)
 Frame = +3

Query  606  RKTHSP-YWSSRMEAWPRMV---SEMSTVFGSRVYERYR*DLTLLEAALMND---DVFAS  764
            R T +P YWSSR E WP+MV   S +S VFGS+V+ERYR DLTLLEAA  ND   D FA 
Sbjct  43   RGTCTPQYWSSRRELWPKMVPHKSTVSNVFGSQVFERYREDLTLLEAAARNDDGKDAFAR  102

Query  765  LVKESTTAL  791
            LVK+ST AL
Sbjct  103  LVKQSTAAL  111



>gb|ACU19025.1| unknown [Glycine max]
Length=153

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND---DVFASLVKESTT  785
            +WS R EAWPRMV E STV   FGSRVYERYR DLTLLEA   ND   + F  LVKE T 
Sbjct  47   FWSGRREAWPRMVPETSTVSNVFGSRVYERYRSDLTLLEATARNDEESNPFGGLVKEGTA  106

Query  786  AL  791
            AL
Sbjct  107  AL  108



>ref|XP_003521291.1| PREDICTED: uncharacterized protein LOC100776685 [Glycine max]
 gb|KHN10741.1| hypothetical protein glysoja_019172 [Glycine soja]
Length=153

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND---DVFASLVKESTT  785
            +WS R EAWPRMV E STV   FGSRVYERYR DLTLLEA   ND   + F  LVKE T 
Sbjct  47   FWSGRREAWPRMVPETSTVSNVFGSRVYERYRSDLTLLEATARNDEESNPFGGLVKEGTA  106

Query  786  AL  791
            AL
Sbjct  107  AL  108



>gb|KDO60494.1| hypothetical protein CISIN_1g042786mg, partial [Citrus sinensis]
Length=113

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E WPRMV + ST   VFGSRVYER+R DLTLLE+   NDD   FA LVK+ T A
Sbjct  51   FWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTRNDDENAFAGLVKQGTAA  110

Query  789  L  791
            L
Sbjct  111  L  111



>ref|XP_006443838.1| hypothetical protein CICLE_v10024115mg [Citrus clementina]
 gb|ESR57078.1| hypothetical protein CICLE_v10024115mg [Citrus clementina]
Length=157

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E WPRMV + ST   VFGSRVYER+R DLTLLE+   NDD   FA LVK+ T A
Sbjct  52   FWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTRNDDENAFAGLVKQGTAA  111

Query  789  L  791
            L
Sbjct  112  L  112



>ref|XP_006479541.1| PREDICTED: uncharacterized protein LOC102615729 [Citrus sinensis]
Length=156

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E WPRMV + ST   VFGSRVYER+R DLTLLE+   NDD   FA LVK+ T A
Sbjct  51   FWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTRNDDENAFAGLVKQGTAA  110

Query  789  L  791
            L
Sbjct  111  L  111



>gb|KEH23927.1| pollen Ole e I family allergen [Medicago truncatula]
Length=151

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 48/70 (69%), Gaps = 7/70 (10%)
 Frame = +3

Query  603  QRKTHSP-YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDDV---FA  761
             R T +P +WS R E WPRMV E STV   FG RVY+RYR DLTLLEA   ND+V   F 
Sbjct  37   NRGTCTPQFWSGRKETWPRMVPETSTVSNVFGWRVYKRYRSDLTLLEATTRNDEVDNPFG  96

Query  762  SLVKESTTAL  791
            +L+KE TTAL
Sbjct  97   ALLKEGTTAL  106



>ref|XP_004289942.1| PREDICTED: uncharacterized protein LOC101311235 [Fragaria vesca 
subsp. vesca]
Length=147

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            YW SR+E+WPRMV + STV   FGSR YERYR DLTL+EA   NDD  VF  L+KE++ A
Sbjct  40   YWGSRVESWPRMVPQTSTVSKVFGSRAYERYRSDLTLMEATARNDDENVFPRLLKEASAA  99

Query  789  L  791
            L
Sbjct  100  L  100



>ref|XP_007162546.1| hypothetical protein PHAVU_001G161200g [Phaseolus vulgaris]
 gb|ESW34540.1| hypothetical protein PHAVU_001G161200g [Phaseolus vulgaris]
Length=149

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND---DVFASLVKESTT  785
            +WS R E WPRMV E STV   FGSRVYERYR DLTL+EA   ND   + F  LVKE T 
Sbjct  43   FWSGRREEWPRMVPETSTVSNVFGSRVYERYRSDLTLVEATARNDEESNAFGGLVKEGTA  102

Query  786  AL  791
            AL
Sbjct  103  AL  104



>ref|XP_009369482.1| PREDICTED: uncharacterized protein LOC103958885 [Pyrus x bretschneideri]
Length=153

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            YW SR EAWP+MV + STV   FGSR YERYR DLTLLEA  MND  +V+  L+K+++ A
Sbjct  48   YWGSRREAWPKMVPQTSTVSKVFGSRAYERYRSDLTLLEATAMNDEENVYPRLLKQASAA  107

Query  789  L  791
            L
Sbjct  108  L  108



>ref|XP_007199047.1| hypothetical protein PRUPE_ppa018256mg [Prunus persica]
 gb|EMJ00246.1| hypothetical protein PRUPE_ppa018256mg [Prunus persica]
Length=151

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            YW SR EAWPRMV + STV   FGSR YERYR DLTLLEA + ND  +V+  L+K+++ A
Sbjct  46   YWGSRREAWPRMVPQTSTVSKVFGSRAYERYRSDLTLLEATVRNDEENVYPRLLKQASAA  105

Query  789  L  791
            L
Sbjct  106  L  106



>ref|XP_008235679.1| PREDICTED: uncharacterized protein LOC103334480 [Prunus mume]
Length=156

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            YW SR EAWPRMV + STV   FGSR YERYR DLTLLEA + ND  +V+  L+K+++ A
Sbjct  51   YWGSRREAWPRMVPQTSTVSKVFGSRAYERYRSDLTLLEATVRNDEENVYPRLLKQASAA  110

Query  789  L  791
            L
Sbjct  111  L  111



>ref|XP_002524607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37815.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +3

Query  609  KTHSPYWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVK  773
            +  + YWSSR EAWPRMV + STV   FGSR++ERYR  LTLLE+   NDD  VF  L+K
Sbjct  36   RCTAQYWSSRREAWPRMVPQTSTVSNVFGSRIFERYRSGLTLLESTARNDDENVFVGLLK  95

Query  774  ESTTAL  791
            ++  AL
Sbjct  96   QAIAAL  101



>ref|XP_008382864.1| PREDICTED: uncharacterized protein LOC103445628 [Malus domestica]
Length=153

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMN--DDVFASLVKESTTA  788
            YW SR EAWP+MV + STV   FGSR YERYR DLTLLEA  MN  ++V+  L+K+++ A
Sbjct  48   YWGSRREAWPKMVPQTSTVSKVFGSRAYERYRSDLTLLEATTMNGEENVYPRLLKQASAA  107

Query  789  L  791
            L
Sbjct  108  L  108



>ref|XP_004493777.1| PREDICTED: protodermal factor 1-like [Cicer arietinum]
Length=151

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDDV---FASLVKESTT  785
            +WS R E WPRMV E STV   FG RVYERYR DLTLLEA   ND+V   F  L+KE T 
Sbjct  45   FWSGRKETWPRMVPETSTVSNVFGWRVYERYRSDLTLLEATARNDEVDNPFGGLLKEGTA  104

Query  786  AL  791
            AL
Sbjct  105  AL  106



>ref|XP_009354948.1| PREDICTED: uncharacterized protein LOC103946053 [Pyrus x bretschneideri]
Length=154

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            YW SR EAWP+MV + STV   FGSR YERYR DLTLLEA + ND  +V+  L+K+++ A
Sbjct  49   YWGSRREAWPKMVPQTSTVSKMFGSRAYERYRSDLTLLEATVRNDEENVYPRLLKQASAA  108

Query  789  L  791
            L
Sbjct  109  L  109



>ref|XP_008372091.1| PREDICTED: uncharacterized protein LOC103435469 [Malus domestica]
Length=154

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            YW SR E+WP+MV + STV   FGSR YERYR DLTLLEA + ND  + +  LVK+++ A
Sbjct  49   YWGSRRESWPKMVPQTSTVSKVFGSRAYERYRSDLTLLEATVRNDEENAYPRLVKQASAA  108

Query  789  L  791
            L
Sbjct  109  L  109



>ref|XP_002300776.2| hypothetical protein POPTR_0002s03930g [Populus trichocarpa]
 gb|EEE80049.2| hypothetical protein POPTR_0002s03930g [Populus trichocarpa]
Length=154

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR EAWPRMV + STV   FGS V+ERYR D+TLLE+   NDD   FA L+K+++ A
Sbjct  49   FWSSRREAWPRMVPQRSTVSKVFGSGVFERYRSDVTLLESTGRNDDENAFAGLLKQASAA  108

Query  789  L  791
            L
Sbjct  109  L  109



>gb|EYU17919.1| hypothetical protein MIMGU_mgv1a016687mg [Erythranthe guttata]
Length=111

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 6/65 (9%)
 Frame = +3

Query  615  HSPYWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMN---DDVFASLVKE  776
            HS   SSR E+ P+MV E STV   FGSR +ERYR DLTL+EAA  N   ++ FA LVK+
Sbjct  2    HSSVLSSRKESCPKMVPEKSTVSNVFGSRAFERYREDLTLMEAASRNEEAENAFAGLVKQ  61

Query  777  STTAL  791
            ST AL
Sbjct  62   STAAL  66



>ref|XP_011028805.1| PREDICTED: uncharacterized protein LOC105128717 [Populus euphratica]
Length=155

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            +WSSR EAWPRMV + STV   FGS V+ERYR D+TLLE+   ND  + FA L+K+++ A
Sbjct  50   FWSSRREAWPRMVPQRSTVSKVFGSGVFERYRSDVTLLESTGRNDEENAFAGLLKQASAA  109

Query  789  L  791
            L
Sbjct  110  L  110



>gb|KDP26531.1| hypothetical protein JCGZ_17689 [Jatropha curcas]
Length=150

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            YWSSR EAWPRMV + ST   VFGS ++ERYR  LTL+E+   NDD   F  L+K+ +TA
Sbjct  45   YWSSRREAWPRMVPQTSTVSNVFGSIIFERYRSGLTLVESTARNDDENAFGRLLKQGSTA  104

Query  789  L  791
            L
Sbjct  105  L  105



>ref|XP_002278457.1| PREDICTED: uncharacterized protein LOC100263547 [Vitis vinifera]
 emb|CBI37118.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 64.3 bits (155),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMN---DDVFASLVKESTT  785
            YW SR EAWPRMV + ST   VFGSR  ER+R D+TLLEA   +   ++VF  L+K+++ 
Sbjct  47   YWGSRKEAWPRMVPQTSTVAKVFGSRASERFRSDMTLLEATAQDESVENVFHGLLKQTSA  106

Query  786  AL  791
            AL
Sbjct  107  AL  108


 Score = 29.3 bits (64),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +1

Query  487  LKS*TPHANTVYLASICSGAGAATAMAKQKRL*FLFTRSRGRRIPR  624
            ++S  P +  V +  +   A  ATA   Q R  FL+TRSRGR  P+
Sbjct  1    MESSAPLSTLVLILFLSCFAVTATAAQTQWRPGFLYTRSRGRCTPQ  46



>ref|XP_010679301.1| PREDICTED: uncharacterized protein LOC104894707 [Beta vulgaris 
subsp. vulgaris]
Length=152

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YW SR E WP MV + STV   FGSR  ER+R DLTLLEAA  NDD   V+  L+K+S+ 
Sbjct  46   YWGSRREEWPNMVPQRSTVSKVFGSRAIERFRFDLTLLEAATRNDDVENVYIRLLKQSSA  105

Query  786  AL  791
            AL
Sbjct  106  AL  107



>ref|XP_002307644.1| hypothetical protein POPTR_0005s24600g [Populus trichocarpa]
 gb|EEE94640.1| hypothetical protein POPTR_0005s24600g [Populus trichocarpa]
Length=149

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E+WPRMV + +TV   FGS V+ERY  D+TLLE+   NDD   FA L+K+++ A
Sbjct  44   FWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRNDDENAFAGLLKQASAA  103

Query  789  L  791
            L
Sbjct  104  L  104



>gb|KHG04833.1| Uroporphyrinogen decarboxylase [Gossypium arboreum]
Length=158

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +3

Query  609  KTHSPYWSSRMEAWPRMV---SEMSTVFGSRVYERYR*DLTLLEAALMND--DVFASLVK  773
            K    +WSSR EAWPRMV   S +S VFGSR  ERYR D+TLLE+  +N+  +VF  L+K
Sbjct  48   KCTPQFWSSRREAWPRMVPQGSTVSNVFGSRASERYRSDMTLLESRAVNEEGNVFNELLK  107

Query  774  ESTTAL  791
            +++ AL
Sbjct  108  QASAAL  113



>ref|XP_011004061.1| PREDICTED: uncharacterized protein LOC105110658 [Populus euphratica]
Length=149

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E+WPRMV + +TV   FGS V+ERY  D+TLLE+   NDD   FA L+K+++ A
Sbjct  44   FWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRNDDENAFAGLLKQASAA  103

Query  789  L  791
            L
Sbjct  104  L  104



>ref|XP_011025980.1| PREDICTED: uncharacterized protein LOC105126722 [Populus euphratica]
Length=149

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD--VFASLVKESTTA  788
            +WSSR E+WPRMV + +TV   FGS V+ERY  D+TLLE+   NDD   FA L+K+++ A
Sbjct  44   FWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRNDDENAFAGLLKQASAA  103

Query  789  L  791
            L
Sbjct  104  L  104



>ref|XP_006857282.1| hypothetical protein AMTR_s00067p00030870 [Amborella trichopoda]
 gb|ERN18749.1| hypothetical protein AMTR_s00067p00030870 [Amborella trichopoda]
Length=156

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 6/67 (9%)
 Frame = +3

Query  609  KTHSPYWSSRMEAWPRMV---SEMSTVFGSRVYERYR*DLTLLEAALMNDDV---FASLV  770
            K    YWSSR E WP+MV   S +S VFGSR  +RYR DLTLLEA   NDD+   +  L+
Sbjct  45   KCTPEYWSSRRETWPKMVPLTSSVSKVFGSRALDRYRADLTLLEATERNDDIGNAYHRLL  104

Query  771  KESTTAL  791
            K+++ AL
Sbjct  105  KQASAAL  111



>ref|XP_010262324.1| PREDICTED: uncharacterized protein LOC104600876 [Nelumbo nucifera]
Length=166

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMV---SEMSTVFGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E+WPRM+   S +S VFG++  ERYR DLTLLEA   NDD    F  L+K+S+ 
Sbjct  60   YWSSRRESWPRMIPQASSVSKVFGTQALERYRSDLTLLEATERNDDSNNAFFWLLKQSSA  119

Query  786  AL  791
            AL
Sbjct  120  AL  121



>ref|XP_004148954.1| PREDICTED: uncharacterized protein LOC101220310 [Cucumis sativus]
 ref|XP_004161530.1| PREDICTED: uncharacterized LOC101220310 [Cucumis sativus]
 gb|KGN44734.1| hypothetical protein Csa_7G375760 [Cucumis sativus]
Length=151

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 7/68 (10%)
 Frame = +3

Query  609  KTHSPYWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAALMNDD----VFASL  767
            +  + +WSSR EAWPRM  E +TV   FGSR +ERY  ++TL+EAA    D    VF  +
Sbjct  38   RCTAQFWSSRSEAWPRMAPESATVAKIFGSRAHERYGSEMTLMEAAAGAGDEEEEVFGRV  97

Query  768  VKESTTAL  791
            VKE+T AL
Sbjct  98   VKEATAAL  105



>ref|XP_010920481.1| PREDICTED: uncharacterized protein LOC105044325 [Elaeis guineensis]
Length=164

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV----FASLVKEST  782
            +W S  EAWP MV +   +S VFGSRV ERY   LTLLEA   NDDV    F+ LVK+S+
Sbjct  57   FWGSGREAWPNMVPQEASVSKVFGSRVLERYEPALTLLEATQRNDDVGGNAFSKLVKQSS  116

Query  783  TAL  791
             AL
Sbjct  117  AAL  119



>ref|XP_007050297.1| Uncharacterized protein TCM_004033 [Theobroma cacao]
 gb|EOX94454.1| Uncharacterized protein TCM_004033 [Theobroma cacao]
Length=168

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMND--DVFASLVKESTTA  788
            +WSSR EAWPRMV + ST   VFGSR +ERYR ++TLLE+  +N+  +V+  L+ +++ A
Sbjct  63   FWSSRREAWPRMVPQTSTVLNVFGSRAFERYRSEMTLLESTGVNEGGNVYDKLLTQASAA  122

Query  789  L  791
            L
Sbjct  123  L  123



>ref|XP_008451248.1| PREDICTED: uncharacterized protein LOC103492595 [Cucumis melo]
Length=178

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (7%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRVYERYR*DLTLLEAA-LMNDDVFASLVKESTTAL  791
            +WSSR EAWPRM  E +TV   FGSR  ERY  ++TL+EAA    ++VF  +VKE+T AL
Sbjct  74   FWSSRSEAWPRMAPESATVAKIFGSRARERYGSEMTLMEAAGGAEEEVFGRVVKEATAAL  133



>ref|XP_010540895.1| PREDICTED: uncharacterized protein LOC104814517 [Tarenaya hassleriana]
Length=202

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMST---VFGSRVYERYR*DLTLLEAALMNDD---VFASLVKESTT  785
            YWSSR E WPRMV E ST   VFG+   ER+R DLTL+E+A  NDD    + +L+K+   
Sbjct  96   YWSSRREVWPRMVPERSTVEKVFGAMAKERWRSDLTLVESAARNDDDGNAYGALLKQGIA  155

Query  786  AL  791
            AL
Sbjct  156  AL  157



>ref|XP_008791598.1| PREDICTED: uncharacterized protein LOC103708447 [Phoenix dactylifera]
Length=164

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV----FASLVKEST  782
            +W S  E WP M  +   +S VFGSRV ERY   LTLLEA   NDDV    F+ LVK+S+
Sbjct  57   FWGSGREVWPNMAPQEASVSKVFGSRVLERYEPGLTLLEATQRNDDVGGNAFSKLVKQSS  116

Query  783  TAL  791
             AL
Sbjct  117  AAL  119



>ref|XP_009413726.1| PREDICTED: uncharacterized protein LOC103994975 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMV---SEMSTVFGSRVYERYR*DLTLLEAALMNDDV----FASLVKEST  782
            +WSS  E WP  V   S +S VFGSR+ ERY   LTLLEA    DD+    F+ LVK+S+
Sbjct  55   FWSSGREPWPNTVPHDSSVSKVFGSRLLERYEPGLTLLEATQRTDDIGGSAFSKLVKQSS  114

Query  783  TAL  791
             AL
Sbjct  115  AAL  117



>ref|XP_006408976.1| hypothetical protein EUTSA_v10002113mg [Eutrema salsugineum]
 gb|ESQ50429.1| hypothetical protein EUTSA_v10002113mg [Eutrema salsugineum]
Length=153

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSSR EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  46   YWSSRREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  105

Query  783  TAL  791
             AL
Sbjct  106  AAL  108



>emb|CDY36764.1| BnaA03g11220D [Brassica napus]
Length=152

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSSR EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  45   YWSSRREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>ref|XP_009132352.1| PREDICTED: uncharacterized protein LOC103856964 [Brassica rapa]
Length=205

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSSR EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  98   YWSSRREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  157

Query  783  TAL  791
             AL
Sbjct  158  AAL  160



>emb|CDY11979.1| BnaC03g14050D [Brassica napus]
Length=152

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSSR EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  45   YWSSRREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLVESTSRNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>gb|KFK40425.1| hypothetical protein AALP_AA3G372100 [Arabis alpina]
Length=152

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 8/71 (11%)
 Frame = +3

Query  603  QRKTHSP-YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVF  758
            QR   +P YWSS+ E+WPRMV E STV   FG  V  ER+R DLTL+E+   ND   + +
Sbjct  37   QRGRCTPQYWSSKRESWPRMVPERSTVEKTFGVMVANERWRFDLTLVESTARNDEEGNAY  96

Query  759  ASLVKESTTAL  791
             +L+K+   AL
Sbjct  97   GALLKQGIAAL  107



>ref|XP_010467805.1| PREDICTED: uncharacterized protein LOC104747808 [Camelina sativa]
Length=152

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS  EAWPRMV E STV   FG  V  ER+R DLTLLE+   ND   + + +L+K+  
Sbjct  45   YWSSEREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLLESTARNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>ref|XP_010415612.1| PREDICTED: uncharacterized protein LOC104701593 [Camelina sativa]
Length=152

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS  EAWPRMV E STV   FG  V  ER+R DLTLLE+   ND   + + +L+K+  
Sbjct  45   YWSSEREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLLESTARNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>ref|XP_006298730.1| hypothetical protein CARUB_v10014827mg [Capsella rubella]
 gb|EOA31628.1| hypothetical protein CARUB_v10014827mg [Capsella rubella]
Length=154

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS  EAWPRMV E STV   FG  V  ER+R DLTLLE+   ND   + + +L+K+  
Sbjct  46   YWSSEREAWPRMVPERSTVEKIFGVMVAKERWRSDLTLLESTARNDEEGNAYGALLKQGI  105

Query  783  TAL  791
             AL
Sbjct  106  AAL  108



>ref|XP_004976229.1| PREDICTED: uncharacterized protein LOC101786121 [Setaria italica]
Length=182

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV----FASLVKEST  782
            +WSS  E WP +V +   +S VFGSR  ERY   LTLLEA +  DD+    F  LVK+ +
Sbjct  75   FWSSGAEPWPNIVPQEAAVSKVFGSRSVERYGPRLTLLEATMRTDDIGGSAFVKLVKQGS  134

Query  783  TAL  791
             AL
Sbjct  135  AAL  137



>ref|XP_002886285.1| hypothetical protein ARALYDRAFT_480880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62544.1| hypothetical protein ARALYDRAFT_480880 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS+ EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  45   YWSSQREAWPRMVPERSTVEKIFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>gb|AAM64424.1| unknown [Arabidopsis thaliana]
Length=152

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS+ EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  45   YWSSQREAWPRMVPERSTVEKIFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>ref|NP_565474.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM15393.1| Expressed protein [Arabidopsis thaliana]
 gb|AAP40503.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84515.1| At2g20515 [Arabidopsis thaliana]
 gb|ABD59100.1| At2g20515 [Arabidopsis thaliana]
 gb|AEC07021.1| uncharacterized protein AT2G20515 [Arabidopsis thaliana]
Length=155

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS+ EAWPRMV E STV   FG  V  ER+R DLTL+E+   ND   + + +L+K+  
Sbjct  48   YWSSQREAWPRMVPERSTVEKIFGVMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGI  107

Query  783  TAL  791
             AL
Sbjct  108  AAL  110



>ref|XP_010489026.1| PREDICTED: uncharacterized protein LOC104766776 [Camelina sativa]
Length=152

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSRV-YERYR*DLTLLEAALMND---DVFASLVKEST  782
            YWSS  EAWPRMV E STV   FG  V  ER+R DLTLLE+   ND   + + +L+K+  
Sbjct  45   YWSSEREAWPRMVPERSTVEKMFGVMVAKERWRSDLTLLESTARNDEEGNAYDALLKQGI  104

Query  783  TAL  791
             AL
Sbjct  105  AAL  107



>ref|XP_002446788.1| hypothetical protein SORBIDRAFT_06g022650 [Sorghum bicolor]
 gb|EES11116.1| hypothetical protein SORBIDRAFT_06g022650 [Sorghum bicolor]
Length=182

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV----FASLVKEST  782
            +WSS  E WP ++ +   ++ VFGSR  ERY   LTLLEA +  DD+    F  LVK+ +
Sbjct  75   FWSSGAEPWPNIIPQEAAVAKVFGSRSVERYGPRLTLLEATMRTDDIGGSAFVKLVKQGS  134

Query  783  TAL  791
             AL
Sbjct  135  AAL  137



>tpg|DAA36981.1| TPA: hypothetical protein ZEAMMB73_327282 [Zea mays]
Length=126

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD----VFASLVKEST  782
            +WSS  E WP +V +   ++ VFGSR  ERY   LTLLEA +  DD     F  LVK+ +
Sbjct  19   FWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTDDAGGSAFVKLVKQGS  78

Query  783  TAL  791
             AL
Sbjct  79   AAL  81



>ref|XP_006653600.1| PREDICTED: uncharacterized protein LOC102709642 [Oryza brachyantha]
Length=156

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 8/66 (12%)
 Frame = +3

Query  618  SPYWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD-----VFASLVK  773
            S +WSS  E WP ++ +   +S VFGSR  +RY   LT+LEA +  DD      FA LVK
Sbjct  46   SKFWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLTVLEATMRTDDSGSNSAFAKLVK  105

Query  774  ESTTAL  791
            + + AL
Sbjct  106  QGSAAL  111



>gb|ACG32677.1| hypothetical protein [Zea mays]
Length=182

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD----VFASLVKEST  782
            +WSS  E WP +V +   ++ VFGSR  ERY   LTLLEA +  DD     F  LVK+ +
Sbjct  75   FWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTDDAGGSAFVKLVKQGS  134

Query  783  TAL  791
             AL
Sbjct  135  AAL  137



>ref|NP_001132608.1| hypothetical protein precursor [Zea mays]
 gb|ACF81526.1| unknown [Zea mays]
 tpg|DAA36979.1| TPA: hypothetical protein ZEAMMB73_327282 [Zea mays]
Length=182

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD----VFASLVKEST  782
            +WSS  E WP +V +   ++ VFGSR  ERY   LTLLEA +  DD     F  LVK+ +
Sbjct  75   FWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTDDAGGSAFVKLVKQGS  134

Query  783  TAL  791
             AL
Sbjct  135  AAL  137



>dbj|BAJ87228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=174

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV---FASLVKESTT  785
            +WSS  E WP +V +   +S VFGSR  ++Y   LTLLEA +  DDV   F  LVK  + 
Sbjct  68   FWSSGAEQWPNIVPQEAAVSKVFGSRSMDKYGPRLTLLEATMRTDDVGSPFVKLVKHGSA  127

Query  786  AL  791
            AL
Sbjct  128  AL  129



>gb|EMT14391.1| hypothetical protein F775_15820 [Aegilops tauschii]
Length=177

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV---FASLVKESTT  785
            +WSS  E WP +V +   +S VFGSR  ++Y   LTLLEA +  DDV   F  LVK  + 
Sbjct  71   FWSSGAEQWPNIVPQEAAVSKVFGSRSMDKYGPRLTLLEATMRTDDVGSPFVKLVKHGSA  130

Query  786  AL  791
            AL
Sbjct  131  AL  132



>ref|NP_001053317.1| Os04g0517000 [Oryza sativa Japonica Group]
 dbj|BAF15231.1| Os04g0517000 [Oryza sativa Japonica Group]
Length=156

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 8/64 (13%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD-----VFASLVKES  779
            +WSS  E WP ++ +   +S VFGSR  +RY   LT+LEA    DD      FA LVK+ 
Sbjct  48   FWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLTVLEATTRTDDNGSSSAFAKLVKQG  107

Query  780  TTAL  791
            + AL
Sbjct  108  SAAL  111



>ref|XP_010037977.1| PREDICTED: uncharacterized protein LOC104426571 [Eucalyptus grandis]
 ref|XP_010042243.1| PREDICTED: uncharacterized protein LOC104431282 [Eucalyptus grandis]
 gb|KCW49768.1| hypothetical protein EUGRSUZ_K03259 [Eucalyptus grandis]
Length=162

 Score = 50.1 bits (118),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 7/63 (11%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSEMSTV---FGSR-VYERYR*DLTLLE---AALMNDDVFASLVKEST  782
            YWSS  E WPRM+   STV   FGSR + ERY  DLT+ E     +   D +  LVK+++
Sbjct  55   YWSSGREKWPRMLPRKSTVSRAFGSRAIGERYGGDLTVWESTAGVVGGGDAYGRLVKQAS  114

Query  783  TAL  791
             AL
Sbjct  115  AAL  117


 Score = 23.1 bits (48),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +1

Query  550  AATAMAKQKRL*FLFTRSRGRRIPR  624
            AA   ++ ++L F +TR+RGR  P+
Sbjct  30   AAPPPSRGRKLGFFYTRTRGRCTPQ  54



>gb|EMS55115.1| hypothetical protein TRIUR3_30226 [Triticum urartu]
Length=201

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 6/62 (10%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDDV---FASLVKESTT  785
            +WSS  E WP +V +   +S VFGSR  ++Y   LTLLEA +  DDV   F  LVK  + 
Sbjct  71   FWSSGAEQWPNIVPQEAAVSKVFGSRSMDKYGPRLTLLEATMRTDDVGSPFVKLVKHGSA  130

Query  786  AL  791
            AL
Sbjct  131  AL  132



>emb|CAH67221.1| OSIGBa0145M07.3 [Oryza sativa Indica Group]
 gb|EAY94853.1| hypothetical protein OsI_16649 [Oryza sativa Indica Group]
 gb|EAZ31347.1| hypothetical protein OsJ_15469 [Oryza sativa Japonica Group]
Length=179

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 8/64 (13%)
 Frame = +3

Query  624  YWSSRMEAWPRMVSE---MSTVFGSRVYERYR*DLTLLEAALMNDD-----VFASLVKES  779
            +WSS  E WP ++ +   +S VFGSR  +RY   LT+LEA    DD      FA LVK+ 
Sbjct  71   FWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLTVLEATTRTDDNGSSSAFAKLVKQG  130

Query  780  TTAL  791
            + AL
Sbjct  131  SAAL  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1487544256264