BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24829_g1_i4 len=2723 path=[5545:0-249 5795:250-281 12373:282-288
5834:289-317 5863:318-356 5902:357-494 6040:495-503 6049:504-539
12430:540-540 12431:541-542 12433:543-546 6091:547-562 6107:563-600
6145:601-636 6181:637-1510 596:1511-1554 12526:1555-1556
9459:1557-1566 3778:1567-1610 12823:1611-1677 760:1678-1704
787:1705-1939 1022:1940-2028 2137:2029-2052 2161:2053-2081
2190:2082-2146 2255:2147-2148 2257:2149-2212 2321:2213-2229
2338:2230-2273 2382:2274-2300 2409:2301-2421 12782:2422-2457
12848:2458-2560 2669:2561-2642 2751:2643-2722]

Length=2723
                                                                      Score     E

ref|XP_009604417.1|  PREDICTED: probable receptor protein kinase ...    850   0.0      
ref|XP_004247890.2|  PREDICTED: probable receptor protein kinase ...    849   0.0      
ref|XP_006360918.1|  PREDICTED: probable receptor protein kinase ...    848   0.0      
ref|XP_009777291.1|  PREDICTED: probable receptor protein kinase ...    832   0.0      
ref|XP_009794479.1|  PREDICTED: probable receptor protein kinase ...    820   0.0      
ref|XP_011101591.1|  PREDICTED: probable receptor protein kinase ...    809   0.0      
ref|XP_006349904.1|  PREDICTED: probable receptor protein kinase ...    773   0.0      
emb|CDP15110.1|  unnamed protein product                                763   0.0      
ref|XP_004252979.1|  PREDICTED: probable receptor protein kinase ...    763   0.0      
gb|EYU31524.1|  hypothetical protein MIMGU_mgv1a001083mg                752   0.0      
gb|EYU32717.1|  hypothetical protein MIMGU_mgv1a001138mg                743   0.0      
ref|XP_010246532.1|  PREDICTED: probable receptor protein kinase ...    737   0.0      
ref|XP_010650399.1|  PREDICTED: probable receptor protein kinase ...    730   0.0      
emb|CAN69461.1|  hypothetical protein VITISV_043132                     727   0.0      Vitis vinifera
emb|CBI39413.3|  unnamed protein product                                719   0.0      
ref|XP_010097979.1|  putative receptor protein kinase TMK1              706   0.0      
ref|XP_009373574.1|  PREDICTED: probable receptor protein kinase ...    701   0.0      
ref|XP_008380457.1|  PREDICTED: probable receptor protein kinase ...    701   0.0      
ref|XP_010246967.1|  PREDICTED: probable receptor protein kinase ...    696   0.0      
ref|XP_009343822.1|  PREDICTED: probable receptor protein kinase ...    686   0.0      
ref|XP_010068984.1|  PREDICTED: probable receptor protein kinase ...    681   0.0      
ref|XP_007221303.1|  hypothetical protein PRUPE_ppa001041mg             677   0.0      
ref|XP_004140603.1|  PREDICTED: probable receptor protein kinase ...    674   0.0      
ref|XP_004162388.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    674   0.0      
ref|XP_008458146.1|  PREDICTED: probable receptor protein kinase ...    674   0.0      
ref|XP_008222737.1|  PREDICTED: probable receptor protein kinase ...    673   0.0      
ref|XP_010673522.1|  PREDICTED: probable receptor protein kinase ...    672   0.0      
ref|XP_006421039.1|  hypothetical protein CICLE_v10004263mg             671   0.0      
gb|KDO47459.1|  hypothetical protein CISIN_1g0023461mg                  660   0.0      
ref|XP_006492525.1|  PREDICTED: probable receptor protein kinase ...    667   0.0      
ref|XP_002308106.1|  hypothetical protein POPTR_0006s07360g             666   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP03933.1|  unnamed protein product                                665   0.0      
ref|XP_009610544.1|  PREDICTED: probable receptor protein kinase ...    660   0.0      
ref|XP_010685103.1|  PREDICTED: probable receptor protein kinase ...    657   0.0      
ref|XP_011020360.1|  PREDICTED: probable receptor protein kinase ...    658   0.0      
ref|XP_009789399.1|  PREDICTED: probable receptor protein kinase ...    655   0.0      
emb|CDY61573.1|  BnaCnng38030D                                          653   0.0      
gb|KHG03733.1|  putative receptor protein kinase TMK1                   652   0.0      
ref|XP_003537524.1|  PREDICTED: probable receptor protein kinase ...    652   0.0      
ref|XP_002324686.2|  hypothetical protein POPTR_0018s13780g             650   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY63752.1|  BnaAnng19060D                                          650   0.0      
ref|XP_009102585.1|  PREDICTED: probable receptor protein kinase ...    650   0.0      
gb|KHN44469.1|  Putative receptor protein kinase TMK1                   647   0.0      
ref|XP_006601886.1|  PREDICTED: probable receptor protein kinase ...    647   0.0      
ref|XP_007221309.1|  hypothetical protein PRUPE_ppa020129mg             644   0.0      
ref|XP_004247046.1|  PREDICTED: probable receptor protein kinase ...    646   0.0      
gb|ABD96566.1|  Rhg4-like receptor kinase II                            644   0.0      Glycine max [soybeans]
ref|XP_006418841.1|  hypothetical protein EUTSA_v10002394mg             644   0.0      
ref|XP_007163803.1|  hypothetical protein PHAVU_001G265500g             642   0.0      
ref|XP_003601704.1|  Receptor-like kinase                               641   0.0      
ref|XP_002883458.1|  leucine-rich repeat family protein                 637   0.0      
ref|NP_001236021.1|  Rhg4-like receptor kinase II precursor             637   0.0      
gb|ADO12863.1|  leucine-rich repeat receptor-like kinase                636   0.0      
gb|ABD96565.1|  Rhg4-like receptor kinase I                             636   0.0      Glycine max [soybeans]
ref|XP_011005684.1|  PREDICTED: probable receptor protein kinase ...    636   0.0      
ref|NP_189017.1|  leucine-rich repeat protein kinase-like protein       635   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296927.1|  hypothetical protein CARUB_v10012920mg             635   0.0      
ref|XP_010023612.1|  PREDICTED: probable receptor protein kinase ...    635   0.0      
ref|XP_006366998.1|  PREDICTED: probable receptor protein kinase ...    634   0.0      
ref|XP_011003774.1|  PREDICTED: probable receptor protein kinase ...    635   0.0      
gb|ACN59321.1|  leucine-rich repeat receptor-like protein kinase        634   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502257.1|  PREDICTED: probable receptor protein kinase ...    634   0.0      
ref|XP_008222748.1|  PREDICTED: probable receptor protein kinase ...    632   0.0      
ref|XP_004504378.1|  PREDICTED: probable receptor protein kinase ...    632   0.0      
gb|ABD96567.1|  Rhg4-like receptor kinase I                             632   0.0      Glycine max [soybeans]
dbj|BAH56605.1|  receptor-like kinase                                   627   0.0      Glycine max [soybeans]
ref|XP_010512862.1|  PREDICTED: probable receptor protein kinase ...    628   0.0      
dbj|BAH56604.1|  receptor-like kinase                                   626   0.0      Glycine max [soybeans]
dbj|BAH56606.1|  receptor-like kinase                                   625   0.0      Glycine max [soybeans]
ref|NP_001236710.1|  receptor-like kinase RHG4                          624   0.0      
ref|XP_010488452.1|  PREDICTED: probable receptor protein kinase ...    625   0.0      
gb|ACM89489.1|  receptor-like kinase                                    622   0.0      Glycine max [soybeans]
gb|KDP32592.1|  hypothetical protein JCGZ_13142                         619   0.0      
ref|XP_010466732.1|  PREDICTED: probable receptor protein kinase ...    619   0.0      
gb|KFK39671.1|  hypothetical protein AALP_AA3G274200                    616   0.0      
ref|XP_006382755.1|  hypothetical protein POPTR_0005s05100g             611   0.0      
ref|XP_010532727.1|  PREDICTED: probable receptor protein kinase ...    610   0.0      
ref|XP_006830550.1|  hypothetical protein AMTR_s00117p00096300          598   0.0      
gb|KCW59923.1|  hypothetical protein EUGRSUZ_H02647                     593   0.0      
ref|XP_003629623.1|  Receptor-like kinase                               592   0.0      
ref|XP_006296979.1|  hypothetical protein CARUB_v10012974mg             588   0.0      
gb|KHN24033.1|  Putative receptor protein kinase TMK1                   584   0.0      
ref|XP_011089643.1|  PREDICTED: probable receptor protein kinase ...    588   0.0      
ref|XP_010026683.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    585   0.0      
ref|XP_010023621.1|  PREDICTED: probable receptor protein kinase ...    594   0.0      
ref|XP_009630216.1|  PREDICTED: probable receptor protein kinase ...    570   0.0      
ref|XP_010023622.1|  PREDICTED: probable receptor protein kinase ...    583   0.0      
ref|XP_009794480.1|  PREDICTED: probable receptor protein kinase ...    563   0.0      
ref|XP_010690479.1|  PREDICTED: probable receptor protein kinase ...    557   8e-180   
ref|XP_006290562.1|  hypothetical protein CARUB_v10016649mg             543   3e-179   
ref|XP_008775313.1|  PREDICTED: probable receptor protein kinase ...    551   8e-179   
ref|XP_003552883.2|  PREDICTED: probable receptor protein kinase ...    537   9e-179   
ref|XP_011043912.1|  PREDICTED: probable receptor protein kinase ...    554   1e-178   
ref|XP_010648936.1|  PREDICTED: probable receptor protein kinase ...    553   3e-178   
ref|XP_004230827.1|  PREDICTED: probable receptor protein kinase ...    551   1e-177   
ref|XP_008812470.1|  PREDICTED: probable receptor protein kinase ...    550   1e-177   
ref|XP_010551437.1|  PREDICTED: probable receptor protein kinase ...    549   7e-177   
ref|XP_010528574.1|  PREDICTED: probable receptor protein kinase ...    547   3e-176   
ref|XP_010043988.1|  PREDICTED: probable receptor protein kinase ...    547   4e-176   
ref|XP_011070545.1|  PREDICTED: probable receptor protein kinase ...    546   5e-176   
ref|XP_007225345.1|  hypothetical protein PRUPE_ppa000982mg             545   3e-175   
ref|XP_002533475.1|  receptor protein kinase, putative                  544   9e-175   Ricinus communis
ref|XP_010424954.1|  PREDICTED: probable receptor protein kinase ...    527   1e-174   
ref|XP_011038249.1|  PREDICTED: probable receptor protein kinase ...    543   1e-174   
ref|XP_008795408.1|  PREDICTED: probable receptor protein kinase ...    542   2e-174   
ref|XP_010936890.1|  PREDICTED: probable receptor protein kinase ...    543   2e-174   
ref|XP_011070546.1|  PREDICTED: probable receptor protein kinase ...    537   2e-174   
ref|XP_008787910.1|  PREDICTED: probable receptor protein kinase ...    542   5e-174   
ref|XP_010502174.1|  PREDICTED: probable receptor protein kinase ...    524   8e-174   
ref|XP_009414792.1|  PREDICTED: probable receptor protein kinase ...    514   2e-173   
ref|XP_006346490.1|  PREDICTED: probable receptor protein kinase ...    538   1e-172   
ref|XP_011099938.1|  PREDICTED: probable receptor protein kinase ...    538   1e-172   
gb|KDO41052.1|  hypothetical protein CISIN_1g002238mg                   538   2e-172   
ref|XP_010908591.1|  PREDICTED: probable receptor protein kinase ...    536   2e-172   
ref|XP_004289581.1|  PREDICTED: probable receptor protein kinase ...    538   2e-172   
ref|XP_002876780.1|  hypothetical protein ARALYDRAFT_484098             518   4e-172   
ref|XP_009404143.1|  PREDICTED: probable receptor protein kinase ...    537   5e-172   
emb|CDY52761.1|  BnaC02g47770D                                          525   8e-172   
ref|XP_008220934.1|  PREDICTED: probable receptor protein kinase ...    535   1e-171   
ref|XP_009129193.1|  PREDICTED: probable receptor protein kinase ...    527   1e-171   
ref|NP_001238698.1|  NAK-type protein kinase precursor                  535   2e-171   
ref|XP_008798481.1|  PREDICTED: probable receptor protein kinase ...    534   5e-171   
ref|XP_007032165.1|  Transmembrane kinase 1 isoform 1                   534   5e-171   
ref|XP_004140293.1|  PREDICTED: probable receptor protein kinase ...    534   5e-171   
emb|CDY09413.1|  BnaA02g25970D                                          525   7e-171   
ref|NP_178291.1|  receptor-like kinase TMK3                             515   8e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408496.1|  PREDICTED: probable receptor protein kinase ...    533   1e-170   
gb|AID55112.1|  leucine-rich repeat receptor-like protein kinase        531   2e-170   
gb|KDP25825.1|  hypothetical protein JCGZ_22547                         533   2e-170   
ref|XP_006494664.1|  PREDICTED: probable receptor protein kinase ...    532   3e-170   
gb|KDO41053.1|  hypothetical protein CISIN_1g002238mg                   526   4e-170   
ref|XP_010271200.1|  PREDICTED: probable receptor protein kinase ...    531   8e-170   
gb|KHN39482.1|  Putative receptor protein kinase TMK1                   530   1e-169   
ref|XP_004298491.1|  PREDICTED: probable receptor protein kinase ...    530   1e-169   
ref|XP_010917500.1|  PREDICTED: probable receptor protein kinase ...    526   1e-168   
ref|XP_007141936.1|  hypothetical protein PHAVU_008G238600g             528   2e-168   
gb|EYU30867.1|  hypothetical protein MIMGU_mgv1a001044mg                526   3e-168   
ref|XP_002281552.2|  PREDICTED: probable receptor protein kinase ...    526   7e-168   Vitis vinifera
ref|XP_002527538.1|  receptor protein kinase, putative                  525   1e-167   Ricinus communis
ref|XP_006494665.1|  PREDICTED: probable receptor protein kinase ...    520   1e-167   
ref|XP_009370081.1|  PREDICTED: probable receptor protein kinase ...    525   1e-167   
ref|XP_010553548.1|  PREDICTED: probable receptor protein kinase ...    494   8e-167   
ref|XP_010673327.1|  PREDICTED: probable receptor protein kinase ...    520   8e-167   
ref|XP_010668632.1|  PREDICTED: probable receptor protein kinase ...    523   1e-166   
ref|XP_002314766.1|  hypothetical protein POPTR_0010s11360g             521   2e-166   Populus trichocarpa [western balsam poplar]
gb|KCW59851.1|  hypothetical protein EUGRSUZ_H02591                     519   2e-166   
ref|XP_004490803.1|  PREDICTED: probable receptor protein kinase ...    522   3e-166   
ref|XP_010906324.1|  PREDICTED: probable receptor protein kinase ...    520   4e-166   
ref|XP_006350960.1|  PREDICTED: probable receptor protein kinase ...    520   6e-166   
ref|XP_009378958.1|  PREDICTED: probable receptor protein kinase ...    520   9e-166   
ref|XP_004142822.1|  PREDICTED: probable receptor protein kinase ...    520   2e-165   
ref|XP_010315276.1|  PREDICTED: probable receptor protein kinase ...    518   2e-165   
ref|XP_006303733.1|  hypothetical protein CARUB_v10011871mg             518   3e-165   
ref|XP_003631009.1|  Kinase-like protein                                518   3e-165   
ref|XP_008467095.1|  PREDICTED: probable receptor protein kinase ...    518   5e-165   
ref|XP_002893435.1|  leucine-rich repeat family protein                 516   1e-164   
ref|XP_004297409.1|  PREDICTED: probable receptor protein kinase ...    514   3e-164   
gb|EYU30155.1|  hypothetical protein MIMGU_mgv1a001033mg                513   2e-163   
ref|XP_009351578.1|  PREDICTED: probable receptor protein kinase ...    514   3e-163   
ref|XP_010032738.1|  PREDICTED: probable receptor protein kinase ...    513   6e-163   
gb|EPS72320.1|  hypothetical protein M569_02431                         510   3e-162   
ref|XP_007214949.1|  hypothetical protein PRUPE_ppa000942mg             511   4e-162   
ref|XP_009587166.1|  PREDICTED: probable receptor protein kinase ...    510   7e-162   
ref|XP_003572876.1|  PREDICTED: probable receptor protein kinase ...    510   8e-162   
gb|KHG20581.1|  putative receptor protein kinase TMK1                   510   9e-162   
ref|XP_011021737.1|  PREDICTED: probable receptor protein kinase ...    509   1e-161   
ref|XP_007153205.1|  hypothetical protein PHAVU_003G015800g             508   2e-161   
ref|XP_009380072.1|  PREDICTED: probable receptor protein kinase ...    508   5e-161   
ref|XP_009351579.1|  PREDICTED: probable receptor protein kinase ...    503   7e-161   
ref|XP_003529231.1|  PREDICTED: probable receptor protein kinase ...    507   7e-161   
ref|XP_010939998.1|  PREDICTED: probable receptor protein kinase ...    507   1e-160   
ref|XP_010932521.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    506   1e-160   
ref|XP_006826595.1|  hypothetical protein AMTR_s00138p00056480          501   5e-160   
gb|KHM99461.1|  Putative receptor protein kinase TMK1                   502   2e-159   
ref|XP_008389147.1|  PREDICTED: probable receptor protein kinase ...    502   1e-158   
gb|KEH40666.1|  receptor kinase TMK1-like protein                       501   1e-158   
ref|XP_004981977.1|  PREDICTED: probable receptor protein kinase ...    502   2e-158   
ref|XP_004498720.1|  PREDICTED: probable receptor protein kinase ...    501   2e-158   
ref|XP_010553540.1|  PREDICTED: probable receptor protein kinase ...    500   4e-158   
ref|XP_004249911.1|  PREDICTED: probable receptor protein kinase ...    500   5e-158   
ref|XP_008789301.1|  PREDICTED: probable receptor protein kinase ...    499   6e-158   
ref|XP_010501607.1|  PREDICTED: probable receptor protein kinase ...    497   2e-157   
emb|CDY03867.1|  BnaC07g10920D                                          496   2e-157   
ref|XP_008358283.1|  PREDICTED: probable receptor protein kinase ...    494   7e-156   
ref|XP_008381802.1|  PREDICTED: probable receptor protein kinase ...    495   1e-155   
ref|XP_008244390.1|  PREDICTED: probable receptor protein kinase ...    493   2e-155   
ref|XP_008803916.1|  PREDICTED: uncharacterized protein LOC103717354    508   1e-154   
ref|XP_009103048.1|  PREDICTED: probable receptor protein kinase ...    489   2e-154   
ref|XP_010527815.1|  PREDICTED: probable receptor protein kinase ...    490   4e-154   
ref|XP_006651752.1|  PREDICTED: probable receptor protein kinase ...    488   7e-154   
gb|KHN16510.1|  Putative receptor protein kinase TMK1                   486   3e-153   
ref|XP_003532526.1|  PREDICTED: probable receptor protein kinase ...    485   7e-153   
ref|XP_002299778.2|  hypothetical protein POPTR_0001s22540g             482   2e-151   Populus trichocarpa [western balsam poplar]
emb|CBI39471.3|  unnamed protein product                                479   6e-151   
ref|XP_002268601.2|  PREDICTED: probable receptor protein kinase ...    481   9e-151   Vitis vinifera
emb|CAH68356.1|  H0723C07.6                                             481   1e-150   Oryza sativa [red rice]
gb|KCW52194.1|  hypothetical protein EUGRSUZ_J01624                     476   3e-150   
ref|XP_006415826.1|  hypothetical protein EUTSA_v10009860mg             478   3e-150   
ref|NP_001054323.1|  Os04g0685900                                       478   1e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006421082.1|  hypothetical protein CICLE_v10004322mg             473   4e-149   
ref|XP_003579497.1|  PREDICTED: probable receptor protein kinase ...    476   6e-149   
gb|KHN12355.1|  Putative receptor protein kinase TMK1                   468   8e-149   
gb|EMS63078.1|  putative receptor protein kinase TMK1                   469   1e-148   
gb|AAO72615.1|  receptor-like protein kinase-like protein               474   4e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462912.1|  PREDICTED: probable receptor protein kinase ...    470   2e-147   
gb|ACM89521.1|  receptor-like protein kinase-like protein               469   7e-147   Glycine max [soybeans]
ref|XP_006653057.1|  PREDICTED: probable receptor protein kinase ...    469   9e-147   
gb|KEH29536.1|  receptor-like kinase, putative                          467   9e-147   
ref|XP_010246966.1|  PREDICTED: probable receptor protein kinase ...    455   2e-146   
gb|KHN41049.1|  Putative receptor protein kinase TMK1                   465   3e-146   
gb|EMT17636.1|  Putative receptor protein kinase TMK1                   468   2e-145   
ref|XP_002980850.1|  hypothetical protein SELMODRAFT_233622             466   4e-145   
ref|XP_007160467.1|  hypothetical protein PHAVU_002G324600g             465   5e-145   
ref|XP_002989354.1|  hypothetical protein SELMODRAFT_129592             465   9e-145   
ref|XP_009412894.1|  PREDICTED: probable receptor protein kinase ...    461   5e-144   
ref|XP_010110337.1|  putative receptor protein kinase TMK1              458   2e-143   
ref|XP_002980529.1|  hypothetical protein SELMODRAFT_233539             459   2e-142   
ref|XP_002530240.1|  protein binding protein, putative                  442   5e-140   Ricinus communis
ref|XP_009629429.1|  PREDICTED: probable receptor protein kinase ...    447   4e-138   
gb|EMT14311.1|  Putative receptor protein kinase TMK1                   442   3e-137   
ref|XP_009408286.1|  PREDICTED: probable receptor protein kinase ...    444   2e-136   
ref|XP_011094233.1|  PREDICTED: probable receptor protein kinase ...    441   4e-136   
ref|XP_002975116.1|  hypothetical protein SELMODRAFT_102446             442   5e-136   
ref|XP_002989008.1|  hypothetical protein SELMODRAFT_129007             441   1e-135   
emb|CBI26796.3|  unnamed protein product                                437   3e-135   
ref|XP_009408287.1|  PREDICTED: probable receptor protein kinase ...    432   7e-134   
gb|EPS70426.1|  hypothetical protein M569_04331                         449   3e-133   
ref|XP_002976801.1|  hypothetical protein SELMODRAFT_268021             432   4e-132   
gb|EYU40639.1|  hypothetical protein MIMGU_mgv1a027041mg                424   6e-130   
emb|CDY40785.1|  BnaAnng06480D                                          421   1e-129   
gb|KHN24152.1|  Putative receptor protein kinase TMK1                   404   2e-127   
ref|XP_011017684.1|  PREDICTED: probable receptor protein kinase ...    416   3e-126   
ref|XP_007032166.1|  Transmembrane kinase 1 isoform 2                   408   1e-125   
gb|KDO41054.1|  hypothetical protein CISIN_1g002238mg                   402   3e-125   
ref|XP_004298216.1|  PREDICTED: probable receptor protein kinase ...    411   1e-124   
gb|EMS59747.1|  putative receptor protein kinase TMK1                   400   1e-122   
gb|AES80551.2|  receptor-like kinase, putative                          403   2e-122   
ref|XP_003624333.1|  Receptor-like kinase                               404   3e-122   
ref|XP_006389323.1|  hypothetical protein POPTR_0030s00450g             400   3e-120   
gb|EPS70217.1|  hypothetical protein M569_04541                         397   7e-120   
ref|XP_009106355.1|  PREDICTED: probable receptor protein kinase ...    397   4e-119   
ref|XP_007034191.1|  Leucine-rich repeat protein kinase family pr...    390   1e-118   
ref|XP_007034190.1|  Leucine-rich repeat protein kinase family pr...    391   6e-117   
ref|XP_011032474.1|  PREDICTED: probable receptor protein kinase ...    382   7e-114   
gb|KHG15618.1|  putative receptor protein kinase TMK1                   374   1e-110   
gb|KCW59913.1|  hypothetical protein EUGRSUZ_H02636                     357   4e-105   
gb|KDP26449.1|  hypothetical protein JCGZ_17607                         290   4e-104   
ref|XP_009416592.1|  PREDICTED: probable receptor protein kinase ...    347   1e-101   
ref|XP_009416591.1|  PREDICTED: probable receptor protein kinase ...    348   6e-101   
ref|XP_009138577.1|  PREDICTED: probable receptor protein kinase ...    301   4e-100   
ref|XP_003624353.1|  Receptor-like kinase                               342   2e-99    
ref|XP_009757873.1|  PREDICTED: probable receptor protein kinase ...    337   6e-97    
ref|XP_009406339.1|  PREDICTED: probable receptor protein kinase ...    336   8e-97    
ref|XP_009619244.1|  PREDICTED: probable receptor protein kinase ...    334   7e-96    
ref|XP_002539444.1|  conserved hypothetical protein                     309   4e-94    Ricinus communis
ref|XP_004492958.1|  PREDICTED: probable receptor protein kinase ...    327   1e-93    
gb|AAF66615.1|  LRR receptor-like protein kinase                        248   3e-93    Nicotiana tabacum [American tobacco]
ref|XP_004493052.1|  PREDICTED: probable receptor protein kinase ...    322   3e-92    
emb|CDP05529.1|  unnamed protein product                                244   5e-92    
ref|XP_010513910.1|  PREDICTED: probable receptor protein kinase ...    250   1e-91    
ref|XP_003576062.1|  PREDICTED: probable receptor protein kinase ...    321   2e-91    
dbj|BAJ91186.1|  predicted protein                                      313   7e-91    
emb|CDY26344.1|  BnaA03g60200D                                          307   8e-91    
ref|XP_006416214.1|  hypothetical protein EUTSA_v10009550mg             268   3e-90    
gb|KEH40668.1|  receptor kinase TMK1-like protein, putative             240   3e-90    
ref|XP_006395848.1|  hypothetical protein EUTSA_v10003606mg             248   9e-90    
gb|KFK45034.1|  hypothetical protein AALP_AA1G335600                    248   9e-90    
gb|KDO60837.1|  hypothetical protein CISIN_1g002255mg                   313   1e-89    
ref|XP_009115288.1|  PREDICTED: probable receptor protein kinase ...    243   3e-89    
ref|XP_009101318.1|  PREDICTED: probable receptor protein kinase ...    242   5e-89    
ref|XP_002274910.2|  PREDICTED: probable receptor protein kinase ...    241   5e-89    Vitis vinifera
ref|XP_009368765.1|  PREDICTED: probable receptor protein kinase ...    307   7e-89    
ref|XP_006448112.1|  hypothetical protein CICLE_v10014172mg             311   9e-89    
ref|XP_006469286.1|  PREDICTED: probable receptor protein kinase ...    315   9e-89    
emb|CDY03107.1|  BnaC07g21200D                                          243   2e-88    
gb|KDO60836.1|  hypothetical protein CISIN_1g002255mg                   313   2e-88    
emb|CDY17648.1|  BnaA06g34670D                                          242   2e-88    
ref|XP_006372526.1|  receptor protein kinase TMK1 precursor             313   4e-88    
gb|EPS64046.1|  hypothetical protein M569_10735                         312   8e-88    
ref|XP_006448111.1|  hypothetical protein CICLE_v10014172mg             312   9e-88    
ref|XP_008381795.1|  PREDICTED: probable receptor protein kinase ...    299   2e-86    
ref|XP_009105191.1|  PREDICTED: probable receptor protein kinase ...    306   1e-85    
gb|KFK41035.1|  hypothetical protein AALP_AA2G077000                    305   2e-85    
emb|CDY17635.1|  BnaA06g34540D                                          241   2e-85    
emb|CDY35882.1|  BnaA07g01050D                                          293   2e-85    
ref|XP_009101661.1|  PREDICTED: probable receptor protein kinase ...    240   3e-85    
ref|XP_008463160.1|  PREDICTED: probable receptor protein kinase ...    303   1e-84    
ref|NP_001067829.1|  Os11g0448000                                       301   2e-84    
ref|XP_009102141.1|  PREDICTED: probable receptor protein kinase ...    289   4e-84    
emb|CDP01661.1|  unnamed protein product                                301   5e-84    
gb|EAY92972.1|  hypothetical protein OsI_14767                          300   6e-84    
emb|CDY07484.1|  BnaA07g25630D                                          300   1e-83    
pdb|4HQ1|A  Chain A, Crystal Structure Of An Lrr Protein With Two...    288   2e-83    
ref|XP_003616214.1|  Kinase-like protein                                299   3e-83    
ref|XP_010556225.1|  PREDICTED: probable receptor protein kinase ...    298   4e-83    
ref|XP_009594248.1|  PREDICTED: probable receptor protein kinase ...    298   1e-82    
ref|XP_006300693.1|  hypothetical protein CARUB_v10019739mg             297   1e-82    
emb|CAA69028.1|  TMK                                                    296   6e-82    
ref|XP_008678122.1|  PREDICTED: probable receptor protein kinase ...    295   6e-82    
emb|CDY39246.1|  BnaC06g27450D                                          295   8e-82    
ref|XP_009775667.1|  PREDICTED: probable receptor protein kinase ...    295   8e-82    
gb|ACN59264.1|  leucine-rich repeat receptor-like protein kinase        294   1e-81    
ref|NP_176789.1|  transmembrane kinase 1                                294   1e-81    
gb|AAP04161.1|  putative receptor protein kinase (TMK1)                 294   1e-81    
ref|XP_006391349.1|  hypothetical protein EUTSA_v10018085mg             294   1e-81    
ref|XP_010105561.1|  putative receptor protein kinase TMK1              294   2e-81    
emb|CDY36253.1|  BnaC07g21070D                                          292   4e-81    
ref|XP_010415157.1|  PREDICTED: probable receptor protein kinase ...    292   8e-81    
ref|XP_008670729.1|  PREDICTED: probable receptor protein kinase ...    292   9e-81    
ref|XP_010511542.1|  PREDICTED: probable receptor protein kinase ...    292   1e-80    
gb|ABF98558.1|  Protein kinase domain containing protein, expressed     292   1e-80    
ref|XP_002450707.1|  hypothetical protein SORBIDRAFT_05g012530          291   2e-80    
ref|XP_008343073.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    291   2e-80    
ref|XP_004503323.1|  PREDICTED: probable receptor protein kinase ...    290   2e-80    
ref|XP_009124646.1|  PREDICTED: probable receptor protein kinase ...    278   4e-80    
ref|XP_006663422.1|  PREDICTED: probable receptor protein kinase ...    288   5e-80    
ref|XP_002887010.1|  hypothetical protein ARALYDRAFT_475717             290   5e-80    
ref|XP_007045490.1|  Leucine-rich repeat protein kinase family pr...    289   1e-79    
ref|XP_010470484.1|  PREDICTED: probable receptor protein kinase ...    287   4e-79    
gb|EAZ28375.1|  hypothetical protein OsJ_12355                          285   1e-78    
ref|XP_010910643.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    286   1e-78    
ref|XP_002312477.1|  hypothetical protein POPTR_0008s13710g             284   6e-78    
ref|XP_009769564.1|  PREDICTED: probable receptor protein kinase ...    283   1e-77    
ref|XP_010512392.1|  PREDICTED: probable receptor protein kinase ...    201   1e-77    
ref|XP_002520629.1|  Protein kinase APK1A, chloroplast precursor,...    268   2e-77    
gb|EPS68163.1|  hypothetical protein M569_06603                         224   5e-77    
ref|XP_008809243.1|  PREDICTED: probable receptor protein kinase ...    281   5e-77    
ref|XP_004979222.1|  PREDICTED: probable receptor protein kinase ...    281   6e-77    
dbj|BAD95052.1|  putative receptor-like protein kinase                  202   1e-76    
emb|CDP06852.1|  unnamed protein product                                280   1e-76    
gb|KDP38160.1|  hypothetical protein JCGZ_04803                         279   2e-76    
ref|NP_173869.1|  leucine-rich repeat protein kinase family protein     275   5e-75    
ref|XP_008644567.1|  PREDICTED: probable receptor protein kinase ...    276   5e-75    
gb|AAG03120.1|AC004133_14  F5A9.23                                      275   8e-75    
emb|CDY50111.1|  BnaC01g43590D                                          261   3e-74    
ref|XP_002463990.1|  hypothetical protein SORBIDRAFT_01g010110          273   3e-74    
ref|XP_011010010.1|  PREDICTED: probable receptor protein kinase ...    273   4e-74    
gb|EEC76074.1|  hypothetical protein OsI_13294                          271   4e-74    
ref|XP_010907800.1|  PREDICTED: probable receptor protein kinase ...    272   9e-74    
ref|XP_006448115.1|  hypothetical protein CICLE_v10017453mg             265   2e-73    
emb|CDY18093.1|  BnaA01g23540D                                          265   3e-72    
ref|XP_009625585.1|  PREDICTED: probable receptor protein kinase ...    266   1e-71    
ref|XP_010109186.1|  putative receptor protein kinase TMK1              265   3e-71    
ref|XP_009767007.1|  PREDICTED: probable receptor protein kinase ...    265   4e-71    
ref|XP_002532551.1|  Serine/threonine-protein kinase PBS1, putative     264   5e-71    
ref|XP_006854639.1|  hypothetical protein AMTR_s00030p00189200          264   7e-71    
gb|KDP36118.1|  hypothetical protein JCGZ_08762                         263   8e-71    
ref|XP_010468419.1|  PREDICTED: probable receptor protein kinase ...    197   2e-70    
ref|XP_010685432.1|  PREDICTED: probable receptor protein kinase ...    262   3e-70    
gb|EAZ29677.1|  hypothetical protein OsJ_13738                          258   8e-70    
ref|XP_002305223.1|  hypothetical protein POPTR_0004s08230g             260   9e-70    
ref|XP_006430067.1|  hypothetical protein CICLE_v10010999mg             260   1e-69    
emb|CBI24423.3|  unnamed protein product                                259   2e-69    
ref|XP_010651647.1|  PREDICTED: probable receptor protein kinase ...    258   4e-69    
ref|NP_001131017.1|  uncharacterized LOC100192365 precursor             258   6e-69    
ref|XP_008230180.1|  PREDICTED: probable receptor protein kinase ...    258   8e-69    
gb|EYU20650.1|  hypothetical protein MIMGU_mgv1a022135mg                257   9e-69    
ref|XP_008230166.1|  PREDICTED: probable receptor protein kinase ...    257   1e-68    
gb|KDP23101.1|  hypothetical protein JCGZ_00527                         257   1e-68    
gb|KDO70607.1|  hypothetical protein CISIN_1g002150mg                   257   1e-68    
ref|XP_008230174.1|  PREDICTED: probable receptor protein kinase ...    257   1e-68    
ref|XP_006481595.1|  PREDICTED: probable receptor protein kinase ...    256   2e-68    
gb|KHN21189.1|  Putative receptor protein kinase TMK1-like protein      256   2e-68    
gb|KEH40667.1|  receptor-like kinase                                    256   2e-68    
ref|XP_007015693.1|  Leucine-rich repeat protein kinase family pr...    256   3e-68    
ref|XP_006592356.1|  PREDICTED: probable receptor protein kinase ...    256   3e-68    
gb|KFK27996.1|  hypothetical protein AALP_AA8G458100                    245   4e-68    
gb|KHG14431.1|  putative receptor protein kinase TMK1                   255   5e-68    
ref|XP_006591063.1|  PREDICTED: probable receptor protein kinase ...    255   6e-68    
ref|XP_011042042.1|  PREDICTED: probable receptor protein kinase ...    255   7e-68    
gb|KHN19921.1|  Putative receptor protein kinase TMK1                   254   7e-68    
ref|XP_002313480.2|  hypothetical protein POPTR_0009s02550g             254   7e-68    
gb|KHN08792.1|  Putative receptor protein kinase TMK1                   167   7e-68    
ref|NP_001051079.2|  Os03g0717000                                       253   8e-68    
ref|XP_002867400.1|  predicted protein                                  237   9e-68    
ref|XP_008665300.1|  PREDICTED: probable receptor protein kinase ...    254   1e-67    
gb|KHG06891.1|  putative receptor protein kinase TMK1                   253   2e-67    
ref|XP_008241052.1|  PREDICTED: probable receptor protein kinase ...    253   2e-67    
ref|XP_009369824.1|  PREDICTED: probable receptor protein kinase ...    253   2e-67    
ref|XP_004303383.1|  PREDICTED: probable receptor protein kinase ...    253   2e-67    
ref|XP_008795571.1|  PREDICTED: probable receptor protein kinase ...    253   2e-67    
ref|NP_001238095.1|  protein kinase precursor                           253   5e-67    
ref|XP_009369830.1|  PREDICTED: probable receptor protein kinase ...    252   5e-67    
ref|XP_004241337.1|  PREDICTED: probable receptor protein kinase ...    252   6e-67    
ref|XP_006361096.1|  PREDICTED: probable receptor protein kinase ...    251   8e-67    
ref|XP_009138235.1|  PREDICTED: probable receptor protein kinase ...    191   9e-67    
ref|XP_006576140.1|  PREDICTED: protein kinase isoform X1               251   9e-67    
ref|XP_010247019.1|  PREDICTED: probable receptor protein kinase ...    251   1e-66    
gb|KHG03667.1|  putative receptor protein kinase TMK1                   249   3e-66    
ref|XP_002489035.1|  hypothetical protein SORBIDRAFT_0343s002010        250   3e-66    
ref|XP_007203232.1|  hypothetical protein PRUPE_ppa000956mg             249   4e-66    
ref|XP_007162969.1|  hypothetical protein PHAVU_001G195500g             249   5e-66    
ref|XP_011090307.1|  PREDICTED: probable receptor protein kinase ...    249   5e-66    
ref|XP_003559550.1|  PREDICTED: probable receptor protein kinase ...    240   8e-66    
ref|XP_008442915.1|  PREDICTED: probable receptor protein kinase ...    248   1e-65    
ref|XP_011042599.1|  PREDICTED: probable receptor protein kinase ...    248   1e-65    
ref|XP_011046412.1|  PREDICTED: probable receptor protein kinase ...    247   2e-65    
dbj|BAF79934.1|  receptor-like kinase                                   247   2e-65    
ref|XP_002987123.1|  hypothetical protein SELMODRAFT_269219             246   4e-65    
ref|XP_010451120.1|  PREDICTED: probable receptor protein kinase ...    239   4e-65    
ref|XP_004136513.1|  PREDICTED: probable receptor protein kinase ...    246   5e-65    
ref|XP_010040349.1|  PREDICTED: probable receptor protein kinase ...    236   6e-65    
ref|XP_002322788.2|  hypothetical protein POPTR_0016s07120g             246   6e-65    
ref|XP_010092554.1|  putative receptor protein kinase TMK1              246   6e-65    
emb|CDP10601.1|  unnamed protein product                                245   7e-65    
ref|XP_002976216.1|  hypothetical protein SELMODRAFT_175461             245   8e-65    
gb|KHF97860.1|  putative receptor protein kinase TMK1                   244   8e-65    
ref|XP_010059098.1|  PREDICTED: probable receptor protein kinase ...    245   1e-64    
gb|KHN17972.1|  Putative receptor protein kinase TMK1                   244   1e-64    
ref|XP_006592774.1|  PREDICTED: probable receptor protein kinase ...    245   1e-64    
gb|EPS70502.1|  hypothetical protein M569_04241                         244   1e-64    
ref|XP_004494248.1|  PREDICTED: probable receptor protein kinase ...    244   1e-64    
emb|CBI30387.3|  unnamed protein product                                159   2e-64    
ref|XP_010031559.1|  PREDICTED: probable receptor protein kinase ...    244   2e-64    
gb|EYU36035.1|  hypothetical protein MIMGU_mgv1a000849mg                244   2e-64    
ref|XP_007150032.1|  hypothetical protein PHAVU_005G120300g             244   3e-64    
gb|KEH24239.1|  receptor-kinase-like protein                            244   3e-64    
ref|XP_007027970.1|  Leucine-rich repeat protein kinase family pr...    244   3e-64    
ref|XP_006481539.1|  PREDICTED: probable receptor protein kinase ...    244   3e-64    
ref|XP_010907801.1|  PREDICTED: probable receptor protein kinase ...    242   4e-64    
ref|XP_010474163.1|  PREDICTED: probable receptor protein kinase ...    238   4e-64    
ref|XP_010262996.1|  PREDICTED: probable receptor protein kinase ...    243   4e-64    
ref|XP_004487454.1|  PREDICTED: probable receptor protein kinase ...    243   6e-64    
ref|XP_002309250.1|  hypothetical protein POPTR_0006s22000g             243   6e-64    
ref|XP_010247002.1|  PREDICTED: probable receptor protein kinase ...    242   7e-64    
gb|KEH29775.1|  receptor kinase TMK1-like protein                       243   7e-64    
gb|ADV29672.1|  receptor-like protein kinase 2.33                       237   8e-64    
gb|KDO58246.1|  hypothetical protein CISIN_1g041143mg                   242   9e-64    
ref|XP_006424117.1|  hypothetical protein CICLE_v10027751mg             242   9e-64    
gb|KHN48414.1|  Putative receptor protein kinase TMK1                   241   1e-63    
ref|XP_007145792.1|  hypothetical protein PHAVU_007G268200g             241   2e-63    
ref|XP_009374103.1|  PREDICTED: probable receptor protein kinase ...    241   2e-63    
gb|EYU18122.1|  hypothetical protein MIMGU_mgv1a000918mg                241   2e-63    
ref|XP_006588868.1|  PREDICTED: probable receptor protein kinase ...    241   2e-63    
ref|XP_009764038.1|  PREDICTED: probable receptor protein kinase ...    241   2e-63    
ref|XP_003518187.1|  PREDICTED: probable receptor protein kinase ...    241   2e-63    
gb|KHN02583.1|  Putative receptor protein kinase TMK1                   241   2e-63    
ref|XP_008380290.1|  PREDICTED: probable receptor protein kinase ...    241   3e-63    
gb|AAT96698.1|  putative LRR-like protein kinase 4                      221   4e-63    
ref|XP_004506220.1|  PREDICTED: probable receptor protein kinase ...    240   4e-63    
ref|XP_009420192.1|  PREDICTED: probable receptor protein kinase ...    239   5e-63    
ref|XP_010557995.1|  PREDICTED: probable receptor protein kinase ...    236   5e-63    
gb|ADV29685.1|  receptor-like protein kinase 2.33                       235   6e-63    
gb|ADV29666.1|  receptor-like protein kinase 2.33                       235   6e-63    
gb|ADV29671.1|  receptor-like protein kinase 2.33                       235   6e-63    
gb|ADV29670.1|  receptor-like protein kinase 2.33                       235   6e-63    
ref|XP_006348472.1|  PREDICTED: probable receptor protein kinase ...    239   7e-63    
gb|ADV29667.1|  receptor-like protein kinase 2.33                       234   8e-63    
ref|XP_010543834.1|  PREDICTED: probable receptor protein kinase ...    239   8e-63    
ref|XP_004293117.1|  PREDICTED: probable receptor protein kinase ...    239   1e-62    
gb|AAX38298.1|  receptor-like protein kinase                            234   2e-62    
ref|XP_009349030.1|  PREDICTED: probable receptor protein kinase ...    238   2e-62    
ref|XP_008360596.1|  PREDICTED: probable receptor protein kinase ...    238   2e-62    
gb|ADV29714.1|  receptor-like protein kinase 2.33                       233   2e-62    
ref|XP_009767611.1|  PREDICTED: probable receptor protein kinase ...    238   2e-62    
ref|XP_009383147.1|  PREDICTED: probable receptor protein kinase ...    238   3e-62    
ref|XP_010557993.1|  PREDICTED: probable receptor protein kinase ...    238   3e-62    
ref|XP_004228606.1|  PREDICTED: probable receptor protein kinase ...    238   3e-62    
ref|XP_011077805.1|  PREDICTED: probable receptor protein kinase ...    237   3e-62    
gb|ADV29742.1|  receptor-like protein kinase 2.33                       233   4e-62    
gb|ACL52740.1|  unknown                                                 231   4e-62    
ref|XP_009419412.1|  PREDICTED: probable receptor protein kinase ...    237   4e-62    
gb|AAX38303.1|  receptor-like protein kinase                            232   4e-62    
gb|ADV29729.1|  receptor-like protein kinase 2.33                       232   4e-62    
gb|ADV29694.1|  receptor-like protein kinase 2.33                       232   5e-62    
ref|XP_009393396.1|  PREDICTED: probable receptor protein kinase ...    237   5e-62    
gb|ADV29684.1|  receptor-like protein kinase 2.33                       232   5e-62    
gb|ADV29668.1|  receptor-like protein kinase 2.33                       232   5e-62    
gb|AAX38300.1|  receptor-like protein kinase                            232   5e-62    
gb|ABW22245.1|  putative receptor-like protein kinase                   232   5e-62    
ref|XP_007027971.1|  Leucine-rich repeat protein kinase family pr...    235   5e-62    
gb|ADV29679.1|  receptor-like protein kinase 2.33                       232   5e-62    
gb|ABW22232.1|  putative receptor-like protein kinase                   232   6e-62    
gb|AEO52909.1|  putative receptor-like protein kinase                   232   6e-62    
ref|XP_001783311.1|  predicted protein                                  236   6e-62    
ref|XP_009612396.1|  PREDICTED: probable receptor protein kinase ...    236   7e-62    
gb|ABW22221.1|  putative receptor-like protein kinase                   232   7e-62    
gb|ADV29716.1|  receptor-like protein kinase 2.33                       232   7e-62    
gb|AAX38306.1|  receptor-like protein kinase                            232   8e-62    
gb|ADV29726.1|  receptor-like protein kinase 2.33                       232   8e-62    
gb|ABW22219.1|  putative receptor-like protein kinase                   231   8e-62    
gb|ADV29657.1|  receptor-like protein kinase 2.33                       231   8e-62    
gb|ACL54632.1|  unknown                                                 231   8e-62    
gb|ACL54527.1|  unknown                                                 233   8e-62    
gb|AEO52816.1|  putative receptor-like protein kinase                   231   9e-62    
gb|AAX38301.1|  receptor-like protein kinase                            231   9e-62    
gb|ADV29713.1|  receptor-like protein kinase 2.33                       231   9e-62    
gb|ABW22220.1|  putative receptor-like protein kinase                   231   9e-62    
gb|AAX38305.1|  receptor-like protein kinase                            231   9e-62    
gb|AEO52808.1|  putative receptor-like protein kinase                   231   9e-62    
gb|ABW22223.1|  putative receptor-like protein kinase                   231   1e-61    
gb|ADV29718.1|  receptor-like protein kinase 2.33                       231   1e-61    
gb|ADV29740.1|  receptor-like protein kinase 2.33                       231   1e-61    
gb|ADV29687.1|  receptor-like protein kinase 2.33                       231   1e-61    
ref|XP_010485099.1|  PREDICTED: probable receptor protein kinase ...    227   1e-61    
ref|XP_004487455.1|  PREDICTED: probable receptor protein kinase ...    234   1e-61    
gb|ADV29682.1|  receptor-like protein kinase 2.33                       231   1e-61    
ref|XP_003596879.1|  Receptor-like protein kinase                       236   1e-61    
gb|ABW22229.1|  putative receptor-like protein kinase                   231   1e-61    
gb|ABW22218.1|  putative receptor-like protein kinase                   231   1e-61    



>ref|XP_009604417.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=927

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/743 (65%), Positives = 573/743 (77%), Gaps = 45/743 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             +F DDAAVMSKLLAALSPAPSGWS+ K  C+WT+V+CDK +G VVSINIDSQS+SG+LPS
Sbjct  27    TFSDDAAVMSKLLAALSPAPSGWSSDKPFCSWTDVSCDKSSGTVVSINIDSQSLSGSLPS  86

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L QL++L++LSVQKNSLSGPLPSFANM+ L E+YLD+N+F+S+P DFLLGLP+L+ FSI
Sbjct  87    DLNQLSNLKTLSVQKNSLSGPLPSFANMTKLAEIYLDNNQFTSVPQDFLLGLPSLQTFSI  146

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             S+NG+LSPWQI  YL ES++LG+  ASNASI GVIP+FFD+FPNLQ+LRLSYNN TG LP
Sbjct  147   SENGKLSPWQIPLYLTESSNLGTILASNASIFGVIPDFFDAFPNLQDLRLSYNNFTGFLP  206

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SFG SEI+NLWLNNQ QGLSGTIDVI +MT+LSQVWL AN+F+GPIPDLSKC N+FDLQ
Sbjct  207   ASFGGSEIRNLWLNNQFQGLSGTIDVIENMTQLSQVWLHANSFSGPIPDLSKCENIFDLQ  266

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCD  1748
             L DNQ TGV+P S+ GLP L NI LQNNKL GPMP F + +KV LG TNSFC+ TPGPCD
Sbjct  267   LRDNQFTGVIPDSVMGLPKLVNITLQNNKLQGPMPQFKDGIKVQLGTTNSFCQSTPGPCD  326

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQVTALL  AGG GYP TLA+SW GND C+ W++I+CD  GKNV     G ++FSG ISP
Sbjct  327   PQVTALLEVAGGFGYPETLAESWIGNDPCKGWSYISCD--GKNVAVATFGKRQFSGFISP  384

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ L SLR L LNDNNLTG IP  LTTL  LQ +DV+NNNLS PLP F   +  ++GGN
Sbjct  385   AFANLISLRTLLLNDNNLTGSIPGILTTLSKLQTIDVTNNNLSGPLPVFRSGIKFTYGGN  444

Query  1387  LLLEKTVATGRGS---------PGSGQTENGS---SMSARMfvvvvivvvivvlvvlfvF  1244
             LLL K  + G GS            G T  GS   ++SA M + VVI VVI VLVVLFV 
Sbjct  445   LLLGKNSSDGGGSGGSPGSNSSTDGGNTSGGSKKSTVSAGMIIGVVISVVIFVLVVLFVS  504

Query  1243  YKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIMGT-------------------------  1139
             YKCY+KR HKRFGR ++PE   S QM+K N + GT                         
Sbjct  505   YKCYIKRRHKRFGRVETPEG--SNQMVKPNVVSGTNGYAGVPSELQSQSSGDHSEMPVFE  562

Query  1138  ----AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNE  971
                 AI IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNE
Sbjct  563   GGNVAISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNE  622

Query  970   FQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQ  791
             FQAEIA L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTL  HLFEW++ G+  LTWKQ
Sbjct  623   FQAEIAVLTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLSQHLFEWQELGYPLLTWKQ  682

Query  790   RVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVE  611
             RVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K  VE
Sbjct  683   RVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGKYSVE  742

Query  610   TRVAGTFGYLAPEYATTGRVTKK  542
             TR+AGTFGYLAPEYA TGRVT K
Sbjct  743   TRLAGTFGYLAPEYAATGRVTTK  765


 Score =   163 bits (412),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 100/149 (67%), Gaps = 3/149 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVTW
Sbjct  740  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVTW  799

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NL+KAID TLDPDE+TFESI+KVAELA HCT  + ++RP+M H VNVL P 
Sbjct  800  FRRVLINKDNLRKAIDQTLDPDEETFESIAKVAELAGHCTAREPFQRPDMGHAVNVLAPL  859

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
               W+  R E   ++  G DL+MSLP + 
Sbjct  860  VELWKPTRNE---DEDSGIDLHMSLPQIL  885



>ref|XP_004247890.2| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=929

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/747 (65%), Positives = 567/747 (76%), Gaps = 45/747 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S +F DDA VMSKLLAALSP PSGWS SK  C+WTNV CDK +  V SIN+DSQS+SG+L
Sbjct  21    SFTFSDDADVMSKLLAALSPTPSGWSTSKPFCSWTNVICDKSSATVTSINLDSQSVSGSL  80

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PSE+TQL++L++LS+QKN LSGPLPSFANMS L +L+LD+N+F+S+P DFLLG+P+L   
Sbjct  81    PSEITQLSNLKTLSLQKNKLSGPLPSFANMSKLADLFLDNNQFTSVPQDFLLGVPSLVTL  140

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SIS+N  LSPWQI  YL EST+LGS +ASNASI GVIP+FFD FPNLQNLRLSYNNLTGS
Sbjct  141   SISENAGLSPWQIPMYLTESTNLGSLYASNASIVGVIPDFFDVFPNLQNLRLSYNNLTGS  200

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SFG SEI NLWLNNQ +GLSG+IDVI SMT+LSQVWL AN+FTG IPDLSKC N+FD
Sbjct  201   LPASFGGSEIMNLWLNNQVKGLSGSIDVIGSMTQLSQVWLHANSFTGSIPDLSKCENIFD  260

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DNQ TG+VP S+  LP L NI LQNN+L GPMP F + V+V LG TNSFCKDTPGP
Sbjct  261   LQLRDNQFTGIVPESVMSLPKLLNITLQNNRLQGPMPQFKDGVEVKLGTTNSFCKDTPGP  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LL  AGG GYP++LA+SWKGNDAC +W+FI+CD  GKNV  V LG + FSGTI
Sbjct  321   CDPQVTTLLDVAGGFGYPLSLAESWKGNDACNSWSFISCDTTGKNVAVVTLGKRGFSGTI  380

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPAF+ LTSLR+L+LNDNNLTG IP  LTTLP+LQVLDVSNNNLS P+P FPP V  +  
Sbjct  381   SPAFANLTSLRSLFLNDNNLTGTIPERLTTLPNLQVLDVSNNNLSGPIPLFPPRVKFNHN  440

Query  1393  GNLLLEKTVAT-----------GRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfv  1247
             GNL L   + T                G   +      S  M V VVI VV+ VLVVLFV
Sbjct  441   GNLFLGTNITTGDDGGGNGSGSNSSGQGGSSSGGSKGPSVGMIVGVVIAVVLFVLVVLFV  500

Query  1246  FYKCYMKREHKRFGRAKSPEKIKSTQMLK----------------TNEIMG---------  1142
              YKCYMKR HKRFGR ++P+  KS +M+K                T+E+           
Sbjct  501   SYKCYMKRRHKRFGRVETPK--KSNEMVKPSLPSVVGGSNRYTGGTSELQSQSSGDHSEI  558

Query  1141  -------TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                     AI IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TK
Sbjct  559   PVFENGNVAISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTK  618

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             GMNEFQAEIA L+KVRH++LVAL+G C+N ++ LLVYEYM  GTL  HLFEW++ G+ PL
Sbjct  619   GMNEFQAEIAVLTKVRHRHLVALLGSCVNGNERLLVYEYMPQGTLSQHLFEWQELGYKPL  678

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K
Sbjct  679   TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGK  738

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
               VETR+AGTFGYLAPEYA TGRVT K
Sbjct  739   YSVETRLAGTFGYLAPEYAATGRVTTK  765


 Score =   163 bits (413),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVTW
Sbjct  740  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVTW  799

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +L+KAID TLDPD++T+ESISKVAELA HCT  + ++RP+M H VNVLGP 
Sbjct  800  FRRVLINKESLRKAIDSTLDPDDETYESISKVAELAGHCTAREPFQRPDMGHAVNVLGPL  859

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    E+  + +G  DL+MSLP
Sbjct  860  VEQWKPTTSEDD-DGYGIIDLDMSLP  884



>ref|XP_006360918.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=932

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/750 (66%), Positives = 572/750 (76%), Gaps = 48/750 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S +F DDA VMSKLLAALSP PSGWS SK  C+WTNV CDK +  V SIN+DSQS+SG+L
Sbjct  21    SFTFSDDADVMSKLLAALSPTPSGWSTSKPFCSWTNVICDKSSATVTSINLDSQSVSGSL  80

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PSE+TQL++L++LS+QKN LSGPLPSFANMS L EL+LD+N+F+S+P DFLLG+PNL   
Sbjct  81    PSEITQLSNLKTLSLQKNKLSGPLPSFANMSKLAELFLDNNQFTSVPQDFLLGVPNLVTL  140

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SIS+NG LSPWQI  YL EST+LGS +ASNASI GVIP+FFD FPNLQNLRLSYNNLTGS
Sbjct  141   SISENGRLSPWQIPIYLTESTNLGSLYASNASIVGVIPDFFDVFPNLQNLRLSYNNLTGS  200

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SFG SEI NLWLNNQ +GLSG+IDVI SMT+LSQVWL AN+FTG IPDLSKC N+FD
Sbjct  201   LPASFGGSEIMNLWLNNQVKGLSGSIDVIGSMTQLSQVWLHANSFTGSIPDLSKCENIFD  260

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DNQ TG+VP S+  LP L NI LQNN+L GP+P F + V+V L  TNSFCKDTPGP
Sbjct  261   LQLRDNQFTGIVPESVMSLPKLLNITLQNNRLQGPIPQFKDGVEVKLETTNSFCKDTPGP  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LL  AGG GYP++LA+SWKGNDAC +W+FI+CD  GKNV  V LG + FSGTI
Sbjct  321   CDPQVTTLLDVAGGFGYPLSLAESWKGNDACNSWSFISCDTTGKNVAVVTLGKRGFSGTI  380

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPAF+ LTSLR+L+LNDNNLTG IP  LTTLP LQVLDVSNNNLS P+P FPP V  +  
Sbjct  381   SPAFANLTSLRSLFLNDNNLTGTIPERLTTLPSLQVLDVSNNNLSGPIPLFPPRVKFTHT  440

Query  1393  GNLLLEKTVATGRGSPGSGQTENGSSMSAR--------------Mfvvvvivvvivvlvv  1256
             GNL L   + TG    GSG   +GS+ S R              M V VVI VV+ VLVV
Sbjct  441   GNLFLGTNITTGGDGGGSGSDGSGSNSSGRGGSSSGGSKGPSVGMIVGVVIAVVLFVLVV  500

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKIKSTQMLK----------------TNEIMG------  1142
             LFV YKCYMKR HKRFGR ++PE  KS +M+K                T+E+        
Sbjct  501   LFVSYKCYMKRHHKRFGRVETPE--KSNEMVKPSLPSVVGGSNGYTGGTSELQSQSSGDH  558

Query  1141  ----------TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGAT  992
                        AI IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA 
Sbjct  559   SEIPVFENGNVAISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAM  618

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
              TKGMNEFQAEIA L+KVRH++LVAL+G C+N ++ LLVYEYM  GTL  HLFEW++ G+
Sbjct  619   GTKGMNEFQAEIAVLTKVRHRHLVALLGSCVNGNERLLVYEYMPQGTLSQHLFEWQELGY  678

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PLTWKQRVTIA DVARG+EYLHSL  QSFIHRD+K  NILL DD+RAKVADFGLV+ AP
Sbjct  679   KPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPLNILLGDDMRAKVADFGLVRNAP  738

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             D K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  739   DGKYSVETRLAGTFGYLAPEYAATGRVTTK  768


 Score =   164 bits (415),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVTW
Sbjct  743  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVTW  802

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NL+KAID TLDPD++T+ESISKV+ELA HCT  + ++RP+M H VNVLGP 
Sbjct  803  FRRVLINKENLRKAIDSTLDPDDETYESISKVSELAGHCTAREPFQRPDMGHAVNVLGPL  862

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    E+  + +G  DL+MSLP
Sbjct  863  VEQWKPTTSEDD-DGYGIIDLDMSLP  887



>ref|XP_009777291.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=893

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/736 (65%), Positives = 568/736 (77%), Gaps = 47/736 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MSKLLAALSPAPSGWS+ K  C+WT+VNCDK +  VVSINIDSQS+SG+LPS+L QL++L
Sbjct  1     MSKLLAALSPAPSGWSSDKSFCSWTDVNCDKSSATVVSINIDSQSLSGSLPSDLNQLSNL  60

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             ++LSVQKNSLSGPLPSFANM+ L E+YLD+N+F+S+P DFLLG+P+L+ FSI++NG+LSP
Sbjct  61    KTLSVQKNSLSGPLPSFANMTKLAEIYLDNNQFTSVPQDFLLGVPSLQSFSINENGKLSP  120

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             WQI  +L ES +LG+  ASNASI GVIP+FFD+FPNLQ+LRLSYNN TGSLP SFG SEI
Sbjct  121   WQIPLHLTESGNLGTILASNASIFGVIPDFFDAFPNLQDLRLSYNNFTGSLPASFGGSEI  180

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             +NLWLNNQ QGLSGTIDVI +MT+LSQVWL AN+F+GPIPDLSKC N+FDLQL DNQ TG
Sbjct  181   RNLWLNNQFQGLSGTIDVIENMTQLSQVWLHANSFSGPIPDLSKCENIFDLQLRDNQFTG  240

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             V+P S+  LP L NI LQNNKL GPMP F + VKV LG TNSFC+ TPGPCDPQV AL+ 
Sbjct  241   VIPDSVMRLPKLVNITLQNNKLQGPMPHFKDGVKVQLGTTNSFCQSTPGPCDPQVAALVE  300

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
              AGG GYP+TLA+SW GND C+ W++I+CD  GKNV     G ++FSG ISPAF+ LTSL
Sbjct  301   VAGGFGYPMTLAESWIGNDPCKGWSYISCD--GKNVAVATFGKRQFSGFISPAFANLTSL  358

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVA  1364
             R L LNDNNLTG IP +LTTLP LQ +DV+NNNLS P+P F   V  ++GGNLLL K  +
Sbjct  359   RTLLLNDNNLTGSIPETLTTLPKLQAIDVTNNNLSGPMPVFRSGVKFTYGGNLLLGKNSS  418

Query  1363  TGRGSPG-------------SGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
              G GS G             SG ++  S++SA M V VVI VV+ VLVVLFV YKCY+KR
Sbjct  419   DGGGSGGSPGSNSSSDGGNTSGGSKK-STVSAGMIVGVVISVVVFVLVVLFVSYKCYIKR  477

Query  1222  EHKRFGRAKSPEKIKSTQMLKTNEIMGT-----------------------------AIK  1130
              HKRFGR ++PE   S QM+K + + GT                             AI 
Sbjct  478   RHKRFGRVETPEG--SNQMVKPSVVNGTNGYAGVPSELQSQSSGDHSEMPVFEGGNVAIS  535

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQAEIA 
Sbjct  536   IQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQAEIAV  595

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTL  HLFEW++ G+  LTWKQRVTI  D
Sbjct  596   LTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLSQHLFEWQELGYPLLTWKQRVTITLD  655

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K  VETR+AGTF
Sbjct  656   VARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGKYSVETRLAGTF  715

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA TGRVT K
Sbjct  716   GYLAPEYAATGRVTTK  731


 Score =   163 bits (412),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 100/149 (67%), Gaps = 3/149 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVTW
Sbjct  706  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVTW  765

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NL+KAID TLDPDE+TFESI+KVAELA HCT  + ++RP+M H VNVL P 
Sbjct  766  FRRVLINKDNLRKAIDQTLDPDEETFESIAKVAELAGHCTAREPFQRPDMGHAVNVLAPL  825

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
               W+  R E   ++  G DL+MSLP + 
Sbjct  826  VELWKPTRNE---DEDSGIDLHMSLPQIL  851



>ref|XP_009794479.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Nicotiana 
sylvestris]
Length=934

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/747 (64%), Positives = 569/747 (76%), Gaps = 48/747 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DDA+VMSKLL++LSP PSGWS S+  C+W NVNCDK +  V SIN+DSQS+SG+LP EL 
Sbjct  25    DDASVMSKLLSSLSPPPSGWSTSQPFCSWKNVNCDKSSTTVTSINLDSQSVSGSLPPELN  84

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             QL++L++LSVQ N LSGPLPSF+NMS+L E++LD+N+F+S+P  FLLG+PNL   SIS+N
Sbjct  85    QLSNLKTLSVQNNQLSGPLPSFSNMSNLAEIFLDNNQFTSVPQGFLLGVPNLVTLSISEN  144

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
             G+LSPWQI +YL EST+LGSF+ASN+SI GVIP+FFDSFPNL NLRLSYNNLTGSLP SF
Sbjct  145   GKLSPWQIPTYLTESTNLGSFYASNSSIIGVIPDFFDSFPNLMNLRLSYNNLTGSLPASF  204

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
               SEI+NLWLNNQ +GLSGTI+VI +MT+LSQVWL AN+FTG IPDLS C ++FDLQL D
Sbjct  205   RGSEIRNLWLNNQLKGLSGTINVIENMTQLSQVWLHANSFTGSIPDLSNCESIFDLQLRD  264

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQV  1739
             NQ TGVVP S+  LP L NI LQNNKL GPMP F + VK  LG TNSFCKD+PGPCDPQV
Sbjct  265   NQFTGVVPESVMTLPKLLNITLQNNKLQGPMPQFKDGVKFNLGTTNSFCKDSPGPCDPQV  324

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
             TALL  A G GYP++LA+SWKGNDAC++W+FI+CD   KNVT  NLG + FSGTISPAF 
Sbjct  325   TALLDVASGFGYPVSLAESWKGNDACKDWSFISCDTTRKNVTVANLGKRGFSGTISPAFV  384

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
             +LTSLRNL+LNDNNLTG IP SLTTLP+LQVLDVSNNNLS P+P FP +V  +  GNL L
Sbjct  385   KLTSLRNLFLNDNNLTGTIPESLTTLPNLQVLDVSNNNLSGPIPLFPASVKFTHTGNLFL  444

Query  1378  EKTV--------ATGRGSPGSGQTENGS------SMSARMfvvvvivvvivvlvvlfvFY  1241
              K +        + G GS      EN S      S+SA M   VVI  V+ VLVVLFV Y
Sbjct  445   GKNISSGGGGSGSGGSGSNSGSPGENSSGGSKRPSVSAGMIAGVVIAAVVFVLVVLFVSY  504

Query  1240  KCYMKREHKRFGRAKSPEKIKS--TQMLKTN--EIMG-----------------------  1142
             KCYMKR HKRFGR ++PEK      +M+K+    ++G                       
Sbjct  505   KCYMKRRHKRFGRVETPEKSNEMVNEMVKSTVPSVVGGSNGYTGVPSELQSQSSGDHSEI  564

Query  1141  -------TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                     AI IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ G    K
Sbjct  565   PVFEGGNIAISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGPMGNK  624

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             GMNEFQAEIA L+KVRH++LVAL+G C+N ++ LLVYEYM  GTL  HLFEW++ G+ PL
Sbjct  625   GMNEFQAEIAVLTKVRHRHLVALLGSCVNGNERLLVYEYMPQGTLSQHLFEWQEFGYKPL  684

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TWK+RVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K
Sbjct  685   TWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGK  744

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
               VETR+AGTFGYLAPEYA TGRVT K
Sbjct  745   YSVETRLAGTFGYLAPEYAATGRVTTK  771


 Score =   170 bits (430),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW E ++I +     V ++ + + Q F         +++   +R ++ D+   +      
Sbjct  685  TWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGK  744

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVT
Sbjct  745  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVT  804

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL+KAIDP LDPD++T+ESISKVAELA HCT  + ++RP+M H VNVLGP
Sbjct  805  WFRRVLISKDNLRKAIDPILDPDDETYESISKVAELAGHCTAREPFQRPDMGHAVNVLGP  864

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+  R E+  +   G DL+MSLP
Sbjct  865  LVEQWKPTRNED--DDGYGIDLDMSLP  889



>ref|XP_011101591.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=931

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/742 (64%), Positives = 562/742 (76%), Gaps = 42/742 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             S  DD+AVM K L++LSPAPSGWS+S   C WTNVNCD  +  V +IN++S S+SG+LP 
Sbjct  29    SAADDSAVMLKFLSSLSPAPSGWSSSTPFCNWTNVNCDSTSTYVTAINLNSASVSGSLPP  88

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             EL QL+ L+SL+VQKNSLSG LPSF NM+SLE++YLD+N F+S+P +FLLGL NL+IFSI
Sbjct  89    ELNQLSQLKSLAVQKNSLSGTLPSFENMTSLEQIYLDNNGFTSVPNNFLLGLTNLQIFSI  148

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             S N +LSPWQI SYL +ST+L +F+ASNASI G IP+ F SFPNLQNLRLSYN+L GSLP
Sbjct  149   SKNMKLSPWQIPSYLTDSTNLVTFYASNASIVGYIPDIFGSFPNLQNLRLSYNDLNGSLP  208

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             GSF  SEIQNLWLNNQ++GLSG IDV+++MT+L QVWL AN F+G IPDLSKC NLFDLQ
Sbjct  209   GSFSGSEIQNLWLNNQKRGLSGGIDVLANMTQLYQVWLHANNFSGGIPDLSKCTNLFDLQ  268

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCD  1748
             L DN+ TGVVP SL  LPNL NI LQNNKL GP P F ++V+V +G TNSFC D PGPCD
Sbjct  269   LRDNRFTGVVPPSLMNLPNLVNITLQNNKLQGPFPQFPSRVEVTIGTTNSFCLDKPGPCD  328

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQVT LL  AG LGYP++LA+SW GN+ACQ+W  I CD QG NVT VN+G Q FSG+ISP
Sbjct  329   PQVTTLLEVAGALGYPMSLAESWLGNNACQDWRLINCDSQGTNVTVVNMGKQGFSGSISP  388

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LTSLR L LNDNNLTG IP  LTTLP LQ  DVSNNNLS P+P FPP V  ++ GN
Sbjct  389   AFANLTSLRTLVLNDNNLTGVIPGVLTTLPQLQTFDVSNNNLSGPIPVFPPRVKFTYAGN  448

Query  1387  LLLEKTVATGRGSPGSGQTENGS-----------SMSARMfvvvvivvvivvlvvlfvFY  1241
             LLL K  + G G  G+     GS           S SA + V V++ VVI V V+LFV Y
Sbjct  449   LLLGKNTSDGGGGAGAPGANPGSPDGSTSGSSKKSSSAGIIVGVIVAVVIFVGVLLFVSY  508

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLK---TNEIMGTA----------------------  1136
             KCY+KR HKRFGR +  E+ K  +++K   TN + G A                      
Sbjct  509   KCYVKRRHKRFGRVEGSEQGK--ELVKPNVTNGLNGYAGVPSELQSQSSGDHSEIPVFEG  566

Query  1135  ----IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                 I IQVL + TN FSEE+VLG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEF
Sbjct  567   GNITISIQVLRQVTNNFSEENVLGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEF  626

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
             QAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTLG HLFEW++HG+ PL+WKQR
Sbjct  627   QAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLGQHLFEWQEHGYQPLSWKQR  686

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             VTIA DVARG+EYLHSL  QSFIHRD+K SNILL+DD+RAKVADFGLVK APD K  VET
Sbjct  687   VTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVKNAPDGKYSVET  746

Query  607   RVAGTFGYLAPEYATTGRVTKK  542
             R+AGTFGYLAPEYA TGRVT K
Sbjct  747   RLAGTFGYLAPEYAATGRVTTK  768


 Score =   169 bits (429),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 125/207 (60%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            +W + ++I +     V ++ + + Q F         ++++  +R ++ D+   K      
Sbjct  682  SWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVKNAPDGK  741

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVT
Sbjct  742  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVT  801

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL+K+IDP LDPD++T+ESI KVAELA HCT  + ++RP+M H VNVLGP
Sbjct  802  WFRRVLINKDNLRKSIDPILDPDDETYESICKVAELAGHCTAREPFQRPDMGHAVNVLGP  861

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+  +PEE  E   G DL+MSLP
Sbjct  862  LVEQWKPSKPEE--EDGYGIDLHMSLP  886



>ref|XP_006349904.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=921

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/739 (61%), Positives = 543/739 (73%), Gaps = 42/739 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD+ VMS  L  LS  PSGW ASK  C W+ VNCDK +  VVSIN+DSQ +SG LPS+L 
Sbjct  23    DDSTVMSNFLKGLSKPPSGWDASKSYCDWSKVNCDKSSNTVVSINLDSQGLSGVLPSDLN  82

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             QL++L++LSVQ+NSLSG LPSFANMS+L E+YL+ N F+S+P DFLLGL +L+IFSIS+N
Sbjct  83    QLSNLKTLSVQRNSLSGVLPSFANMSNLAEIYLNDNGFTSVPQDFLLGLTSLQIFSISEN  142

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
             G+LSPWQI SYL +S +L + +AS+AS+ GVIP+F   FPNLQ+LRLSYNN TGSLP SF
Sbjct  143   GKLSPWQIPSYLIDSNNLVNVYASHASLFGVIPDFLGKFPNLQDLRLSYNNFTGSLPASF  202

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
             G SEI+NLWLNNQ +GLSGTIDVISSM +LSQVWL AN+FTGPIP+LSKC N+FDLQL D
Sbjct  203   GDSEIKNLWLNNQVKGLSGTIDVISSMFQLSQVWLHANSFTGPIPNLSKCENIFDLQLRD  262

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQV  1739
             N  TGV+P S+  LPNL NI L+NNKL GPMP F  +VKV +  TNSFC DTP PC+ QV
Sbjct  263   NDFTGVIPDSVMKLPNLLNISLKNNKLQGPMPEFRKEVKVEIEGTNSFCLDTPRPCNSQV  322

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL  AGG GYP  LA SWKGNDAC  W+ ++CD   KNV  V LG  R SG ISPAF+
Sbjct  323   MTLLDVAGGFGYPGFLADSWKGNDACNGWSHVSCDGSKKNVDVVTLGKLRLSGFISPAFA  382

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
             +LTSLRNL+LNDNNLTG IP SL  LP L  LDVSNNNLS P+P+F   V +  GGN+ L
Sbjct  383   KLTSLRNLFLNDNNLTGSIPESLAALPMLLTLDVSNNNLSGPVPAFRSNVKLINGGNVFL  442

Query  1378  EKTVATGRGSPGSGQTENGSS------------MSARMfvvvvivvvivvlvvlfvFYKC  1235
              K ++ GRGS GS  + + S             +   +   VVI VVI +LV+L+V YKC
Sbjct  443   GKNISDGRGSGGSPGSGSSSDGGNSSGGSKGSSVQPGVVAGVVISVVIFILVLLYVSYKC  502

Query  1234  YMKREHKRFGRAKSPEKIKSTQMLKTNEIMG----------------------------T  1139
             Y++R HKRFGR ++PE+  S  M+K   ++G                             
Sbjct  503   YIRRRHKRFGRVQNPER--SNDMVKPGVVIGNGYAGVPSELQSQSSGDHSEMPIFEGGNV  560

Query  1138  AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAE  959
             AI  QVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQAE
Sbjct  561   AISFQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQAE  620

Query  958   IAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTI  779
             IA L+KVRH++LVAL+G C+N ++ LLVYEYM  GTL  HLFEW++HG   LTWKQRVTI
Sbjct  621   IAVLTKVRHRHLVALLGSCVNGNERLLVYEYMPQGTLSQHLFEWQEHGCPILTWKQRVTI  680

Query  778   AWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVA  599
             A DVARG+EYLHSL   SFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+A
Sbjct  681   ALDVARGVEYLHSLAQTSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLA  740

Query  598   GTFGYLAPEYATTGRVTKK  542
             GTFGYLAPEYA TGRVT K
Sbjct  741   GTFGYLAPEYAATGRVTTK  759


 Score =   163 bits (412),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 3/149 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DETLPDE  HLVTW
Sbjct  734  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETLPDERSHLVTW  793

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
              +++    NL+KAIDPTLDPDE+T+ESI KVAELA HCT  + ++RP+M H VNVL P 
Sbjct  794  LRRVLVNKDNLRKAIDPTLDPDEETYESICKVAELAGHCTAREPFQRPDMGHAVNVLAPL  853

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
               W+  R E   ++  G DL MSLP + 
Sbjct  854  VELWKPTRNE---DEDSGIDLQMSLPQIL  879



>emb|CDP15110.1| unnamed protein product [Coffea canephora]
Length=900

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/741 (62%), Positives = 536/741 (72%), Gaps = 51/741 (7%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MSKLLAALSP PSGW ++K  C WTNVNCD     V SIN+DSQS+SG LP EL QL+SL
Sbjct  1     MSKLLAALSPNPSGWDSTKPFCRWTNVNCDSTNKFVTSINLDSQSLSGTLPPELGQLSSL  60

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +S+S+QKNSLSG LPSFAN++SLE +YLD N FSS+P DFLLG  NL+  SIS+N  L+P
Sbjct  61    QSVSLQKNSLSGALPSFANLTSLESVYLDFNSFSSVPSDFLLGCSNLQTLSISENYNLAP  120

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             WQI  YL  S++L +F+ASNASI G IP+FFDSFPNLQ+LRLSYNN+TG LP SFG SEI
Sbjct  121   WQIPLYLTGSSNLQTFYASNASIVGGIPDFFDSFPNLQSLRLSYNNITGGLPNSFGGSEI  180

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
              NLWLNNQ    SG IDV+SSMT++ QVWL ANAFTGPIPDLSKC NLFDLQL DNQLTG
Sbjct  181   TNLWLNNQGL--SGGIDVLSSMTQIYQVWLHANAFTGPIPDLSKCTNLFDLQLRDNQLTG  238

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             VVP SL  LP L NI L NNKL GP+P F + V   LG TNSFC  TPGPCDPQVTALLA
Sbjct  239   VVPPSLMNLPKLANITLSNNKLQGPVPQFRDGVDAKLGSTNSFCGTTPGPCDPQVTALLA  298

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
              AGG GYP+ LAQSW+GN++C +W+F+TCDPQGKNVT V+LG Q  SG ISPAF+ LTSL
Sbjct  299   VAGGFGYPMLLAQSWQGNNSCDHWSFVTCDPQGKNVTMVSLGKQHLSGIISPAFANLTSL  358

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK---  1373
             RNLYLNDNNL G +P  LTTLP LQ +DVSNNNL+ P P FP  V   + GNLLLEK   
Sbjct  359   RNLYLNDNNLNGTVPEVLTTLPQLQTIDVSNNNLAGPRPVFPSTVKFVYTGNLLLEKNQT  418

Query  1372  ---------------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
                            +     GSP    +  GSS+SA M   VV  V++ V V+LFV YK
Sbjct  419   AGGSGSGGGTPGGAPSSGASGGSPSGSGSSKGSSVSAGMIAGVVGAVIVFVGVLLFVSYK  478

Query  1237  CYMKREHKRFGRAKSPEKIKSTQMLKTNEIMG----------------------------  1142
             CY K+  K FGR    EK   ++M K N + G                            
Sbjct  479   CYAKKRVKSFGRVAGSEK--GSEMSKPNVVGGLNGYGGVPSEIQSQSSSDHTEIPIFEGG  536

Query  1141  -TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQ  965
               +I IQVL + TN FSE++VLG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQ
Sbjct  537   NVSIPIQVLRQVTNNFSEDNVLGKGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQ  596

Query  964   AEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRV  785
             +EIA L+KVRH++LVAL+GYC N  + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRV
Sbjct  597   SEIAVLTKVRHRHLVALLGYCTNGSERLLVYEYMPQGTLAQHLFEWQELGYPPLTWKQRV  656

Query  784   TIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETR  605
             TIA DV RG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ AP     VETR
Sbjct  657   TIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPTGNYSVETR  716

Query  604   VAGTFGYLAPEYATTGRVTKK  542
             +AGTFGYLAPEYA TGRVT K
Sbjct  717   LAGTFGYLAPEYAATGRVTTK  737


 Score =   159 bits (401),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 123/207 (59%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   +     N
Sbjct  651  TWKQRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPTGN  710

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+ DE  HLVT
Sbjct  711  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMSDERSHLVT  770

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N++KAID TL PD++T+ESI KVAELA HCT  + ++RP+M H VNVLGP
Sbjct  771  WFRRVLINKDNIRKAIDSTLGPDDETYESICKVAELAGHCTAREPHQRPDMGHAVNVLGP  830

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+  + +E  E+  G DL+MSLP
Sbjct  831  LVEQWKPAKNDE--EESYGIDLHMSLP  855



>ref|XP_004252979.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=921

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/744 (62%), Positives = 543/744 (73%), Gaps = 42/744 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S++F DD+AVMS  L  LS  PSGW ASK  C W+ V CDK +  VVSIN+DSQ +SG L
Sbjct  18    SLTFSDDSAVMSNFLKGLSKPPSGWDASKPYCDWSKVTCDKSSNTVVSINLDSQGLSGVL  77

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PSEL QL++L+ LSVQ+NSLSG LPSFANMS+L E+YL+ N F+S+P DFLLGL +L+IF
Sbjct  78    PSELNQLSNLKILSVQRNSLSGVLPSFANMSNLAEIYLNDNGFTSVPQDFLLGLTSLQIF  137

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SIS+N +LSPWQI SYL +S +L + +ASNAS+ GVIP+F   FPNLQ+LRLSYNN TGS
Sbjct  138   SISENWKLSPWQIPSYLIDSNNLITVYASNASLFGVIPDFLGKFPNLQDLRLSYNNFTGS  197

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SFG SEI+NLWLNNQ +GLSGTIDVISSM +LSQVWL AN+FTGPIPDLSKC ++ D
Sbjct  198   LPASFGDSEIKNLWLNNQVKGLSGTIDVISSMVQLSQVWLHANSFTGPIPDLSKCESISD  257

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DN  TGV+P S+  LPNL +I LQNNKL GPMP FGNKVKV +G TNSFC D PGP
Sbjct  258   LQLRDNDFTGVIPDSVMNLPNLLSISLQNNKLQGPMPQFGNKVKVEIGSTNSFCLDIPGP  317

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD QV  LL  AGG GYP  LA SWKGNDAC  W+ ++CD   K V  V LG  R SG I
Sbjct  318   CDSQVMTLLDVAGGFGYPGFLADSWKGNDACNGWSHVSCDGSKKKVDVVTLGKLRLSGFI  377

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPAF++LTSLRNL LNDNNLTG IP SL  LP LQ LDVSNNNLS P+P+F   V    G
Sbjct  378   SPAFAKLTSLRNLLLNDNNLTGSIPESLAALPMLQTLDVSNNNLSGPVPAFRSNVKFING  437

Query  1393  GNLLLEKTVATGRGSPGSGQTENGSSMSAR------------Mfvvvvivvvivvlvvlf  1250
             GN+ L K ++ G GS GS  + + S                 +   VVI V I +LVVL+
Sbjct  438   GNVFLGKNISDGGGSGGSPGSGSSSDGGNSSGGSKGSSVQLGVVAGVVISVFIFILVVLY  497

Query  1249  vFYKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIMG------------------------  1142
             V YKCY++R HKRFGR ++PE+  S  M+K   ++G                        
Sbjct  498   VSYKCYIRRRHKRFGRVQNPER--SNDMVKPGLVIGNGYAGVPSELQSQSSGDHTEMPIF  555

Query  1141  ----TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
                   I IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMN
Sbjct  556   EGGNVVISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMN  615

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQAEIA L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTL  HLFEW++HG   LTWK
Sbjct  616   EFQAEIAVLTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLSQHLFEWQEHGCPTLTWK  675

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             QRVTIA DVARG+EYLHSL   SFIHRD+K SNILL DD+RAKVADFGLVK APD K  V
Sbjct  676   QRVTIALDVARGVEYLHSLAQTSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSV  735

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  736   ETRLAGTFGYLAPEYAATGRVTTK  759


 Score =   162 bits (411),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 98/149 (66%), Gaps = 3/149 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DETLPDE  HLVTW
Sbjct  734  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETLPDERSHLVTW  793

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
              +++    NL+KAIDPTLDPDE+T+ESI KVAELA HCT  + ++RP+M H VNVL P 
Sbjct  794  LRRVLVNKDNLRKAIDPTLDPDEETYESICKVAELAGHCTAREPFQRPDMGHAVNVLAPL  853

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
               W+  R E   ++  G DL MSLP + 
Sbjct  854  VELWKPTRNE---DEDSGIDLQMSLPQIL  879



>gb|EYU31524.1| hypothetical protein MIMGU_mgv1a001083mg [Erythranthe guttata]
Length=893

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/728 (60%), Positives = 530/728 (73%), Gaps = 51/728 (7%)
 Frame = -2

Query  2593  APSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSL  2414
             AP+GWS+S   C W  V CD  + +VV ++++S +ISG+LP E+ QL+ LR+L+VQKNSL
Sbjct  11    APTGWSSSTSFCKWPGVTCDS-SSSVVDLDLNSAAISGSLPPEINQLSQLRTLAVQKNSL  69

Query  2413  SGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAES  2234
             +G LPSF NM+SLE +YLD+N F+S+P +FLLGL NL+ FSIS+N +L PWQI SYL +S
Sbjct  70    TGTLPSFQNMTSLEAIYLDNNAFTSLPENFLLGLTNLQTFSISENTKLPPWQIPSYLTDS  129

Query  2233  TSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnlwlnnqqq  2054
              +L  FFASNAS+TG IP+ F SFPNLQNLRLSYNNLTGSLPGSF  SEIQNLWLNNQQQ
Sbjct  130   ANLAGFFASNASLTGTIPDIFGSFPNLQNLRLSYNNLTGSLPGSFSGSEIQNLWLNNQQQ  189

Query  2053  gLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLP  1874
             GLSGTIDV+++MT+L+QVWL AN+F+G IPDLSKC NLFDLQL DN+ TGV+P SL  LP
Sbjct  190   GLSGTIDVLANMTQLAQVWLHANSFSGGIPDLSKCTNLFDLQLRDNRFTGVIPPSLMNLP  249

Query  1873  NLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPIT  1694
             +L NI LQNNKL GP P F  KVK  +G TNSFC D PGPCDPQV+ LL  AG LGYP+ 
Sbjct  250   SLLNITLQNNKLQGPFPQFPTKVKTTIGTTNSFCLDAPGPCDPQVSTLLDIAGALGYPMP  309

Query  1693  LAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNN  1517
             LA+SWKGN+AC  +W FI CD Q KNVT+V +G Q F GTISPAF+ L SLR+L L+DN+
Sbjct  310   LAESWKGNNACSGDWRFINCDSQLKNVTSVTMGRQGFYGTISPAFANLASLRSLVLSDNH  369

Query  1516  LTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK------------  1373
             LTG IP  LT L  LQ LDVSNN+LS P+P FP  V  +  GNL+L K            
Sbjct  370   LTGVIPSELTALTQLQTLDVSNNDLSGPIPVFPSTVKFTSTGNLMLGKNDTSGGGGGGGA  429

Query  1372  -TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAK  1196
                   R S  S +     S+S  +   VVI V++ V V+LFV YKCY+K+ H RFGR +
Sbjct  430   PPGGPNRSSTASSK----KSVSPALIAGVVIAVLVFVGVLLFVSYKCYIKKRHTRFGRVQ  485

Query  1195  SPEKIKSTQMLKTNEIMGT------------------------------AIKIQVLEKAT  1106
               E  K  +++K N   GT                              +I IQVL + T
Sbjct  486   GSENGK--ELVKPNSTNGTNGFGGSHSELQSQSSGDYSEAISSFEGGNVSISIQVLRQVT  543

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKN  926
             + F+ ++VLG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQAEI  L+KVRH++
Sbjct  544   DNFNPKNVLGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQAEIGVLTKVRHRH  603

Query  925   LVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYL  746
             LVAL+GYC+N ++ LLVYEYM  GTLG HLFEW++  + PLTWKQRVT+A DVARG+EYL
Sbjct  604   LVALLGYCVNGNERLLVYEYMPQGTLGQHLFEWEELCYQPLTWKQRVTVALDVARGVEYL  663

Query  745   HSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYA  566
             HSL  QSFIHRD+K SNILL+DD+RAKVADFGLVK APD K  +ET++AGTFGYLAPEYA
Sbjct  664   HSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVKNAPDGKYSLETKLAGTFGYLAPEYA  723

Query  565   TTGRVTKK  542
              TGRVT K
Sbjct  724   ATGRVTTK  731


 Score =   170 bits (430),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 13/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +++ +     V ++ + + Q F         ++++  +R ++ D+   K      
Sbjct  645  TWKQRVTVALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVKNAPDGK  704

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL  +L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVT
Sbjct  705  YSLETKLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVT  764

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL+K+ID  LDPDE+T+ESI KVAELA HCT  + ++RP M H VNVLGP
Sbjct  765  WFRRVLINKDNLRKSIDSLLDPDEETYESICKVAELAGHCTAREPFQRPEMGHAVNVLGP  824

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+  +PE   E  GG DL+MSLP
Sbjct  825  LVEQWKPSKPE---EDDGGIDLHMSLP  848



>gb|EYU32717.1| hypothetical protein MIMGU_mgv1a001138mg [Erythranthe guttata]
Length=880

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/715 (60%), Positives = 533/715 (75%), Gaps = 23/715 (3%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MSKLL++LSP P+GWS++ + C WTNV CD     V +I++DS ++SG LP EL QL  L
Sbjct  1     MSKLLSSLSPPPTGWSSATNFCNWTNVKCDPTNSFVTAIDLDSAAVSGTLPPELNQLTQL  60

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +SL++QKNS++G LPSF N+++L+++ LD N F+SIP +FLLGL NL+ FSIS N +LSP
Sbjct  61    QSLNLQKNSITGTLPSFQNITTLQQILLDDNSFTSIPDNFLLGLTNLQTFSISQNYKLSP  120

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W+I +YL+EST+L +FFASN+++ G IP+FF+ FPNLQNLRLSYN+LTGSLPGS   SEI
Sbjct  121   WEIPNYLSESTNLVNFFASNSTLKGTIPDFFNFFPNLQNLRLSYNDLTGSLPGSLSGSEI  180

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             QNLWLNNQ QGLSGTI+V+S+MT+LSQVWL ANAF+G IPDLS C NLFDLQL DN+ TG
Sbjct  181   QNLWLNNQIQGLSGTINVLSNMTQLSQVWLHANAFSGGIPDLSTCENLFDLQLRDNKFTG  240

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             +VP SL  LPNL NI +QNN+L GP P F +KV+  +G TNSFC + PGPCDPQV+ LL 
Sbjct  241   IVPPSLMNLPNLVNITMQNNRLQGPYPEFSSKVEATIGITNSFCLEKPGPCDPQVSLLLD  300

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
              AG LGYP+ LA SWKGN+ CQNW F+ CD  GKN+T VN+  Q FSGTISP+F+ LTSL
Sbjct  301   IAGSLGYPLLLADSWKGNNPCQNWRFVNCDSLGKNITIVNMARQGFSGTISPSFANLTSL  360

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVA  1364
             RNL LNDN L+G IP  LT+LP LQ LDVSNNNLS  +  FP  V  ++GGN LL K  +
Sbjct  361   RNLVLNDNKLSGSIPSVLTSLPQLQNLDVSNNNLSGEILVFPANVKFNYGGNSLLGKNES  420

Query  1363  TG--RGSPGSGQTENGSSMSAR----MfvvvvivvvivvlvvlfvFYKCYMKREHKRFGR  1202
              G   G+  +    +GSS  A     M V V++ V I V VV+FV YK ++KR  K  GR
Sbjct  421   QGCCDGAGANPMNADGSSSKASSSIGMIVGVILAVSIFVGVVMFVSYKVHLKRRGKIIGR  480

Query  1201  AKSPE----KIKSTQMLKTN-----------EIMGTAIKIQVLEKATNFFseesvlgsgg  1067
              +  E    K K+  M+KT            E M  +  I++L + TN F EE++LG GG
Sbjct  481   VEGLEEGKGKPKTNFMIKTQSQNSGDHSQKGESM-NSFSIEILRQVTNNFGEENILGRGG  539

Query  1066  ygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHK  887
             +GVVY G + NGTK+AVK+M+ GA  TKG+ EF++EIA L+KVRH++LVAL+GYCIN ++
Sbjct  540   FGVVYKGVMVNGTKIAVKRMESGAA-TKGLKEFESEIAVLTKVRHRHLVALLGYCINGNE  598

Query  886   MLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDI  707
              LLVYEYM  GTL  HLFE +  G D L+WKQRVT+A DVARG+EYLHSL  QSFIHRD+
Sbjct  599   RLLVYEYMPQGTLAQHLFERQDLGCDSLSWKQRVTVALDVARGVEYLHSLAQQSFIHRDL  658

Query  706   KSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K SNILL+DD+RAKVADFGLVK APD    VETR+AGTFGYLAPEYA TGRVT K
Sbjct  659   KPSNILLSDDMRAKVADFGLVKNAPDGNCSVETRLAGTFGYLAPEYAATGRVTTK  713


 Score =   161 bits (407),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 123/211 (58%), Gaps = 11/211 (5%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            +W + +++ +     V ++ + + Q F         ++++  +R ++ D+   K     N
Sbjct  627  SWKQRVTVALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVKNAPDGN  686

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+P E  HLVT
Sbjct  687  CSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPYEKSHLVT  746

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++I    NL+K+IDP L+PD+ T+ESI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  747  WFRRVIVSKDNLKKSIDPILEPDDATYESICKVAELAGHCTAREPYQRPDMGHAVNVLGP  806

Query  261  FAHNWRSLRP-EEIVEKFGGFDLNMSLPLVF  172
                W   RP EE      G DL+M+LP + 
Sbjct  807  LVERWMPTRPEEEEASSSSGIDLHMNLPQIL  837



>ref|XP_010246532.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=928

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/746 (57%), Positives = 526/746 (71%), Gaps = 48/746 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S++  DDAA+M+KL A+LSP PS WS + DPC WT VNCD     + +I++ S+S++G L
Sbjct  23    SLAVADDAAIMNKLAASLSPTPSDWSGN-DPCKWTGVNCDA-NERITAISLASKSLTGTL  80

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PS+L QL  L+ L++Q N +SGPLPS AN+++L+E+YLDSN F+S+P  FL GL NL+I 
Sbjct  81    PSDLNQLTQLKILALQNNHISGPLPSLANLTNLQEVYLDSNNFTSVPDSFLTGLDNLQIL  140

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SIS+N  L+PW I   L +S SL + +AS +++ G IP+ F S PNLQ++RLSYNNLTGS
Sbjct  141   SISENSNLAPWSIPLDLGKSASLVTLYASKSNVMGTIPDIFGSLPNLQSVRLSYNNLTGS  200

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S++QNLWLNNQ  GLSGTIDV+ +M +LSQVWL AN F+GPIPDLSKC +LFD
Sbjct  201   LPPSLNGSDVQNLWLNNQADGLSGTIDVLGTMAQLSQVWLHANKFSGPIPDLSKCTSLFD  260

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DNQ TG +P +L  LPNL N+ LQNNKL GP P F + V V++G TN+FC   PGP
Sbjct  261   LQLRDNQFTGTIPETLMSLPNLLNVTLQNNKLQGPYPQFKSNVNVVVGTTNNFCNQKPGP  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVTALLA AGG GYP++L+ +W GNDACQ W+F+TC  QGKNV+ +NLG Q  SGTI
Sbjct  321   CDPQVTALLALAGGFGYPVSLSDAWDGNDACQGWSFVTC--QGKNVSVINLGKQHLSGTI  378

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             S A + LTSLRNLYLNDNNLTGPIP +LT L  LQ LDV+NNNL+  +P FP +V +   
Sbjct  379   SSAIANLTSLRNLYLNDNNLTGPIPSALTGLTQLQTLDVTNNNLTGKIPDFPQSVTLKTS  438

Query  1393  GNLLL----------------EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvl  1262
             GN LL                     +  GSP      N  S+S  M    VI VVI + 
Sbjct  439   GNPLLGIDSSSGSGSGGNSGSSSGANSPGGSPSDSPKTN--SVSPGMIAGTVIAVVIFLC  496

Query  1261  vvlfvFYKCYMKREHKRFGRAKSP---------------------EKIKSTQMLKTNEIM  1145
             VV FVFYKC  K++H++F R + P                      ++ S     T+EI 
Sbjct  497   VVFFVFYKCCTKKKHQKFSRVQGPSSNGKEVVKNGVIGMNGFGVASELHSQSSGDTSEIQ  556

Query  1144  -----GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKG  980
                     I IQVL + TN FSEE++LG GG+GVVY G L +GT++AVK+M+     TKG
Sbjct  557   FFEGGNVVIPIQVLRQVTNNFSEENILGRGGFGVVYKGILHDGTQIAVKRMESTVMGTKG  616

Query  979   MNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLT  800
             MNEF+AEI  L+KVRH++LVAL+G+CIN ++ LLVYEYM  GTLG HLFEW +HG+ PLT
Sbjct  617   MNEFKAEIGVLTKVRHRHLVALLGFCINGNERLLVYEYMPQGTLGQHLFEWNEHGYLPLT  676

Query  799   WKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKS  620
             WKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL D +RAKVADFGLVK APD K 
Sbjct  677   WKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDSMRAKVADFGLVKNAPDGKY  736

Query  619   FVETRVAGTFGYLAPEYATTGRVTKK  542
              VETR+AGTFGYLAPEYA TGRVT K
Sbjct  737   SVETRLAGTFGYLAPEYAATGRVTTK  762


 Score =   156 bits (395),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  676  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDSMRAKVADFGLVKNAPDGK  735

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+DET+P+E  HLVT
Sbjct  736  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDETVPEERSHLVT  795

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N++KAID TLDPDE+TF +I KVAELA HCT  +  +RP+M H VNVLGP
Sbjct  796  WFRRVLINKDNIRKAIDTTLDPDEETFVNICKVAELAGHCTAREPVQRPDMGHAVNVLGP  855

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+M+LP
Sbjct  856  LVEQWKPSSQEE--EESYGIDLHMTLP  880



>ref|XP_010650399.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=927

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/744 (57%), Positives = 518/744 (70%), Gaps = 44/744 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDK---PTGNVVSINIDSQSISGN  2477
             +  DDAAVM  L   LS  PSGW+ S D C+W  +NC       G V +IN+ S+ +SG 
Sbjct  23    ALADDAAVMDNLRKGLSSTPSGWTGS-DFCSWEGINCGNTGDSNGRVTAINMASKGLSGT  81

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRI  2297
             LPS+L QL+ L +LS Q NSLSG LPS AN+  L+++YL+SN F+SI  DF   L +L+ 
Sbjct  82    LPSDLNQLSQLVTLSFQSNSLSGSLPSLANLQFLQDIYLNSNNFTSIDKDFFTNLTSLQT  141

Query  2296  FSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTG  2117
              S+ +N +L+PW I   L++S SL  F+ASNA+I G IP++F S P+L  LRLSYNNL G
Sbjct  142   VSLGENPDLAPWSIPDGLSQSKSLAIFYASNANIEGSIPDWFGSMPSLNELRLSYNNLNG  201

Query  2116  SLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             SLP S   + IQ LW+NNQQ GLSGTIDV+++M  L QVWLQANAFTGPIPDLS C  LF
Sbjct  202   SLPSSLPGTSIQKLWMNNQQSGLSGTIDVLAAMPDLRQVWLQANAFTGPIPDLSNCTQLF  261

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG  1757
             DLQL DNQ TG+VP SLT LP L NI L+NNKL GP+P F   V V L D N FC+ + G
Sbjct  262   DLQLRDNQFTGIVPSSLTSLPKLVNITLKNNKLQGPVPEFSTGVNVEL-DNNKFCRTSVG  320

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCD QVT LL  AG LGYP TLA SW+GNDAC  WAFI+CD QGKNVT VN   + F+GT
Sbjct  321   PCDSQVTTLLEVAGALGYPTTLADSWEGNDACNQWAFISCDTQGKNVTIVNFAKRGFTGT  380

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPAF+ LTSLRNLYLNDN LTG IP SLT+L  LQVLDVSNNNL+  +P F   V ++ 
Sbjct  381   ISPAFANLTSLRNLYLNDNKLTGSIPESLTSLTQLQVLDVSNNNLTGGIPKFGDGVKVTT  440

Query  1396  GGNLLL----------EKTVATGRGSPGS--GQTENGSSMSARMfvvvvivvvivvlvvl  1253
              GNLLL            +  T   SP      + NGS+ SA +   +V+ VVI + VVL
Sbjct  441   TGNLLLGNGTDSGSGDSPSSGTDTTSPSGTPAGSPNGSTPSAGVIAAIVVAVVIFIGVVL  500

Query  1252  fvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN---------------------------  1154
             FV YKCY++++HK+FGR  +PE  K   + K                             
Sbjct  501   FVSYKCYVRKQHKKFGRVDNPENGKEMVVNKVMGGMGGYGGVPSELHSQSSGDHSDIPVF  560

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E    AI IQVL + TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  TKGMN
Sbjct  561   EGGNIAISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESAAVGTKGMN  620

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQAEIA L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTLG HLF+W+++G+ PLTWK
Sbjct  621   EFQAEIAVLTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLGQHLFDWRENGYPPLTWK  680

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             QRVTIA DV RG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  V
Sbjct  681   QRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSV  740

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  741   ETRLAGTFGYLAPEYAATGRVTTK  764


 Score =   166 bits (420),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+DET+PDE  HLV+W
Sbjct  739  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDETMPDERSHLVSW  798

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NLQKAID TLDPDE+T  SI KVAELA HCT  + Y+RP M H VN+LGP 
Sbjct  799  FRRVLINKDNLQKAIDQTLDPDEETLASICKVAELAGHCTAREPYQRPEMGHAVNILGPL  858

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ +RP+E  ++  G DL+MSLP
Sbjct  859  VEQWKPVRPDE--DESYGIDLHMSLP  882



>emb|CAN69461.1| hypothetical protein VITISV_043132 [Vitis vinifera]
Length=921

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/744 (57%), Positives = 516/744 (69%), Gaps = 44/744 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDK---PTGNVVSINIDSQSISGN  2477
             +  DDAAVM  L   LS  PSGW+ S D C+W  +NC       G V +IN+ S+ +SG 
Sbjct  17    ALADDAAVMDNLRKGLSXTPSGWTGS-DFCSWEGINCGNTGDSNGXVTAINMASKGLSGT  75

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRI  2297
             LPS+L QL+ L +LS Q NSL G LPS AN+  L+++YL+SN F SI  DF   L +L+ 
Sbjct  76    LPSDLNQLSQLVTLSFQSNSLXGSLPSLANLQFLQBIYLNSNNFXSIDKDFFTNLTSLQT  135

Query  2296  FSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTG  2117
              S+ +N +L+PW I   L++S SL  F+ASNA+I G IP++F S P+L  LRLSYNNL G
Sbjct  136   VSLGENPDLAPWSIPDGLSQSKSLAIFYASNANIEGSIPDWFGSMPSLNELRLSYNNLNG  195

Query  2116  SLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             SLP S   + IQ LW+NNQQ GLSGTIDV+++M  L QVWLQANAFTGPIPDLS C  LF
Sbjct  196   SLPSSLPGTSIQKLWMNNQQSGLSGTIDVLAAMPDLXQVWLQANAFTGPIPDLSNCTQLF  255

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG  1757
             DLQL DNQ TG+VP SLT LP L NI L+NNKL GP+P F   V V L D N FC+ + G
Sbjct  256   DLQLRDNQFTGIVPSSLTSLPQLVNITLKNNKLQGPVPEFSTGVNVEL-DNNKFCRTSVG  314

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCD QVT LL  AG LGYP TLA SW+GNDAC  WAFI+CD QGKNVT VN   + F+GT
Sbjct  315   PCDSQVTTLLEVAGALGYPTTLADSWEGNDACBQWAFISCDTQGKNVTIVNFAKRGFTGT  374

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPAF+ LTSLRNLYLNDN LTG IP SLT+L  LQVLDVSNNNL+  +P F   V ++ 
Sbjct  375   ISPAFANLTSLRNLYLNDNKLTGSIPESLTSLTQLQVLDVSNNNLTGGIPKFGDGVKVTT  434

Query  1396  GGNLLL----------EKTVATGRGSPGS--GQTENGSSMSARMfvvvvivvvivvlvvl  1253
              GNLLL            +  T   SP      + NGS+ SA +   +V+ VVI + VVL
Sbjct  435   TGNLLLGNGTDSGSGDSPSSGTDTTSPSGTPAGSPNGSTPSAGVIAAIVVAVVIFIGVVL  494

Query  1252  fvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN---------------------------  1154
             FV YKCY++++HK+FGR  +PE  K   + K                             
Sbjct  495   FVSYKCYVRKQHKKFGRVDNPENGKEMVVNKVMGGMGGYGGVPSELHSQSSGDHSDIPVF  554

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E    AI IQVL + TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  TKGMN
Sbjct  555   EGGNIAISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESAAVGTKGMN  614

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQAEIA L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTLG HLF+W+++G+ PLTWK
Sbjct  615   EFQAEIAVLTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLGQHLFDWRENGYPPLTWK  674

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             QRVTIA DV RG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  V
Sbjct  675   QRVTIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSV  734

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  735   ETRLAGTFGYLAPEYAATGRVTTK  758


 Score =   166 bits (420),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+DET+PDE  HLV+W
Sbjct  733  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDETMPDERSHLVSW  792

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NLQKAID TLDPDE+T  SI KVAELA HCT  + Y+RP M H VN+LGP 
Sbjct  793  FRRVLINKDNLQKAIDQTLDPDEETLASICKVAELAGHCTAREPYQRPEMGHAVNILGPL  852

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ +RP+E  ++  G DL+MSLP
Sbjct  853  VEQWKPVRPDE--DESYGIDLHMSLP  876



>emb|CBI39413.3| unnamed protein product [Vitis vinifera]
Length=897

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/736 (57%), Positives = 512/736 (70%), Gaps = 44/736 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDK---PTGNVVSINIDSQSISGNLPSELTQL  2453
             M  L   LS  PSGW+ S D C+W  +NC       G V +IN+ S+ +SG LPS+L QL
Sbjct  1     MDNLRKGLSSTPSGWTGS-DFCSWEGINCGNTGDSNGRVTAINMASKGLSGTLPSDLNQL  59

Query  2452  ASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGE  2273
             + L +LS Q NSLSG LPS AN+  L+++YL+SN F+SI  DF   L +L+  S+ +N +
Sbjct  60    SQLVTLSFQSNSLSGSLPSLANLQFLQDIYLNSNNFTSIDKDFFTNLTSLQTVSLGENPD  119

Query  2272  LSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGS  2093
             L+PW I   L++S SL  F+ASNA+I G IP++F S P+L  LRLSYNNL GSLP S   
Sbjct  120   LAPWSIPDGLSQSKSLAIFYASNANIEGSIPDWFGSMPSLNELRLSYNNLNGSLPSSLPG  179

Query  2092  SEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQ  1913
             + IQ LW+NNQQ GLSGTIDV+++M  L QVWLQANAFTGPIPDLS C  LFDLQL DNQ
Sbjct  180   TSIQKLWMNNQQSGLSGTIDVLAAMPDLRQVWLQANAFTGPIPDLSNCTQLFDLQLRDNQ  239

Query  1912  LTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTA  1733
              TG+VP SLT LP L NI L+NNKL GP+P F   V V L D N FC+ + GPCD QVT 
Sbjct  240   FTGIVPSSLTSLPKLVNITLKNNKLQGPVPEFSTGVNVEL-DNNKFCRTSVGPCDSQVTT  298

Query  1732  LLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQL  1553
             LL  AG LGYP TLA SW+GNDAC  WAFI+CD QGKNVT VN   + F+GTISPAF+ L
Sbjct  299   LLEVAGALGYPTTLADSWEGNDACNQWAFISCDTQGKNVTIVNFAKRGFTGTISPAFANL  358

Query  1552  TSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL--  1379
             TSLRNLYLNDN LTG IP SLT+L  LQVLDVSNNNL+  +P F   V ++  GNLLL  
Sbjct  359   TSLRNLYLNDNKLTGSIPESLTSLTQLQVLDVSNNNLTGGIPKFGDGVKVTTTGNLLLGN  418

Query  1378  --------EKTVATGRGSPGS--GQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
                       +  T   SP      + NGS+ SA +   +V+ VVI + VVLFV YKCY+
Sbjct  419   GTDSGSGDSPSSGTDTTSPSGTPAGSPNGSTPSAGVIAAIVVAVVIFIGVVLFVSYKCYV  478

Query  1228  KREHKRFGRAKSPEKIKSTQMLKTN---------------------------EIMGTAIK  1130
             +++HK+FGR  +PE  K   + K                             E    AI 
Sbjct  479   RKQHKKFGRVDNPENGKEMVVNKVMGGMGGYGGVPSELHSQSSGDHSDIPVFEGGNIAIS  538

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             IQVL + TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  TKGMNEFQAEIA 
Sbjct  539   IQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESAAVGTKGMNEFQAEIAV  598

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             L+KVRH++LVAL+G+C+N ++ LLVYEYM  GTLG HLF+W+++G+ PLTWKQRVTIA D
Sbjct  599   LTKVRHRHLVALLGFCVNGNERLLVYEYMPQGTLGQHLFDWRENGYPPLTWKQRVTIALD  658

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             V RG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTF
Sbjct  659   VGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTF  718

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA TGRVT K
Sbjct  719   GYLAPEYAATGRVTTK  734


 Score =   166 bits (420),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+DET+PDE  HLV+W
Sbjct  709  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDETMPDERSHLVSW  768

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    NLQKAID TLDPDE+T  SI KVAELA HCT  + Y+RP M H VN+LGP 
Sbjct  769  FRRVLINKDNLQKAIDQTLDPDEETLASICKVAELAGHCTAREPYQRPEMGHAVNILGPL  828

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ +RP+E  ++  G DL+MSLP
Sbjct  829  VEQWKPVRPDE--DESYGIDLHMSLP  852



>ref|XP_010097979.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXB73709.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=925

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/745 (57%), Positives = 514/745 (69%), Gaps = 49/745 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPA-PSGWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
              DDA VMS   A + PA P  WS +   CT W  V CD  +G V++IN+  QS+ G LPS
Sbjct  23    ADDATVMSAFSAGIKPAAPLSWSDTSKLCTGWKGVKCDN-SGRVIAINLADQSLGGELPS  81

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L  L+ L +LS+Q NS SG LPS AN+SSL+E+YLDSN F+S+P     GL NL+  S+
Sbjct  82    DLNSLSQLVTLSLQGNSFSGALPSLANLSSLQEIYLDSNNFTSVPAGCFQGLTNLQKLSM  141

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             S N +L  W   + L +S+SL + +A + +I G IP+ F SF NLQ+LRLSYNNL GSLP
Sbjct  142   SQNLDLKSWSFPAELIDSSSLVTLYAGSCNIVGRIPDIFSSFTNLQDLRLSYNNLNGSLP  201

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SF  S IQ+LWLNNQQ GLSG +DV+S+MT+L QVWL  N FTGPIPDLS    LFDLQ
Sbjct  202   PSFAGSGIQHLWLNNQQVGLSGRVDVLSNMTQLYQVWLHKNQFTGPIPDLSNLDALFDLQ  261

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCD  1748
             L DN  TGV+  +L  + +L N+ L NNKL GP P F + VKV L  TNSFCK+T G CD
Sbjct  262   LRDNLFTGVISSTLMSISSLRNVSLANNKLQGPQPSFSSSVKVDLTGTNSFCKNTAGDCD  321

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQV+ L+A AG LGYP+ LA SWKGNDAC+ W+F+ CD  G NV TVN   + F+GTISP
Sbjct  322   PQVSTLIAIAGDLGYPMLLADSWKGNDACKEWSFLVCDSDG-NVITVNFQKRHFTGTISP  380

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LTSL+NL LNDN+LTGPIP SLT LP LQVLDVSNNNL+  +P FP  V ++  GN
Sbjct  381   AFANLTSLKNLLLNDNDLTGPIPHSLTQLPQLQVLDVSNNNLTGDVPKFPSRVKLTTTGN  440

Query  1387  LLLEKT---------------VATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvl  1253
             LLL KT                A   GSP    + N S  SA M   +VI V+I VLVVL
Sbjct  441   LLLGKTPSSGSGGSPSDSDSGSAAPAGSPAGSSSGNRS--SAGMIAGIVIAVIIFVLVVL  498

Query  1252  fvFYKCYMKREHKRFGRAKSPEK-----IKSTQMLKTNEIMG------------------  1142
             FV +KCY+K  HK+FGR ++PE      IKS  M  TN   G                  
Sbjct  499   FVLFKCYVKNRHKKFGRVENPENGKEMVIKSNVMGGTNGYNGVPSELQSQSSGDRSDFHI  558

Query  1141  -----TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
                    I IQVL + TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+  A  TKGM
Sbjct  559   FEGGNVTISIQVLRQVTNNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESAAVGTKGM  618

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
             NEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W+++G  PLTW
Sbjct  619   NEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWRENGLSPLTW  678

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
             KQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  
Sbjct  679   KQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYS  738

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             VETR+AGTFGYLAPEYA TGRVT K
Sbjct  739   VETRLAGTFGYLAPEYAATGRVTTK  763


 Score =   155 bits (393),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  677  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  736

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+++PDE  HLVT
Sbjct  737  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDSVPDERSHLVT  796

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KA+D TL+PDE+T ESI KVAELA HCT  + Y+RP+M H VN+LGP
Sbjct  797  WFRRVLINKENIPKAMDHTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNILGP  856

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  857  LVEQWKPTCHEE--EENYGIDLHMSLP  881



>ref|XP_009373574.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=924

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/740 (57%), Positives = 512/740 (69%), Gaps = 44/740 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD+ VMSKL A L PAP GWS S   C+W  VNCD  +  V SIN+ S+ +SG+LPS L
Sbjct  27    ADDSDVMSKLAAGLRPAPKGWSTSTAYCSWDGVNCDT-SKRVTSINLASKGLSGSLPSNL  85

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L +LS+Q NSLSG  PS AN+SSL+E+YLD+N F+SIP    +GL +L+I S+S 
Sbjct  86    NSLSQLTTLSLQSNSLSGAFPSLANLSSLQEVYLDTNNFTSIPAGCFMGLSSLQILSMSQ  145

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L  W   S L E++SL +F ASN ++ G +P+ FDSFPNLQNLRLSYNN TG L  +
Sbjct  146   NINLDSWVFPSELTEASSLVTFAASNVNLYGSLPDVFDSFPNLQNLRLSYNNFTGPLSKT  205

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQNLW+NNQ  GLSGT++V+++MT+LSQVWLQ N FTGPIPDLSKC  LFDLQL 
Sbjct  206   FSGSGIQNLWVNNQVLGLSGTVEVLANMTQLSQVWLQKNQFTGPIPDLSKCETLFDLQLR  265

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQ TG+VP +L  + +L+N+ L NNKL GPMP FG+ V+    D NSFC+ TPG CDP 
Sbjct  266   DNQFTGIVPATLMSISSLKNVSLDNNKLQGPMPAFGSTVEKSTVDGNSFCQTTPGTCDPL  325

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V  LL  AG  GYP+ LA SW GN  C  W+FI CDPQGK V TVN  N+ F+GTISPAF
Sbjct  326   VNTLLEVAGAFGYPVLLADSWTGNKPCSGWSFIVCDPQGK-VFTVNFDNKHFNGTISPAF  384

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NL L+ NNL G IP SL +L  LQ+LDVSNNNLS  +P FP  V +   GN+L
Sbjct  385   ANLTSLKNLVLSRNNLVGSIPDSLLSLTQLQLLDVSNNNLSGAIPKFPSTVKLVTTGNVL  444

Query  1381  LEKTV----------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlf  1250
             +  T                  T  GSP   Q  NG S+S  M   +VI VVI V+VVLF
Sbjct  445   IGTTPSTGGGGGTPSGTGSNGTTPSGSP--AQASNGPSVSPGMIAGIVIAVVIFVVVVLF  502

Query  1249  vFYKCYMKREHKRFGRAKSP----EKIKSTQMLKTNEIMG--------------------  1142
             V YKCY  ++HK+FGR  +P    E  KS  M   N   G                    
Sbjct  503   VSYKCYASKKHKKFGRVANPLTGIEIAKSDVMSSANGYNGVTSELQSQSSGDLHVFEGGN  562

Query  1141  TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQA  962
              AI IQVL + TN FSE+++LG GG+G+VY G+L +GTK+AVK+M+  A  TKG+NEFQA
Sbjct  563   VAISIQVLRQVTNNFSEDNILGRGGFGIVYKGELHDGTKIAVKRMESVAVGTKGLNEFQA  622

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KVRH++LVAL+G CIN ++ LLVYEYM  GTL  HLFEW++ G  PLTWKQRVT
Sbjct  623   EIAVLTKVRHRHLVALLGSCINGNERLLVYEYMPQGTLTQHLFEWREIGVPPLTWKQRVT  682

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRV  602
             IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+
Sbjct  683   IALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRL  742

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGYLAPEYA TGRVT K
Sbjct  743   AGTFGYLAPEYAATGRVTTK  762


 Score =   157 bits (398),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 121/207 (58%), Gaps = 13/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  676  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  735

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+I+G+KA+D+T+PDE  HLV+
Sbjct  736  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELISGRKALDDTMPDERSHLVS  795

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA +CT  + Y+RP+M H VN+LGP
Sbjct  796  WFRRVLVNKENIPKAIDQTLDPDEETMESICKVAELAGYCTAREPYQRPDMGHAVNILGP  855

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               +W   +P    E+  G DL+MSLP
Sbjct  856  LVEHW---KPTTHEEENSGIDLHMSLP  879



>ref|XP_008380457.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=924

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/740 (58%), Positives = 514/740 (69%), Gaps = 44/740 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD+ VMSKL A+L+PAP GWS S   C+W  VNCD  +  V SIN+ S+ +SG+LPS L
Sbjct  27    ADDSDVMSKLTASLNPAPKGWSTSTAYCSWDGVNCDT-SKRVTSINLASKGLSGSLPSNL  85

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L +LS+Q NSLSG  PS AN+SSL+E+YLD+N F+SIP     GL +L+I S+S 
Sbjct  86    NSLSQLTTLSLQSNSLSGAFPSLANLSSLQEVYLDTNNFTSIPAGCFTGLSSLQILSMSQ  145

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L  W   S L E++SL +F A N ++ G +P+ FDSFPNLQNLRLSYNN TG LP +
Sbjct  146   NINLDSWVFPSELTEASSLVTFAAGNVNLYGSLPDVFDSFPNLQNLRLSYNNFTGPLPKT  205

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQNLWLNNQ  GLSG+I+V+++MT+LSQVWLQ N FTGPIPDLSKCV LFDLQL 
Sbjct  206   FSGSGIQNLWLNNQLLGLSGSIEVLANMTQLSQVWLQNNQFTGPIPDLSKCVTLFDLQLR  265

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQ TG+VP +L  + +L+N+ L NNKL GPMP F + V+    D NSFC+ TPG CDP 
Sbjct  266   DNQFTGIVPATLMSISSLKNVSLDNNKLQGPMPAFRSTVEKSTVDGNSFCQTTPGTCDPL  325

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             VT LL  AG  GYP+ LA SW GN  C  W+FI CDPQGK V TVN  N+ F+GTISPAF
Sbjct  326   VTTLLEVAGAFGYPVLLADSWTGNKPCSGWSFIVCDPQGK-VFTVNFDNKHFNGTISPAF  384

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NL L+ NNL G IP SL +L  LQ+LDVSNNNLS  +P FP  V +   GN+L
Sbjct  385   ANLTSLKNLVLSRNNLVGSIPDSLLSLTQLQLLDVSNNNLSGVIPKFPSTVKLVTTGNVL  444

Query  1381  LEKTV----------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlf  1250
             +  T                  T  GSP   Q  NG S+S  M   +VI VVI ++VVLF
Sbjct  445   IGTTPSTGGGGGTPSGTGSNGTTPSGSP--AQASNGPSVSPGMIAGIVIAVVIFIVVVLF  502

Query  1249  vFYKCYMKREHKRFGRAKSP----EKIKSTQMLKTNEIMG--------------------  1142
             V YKCY  ++HK+FGR  +P    E  KS  M   N   G                    
Sbjct  503   VSYKCYAGKKHKKFGRVANPLTGIEIAKSDVMSSANGYNGVTSELQSQSSGDLHVFEGGN  562

Query  1141  TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQA  962
              AI IQVL + TN FSE+++LG GG+G+VY G+L +GTK+AVK+M+  A  TKG+NEFQA
Sbjct  563   VAISIQVLRQVTNNFSEDNILGRGGFGIVYKGELHDGTKIAVKRMESVAVGTKGLNEFQA  622

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KVRH++LVAL+G CIN ++ LLVYEYM  GTL  HLFEW++ G  PLTWKQRVT
Sbjct  623   EIAVLTKVRHRHLVALLGSCINGNERLLVYEYMPQGTLTQHLFEWREIGVPPLTWKQRVT  682

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRV  602
             IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+
Sbjct  683   IALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRL  742

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGYLAPEYA TGRVT K
Sbjct  743   AGTFGYLAPEYAATGRVTTK  762


 Score =   159 bits (401),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 13/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  676  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  735

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+I+G+KA+D+T+PDE  HLV+
Sbjct  736  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELISGRKALDDTMPDERSHLVS  795

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VN+LGP
Sbjct  796  WFRRVLVNKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNILGP  855

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               +W   +P    E+  G DL+MSLP
Sbjct  856  LVEHW---KPTTHEEENSGIDLHMSLP  879



>ref|XP_010246967.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=859

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/730 (55%), Positives = 513/730 (70%), Gaps = 46/730 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S++  DDAA+M KL A+LS  P  WS + DPC WT + CD  T  V  IN+  +S+ G+L
Sbjct  23    SIAISDDAAIMGKLAASLSGHPPDWSGN-DPCIWTGITCDN-TNRVTGINLPKKSLGGSL  80

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             P +L QL  LR L +Q N++SG LPS AN+++L E+ L+SN+F+S+P  FL GL +L++ 
Sbjct  81    PPDLNQLTQLRLLYLQNNAISGDLPSLANLTNLIEINLNSNKFTSVPDTFLTGLTSLQLL  140

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SIS+N +L+PW I   LA+ST+L +F+AS A+I G+IP+ F SFPNL +LRLSYN+LTG 
Sbjct  141   SISNNTDLAPWSIPVDLAQSTTLVTFYASRANIMGMIPDIFGSFPNLLSLRLSYNSLTGP  200

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S G ++IQNLWL++Q  GL+GTI+V+ +MT++SQVWLQ N FTGPIPDLSKC  LFD
Sbjct  201   LPPSLGGTKIQNLWLDHQASGLAGTIEVLGTMTQISQVWLQTNKFTGPIPDLSKCTALFD  260

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DN+ TGVVP +L  LP+L ++ L +N   GP+P F + V+VILG  N FC  TPGP
Sbjct  261   LQLRDNRFTGVVPETLMSLPSLLHVSLSSNMFQGPLPQFKSNVEVILGSGNRFCSKTPGP  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LLA AGG GYP++LA++W GN+AC  WAFITCD Q KNVT ++LG Q+ SGTI
Sbjct  321   CDPQVTVLLAMAGGFGYPMSLAEAWVGNNACHGWAFITCDSQ-KNVTVISLGKQQLSGTI  379

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA S LTSLR L+LNDNNLTGPIP SLTTLP LQ LDV+NNNL+  +P FP  V +   
Sbjct  380   SPAISNLTSLRMLFLNDNNLTGPIPESLTTLPKLQTLDVTNNNLTGKIPVFPAGVLLKMS  439

Query  1393  GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHK  1214
             GN LL     T   SPG             +   +VIV ++ + +  FV+YK Y+ +  +
Sbjct  440   GNPLLGAHRGT---SPG-------------LIAGIVIVSLVFLAIAFFVYYKYYVNKRSQ  483

Query  1213  RF-----GRAKSPEKIKSTQMLKTNEIMG---------------------TAIKIQVLEK  1112
             +        A + E+ KS  M  T+   G                       I I+VL +
Sbjct  484   KIEPVESSHANANEEGKS-GMFATSGFGGGSEHYSNEDASSDIRFFEGGSVVIPIEVLRQ  542

Query  1111  ATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRH  932
              TN FSEE  LG GG+G+VY G++ +GT+VAVK+M+     TKGMNEFQ+EIA LSK+RH
Sbjct  543   ITNNFSEEKELGRGGFGIVYKGEMKDGTQVAVKRMESSLMGTKGMNEFQSEIAVLSKLRH  602

Query  931   KNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIE  752
             ++LVAL+G+CIN ++ LLVYEYM  GTLG HLFEWK   + PLTWKQRV IA D+ARG+E
Sbjct  603   RSLVALLGHCINGNERLLVYEYMPQGTLGEHLFEWKTRRYPPLTWKQRVAIALDMARGVE  662

Query  751   YLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPE  572
             YLH+L  QSFIHRD+K +NILL DD+RAKVADFGLVK APD    +ETR+AGTFGYLAPE
Sbjct  663   YLHTLAQQSFIHRDLKPTNILLGDDMRAKVADFGLVKNAPDGNFSIETRLAGTFGYLAPE  722

Query  571   YATTGRVTKK  542
             YA TGRVT K
Sbjct  723   YAATGRVTTK  732


 Score =   146 bits (369),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 111/186 (60%), Gaps = 11/186 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ T + Q F         +++   +R ++ D+   K     N
Sbjct  646  TWKQRVAIALDMARGVEYLHTLAQQSFIHRDLKPTNILLGDDMRAKVADFGLVKNAPDGN  705

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+P E+CHLV+
Sbjct  706  FSIETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPAESCHLVS  765

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+  + +++ AID TLDPD++TF SI KVA+LA HCT  + ++RP+M H VNVL P
Sbjct  766  WFRRIL-INKDIRSAIDSTLDPDDETFASICKVADLAGHCTAREPFQRPDMGHAVNVLCP  824

Query  261  FAHNWR  244
                W+
Sbjct  825  LVEQWK  830



>ref|XP_009343822.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=925

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/733 (57%), Positives = 511/733 (70%), Gaps = 40/733 (5%)
 Frame = -2

Query  2626  VMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLAS  2447
             VMSKL   LSPAP  WS S   C W  V CD  +  + SIN+ S+++SG+LPS L  L+ 
Sbjct  32    VMSKLAEGLSPAPKDWSKSTGYCDWDGVKCDS-SNRITSINLASKALSGSLPSNLNSLSQ  90

Query  2446  LRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELS  2267
             L +LS+Q NSLSG  PS AN+S L+E+YLD+N F+SIP     GL +L+I S+S N  L 
Sbjct  91    LTTLSLQSNSLSGAFPSLANLSFLQEIYLDTNNFTSIPAGCFKGLSSLQILSMSQNINLD  150

Query  2266  PWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE  2087
              W   S L E++SL +  A NA++ G +P+ FDSFPNLQN+RLSYNN TG LP +F  S 
Sbjct  151   SWVFPSELTEASSLVTLAAGNANLYGPLPDVFDSFPNLQNVRLSYNNFTGFLPKTFSGSG  210

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             IQNLWLNNQ  GLSGTI+V+++MT+LSQVWL  N FTGPIPDLSKC  LFDLQ+ DNQ T
Sbjct  211   IQNLWLNNQLFGLSGTIEVLANMTQLSQVWLHKNQFTGPIPDLSKCETLFDLQIRDNQFT  270

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             G+VP +L  + +L+N+ L NNKL GPMP+FG+ V+    D NSFC+ TPG CDP VT LL
Sbjct  271   GIVPSTLMSISSLKNVSLDNNKLQGPMPVFGSNVEKSTVDGNSFCQTTPGRCDPLVTTLL  330

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               AG  GYP+ LA SW+GN  C  W+FI CDPQGK V TVN  N+ F+GTISPAF+ LTS
Sbjct  331   EVAGAFGYPVLLADSWEGNKPCSGWSFIVCDPQGK-VFTVNFENKHFNGTISPAFANLTS  389

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             L+NL L+ NNL G IP SL +L  LQ+LDVSNNNLS  +P FP  V +   GN+L+  T 
Sbjct  390   LKNLVLSRNNLVGSIPDSLLSLAQLQLLDVSNNNLSGAIPKFPSTVKLITNGNVLIGTTP  449

Query  1366  ATG--RGSP-GSGQ-----------TENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
             +TG   G+P GSG              NGSS+S  M   +VI ++I ++VVLFV +KCY 
Sbjct  450   STGGEGGTPSGSGSNGTTPSGSPALVSNGSSVSPGMIAGIVIAIIIFIVVVLFVSFKCYT  509

Query  1228  KREHKRFGRAKSP----EKIKSTQMLKTNEIMG--------------------TAIKIQV  1121
              ++H++FGR  +P    E  KS  M   N   G                     AI IQV
Sbjct  510   SKKHRKFGRVGNPSNGTEIAKSDVMSSANGYNGVTSELQSQSSGDLHVFEGGNVAISIQV  569

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L + T  FSE+++LG GG+GVVY G+L +GTKVAVK+M+  A  TKG+NEFQAEIA L+K
Sbjct  570   LRQVTKNFSEDNILGRGGFGVVYKGELHDGTKVAVKRMESVAVGTKGLNEFQAEIAVLTK  629

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL+G CIN ++ LLVYEYM  GTL  HLFEW++ G  PLTWKQRVTIA DVAR
Sbjct  630   VRHRHLVALLGSCINGNERLLVYEYMPQGTLTQHLFEWRETGVPPLTWKQRVTIALDVAR  689

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYL
Sbjct  690   GVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYL  749

Query  580   APEYATTGRVTKK  542
             APEYA TGRVT K
Sbjct  750   APEYAATGRVTTK  762


 Score =   158 bits (399),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 122/207 (59%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  676  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  735

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+++G+KA+D+T+PDE  HLV+
Sbjct  736  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELMSGRKALDDTMPDERSHLVS  795

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VN+LGP
Sbjct  796  WFRRVLVNKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNILGP  855

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               +W+    E+  E+  G DL+MSLP
Sbjct  856  LVEHWKPTTHEK--EENSGIDLHMSLP  880



>ref|XP_010068984.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW57193.1| hypothetical protein EUGRSUZ_H00009 [Eucalyptus grandis]
Length=924

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/731 (57%), Positives = 523/731 (72%), Gaps = 37/731 (5%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD++ M+ L A +SPAPSGWS+S   C W  VNCD  +  V +IN+ S+S++G LP++L+
Sbjct  36    DDSSAMADLRAGMSPAPSGWSSSTPYCKWDGVNCDS-SSRVTAINLASRSLAGTLPADLS  94

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ L++LS+QKN+ SGP+PS AN++SL+E+YLD N F+S+P     GL +L+  S+S+N
Sbjct  95    SLSRLKTLSLQKNAFSGPVPSLANLASLQEVYLDVNNFTSVPSGAFAGLTSLQTLSLSNN  154

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L PW I S L +ST+L +F+A NA++ G +P+FF SFP+LQ+LRLSYNNLTG LP SF
Sbjct  155   FNLDPWAIPSELNQSTALVTFYAGNANVVGSLPDFFGSFPSLQSLRLSYNNLTGPLPPSF  214

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
               S IQNLWLNNQ QGLSGTIDV+SSM  LSQVWL  N+F GPIPDLSKC +LFDLQL D
Sbjct  215   AGSGIQNLWLNNQAQGLSGTIDVLSSMPELSQVWLHKNSFAGPIPDLSKCESLFDLQLRD  274

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQV  1739
             N LTGVVP +L  LP+L+N+ L NNKL GP+P   NK++     TNSFC   PGPC  QV
Sbjct  275   NDLTGVVPANLMSLPSLKNVSLDNNKLQGPVPDNPNKIQFTYDGTNSFCNTAPGPCSSQV  334

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
             T LL  AG LGYP TLA SW+GNDACQ W+FITC  QGKNVT+VN   Q F+GTISPAF+
Sbjct  335   TTLLEIAGALGYPATLADSWEGNDACQGWSFITC--QGKNVTSVNFSKQHFAGTISPAFA  392

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LTSLR+L L+DN+LTG IP  L  LP LQVLDVSNNNLS  +P FP +V  +  GN LL
Sbjct  393   NLTSLRSLLLSDNDLTGSIPDGLAKLPQLQVLDVSNNNLSGAVPVFPASVKFTSTGNPLL  452

Query  1378  EKTVATGRGSPGSGQTENGSSMSAR--------MfvvvvivvvivvlvvlfvFYK-CYMK  1226
              K+ ++G G      +  GSS SA         + V +V+  ++ + ++LFV Y+ CY K
Sbjct  453   GKSSSSGSGGASGSNSTPGSSSSASNGSSVSAGLIVAIVLSALVFLAILLFVLYRCCYAK  512

Query  1225  REHKRFGRAKSPEKIKSTQMLKTNEIMG-----------------------TAIKIQVLE  1115
             R++   G+ ++ EK K  ++ K N + G                        AI I VL 
Sbjct  513   RKNAGIGQGENLEKGK--EVAKINGMNGQGGVQSEIHSQGSGDLPVFDGGNVAISIDVLR  570

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
             + T+ FSE +VLG GG+GVVY G+L +GT +AVK+M+  A   KG++EFQ+E+A L+KVR
Sbjct  571   QVTDDFSEANVLGRGGFGVVYEGELHDGTMIAVKRMESAALGNKGLHEFQSELAVLTKVR  630

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LVAL+GYCIN ++ LLVYE+M  GTL  HLFEW+  G+ PLTWKQRVTIA DVARG+
Sbjct  631   HRHLVALLGYCINGNERLLVYEHMPQGTLAQHLFEWEVMGYSPLTWKQRVTIALDVARGV  690

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  +ETR+AGTFGYLAP
Sbjct  691   EYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSLETRLAGTFGYLAP  750

Query  574   EYATTGRVTKK  542
             EYA TGRVT K
Sbjct  751   EYAATGRVTTK  761


 Score =   151 bits (382),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  675  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  734

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL   L G    L       G    KVD+YAFGVVLMEI+TG+KA+D+++PD+  HLVT
Sbjct  735  YSLETRLAGTFGYLAPEYAATGRVTTKVDIYAFGVVLMEILTGRKALDDSMPDDRAHLVT  794

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID T +PD+ T ESI KVAELA HCT  + ++RP+M H VNVL P
Sbjct  795  WFRRVLINKENIPKAIDRTFNPDDDTLESICKVAELAGHCTAREPFQRPDMGHAVNVLSP  854

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E   G DL+MSLP
Sbjct  855  LVEQWKPSSQEE--EDNYGIDLHMSLP  879



>ref|XP_007221303.1| hypothetical protein PRUPE_ppa001041mg [Prunus persica]
 gb|EMJ22502.1| hypothetical protein PRUPE_ppa001041mg [Prunus persica]
Length=925

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/745 (56%), Positives = 506/745 (68%), Gaps = 53/745 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLPSE  2465
              DD+ VMSKL   L   P  WS  K  C W  + CD   GN V SIN+ S+S+SG+LPS 
Sbjct  26    ADDSDVMSKLAEGLKNTPKDWSTGKTYCDWEGIKCD---GNSVTSINLASKSLSGSLPSN  82

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L  L +LS+Q NSLSGP PS AN+S L+E+YLD+N F+SIP     GL +L++ S+S
Sbjct  83    LNSLTKLTTLSLQSNSLSGPFPSLANLSLLQEIYLDTNNFTSIPSGCFQGLSSLQVLSMS  142

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
              N  L PW + + L +++SL +  A NA++ G +PN FDSFPNLQNLRLSYNN +G LP 
Sbjct  143   QNINLVPWVLPTELTQASSLVTLAAGNANLYGSLPNIFDSFPNLQNLRLSYNNFSGFLPK  202

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S IQNLWLNNQQ GLSGTI+V+S+MT+L+QVWL  N FTGPIPD+SKC  LFDLQL
Sbjct  203   SFSGSGIQNLWLNNQQFGLSGTIEVLSNMTQLNQVWLHKNQFTGPIPDISKCKTLFDLQL  262

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKV-KVILGDTNSFCKDTPGPCD  1748
              DN LTG+VP +L     ++N+ L NNKL GP+P+FG+ V K     TNSFC+  PGPCD
Sbjct  263   RDNLLTGIVPATLMSSTAIQNVSLDNNKLQGPLPVFGSNVTKATFDGTNSFCQTKPGPCD  322

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQV  LL  AG L YP  LA+SW+GN+AC  W+F+ CD QGK V TVN  N+ F+G ISP
Sbjct  323   PQVNTLLEVAGALAYPSLLAESWEGNNACDGWSFVVCDTQGK-VITVNFENKHFTGIISP  381

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LTSL+NL L +NNLTG IP SL TL  LQ+LDVSNNNL   +P FP  V +   GN
Sbjct  382   AFANLTSLKNLVLKNNNLTGSIPASLLTLQQLQLLDVSNNNLFGEIPKFPYTVKLITTGN  441

Query  1387  LLLEK-------------------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivv  1265
             +L+                     T   G  +P SG    GSS+S  M   +VI VVI +
Sbjct  442   VLIGTTPSSGGGGGGTPSGSGSNGTTPNGSPAPASG----GSSVSPGMIAGIVIAVVIFI  497

Query  1264  lvvlfvFYKCYMKREHKRFGRAKSP----EKIKSTQMLKTNEIMG---------------  1142
             +VVLFV  KCY  ++H +FGR  +P    E  KS  M   N   G               
Sbjct  498   VVVLFVSIKCYASKKHGKFGRVDNPMNGIEIAKSDVMSSANGYNGVQSDLHSQSSGDLHV  557

Query  1141  -----TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
                   AI I VL   TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  TKG+
Sbjct  558   FEGGNVAISIHVLRDVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESVAVGTKGL  617

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
             NEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W++ G  PLTW
Sbjct  618   NEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWREIGVPPLTW  677

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
             KQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  
Sbjct  678   KQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYS  737

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             VETR+AGTFGYLAPEYA TGRVT K
Sbjct  738   VETRLAGTFGYLAPEYAATGRVTTK  762


 Score =   157 bits (398),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  676  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  735

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+++G+KA+D+T+PDE  HLV+
Sbjct  736  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELMSGRKALDDTMPDERSHLVS  795

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T  SI KVAELA HCT  + Y+RP+M H VN+LGP
Sbjct  796  WFRRVLVNKENIPKAIDQTLDPDEETMGSIYKVAELAGHCTAREPYQRPDMGHAVNILGP  855

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               +W+    EE  E+  G DL+MSLP
Sbjct  856  LVEHWKPTTNEE--EENSGIDLHMSLP  880



>ref|XP_004140603.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN46582.1| hypothetical protein Csa_6G109770 [Cucumis sativus]
Length=930

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/748 (55%), Positives = 524/748 (70%), Gaps = 53/748 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD+AV+ KL AALSP PSGWS++   C+W  + CD  +  V SIN+ S+S+SG LPS+L
Sbjct  24    ADDSAVIQKLAAALSPTPSGWSSNTPFCSWKEIRCDS-SSRVTSINLASKSLSGVLPSDL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L SLS+Q+NSL+GP+PSFAN+S L+ LYLD+N FSS+ P    GL +L++ S++ 
Sbjct  83    NSLSQLTSLSLQRNSLTGPIPSFANLSFLQSLYLDNNNFSSVSPGAFQGLTSLQVLSLTQ  142

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L+PW I + L +++SL S +A NA+I G +P+FFDSF +LQ LRLSYNNLTG LP S
Sbjct  143   NVNLAPWSIPTDLTQASSLVSLYAGNANIVGSLPDFFDSFASLQELRLSYNNLTGVLPKS  202

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
              G S I++LWLNNQ  GLSG+ID++SSMT+LSQVWLQ N FTG IPD SKC  LFDLQL 
Sbjct  203   LGGSGIKSLWLNNQLNGLSGSIDLLSSMTQLSQVWLQKNQFTGQIPDFSKCEGLFDLQLR  262

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQ TG+VP SL  L +L N+ L NNKL GP+P+F ++V+      N FCK TP PCD Q
Sbjct  263   DNQFTGIVPPSLMSLSSLLNVSLDNNKLQGPLPVFDSRVQATFSSVNRFCKTTPDPCDAQ  322

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V+ LLA AG  GYPI+LA +W+GN+ C +W+F+ C  +GK VTTVN G Q   G ISPAF
Sbjct  323   VSVLLAVAGAFGYPISLADAWEGNNVCLDWSFVICT-EGK-VTTVNFGKQHLVGVISPAF  380

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NLYLNDNNL G IP SLTTL  LQ LDVSNNNLS  +P F   V ++  GN L
Sbjct  381   ANLTSLKNLYLNDNNLVGEIPESLTTLTQLQNLDVSNNNLSGQVPKFATTVRLNTKGNPL  440

Query  1381  LEKTVATGRGSPGSGQT-----ENGSSMSAR-------------Mfvvvvivvvivvlvv  1256
             +  ++  G G    G        NG+++                +   VVI V++ V V+
Sbjct  441   IGTSLGPGNGGNDGGAGGGKIDSNGTTIDGTTSGSSNGSSVSAGVIAGVVIAVIVFVAVL  500

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN--------------------------  1154
             LFV +KCY+   HK+FG+  +PE  K  +++K++                          
Sbjct  501   LFVVFKCYVSNRHKKFGKVNNPENGK--EIMKSDGGSGLNGYAGVPSELQSQSSEDFSND  558

Query  1153  ----EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                 E    AI IQVL++ TN FSE++VLG GG+GVVY G+L +GTK+AVK+M+ G   T
Sbjct  559   INVFEGGSVAISIQVLKQVTNNFSEDNVLGRGGFGVVYKGELHDGTKIAVKRMESGPMGT  618

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KGM+EFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W+++G+ P
Sbjct  619   KGMSEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWQENGYPP  678

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQR+TIA DVARG+EYLHSL  QSFIHRD+K SNILL+DD+RAKVADFGLV+ APD 
Sbjct  679   LTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVRNAPDG  738

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  739   KYSVETRLAGTFGYLAPEYAATGRVTTK  766


 Score =   157 bits (396),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         ++++  +R ++ D+   +      
Sbjct  680  TWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVRNAPDGK  739

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+D+T+PDE  HLVT
Sbjct  740  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDDTMPDERSHLVT  799

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + ++RP+M H VN+LGP
Sbjct  800  WFRRVLIMKENIPKAIDQTLNPDEETMESILKVAELAGHCTAREPHQRPDMGHAVNILGP  859

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+     E  E+  G DL+MSLP
Sbjct  860  LVEQWKPSNQHE--EETDGIDLHMSLP  884



>ref|XP_004162388.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1-like [Cucumis sativus]
Length=930

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/748 (55%), Positives = 524/748 (70%), Gaps = 53/748 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD+AV+ KL AALSP PSGWS++   C+W  + CD  +  V SIN+ S+S+SG LPS+L
Sbjct  24    ADDSAVIQKLAAALSPXPSGWSSNTPFCSWKEIRCDS-SSRVTSINLASKSLSGVLPSDL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L SLS+Q+NSL+GP+PSFAN+S L+ LYLD+N FSS+ P    GL +L++ S++ 
Sbjct  83    NSLSQLTSLSLQRNSLTGPIPSFANLSFLQSLYLDNNNFSSVSPGAFQGLTSLQVLSLTQ  142

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L+PW I + L +++SL S +A NA+I G +P+FFDSF +LQ LRLSYNNLTG LP S
Sbjct  143   NVNLAPWSIPTDLTQASSLVSLYAGNANIVGSLPDFFDSFASLQELRLSYNNLTGVLPKS  202

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
              G S I++LWLNNQ  GLSG+ID++SSMT+LSQVWLQ N FTG IPD SKC  LFDLQL 
Sbjct  203   LGGSGIKSLWLNNQLNGLSGSIDLLSSMTQLSQVWLQKNQFTGQIPDFSKCEGLFDLQLR  262

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQ TG+VP SL  L +L N+ L NNKL GP+P+F ++V+      N FCK TP PCD Q
Sbjct  263   DNQFTGIVPPSLMSLSSLLNVSLDNNKLQGPLPVFDSRVQATFSSVNRFCKTTPDPCDAQ  322

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V+ LLA AG  GYPI+LA +W+GN+ C +W+F+ C  +GK VTTVN G Q   G ISPAF
Sbjct  323   VSVLLAVAGAFGYPISLADAWEGNNVCLDWSFVICT-EGK-VTTVNFGKQHLVGVISPAF  380

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NLYLNDNNL G IP SLTTL  LQ LDVSNNNLS  +P F   V ++  GN L
Sbjct  381   ANLTSLKNLYLNDNNLVGEIPESLTTLTQLQNLDVSNNNLSGQVPKFATTVRLNTKGNPL  440

Query  1381  LEKTVATGRGSPGSGQT-----ENGSSMSAR-------------Mfvvvvivvvivvlvv  1256
             +  ++  G G    G        NG+++                +   VVI V++ V V+
Sbjct  441   IGTSLGPGNGGNDGGAGGGKIDSNGTTIDGTTSGSSNGSSVSAGVIAGVVIAVIVFVAVL  500

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN--------------------------  1154
             LFV +KCY+   HK+FG+  +PE  K  +++K++                          
Sbjct  501   LFVVFKCYVSNRHKKFGKVNNPENGK--EIMKSDGGSGLNGYAGVPSELQSQSSEDFSND  558

Query  1153  ----EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                 E    AI IQVL++ TN FSE++VLG GG+GVVY G+L +GTK+AVK+M+ G   T
Sbjct  559   INVFEGGSVAISIQVLKQVTNNFSEDNVLGRGGFGVVYKGELHDGTKIAVKRMESGPMGT  618

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KGM+EFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W+++G+ P
Sbjct  619   KGMSEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWQENGYPP  678

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQR+TIA DVARG+EYLHSL  QSFIHRD+K SNILL+DD+RAKVADFGLV+ APD 
Sbjct  679   LTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVRNAPDG  738

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  739   KYSVETRLAGTFGYLAPEYAATGRVTTK  766


 Score =   157 bits (396),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         ++++  +R ++ D+   +      
Sbjct  680  TWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLSDDMRAKVADFGLVRNAPDGK  739

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+D+T+PDE  HLVT
Sbjct  740  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDDTMPDERSHLVT  799

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + ++RP+M H VN+LGP
Sbjct  800  WFRRVLIMKENIPKAIDQTLNPDEETMESILKVAELAGHCTAREPHQRPDMGHAVNILGP  859

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+     E  E+  G DL+MSLP
Sbjct  860  LVEQWKPSNQHE--EETDGIDLHMSLP  884



>ref|XP_008458146.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=933

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/748 (55%), Positives = 525/748 (70%), Gaps = 53/748 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDA V+ KL AA+SP PSGWS++   C+W  + CD  +  V SIN+DS+S+SG LPS+L
Sbjct  27    ADDATVIQKLAAAVSPTPSGWSSNTPFCSWKEIRCDS-SSRVTSINLDSKSLSGVLPSDL  85

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L SLS+Q+NS +GP+PSFAN+S L+ LYL  N FSS+ P    GL +L+I S++ 
Sbjct  86    NSLSQLTSLSLQRNSFTGPIPSFANLSFLQTLYLHDNNFSSVSPGAFQGLTSLQILSLTQ  145

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L+PW I + L +++SL S +A+NA++ G +P+FFDSF +LQ LRLSYNNLTG LP S
Sbjct  146   NVNLAPWSIPTDLTQASSLVSLYAANANLVGSLPDFFDSFSSLQELRLSYNNLTGVLPKS  205

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
              G S I++LWLNNQ  GLSG+ID++SSMT+L+QVWLQ N FTG IPD SKC  LFDLQL 
Sbjct  206   LGGSGIKSLWLNNQLNGLSGSIDLLSSMTQLTQVWLQKNQFTGQIPDFSKCEGLFDLQLR  265

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQ TG+VP SL  L +L N+ L NNKL GP+P+F ++V+      N FCK TPGPCD Q
Sbjct  266   DNQFTGIVPPSLMSLSSLLNVSLDNNKLQGPLPVFDSRVQASFSSVNRFCKSTPGPCDAQ  325

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V+ LLA AG  GYPI+LA +W+GN+ CQ+W+F+ C  +GK VTTVN   Q   G ISPAF
Sbjct  326   VSVLLAVAGAFGYPISLADAWEGNNVCQDWSFVVCT-EGK-VTTVNFAKQHLVGVISPAF  383

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NLYLNDNNL G IP SLTTL  LQ LDVSNNNLS  +P F P V ++  GN L
Sbjct  384   ANLTSLKNLYLNDNNLVGEIPESLTTLTQLQNLDVSNNNLSGQIPKFAPTVRLNTKGNPL  443

Query  1381  LEKTVA-----TGRGSPGSGQTENGSSMS-------------ARMfvvvvivvvivvlvv  1256
             +  +++        G+ G     NG+++              A +   VVI VV+ V V+
Sbjct  444   IGTSLSPGNGGNDGGAGGGKIGSNGTTIDGTTSGSSNGSSVSAGVIAGVVIAVVVFVAVL  503

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN--------------------------  1154
             LFV +KCY+   HK+FG+  +PE  K  +++K++                          
Sbjct  504   LFVVFKCYVSNRHKKFGKVNNPENGK--EIVKSDGGSGLNGYAGVPSELQSQSSEDFSND  561

Query  1153  ----EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                 E    AI IQVL++ TN FSE++VLG GG+GVVY G+L +GTK+AVK+M+ G   T
Sbjct  562   INVFEGGNVAISIQVLKQVTNNFSEDNVLGRGGFGVVYKGELHDGTKIAVKRMESGPMGT  621

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KGM+EFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W+++G+ P
Sbjct  622   KGMSEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWQENGYPP  681

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQR+TIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD 
Sbjct  682   LTWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDG  741

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  742   KYSVETRLAGTFGYLAPEYAATGRVTTK  769


 Score =   154 bits (390),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 96/146 (66%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+D+T+PDE  HLVTW
Sbjct  744  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDDTMPDERSHLVTW  803

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + ++RP+M H VN+LGP 
Sbjct  804  FRRVLIMKENIPKAIDQTLNPDEETMESILKVAELAGHCTAREPHQRPDMGHAVNILGPL  863

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+     E  E+  G DL+MSLP
Sbjct  864  VEQWKPSNQHE--EETDGIDLHMSLP  887



>ref|XP_008222737.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=924

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/743 (56%), Positives = 501/743 (67%), Gaps = 50/743 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD+ VMSKL  +L  AP  WS  K  C W  + C +    V SIN+ S+S+SG+LPS L
Sbjct  26    ADDSDVMSKLAESLKNAPKDWSTGKTYCYWEGIKCVE--NRVTSINLASKSLSGSLPSNL  83

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L +LS+Q NSLSG  PS AN+S L+E+YLD+N F+SIP     GL +L++ S+S 
Sbjct  84    NSLTQLTTLSLQSNSLSGLFPSLANLSFLQEIYLDTNNFTSIPSGCFQGLSSLQVLSMSQ  143

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW     L +++SL +  A NA++ G +P+ FDSFPNLQNLRLSYNN +G LP S
Sbjct  144   NINLDPWVFPIELTQASSLVTLAAGNANLYGSLPDIFDSFPNLQNLRLSYNNFSGFLPKS  203

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQNLWLNNQQ GLSGTI+V+S+MT+L+QVWL  N FTGPIPD+SKC  LFDLQL 
Sbjct  204   FSGSGIQNLWLNNQQFGLSGTIEVLSNMTQLNQVWLHKNQFTGPIPDISKCKTLFDLQLR  263

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DN LTG+VP +L     ++N+ L NNKL GP P+FG+ V+     TNSFC   PGPCDPQ
Sbjct  264   DNLLTGIVPATLMSSTAIQNVSLDNNKLQGPQPVFGSNVRATFEGTNSFCLTKPGPCDPQ  323

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V  LL  AG LGYPI LA SW+GN+AC  W+FI CD QGK V TVN  N+ F+G ISPAF
Sbjct  324   VNTLLEVAGALGYPILLAGSWEGNNACDRWSFIVCDTQGK-VITVNFENKHFTGIISPAF  382

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NL L +NNLTG +P SL TL  LQ+LDVSNNNL   +P FP  V +   GN+L
Sbjct  383   ANLTSLKNLVLKNNNLTGSMPASLLTLQQLQLLDVSNNNLFGEIPKFPDTVKLITTGNVL  442

Query  1381  LEK-------------------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlv  1259
             +                     T   G  +P SG    GSS+S  M   +VI VVI  +V
Sbjct  443   IGTTPSSGGGGGGTPSGSGSNGTTPNGTPAPASG----GSSVSPGMIAGIVIAVVIFFVV  498

Query  1258  vlfvFYKCYMKREHKRFGRAKSP----EKIKSTQMLKTNEIMG-----------------  1142
             VLFV  KCY  ++H +FGR  +P    E  KS  M   N   G                 
Sbjct  499   VLFVSIKCYASKKHGKFGRVDNPMNGIEIAKSDVMSSANGYNGVQSDLHSQSSGDLHVFE  558

Query  1141  ---TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNE  971
                 AI I VL   TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  TKG+NE
Sbjct  559   GGNVAISIHVLRDVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESVAVGTKGLNE  618

Query  970   FQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQ  791
             FQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W++ G  PLTWKQ
Sbjct  619   FQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWREIGVPPLTWKQ  678

Query  790   RVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVE  611
             RVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VE
Sbjct  679   RVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVE  738

Query  610   TRVAGTFGYLAPEYATTGRVTKK  542
             TR+AGTFGYLAPEYA TGRVT K
Sbjct  739   TRLAGTFGYLAPEYAATGRVTTK  761


 Score =   157 bits (398),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  675  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  734

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+++G+KA+D+T+PDE  HLV+
Sbjct  735  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELMSGRKALDDTMPDERSHLVS  794

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T  SI KVAELA HCT  + Y+RP+M H VN+LGP
Sbjct  795  WFRRVLVNKENIPKAIDQTLDPDEETMGSIYKVAELAGHCTAREPYQRPDMGHAVNILGP  854

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               +W+    EE  E+  G DL+MSLP
Sbjct  855  LVEHWKPTTNEE--EENSGIDLHMSLP  879



>ref|XP_010673522.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=922

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/738 (57%), Positives = 510/738 (69%), Gaps = 40/738 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DD + M   L AL+  PSGW +S D C W  +NC+     V SIN+ SQS+SGNLP  L
Sbjct  24    ADDKSAMDDFLKALTTPPSGWDSSTDFCKWKGINCNS-DNKVTSINLASQSLSGNLPPSL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L +LS+Q N  SG LPSFAN+S L+++YLD N FSSIP     GL +L+  S+S 
Sbjct  83    NSLSQLTTLSLQNNHFSGILPSFANLSFLQQIYLDFNNFSSIPSGAFSGLSSLQTLSLSF  142

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N +LSPW   S L++S SL S +ASNA+I G IP+FFD+FP LQ+LRLSYN L GSLP S
Sbjct  143   NFDLSPWPFPSELSDSASLVSIYASNANIEGEIPDFFDNFPGLQDLRLSYNGLNGSLPRS  202

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQ LWLNNQ+ GL GTIDV+S MT L+QVWL AN FTG IPDLS C  +FDLQL 
Sbjct  203   FNGSAIQKLWLNNQKSGLFGTIDVVSGMTALTQVWLHANKFTGVIPDLSACTEIFDLQLR  262

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKV-KVILG--DTNSFCKDTPGPC  1751
             DNQ +G+V  S+  LP L N+ LQNN+L GPMP F   V  V LG  +TN FC++  G C
Sbjct  263   DNQFSGIVSPSIVSLPKLLNVTLQNNRLQGPMPDFPKTVLNVSLGNENTNRFCRNVSGDC  322

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DPQV+ LL  AG LGYPI LA SW GNDAC  W+F+TCD   K V TV    Q FSGTIS
Sbjct  323   DPQVSVLLQVAGALGYPIKLADSWTGNDACNQWSFVTCDSSRK-VVTVAFAKQGFSGTIS  381

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PAF+ LTSL +LYLNDNNLTG IP SL +LP ++ +D++NN+LS  +P F   VN+   G
Sbjct  382   PAFANLTSLTDLYLNDNNLTGTIPESLVSLPRIRKIDLTNNDLSGKVPVFKTGVNLLTAG  441

Query  1390  NLLLEKTV--------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
             N  + K V        + G  + GSG    GSS+SA M V VVI V++ V+VV+FV YKC
Sbjct  442   NKNIGKDVPSPGGSGDSGGNSTSGSGGGSKGSSVSAGMVVGVVIAVLVFVVVVMFVLYKC  501

Query  1234  YMKREHKRFGRAKSPEK----IKSTQMLKTNEIMG-----------------------TA  1136
             YMK++H++FG+ ++PE     +K+  M  TN   G                         
Sbjct  502   YMKKKHRKFGKVQNPEAGNEMVKTNIMAATNGYAGVPSELQSQSSGDHGDFPVFEGGNVT  561

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             I IQVL + TN FSE+++LG GG+GVVY G+L +GTK+AVK+M   A  TKG+NEFQAEI
Sbjct  562   ISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMVATAMGTKGLNEFQAEI  621

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LVAL+G+C+N ++ LLVYEYM  G LG HLFEW++ G  PLTWKQRVTIA
Sbjct  622   AVLTKVRHRHLVALLGFCVNGNERLLVYEYMPQGHLGQHLFEWQELGHSPLTWKQRVTIA  681

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL   SFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  682   LDVARGVEYLHSLAQTSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  741

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  742   TFGYLAPEYAVTGRVTTK  759


 Score =   153 bits (386),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 105/174 (60%), Gaps = 10/174 (6%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K+DVYAFGV+LME+ITG+KA+DET+PDE  HLVTW
Sbjct  734  SVETRLAGTFGYLAPEYAVTGRVTTKIDVYAFGVILMELITGRKALDETMPDERSHLVTW  793

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I+    N++K+ID  L+PD++TFE I +VAELA HCT  + ++RP+M H VNVLGP 
Sbjct  794  FRRILINKDNIRKSIDDILNPDDETFEIIGRVAELAGHCTAREPHQRPDMGHAVNVLGPL  853

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFD--------DSSIESLSFTNAQHRL  121
               W+  R E+  +   G DL+MSLP             + I  LSF+  Q  +
Sbjct  854  VEQWKPSRQED--DDPDGIDLHMSLPQALQRWQANEGTSTMISDLSFSRTQASI  905



>ref|XP_006421039.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
 gb|ESR34279.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
Length=933

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/748 (54%), Positives = 504/748 (67%), Gaps = 55/748 (7%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD +VM KL  +L   PS WS++     C WT +NCD  +  V SI++    +SG L  E
Sbjct  27    DDGSVMLKLAQSLQNLPSDWSSTSSTGYCRWTGINCDN-SNRVTSISLAKSGLSGTLSPE  85

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             ++ L  L +LS Q N+++G +PS AN +SL+++YLD+N F+S+P     GL NL++ S+S
Sbjct  86    ISSLTQLETLSFQINNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLS  145

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             DN  L+PW   + L +STSL + +  NA+I G+IP+FFDSF NLQNLRLSYNN TGSLP 
Sbjct  146   DNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDFFDSFSNLQNLRLSYNNFTGSLPA  205

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S+IQNLW+N+QQ GLSGT+DV+S MT+L QVWL  N FTGPIPDLSKC +LFDL L
Sbjct  206   SFAKSDIQNLWMNDQQLGLSGTLDVLSGMTQLRQVWLHKNQFTGPIPDLSKCESLFDLSL  265

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK---DTPGP  1754
              DNQLTGVVP S+  LP L NI LQNNKL GP PLF +KV+ +  D N+FCK   D   P
Sbjct  266   RDNQLTGVVPASVISLPALLNISLQNNKLQGPYPLFPSKVQKVSLDHNNFCKNSSDAATP  325

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LL  AG +GYP  L+ SW+GN+AC  W F+TC  QG+ +  +NL N+  +G I
Sbjct  326   CDPQVTTLLQIAGDMGYPAILSDSWEGNNACDGWPFVTCS-QGR-IIIINLANKHLAGKI  383

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA++ LTSL+NLYL  NNLTGPIP  LT L  LQ LDVSNNNLS  +P F   V  +  
Sbjct  384   SPAYANLTSLKNLYLQQNNLTGPIPDGLTKLASLQNLDVSNNNLSGKVPDFGSNVKFTVS  443

Query  1393  -GNLLLEKTVAT---GRGSPGSGQT--------ENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  +   V T   G G+PGS  +         + S +S    V +V+VVVI + VV F
Sbjct  444   PGNPFIGTNVDTTPGGAGTPGSKPSGPSGSPAASSKSKLSVGTIVAIVVVVVIFIAVVFF  503

Query  1249  vFYKCYMKREHKRFGRAKSPE--------------------------------KIKSTQM  1166
             V YK   +R+H++FGR K+PE                                 +    +
Sbjct  504   VVYKFIARRKHRKFGRVKNPEVGNEMNKNGVTGGNGTNGYNGVPSELHSQSSGDVSDRHL  563

Query  1165  LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
              +   +   AI I+VL + T+ FSE ++LG GG+GVVY G+L +GTK+AVK+M+      
Sbjct  564   FEGGNV---AISIEVLRQVTDNFSEANILGRGGFGVVYGGELPDGTKIAVKRMESNTMGN  620

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG++EFQAEIA L+KVRH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW  HG+ P
Sbjct  621   KGLSEFQAEIAVLTKVRHRHLVALLGYCINGSERLLVYEYMPRGTLAQHLFEWHDHGYTP  680

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNIL+ DD+RAKVADFGLVK APD 
Sbjct  681   LTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKVADFGLVKNAPDG  740

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  741   KYSVETRLAGTFGYLAPEYAATGRVTTK  768


 Score =   150 bits (378),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  682  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKVADFGLVKNAPDGK  741

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K+DVYAFGVVLME ITG+KA+D+T+PD+  HLVT
Sbjct  742  YSVETRLAGTFGYLAPEYAATGRVTTKIDVYAFGVVLMETITGRKALDDTMPDDRAHLVT  801

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAIDP L+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  802  WFRRVLISKENIPKAIDPNLNLDEETIESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  861

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    E+  E   G DL+MSLP
Sbjct  862  LVEQWKPATRED--EDGYGIDLHMSLP  886



>gb|KDO47459.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
 gb|KDO47460.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
Length=760

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/740 (54%), Positives = 499/740 (67%), Gaps = 55/740 (7%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD +VM KL  +L   PS WS+  S   C WT +NCD  +  V +I++    +SG L  E
Sbjct  27    DDGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDN-SNRVTTISLAKSGLSGTLSPE  85

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             ++ L  L +LS Q N+++G +PS AN +SL+++YLD+N F+S+P     GL NL++ S+S
Sbjct  86    ISSLTQLETLSFQMNNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLS  145

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             DN  L+PW   + L +STSL + +  NA+I G+IP+FFDSF NLQNLRLSYNN TGSLP 
Sbjct  146   DNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDFFDSFSNLQNLRLSYNNFTGSLPA  205

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S+IQNLW+N+QQ GLSGT+DV+S MT+L QVWL  N FTGPIPDLSKC +LFDL L
Sbjct  206   SFAKSDIQNLWMNDQQLGLSGTLDVLSGMTQLRQVWLHKNQFTGPIPDLSKCESLFDLSL  265

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK---DTPGP  1754
              DNQLTGVVP S+  LP L NI LQNNKL GP PLF +KV+ +  D N+FCK   D   P
Sbjct  266   RDNQLTGVVPASVISLPALLNISLQNNKLQGPYPLFPSKVQKVSLDHNNFCKNSSDAGKP  325

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LL  AG +GYP  L+ SW+GN+AC  W F+TC  QG+ + T+NL N+  +G I
Sbjct  326   CDPQVTTLLQIAGDMGYPAILSDSWEGNNACDGWPFVTCS-QGR-IITINLANKLLAGNI  383

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA++ LTSL+NLYL  NNLTGPIP  LT L  LQ LDVSNNNLS  +P F   V  +  
Sbjct  384   SPAYANLTSLKNLYLQQNNLTGPIPDGLTKLASLQNLDVSNNNLSGKVPDFGSNVKFTVS  443

Query  1393  -GNLLLEKTVAT---GRGSPGSGQT--------ENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  +   V T   G G+PGS  +         + S +S    V +V+VVVI + VV F
Sbjct  444   PGNPFIGTNVDTTPGGAGTPGSKPSGPSGSPAASSKSKLSVGTIVAIVVVVVIFIAVVFF  503

Query  1249  vFYKCYMKREHKRFGRAKSPE--------------------------------KIKSTQM  1166
             V YK   +R+H++FGR K+PE                                 +    +
Sbjct  504   VVYKFIARRKHRKFGRVKNPEVGNEMNKNGVTGGNGTNGYNGVPSELHSQSSGDVSDRHL  563

Query  1165  LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
              +   +   AI I+VL + T+ FSE ++LG GG+GVVY G+L +GTK+AVK+M+      
Sbjct  564   FEGGNV---AISIEVLRQVTDNFSEANILGRGGFGVVYGGELPDGTKIAVKRMESNTMGN  620

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG++EFQAEIA L+KVRH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW  HG+ P
Sbjct  621   KGLSEFQAEIAVLTKVRHRHLVALLGYCINGSERLLVYEYMPRGTLAQHLFEWHDHGYTP  680

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNIL+ DD+RAKVADFGLVK APD 
Sbjct  681   LTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKVADFGLVKNAPDG  740

Query  625   KSFVETRVAGTFGYLAPEYA  566
             K  VETR+AGTFGYLAPEYA
Sbjct  741   KYSVETRLAGTFGYLAPEYA  760



>ref|XP_006492525.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=933

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/748 (53%), Positives = 504/748 (67%), Gaps = 55/748 (7%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD +VM KL  +L   PS WS++     C WT +NCD  +  V +I++    +SG L  E
Sbjct  27    DDGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDN-SNRVTTISLAKSGLSGTLSPE  85

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             ++ L  L +LS Q N+++G +PS AN +SL+++YLD+N F+S+P     GL NL++ S+S
Sbjct  86    ISSLTQLETLSFQMNNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLS  145

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             DN  L+PW   + L +STSL + +  NA+I G+IP+ F SF NLQNLRLSYNN TGSLP 
Sbjct  146   DNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDVFYSFSNLQNLRLSYNNFTGSLPA  205

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S+IQNLW+N+QQ GLSGT+DV+S MT+L QVWL  N FTGPIPDLSKC +LFDL L
Sbjct  206   SFAKSDIQNLWMNDQQLGLSGTLDVLSGMTQLRQVWLHKNQFTGPIPDLSKCESLFDLSL  265

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK---DTPGP  1754
              DNQLTGVVP S+  LP L NI LQNNKL GP PLF +KV+ +  D N+FCK   D   P
Sbjct  266   RDNQLTGVVPASVISLPALLNISLQNNKLQGPYPLFPSKVQKVSLDHNNFCKNSSDAGKP  325

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVT LL  AG +GYP  L+ SW+GN+AC  W F+TC  QG+ + T+NL N+  +G I
Sbjct  326   CDPQVTTLLQIAGDMGYPAILSDSWEGNNACDGWPFVTCS-QGR-IITINLANKLLAGNI  383

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA++ LTSL+NLYL  NNLTGPIP  LT L  LQ LDVSNNNLS  +P F   V  +  
Sbjct  384   SPAYANLTSLKNLYLQQNNLTGPIPDGLTKLASLQNLDVSNNNLSGKVPDFGSNVKFTVS  443

Query  1393  -GNLLLEKTVAT---GRGSPGSGQT--------ENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  +   V T   G G+PGS  +         + S +S    V +V+VVVI + VV F
Sbjct  444   PGNPFIGTNVDTTPGGAGTPGSKPSGPSGSPAASSKSKLSVGTIVAIVVVVVIFIAVVFF  503

Query  1249  vFYKCYMKREHKRFGRAKSPE--------------------------------KIKSTQM  1166
             V YK   +R+H++FGR K+PE                                 +   ++
Sbjct  504   VVYKFIARRKHRKFGRVKNPEVGNEMNKNGVTGGNGPNGYNGVPSELHSQSSGDVSDRRL  563

Query  1165  LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
              +   +   AI I+VL + T+ F+E ++LG GG+GVVY G+L +GTK+AVK+M+      
Sbjct  564   FEGGNV---AISIEVLRQVTDNFNEANILGRGGFGVVYRGELPDGTKIAVKRMESNTMGN  620

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG++EFQAEIA L+KVRH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW  HG+ P
Sbjct  621   KGLSEFQAEIAVLTKVRHRHLVALLGYCINGSERLLVYEYMPRGTLAQHLFEWHDHGYTP  680

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNIL+ DD+RAKVADFGLVK APD 
Sbjct  681   LTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKVADFGLVKNAPDG  740

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  741   KYSVETRLAGTFGYLAPEYAATGRVTTK  768


 Score =   150 bits (378),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  682  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILIGDDMRAKVADFGLVKNAPDGK  741

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K+DVYAFGVVLME ITG+KA+D+T+PD+  HLVT
Sbjct  742  YSVETRLAGTFGYLAPEYAATGRVTTKIDVYAFGVVLMETITGRKALDDTMPDDRAHLVT  801

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAIDP L+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  802  WFRRVLISKENIPKAIDPNLNLDEETIESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  861

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    E+  E   G DL+MSLP
Sbjct  862  LVEQWKPATRED--EDGYGIDLHMSLP  886



>ref|XP_002308106.1| hypothetical protein POPTR_0006s07360g [Populus trichocarpa]
 gb|EEE91629.1| hypothetical protein POPTR_0006s07360g [Populus trichocarpa]
Length=931

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/742 (56%), Positives = 502/742 (68%), Gaps = 53/742 (7%)
 Frame = -2

Query  2617  KLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             KL +AL+P P GWS   S D C W  V CD  + NV+SIN+ +QS+SG LPSEL+ L+ L
Sbjct  33    KLASALTPTPKGWSTTNSDDYCNWNGVKCDS-SNNVISINLATQSLSGILPSELSTLSQL  91

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +SLS+Q+N LSG LPS AN++SL E+Y+ +N F+SIP D   GL +L+  S+++N  L  
Sbjct  92    QSLSLQENKLSGALPSLANLASLREIYIGTNNFTSIPQDCFKGLTSLQTMSMNENINLES  151

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W IS+ L ES SL +F ASNA I G IP+ F SFP+LQNLRLSYNNLTG LP SF +SEI
Sbjct  152   WVISTDLTESPSLTTFEASNAKIFGTIPDMFASFPSLQNLRLSYNNLTGGLPPSFANSEI  211

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             QNLWLNNQ+ GLSG I+V+SSM +LSQVWLQ N FTGP+PDLSK  NLFDLQL DNQ TG
Sbjct  212   QNLWLNNQEMGLSGNIEVLSSMEQLSQVWLQKNQFTGPVPDLSKSKNLFDLQLRDNQFTG  271

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALL  1727
             ++PVSL  LP L NI L NNKL GP+P FG  V V     N+FC DT G  CDPQVT LL
Sbjct  272   ILPVSLHSLPGLLNISLSNNKLQGPVPQFGKDVIVDNSGLNNFCVDTAGVACDPQVTTLL  331

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               AGG GYP+TL+ SWKGNDAC  W F+ CD   K VTTV+LG Q F G ISPAF+ LT+
Sbjct  332   EIAGGFGYPVTLSDSWKGNDACSGWPFVFCDSSKKTVTTVSLGKQHFGGIISPAFANLTA  391

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-GNLLL---  1379
             L  L LNDNNL+GPIP SL  L  L +LDVSNNNL+  +PSF  +V ++   GN  L   
Sbjct  392   LTTLKLNDNNLSGPIPDSLAKLSQLSLLDVSNNNLTGKIPSFATSVKLTTTPGNPFLGSG  451

Query  1378  --------------EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
                             T A G G  G G    G  +S  +   +V+ +VIV ++ +F+ +
Sbjct  452   GVPGSGGAPSPGSDSNTTAPGDGPNGKGI--GGKKVSPGLIAGIVVGLVIVGVIGVFLLF  509

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKTNEIMG---------------------------  1142
             K  +K++  + GR    E       L TN   G                           
Sbjct  510   KINIKKKRGKSGRVNDQENGDGISALVTNGSSGCTKGYGVLSEIQSQSSGNHSGRNIFEG  569

Query  1141  --TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                 I I+VL + T+ FSE ++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEF
Sbjct  570   GNNVISIEVLRQVTDNFSENNILGKGGFGVVYKGELHDGTKIAVKRMEAGAMGTKGMNEF  629

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
             QAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  G L  HLFEW++ G+ PLTWKQR
Sbjct  630   QAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGNLAQHLFEWQELGYPPLTWKQR  689

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             VTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD    +ET
Sbjct  690   VTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGNYSMET  749

Query  607   RVAGTFGYLAPEYATTGRVTKK  542
             R+AGTFGYLAPEYA TGRVT K
Sbjct  750   RLAGTFGYLAPEYAATGRVTTK  771


 Score =   159 bits (403),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K     N
Sbjct  685  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGN  744

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGV+LMEI+TG+KA+D+T+PDE  HLVT
Sbjct  745  YSMETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMEIMTGRKALDDTVPDERAHLVT  804

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    +L KAID TL+PDE+T  SI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  805  WFRRVLVNKDSLPKAIDQTLNPDEETLVSIFKVAELAGHCTAREPYQRPDMGHAVNVLGP  864

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E   G DL+MSLP
Sbjct  865  LVEQWKPTNHEE--ESTSGIDLHMSLP  889



>emb|CDP03933.1| unnamed protein product [Coffea canephora]
Length=910

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/728 (54%), Positives = 509/728 (70%), Gaps = 31/728 (4%)
 Frame = -2

Query  2644  FCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             F DDAA+M++L    S AP GWS +  PC WT V CD  +G V+SI + S+S+SG LPS 
Sbjct  27    FADDAAIMAELAKGFSNAPPGWSGNT-PCKWTGVQCDS-SGRVISIILISKSLSGKLPSG  84

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L +L+SL+SL+ Q+N L GPLPS +N++SL E+YLD N F+S+PPDFL+GL +L+ FSI 
Sbjct  85    LNKLSSLQSLNFQRNQLLGPLPSLSNLTSLREVYLDGNNFTSVPPDFLMGLTSLQTFSIG  144

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             +N  L PW I + LA+ST+L SF A+ A+I G IP+ F SFP+LQ+LRLSYNN+TG LP 
Sbjct  145   ENLNLPPWTIPNTLADSTALVSFIANKANIAGEIPDIFGSFPSLQSLRLSYNNITGGLPP  204

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S IQNLWLNNQ  GLSG IDV+ +M++++QVWL  N F+GPIPDLS C +LFDLQL
Sbjct  205   SFAESGIQNLWLNNQIAGLSGGIDVLGAMSQVTQVWLHVNKFSGPIPDLSGCKSLFDLQL  264

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDT---NSFCKDTPGP  1754
              DNQLTGV+P SL+ LP L+N+ L+NN   GP+P F   V+V  G +   NSFC  +PGP
Sbjct  265   RDNQLTGVIPPSLSSLPELQNVTLENNLFQGPVPKFPAGVQVTDGSSDGKNSFCNTSPGP  324

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             C  QVT LL  AG L YP  LA+SWKGN+ CQNW FI CD    +V+ +N GNQ F G I
Sbjct  325   CALQVTILLQVAGALNYPSALAESWKGNNPCQNWRFIVCD--SGSVSVINFGNQNFPGLI  382

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA + LTSLR L ++ N LTG IP +LT+L  L+VLDVSNNNLS  +P F P V++   
Sbjct  383   SPAIANLTSLRTLDMHANKLTGSIPATLTSLTKLKVLDVSNNNLSGKIPEFAPGVSVKTS  442

Query  1393  GN----LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             GN    + L  +   G  S G       S     + V++V+ V++VV++   V+ + Y+K
Sbjct  443   GNPFIGIELPPSFPPGNASSGPIDKAKASVSPWIIVVIIVVAVIMVVVLGFIVYRRYYVK  502

Query  1225  REHKRFGRAKSPEKIKS--------------TQMLKTN------EIMGTAIKIQVLEKAT  1106
             ++ + +  AK  +  K+              +QM   N      + +  AI I+VL +AT
Sbjct  503   KQSREYKSAKGSKNGKTSLEGDSDAISSDLPSQMDTENYDFHFSDGISVAIPIEVLREAT  562

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKN  926
             N FSE+++LG GG+G+VY G+L +GT++AVK+M+    + KG+ EF+AEI  LSKVRHKN
Sbjct  563   NHFSEQNILGEGGFGIVYKGQLHDGTQIAVKRMESSFMNKKGLGEFRAEIEVLSKVRHKN  622

Query  925   LVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYL  746
             LVAL G+C+N ++ LLVYEYM  GTLG HL  W++ G  PLTWKQR++IA DVARG+EYL
Sbjct  623   LVALHGFCVNGNERLLVYEYMPQGTLGQHLISWQERGTLPLTWKQRLSIALDVARGVEYL  682

Query  745   HSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYA  566
             H L +QSFIHRD+K SNILL DD+RAKV+DFGLVK APD K  VETR+AGTFGYLAPEYA
Sbjct  683   HGLANQSFIHRDLKPSNILLGDDMRAKVSDFGLVKIAPDGKHSVETRLAGTFGYLAPEYA  742

Query  565   TTGRVTKK  542
              TGRVT K
Sbjct  743   ATGRVTTK  750


 Score =   145 bits (366),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGV+LME+ITG+KA+D+  P+E  HLVTW
Sbjct  725  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMELITGQKALDDAQPEEKAHLVTW  784

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++I     ++ ++DP+L PDE+TF+SI KVAELAAHCT    ++RP M H VNVL P 
Sbjct  785  FRRVIFNKDEIRSSLDPSLRPDEETFKSIWKVAELAAHCTARDQHQRPIMGHAVNVLSPL  844

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W     +E  + F G DLNMSLP
Sbjct  845  VEQWMPGSDDEEEDSF-GIDLNMSLP  869



>ref|XP_009610544.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=923

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/733 (51%), Positives = 505/733 (69%), Gaps = 38/733 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             DAAVM+KL  +L+P P+GWS   + C W  V+CD  +G V SI++ S+S++G LP +L Q
Sbjct  36    DAAVMAKLAKSLAPTPTGWSG-PNVCKWPGVSCDS-SGRVSSISLISKSVAGELPPDLNQ  93

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+SL+SL++Q+N L G LP  +++SSL+E++LD+N F+S+PP+FL GL +L  FSI +N 
Sbjct  94    LSSLQSLNLQRNRLYGSLPPLSDLSSLQEVHLDNNNFTSVPPNFLKGLTSLEHFSIDENP  153

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L PW I   L +S+SL  F ASNA+I G IP+ F SFP+L+N+RLSYNN+TG LP SF 
Sbjct  154   SLPPWTIPDSLTDSSSLADFSASNANIMGQIPDIFGSFPSLENVRLSYNNITGFLPASFA  213

Query  2095  SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
             +S I+NL LNNQ+ GLSG IDV+ SM +L+QVW+  N F+GPIPDLS C NL DLQL DN
Sbjct  214   NSGIKNLVLNNQKNGLSGRIDVLGSMEQLTQVWIHVNKFSGPIPDLSLCTNLVDLQLRDN  273

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVT  1736
              LTGV+P SLT LP L N+ LQNN  +GPMP+F   V+V LG+ N FC  +P PCDPQVT
Sbjct  274   TLTGVIPASLTSLPKLANVSLQNNIFMGPMPVFKTGVQVSLGNMNHFCNPSPEPCDPQVT  333

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
              LL  AG +GYP+ +A+SW GN+ C+ W F+TCDP+G +V  +N   Q + GTISPA + 
Sbjct  334   VLLEVAGAVGYPMRVAESWAGNNPCKGWDFVTCDPKG-SVIVINFAKQNWVGTISPAAAN  392

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             LT+L+ L ++DNNLTGPIP SLT+LP LQ++DVSNNN+S  +P F P V +   GN  + 
Sbjct  393   LTALKQLVMSDNNLTGPIPASLTSLPELQLVDVSNNNISGKIPKFRPDVIVKTSGNPFMG  452

Query  1375  KTVATGR--------------GSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
             K +                   SP  G  ++       + +V+  +++I+VL ++   YK
Sbjct  453   KDLPPSSPPGSPSSPGGTDNPSSPTIGAHKSSVPTWVIVAIVIAAIILILVLCLVIYKYK  512

Query  1237  CYMKREHKRFGRAK-------SPEKIKSTQMLKTNEIMGTA--------------IKIQV  1121
             C  K +  +    K       SP+ +     + +     +A              I +++
Sbjct  513   CNGKSKLSKVKTGKEQKLKNNSPKNVNGYGAIPSTASQSSAANSEIYIYDGGNVTIPVEL  572

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L +AT+ F+EE++LG GG+G+VY GKL +GT++AVK+M+      KG+NEF+AEI  L+K
Sbjct  573   LREATDNFNEENILGRGGFGIVYKGKLHDGTEIAVKRMEASIASNKGLNEFKAEIEVLTK  632

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL G+C+N ++ LLVYEYM  GTLG HLF+ +  GF PLTWKQR+ IA DVAR
Sbjct  633   VRHRHLVALHGFCVNGYERLLVYEYMPQGTLGQHLFDHEHLGFPPLTWKQRLIIALDVAR  692

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLH L  QSFIHRD+K SN+LL DD+RAKVADFGLVK APD K  VET++AGTFGYL
Sbjct  693   GVEYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVADFGLVKNAPDGKYSVETKLAGTFGYL  752

Query  580   APEYATTGRVTKK  542
             APEYA+TGRVT K
Sbjct  753   APEYASTGRVTTK  765


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K+DV+AFGV+LME+ITG+KA+DE LP++  HLV W
Sbjct  740  SVETKLAGTFGYLAPEYASTGRVTTKIDVFAFGVMLMEMITGRKALDENLPEDRSHLVPW  799

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N++  +DP++DPDE+T++SI KV ELA HC   +  +RP+M H V+VL P 
Sbjct  800  FRRMVMNKENIRYILDPSVDPDEETYQSICKVVELAGHCAAREPSQRPDMGHAVSVLAPL  859

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W         +     D NMSLP
Sbjct  860  VEQWTPTASNG--DDSFNIDFNMSLP  883



>ref|XP_010685103.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=928

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/739 (53%), Positives = 503/739 (68%), Gaps = 43/739 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S +  DDA +M KL  + +P P  WS + +PC W  ++C   +G + SI + S+SISG L
Sbjct  29    STASADDATIMMKLSRSFNPPPPNWSGN-NPCKWQGISCGS-SGQLTSITLVSKSISGTL  86

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PSE+TQL++L SLS+Q N LSG +P  ANMS+L+E++LD N FS IP +FL+GLPNL+ F
Sbjct  87    PSEITQLSNLESLSLQNNHLSGTIPPLANMSNLQEVFLDGNFFSHIPSNFLVGLPNLQSF  146

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             SI+DN  L  W I   L+ES+SL SF A+NAS+ G IP+ F S P+LQ+LRLSYNN+TG 
Sbjct  147   SITDN-PLDSWSIPQGLSESSSLQSFRAANASVVGPIPDIFGSLPSLQDLRLSYNNITGF  205

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SF  S IQNLW+NNQ+QGLSG +DV+  M  L+QVW+Q N F GPIPDLSKC +LFD
Sbjct  206   LPASFAGSSIQNLWINNQKQGLSGVLDVLGKMPNLAQVWVQDNDFVGPIPDLSKCTSLFD  265

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DN L+GV+P SL+ LP L NI LQNNKL GPMP FGN V+V LG TNSFCK TPGP
Sbjct  266   LQLRDNHLSGVIPPSLSNLPKLVNISLQNNKLQGPMPSFGNGVQVTLGFTNSFCKTTPGP  325

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDPQVTALL   G LGYP  LA+SWKGNDAC+NWA ++CD  GK +  VN   Q + G I
Sbjct  326   CDPQVTALLDIVGSLGYPSELAESWKGNDACKNWAHVSCDSSGK-INVVNFAKQNWGGFI  384

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP+F+ LTSL ++ LNDN+L G IP  L+ L  L   D+SNNNL+  +PSF  +V +   
Sbjct  385   SPSFANLTSLTSIILNDNDLVGKIPDELSGLKMLHKFDISNNNLTGKVPSFGQSVEVISN  444

Query  1393  GNLLLEKTVATGRG---------SPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             GN  L   V T            SPG+    + S +S      +VI V+++++   F+ Y
Sbjct  445   GNPFLGTNVDTSNSLKSPPGMTNSPGTNDHSH-SRLSPYEVAAIVIGVILLLVAAGFLLY  503

Query  1240  ---------KCYMKREHKRFGRAK----------------SPEKIKSTQMLKTNEIMGTA  1136
                      K Y   ++  F R K                SP +  S+ ML         
Sbjct  504   PRFKKWLIDKVYRSGKNNPFYRGKNKVEDFKNPISQYPQGSPMEQSSSSMLNNGS---NT  560

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             I I+VL + TN FSE+++LG GG+G+VY G L +GT++AVK+M+     TKG +EF+AEI
Sbjct  561   IPIEVLREVTNNFSEKNILGRGGFGIVYKGVLQDGTEIAVKRMESNLQGTKGKSEFEAEI  620

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
               LSKVRH++LVAL+GYCIN ++ +++YEYM  GTLG H+FE+ + G  PLTWKQR+ IA
Sbjct  621   EVLSKVRHRHLVALLGYCINGNERIVIYEYMPQGTLGQHIFEYDEIGRSPLTWKQRLVIA  680

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF-VETRVA  599
              DVARG+EYLHSL  QSFIHRD+K SN+LL D++RAKV+DFGLVK A D   + +ETR+A
Sbjct  681   LDVARGVEYLHSLAQQSFIHRDLKPSNVLLGDNMRAKVSDFGLVKSASDQGKYSLETRLA  740

Query  598   GTFGYLAPEYATTGRVTKK  542
             GTFGYLAPEYA TGRVT K
Sbjct  741   GTFGYLAPEYAATGRVTTK  759


 Score =   136 bits (342),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            SL   L G    L       G    KVDV+AFGV+LME+ITG+KA+DE+LP+E   LVTW
Sbjct  734  SLETRLAGTFGYLAPEYAATGRVTTKVDVFAFGVILMELITGRKALDESLPEEQAQLVTW  793

Query  438  FHKIIRKSHNLQKAIDPTLDPD-EQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F +++    +++K+IDP L+   E+ FESI KVAEL+ HCT  + ++RP+M H VN+L P
Sbjct  794  FRRVLITKESIRKSIDPNLETGKEEIFESICKVAELSGHCTAREPHQRPDMSHAVNILSP  853

Query  261  FAHNWRSLRPEEI--VEKFGGFDLNMSLP  181
                W   RP E+     + G D+NM+LP
Sbjct  854  LVEQW---RPAEMDGATDWVGIDVNMNLP  879



>ref|XP_011020360.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=962

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/742 (55%), Positives = 502/742 (68%), Gaps = 53/742 (7%)
 Frame = -2

Query  2617  KLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             KL +AL+P P GWS   S D C W  V CD  + NV+SIN+ +QS+SG LPSEL+ L+ L
Sbjct  64    KLASALTPTPKGWSTTNSNDYCKWNGVKCDN-SNNVISINLATQSLSGILPSELSTLSQL  122

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +SLS+Q+N L G LPS AN++SL E+Y+ +N F+SIP D   GL +L+  S++DN  L  
Sbjct  123   QSLSLQENKLYGALPSLANLASLREIYIGTNNFTSIPQDCFKGLTSLQTLSMNDNINLES  182

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W IS+ L ES+SL +F ASNA I G IP+ F SFP+LQNLRLSYNNLTG LP SF +S I
Sbjct  183   WVISTDLTESSSLTTFEASNAKIFGTIPDMFASFPSLQNLRLSYNNLTGGLPPSFANSGI  242

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             QNLWLNNQ+ GLSGTI+V+ SM +LSQVWLQ N FTGPIPD SK  +LFDLQL DNQ TG
Sbjct  243   QNLWLNNQEMGLSGTIEVLPSMEQLSQVWLQKNQFTGPIPDFSKSKSLFDLQLRDNQFTG  302

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALL  1727
             ++PVSL  LP L NI L NNKL GP+P FG  V V     N+FC DT G  CDPQVT LL
Sbjct  303   ILPVSLHSLPGLLNISLSNNKLQGPVPQFGKDVIVDNSGLNNFCVDTAGVACDPQVTTLL  362

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               AGG GYP+TL+ SWKGNDAC  W F+ CD   K VTTV+LG Q F G ISPAF+ LT+
Sbjct  363   EIAGGFGYPVTLSDSWKGNDACSGWPFVFCDSSKKTVTTVSLGKQHFGGIISPAFANLTA  422

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-GNLLLEKT  1370
             L  L LNDNNL+GPIP SL  L  L +LDVSNNNL+  +PSF  +V ++   GN  L   
Sbjct  423   LTTLKLNDNNLSGPIPDSLAKLSQLSLLDVSNNNLTGKIPSFATSVKLTTTPGNPFLGSG  482

Query  1369  VA------------TGRGSPGSGQTENGSSMSAR-----MfvvvvivvvivvlvvlfvFY  1241
                           +   +PG G   NG  + A+     +   +V+ +VIV  + LF+ +
Sbjct  483   GGPGSGGAPSPGSDSNTTTPGDG--PNGKGIGAKKVSPGLIAGIVVGLVIVGFIGLFLLF  540

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKTN-------------EIMGTA------------  1136
             K  +K++  + GR    E       L TN             EI   +            
Sbjct  541   KINIKKKRGKSGRVNDQENGDGINALVTNGSSSCTKGYGVLSEIQSQSSGNHSGRNIFEG  600

Query  1135  ----IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                 I I+VL + T+ FSE ++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEF
Sbjct  601   GNNVISIEVLRQVTDNFSENNILGKGGFGVVYKGELHDGTKIAVKRMEAGAMGTKGMNEF  660

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
             QAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++ G+ PLTWKQR
Sbjct  661   QAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLAQHLFEWQELGYPPLTWKQR  720

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             VTI  DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD    +ET
Sbjct  721   VTITLDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGNYSMET  780

Query  607   RVAGTFGYLAPEYATTGRVTKK  542
             R+AGTFGYLAPEYA TGRVT K
Sbjct  781   RLAGTFGYLAPEYAATGRVTTK  802


 Score =   156 bits (394),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 119/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K     N
Sbjct  716  TWKQRVTITLDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGN  775

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVD+Y FGV+LMEI+TG+KA+D+T+PDE  HLVT
Sbjct  776  YSMETRLAGTFGYLAPEYAATGRVTTKVDLYVFGVILMEIMTGRKALDDTVPDERAHLVT  835

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    +L KAID TL+PDE+T  SI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  836  WFRRVLVNKDSLPKAIDQTLNPDEETLVSIFKVAELAGHCTAREPYQRPDMGHAVNVLGP  895

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E   G DL+MSLP
Sbjct  896  LVEQWKPTNHEE--ESTSGIDLHMSLP  920



>ref|XP_009789399.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=917

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/731 (52%), Positives = 505/731 (69%), Gaps = 36/731 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D+AVM+KL  +L+P P+GWS   D C W  V+CD  +G V SI++ S+S++G LP +L Q
Sbjct  32    DSAVMAKLAKSLTPTPTGWSG-PDVCKWPGVSCDS-SGRVSSISLISKSVAGELPPDLNQ  89

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L++L+SL++Q+N L G LP  +++SSL+E++LD+N F+S+P +FL GL +L  F I +N 
Sbjct  90    LSNLQSLNLQRNRLYGSLPPLSDLSSLQEVHLDNNNFTSVPSNFLKGLTSLEHFCIDENP  149

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L PW I   L +S+SL  F ASNA+I G IP+ F SFP+L+N+RLSYNN+TG LP SF 
Sbjct  150   SLPPWTIPDSLTDSSSLADFSASNANIMGQIPDIFGSFPSLENVRLSYNNITGFLPSSFA  209

Query  2095  SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              S I+NL LNNQ+ GLSG IDV+ SM +L+QVW+  N F+GPIPDLS C+NL DLQL DN
Sbjct  210   KSGIKNLVLNNQKNGLSGRIDVLGSMEQLTQVWIHVNKFSGPIPDLSLCINLVDLQLRDN  269

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVT  1736
              LTGV+P SLT LP L N+ LQNN  +GPMP+F   V+V LG+ N FC  +PGPCDPQVT
Sbjct  270   TLTGVIPASLTSLPKLANVSLQNNIFMGPMPVFKTGVQVNLGNMNHFCNPSPGPCDPQVT  329

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
              LL  AG +GYP+ +A+SW GN+ C+ W F+TCDP+G +V  +N   Q + GTISPA + 
Sbjct  330   VLLEVAGAVGYPMRVAESWAGNNPCKGWDFVTCDPKG-SVIVINFAKQNWVGTISPAAAN  388

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             LT+L+ L ++DNNL GP+P SLT+LP LQ++DVSNNN+S  +P F P V +   GN  + 
Sbjct  389   LTALKQLVMSDNNLIGPVPASLTSLPELQLVDVSNNNISGKIPKFRPDVIVKTSGNPFMG  448

Query  1375  KTV---ATGRGSPGSGQTENGSSMS-ARMfvvvvivvvivvlvvlfvFYKCYMKREHKRF  1208
             K +   +        G T++ SS +         ++V IV+  ++ +   C +  ++KR 
Sbjct  449   KDLPPSSPPGSPSSPGGTDDPSSPTIGAHKASTWVIVAIVIAAIILIIVLCLVIYKYKRN  508

Query  1207  GRAK-SPEKIKSTQMLKTNE---------IMGTA-------------------IKIQVLE  1115
             G +K S  K    Q LK N          I  TA                   I +++L 
Sbjct  509   GNSKLSKVKTGKEQKLKNNSPKNVNGYGAIPSTASQSSAANSEIYIYDGGNVTIPVELLR  568

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
             +AT+ F+EE++LG GG+G+VY GKL +GT++AVK+M+      KG+NEF+AEI  L+KVR
Sbjct  569   EATDNFNEENILGRGGFGIVYKGKLHDGTEIAVKRMEASIASNKGLNEFKAEIEVLTKVR  628

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LVAL G+C+N ++ LLVYEYM  GTLG HLF+ +  GF PLTWKQR+ IA DVARG+
Sbjct  629   HRHLVALHGFCVNGYERLLVYEYMPQGTLGQHLFDHEHLGFPPLTWKQRLIIALDVARGV  688

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLH L  QSFIHRD+K SN+LL DD+RAKVADFGLVK APD K  VET++AGTFGYLAP
Sbjct  689   EYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVADFGLVKNAPDGKYSVETKLAGTFGYLAP  748

Query  574   EYATTGRVTKK  542
             EYA+TGRVT K
Sbjct  749   EYASTGRVTTK  759


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K+DV+AFGV+LME+ITG+KA+DE LP++  HLV W
Sbjct  734  SVETKLAGTFGYLAPEYASTGRVTTKIDVFAFGVMLMEMITGRKALDENLPEDRSHLVPW  793

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N++  +DP++DPDE+T++SI KV ELA HC   +  +RP+M H V+VL P 
Sbjct  794  FRRMVMNKENIRYILDPSVDPDEETYQSICKVVELAGHCAAREPSQRPDMGHAVSVLAPL  853

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W         +     D NMSLP
Sbjct  854  VEQWTPTASNG--DDSFNIDFNMSLP  877



>emb|CDY61573.1| BnaCnng38030D [Brassica napus]
Length=911

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/736 (52%), Positives = 504/736 (68%), Gaps = 43/736 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWS--ASKDPCTWTNVNCDKPTGNVVSINIDSQSISG  2480
             + S  DD A M  L  +  P PS WS  +S D C WT V C   +G V SI+++  S+SG
Sbjct  21    TTSTADDGAAMLALAKSFRPPPSDWSTTSSTDYCKWTGVKCT--SGRVNSISLEDTSLSG  78

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              LP E++ L+ L++L++Q+N LSG +PSFA +SSL+E+YLD N F  + P    GL +L+
Sbjct  79    GLPPEISTLSELKTLTLQRNKLSGKIPSFAKLSSLQEIYLDENLFDGVEPGAFAGLTSLQ  138

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             I SISDN  ++ W   S L +STSL S    N +I+GV+P+ FDSF +LQ+LRLSYNN+T
Sbjct  139   ILSISDNPNIAAWSFPSELVDSTSLTSVSLDNTTISGVLPDVFDSFASLQSLRLSYNNIT  198

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             G+LP S   S +QNLW+NNQ+ GL+GTI+V+S MT LSQ WLQ N  TGPIPDLSK  NL
Sbjct  199   GALPPSLAKSPVQNLWINNQESGLTGTIEVLSGMTSLSQAWLQKNQLTGPIPDLSK-TNL  257

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
             FDLQL DNQLTG+V  SL  L +L+NI L +NK  GP+PLF  +V  +  + N FC    
Sbjct  258   FDLQLRDNQLTGIVSPSLLPLGSLKNITLDSNKFQGPLPLFPPEVAKVSAEHNYFCTAKA  317

Query  1759  GP-CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             G  CDPQV  LLA AGGLGYP TLA+SW+GNDAC NWA++TCD   KNV T+N+    F+
Sbjct  318   GENCDPQVMTLLAVAGGLGYPSTLAESWQGNDACSNWAYVTCDSSKKNVVTLNVAKHGFA  377

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             G ISPA + LTSL+N+YLNDNNLTG +P+ LT +P LQ++DVSNNNL+  +P FP  V  
Sbjct  378   GVISPAIANLTSLKNVYLNDNNLTGVVPIVLTFMPSLQLIDVSNNNLTGEIPIFPAQVKF  437

Query  1402  SFG-GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             ++  GN+L+   +        +     G    A + + V++ V++ + ++ FV YK  MK
Sbjct  438   NYKPGNVLIGTDIGD-----STNGGGPGGGSKAGVIIGVIVGVLVFLAILGFVVYKFVMK  492

Query  1225  REHKRFGRAKSPEKIKSTQMLKTNEIMG----------------------------TAIK  1130
             +++ +FGR   PE  K+ +++ +++  G                              I 
Sbjct  493   KKYGKFGRT-DPE--KAGKLMVSDDKNGYGANNFNALKSPSSGDSGGDRFPLEGGNVTIP  549

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             ++VL + TN FSE ++LG GG+GVVY G+L +GTK A+K+M+  +   KG NEFQAEIA 
Sbjct  550   MEVLRQVTNNFSEANILGRGGFGVVYAGELHDGTKTAIKRMESSSMGDKGRNEFQAEIAV  609

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFE+++ G+ PLTWKQRV+IA D
Sbjct  610   LTKVRHRHLVALLGYCVNGYERLLVYEYMPQGNLGQHLFEYQELGYSPLTWKQRVSIALD  669

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  QSFIHRD+KSSNILL DD+RAKVADFGLVK APD K  VETR+AGTF
Sbjct  670   VARGVEYLHSLAQQSFIHRDLKSSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTF  729

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA TGRVT K
Sbjct  730   GYLAPEYAATGRVTTK  745


 Score =   147 bits (370),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 118/208 (57%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  659  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKSSNILLGDDMRAKVADFGLVKNAPDGK  718

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME++TG+KA+D++LPDE CHLVT
Sbjct  719  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMLTGRKALDDSLPDEKCHLVT  778

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+     + K +D TL+ D++T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  779  WFRRILINKEKISKELDQTLEADKETLESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  838

Query  261  FAHNWRSLRPEEIVEKFGGFDL-NMSLP  181
                W+    E+  E+  G D+ NMSLP
Sbjct  839  LVEKWKPTSQEQ--EESFGIDMNNMSLP  864



>gb|KHG03733.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=920

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/744 (53%), Positives = 511/744 (69%), Gaps = 53/744 (7%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASK--DPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD A M K+ ++  P P+GWS+S   + C W  +NCDK + +V SIN+ S+S+SG L  +
Sbjct  22    DDGATMLKIASSFRPPPTGWSSSSSDNYCKWPGINCDK-SNSVTSINLSSKSLSGTLSPD  80

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             +  L+ L++LS+Q+N+LSG +PSFAN+SSL+E+YLDSN F+SI P+   GL +L+  S+S
Sbjct  81    IAALSELQTLSLQRNALSGTIPSFANLSSLQEVYLDSNTFTSISPNAFSGLTSLQKLSLS  140

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             DN  LSPW     L++ST L      N S+ G +P+ FDS  +L+++RLSYNNL+G LP 
Sbjct  141   DNAGLSPWTFPD-LSQSTGLVELQLDNTSLFGSLPDIFDSMNSLKSIRLSYNNLSGILPA  199

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             S G S +QNLW+NNQ  G +GT+ V+S+MT+LSQVWLQ N FTGPIPDLSKC+++FDLQL
Sbjct  200   SLGGSMVQNLWINNQDVGFTGTLQVLSNMTQLSQVWLQKNLFTGPIPDLSKCLDIFDLQL  259

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKV-KVILGDTNSFCKDTPGPCD  1748
              DNQLTG VP SL  LPNL+N+ L NNKL GP P F   V K ++   N+FC     PC+
Sbjct  260   RDNQLTGPVPKSLIDLPNLKNVSLSNNKLQGPFPEFPTSVEKKVVDGNNNFCNSNGDPCN  319

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQVT LL  AGG GYP++L+ +W GNDAC+ W+FI+CD + KNV TVNL  +   GTISP
Sbjct  320   PQVTTLLEIAGGFGYPVSLSDNWPGNDACE-WSFISCDSR-KNVITVNLEKKNLVGTISP  377

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LTSL+NL LN N LTG IP SLT L  LQ+LDVSNNNLS  +P F  +V   + GN
Sbjct  378   AFANLTSLKNLNLNGNGLTGSIPDSLTKLTSLQLLDVSNNNLSGDIPKFSNSVKFLYSGN  437

Query  1387  LLLEKTVATGRGSPG--------------SGQTENGSSMSARMfvvvvivvvivvlvvlf  1250
              LL K+  +G G                 SG ++N    S  M V ++  V+I V VV F
Sbjct  438   SLLGKSGGSGDGGDSGSGASAGGSDGNLKSGNSKN----SIAMIVGIIAGVLIFVAVVCF  493

Query  1249  vFYKCYMKREHKRFGRAKSPEK----IKS--------------TQMLKTN----------  1154
             V YK  M + + +FG+ +  +     +KS              ++ML  +          
Sbjct  494   VSYKYIMNKRYGKFGKVEGSDAERGVVKSPANGGGMNGNGGVPSEMLSQSSGDRSDHHFF  553

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E     I IQVL + T+ F+E +VLG GG+GVVY G+L +GT++AVK+M+  +T TKGMN
Sbjct  554   EGGNVVISIQVLRQVTDNFNEANVLGRGGFGVVYKGELHDGTQIAVKRMECVSTGTKGMN  613

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW+++G+ P TWK
Sbjct  614   EFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLSQHLFEWRENGYAPFTWK  673

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             QR TIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK AP+ K  V
Sbjct  674   QRATIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPEGKYSV  733

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  734   ETRLAGTFGYLAPEYAATGRVTTK  757


 Score =   150 bits (380),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 116/207 (56%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW +  +I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  671  TWKQRATIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPEGK  730

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DETLPDE  HLVT
Sbjct  731  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETLPDERSHLVT  790

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ K +D T++ DE+T  SI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  791  WFRRVLTNKDNIPKVVDETINCDEETMASIFKVAELAGHCTAREPYQRPDMGHAVNVLGP  850

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    E+   +  G DL+MSLP
Sbjct  851  LVELWKPTTQED--GENSGIDLHMSLP  875



>ref|XP_003537524.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=927

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/743 (54%), Positives = 485/743 (65%), Gaps = 46/743 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             +  DD   MSKL  ALSP PSGWS S   C W  V C      V SINI SQS+ G LP 
Sbjct  28    AIADDGEFMSKLAKALSPTPSGWSGSSF-CAWNGVKCS--AHRVTSINIASQSLGGMLPP  84

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L  L+ L SLS+Q N+LSG  PS AN+S LE ++L SN F+SIP     GLP+L+  S+
Sbjct  85    DLNSLSQLTSLSLQNNALSGAFPSLANLSMLESVFLSSNNFTSIPVGCFQGLPSLQTLSM  144

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             +D+  L+PW I + L +S +L      NA++ G +P+ FD F +L  LRLSYNNLTG LP
Sbjct  145   TDSINLAPWTIPAELTDSINLVKLELGNANLIGTLPDVFDKFVSLVELRLSYNNLTGVLP  204

Query  2107  GSFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
              SF  S IQN+   N    G SGTI+V++SMT LSQVWLQ N FTGPIPDLS C  LFDL
Sbjct  205   KSFAGSAIQNMWLNNQNGFGFSGTIEVLASMTHLSQVWLQKNQFTGPIPDLSNCTTLFDL  264

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPC  1751
             QL DNQLTGVVP SL  L  L+N+ L NN L GP+P FG  VK  L   NSFC    GPC
Sbjct  265   QLRDNQLTGVVPPSLMSLSGLQNVTLANNALQGPVPSFGKGVKFTLDGINSFCLKDVGPC  324

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             D +VT LL  A G GYP  LA+SW GND C +W+F+ C   G  + TVNL  Q  +GTIS
Sbjct  325   DSRVTTLLDIAAGFGYPFQLARSWTGNDPCDDWSFVVC--AGGKIITVNLAKQNLTGTIS  382

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PAF+ LT LRNL+LNDNNL G IP SLT L  L+VL+VSNN LS  +P F   V  +  G
Sbjct  383   PAFANLTDLRNLFLNDNNLGGSIPGSLTNLAQLEVLNVSNNKLSGDVPKFSSKVKFTTAG  442

Query  1390  NLLLEK---------TVATGRGSPGSGQTE---NGSSMSARMfvvvvivvvivvlvvlfv  1247
             N LL +         T + G G   SG      +GSS+S      +V++ V  V VV+FV
Sbjct  443   NDLLGRSDGGGGSGTTPSKGSGDAPSGSPSAGTSGSSLSPAWIAGIVVIAVFFVAVVVFV  502

Query  1246  FYKCYMKREHKRFGRAKSPE----KIKSTQMLKTN------------------------E  1151
             F KC+ K  H +FGR  +PE    ++K   M  TN                        E
Sbjct  503   FCKCHAKNRHGKFGRVNNPENGKGEVKIDMMSVTNSNGYGGVPSELQSQGSERSDLHVFE  562

Query  1150  IMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNE  971
                  I IQVL + T+ FSE+++LG GG+GVVY G+L +GT++AVK+M+  AT +KG+NE
Sbjct  563   GGNATISIQVLRQVTDNFSEKNILGRGGFGVVYKGELHDGTQIAVKRMESVATGSKGLNE  622

Query  970   FQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQ  791
             FQAEIA LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W ++G  PLTWKQ
Sbjct  623   FQAEIAVLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWGENGCAPLTWKQ  682

Query  790   RVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVE  611
             RV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VE
Sbjct  683   RVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVE  742

Query  610   TRVAGTFGYLAPEYATTGRVTKK  542
             TR+AGTFGYLAPEYA TGRVT K
Sbjct  743   TRLAGTFGYLAPEYAATGRVTTK  765


 Score =   160 bits (404),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  679  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  738

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  739  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTVPDERSHLVS  798

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  799  WFRRVLINKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLGP  858

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  859  LVEQWKPTTHEE--EEGYGIDLHMSLP  883



>ref|XP_002324686.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
 gb|EEF03251.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
Length=929

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/761 (53%), Positives = 478/761 (63%), Gaps = 76/761 (10%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
              DDA  M KL +AL+P P GWS +     C W  V CD  + NV+SIN+ SQ +SG LPS
Sbjct  24    ADDAGTMLKLASALTPTPKGWSTTNTNGYCKWNGVKCDN-SNNVISINLASQGLSGTLPS  82

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             EL+ L+ L+S S+Q N L GPLPS AN++ L E+Y+ +N F+SIP DF  GL +L+  S+
Sbjct  83    ELSTLSQLQSFSLQDNKLIGPLPSLANLAFLREVYIGTNNFTSIPADFFKGLTSLQTLSM  142

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
               N  L PW +S+ L ES+SL +F AS+A+I G IPN F SFP+LQNLRLSYNNLTG LP
Sbjct  143   DANINLEPWVLSTDLTESSSLNTFEASHANIFGAIPNMFASFPSLQNLRLSYNNLTGGLP  202

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SF +S IQNLWLNNQ+ GLSGTI+V+ SM +LSQVWLQ N FTGPIPD SK  +LFDLQ
Sbjct  203   PSFANSGIQNLWLNNQEMGLSGTIEVLPSMEQLSQVWLQKNQFTGPIPDFSKSKSLFDLQ  262

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PC  1751
             L DNQ TG+ PVSL+    L NI   NNKL GP+P FG  VKV     N+FC DT G  C
Sbjct  263   LRDNQFTGIFPVSLSSQAGLLNISFYNNKLQGPVPQFGKGVKVDNSGLNNFCVDTAGVAC  322

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
              PQVT LL  AGG GYP+ L+ SWKGNDAC  W F+TCD Q K V TV+LG Q F G IS
Sbjct  323   HPQVTTLLEIAGGFGYPVMLSDSWKGNDACNGWPFVTCDSQKKTVITVSLGKQHFGGIIS  382

Query  1570  PAFSQLTSLRNLYLND------------------------NNLTGPIP-----VSLTTLP  1478
             PAF  LT+L  L LND                        NNLTG IP     V LT  P
Sbjct  383   PAFVNLTALTTLKLNDNNLSGPIPDSLIKLSQLSLLDVSNNNLTGKIPAFASSVKLTITP  442

Query  1477  HLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMf  1298
                 L     + S   PS     N +  G       V  GRG        NG    +   
Sbjct  443   GNPFLGSGGGSGSGGTPSSGSDSNTTTPGG------VPNGRG--------NGGKKVSPGV  488

Query  1297  vvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN------------  1154
             +  V+ +VIV  +  FV +K   K++  + GR    E       L  N            
Sbjct  489   IAGVVGIVIVGAIGFFVLFKVNRKKKRGKSGRVNDQESGNGINALVKNGSSCCTNGYGVL  548

Query  1153  -----------------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
                              E     I I+VL + T+ FSE ++LG GG+GVVY G+L +GTK
Sbjct  549   SEIQSQSSGNHSGRHFFEGGNVVISIEVLRQVTDNFSENNILGKGGFGVVYKGELHDGTK  608

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+ GA  TKGMNEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL 
Sbjct  609   IAVKRMESGAMGTKGMNEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLA  668

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLFEW++ G+ PLTWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAK
Sbjct  669   QHLFEWQELGYPPLTWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAK  728

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             VADFGLVK APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  729   VADFGLVKNAPDGKYSMETRLAGTFGYLAPEYAATGRVTTK  769


 Score =   160 bits (404),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 132/236 (56%), Gaps = 19/236 (8%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  683  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  742

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGV+LMEI+TG+KA+D+T+PDE  HLVT
Sbjct  743  YSMETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVILMEIMTGRKALDDTVPDERAHLVT  802

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL KAID TL+PDE+TF SI KVAELA HCT  + ++RP+M H VNVLGP
Sbjct  803  WFRRVLVNKDNLPKAIDQTLNPDEETFVSIFKVAELAGHCTAREPHQRPDMGHAVNVLGP  862

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLPLVF-----DDSSIESLSFTNAQHRLNQSA  109
                W+    EE  E   G DL+MSLP        D+ +  S +F N  +  +QS+
Sbjct  863  LVEQWKPTNHEE--EGNSGIDLHMSLPQFLQRWQADEGT--STTFNNMSYSQSQSS  914



>emb|CDY63752.1| BnaAnng19060D [Brassica napus]
Length=912

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/736 (53%), Positives = 503/736 (68%), Gaps = 42/736 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWS--ASKDPCTWTNVNCDKPTGNVVSINIDSQSISG  2480
             + S  DD A M  L  +  P PS WS  +S D C WT V C   +G V SI+++  S+SG
Sbjct  21    TTSTADDGAAMLALAKSFRPPPSDWSTTSSTDYCKWTGVKCT--SGRVNSISLEDTSLSG  78

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              LP E++ L+ L++L++Q+N LSG +PSFA +SSL+E+YLD N F  + P    GL +L+
Sbjct  79    GLPPEISTLSELKTLTLQRNKLSGKIPSFAKLSSLQEIYLDENLFDGVEPGAFAGLTSLQ  138

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             I SISDN  ++ W   S L +STSL S    N +I+GV+P+ FDSF +LQ+LRLSYNN+T
Sbjct  139   ILSISDNPNIAAWSFPSELVDSTSLTSVSLDNTTISGVLPDVFDSFASLQSLRLSYNNIT  198

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             G+LP S   S +QNLW+NNQ+ GL+GTI+V+S MT L+Q WLQ N  TGPIPDLSK  NL
Sbjct  199   GALPPSLAKSPVQNLWINNQESGLTGTIEVLSGMTSLTQAWLQKNQLTGPIPDLSK-TNL  257

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
             FDLQL DNQLTG+V  SL  L +L+NI L +NK  GP+PLF  +V  +  + N FC    
Sbjct  258   FDLQLRDNQLTGIVSPSLLPLGSLKNITLDSNKFQGPLPLFPPEVAKVSAEHNYFCTAKA  317

Query  1759  GP-CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             G  CDPQV  LLA AGGLGYP TLA+SW+GNDAC NWA++TCD   KNV T+NL    F+
Sbjct  318   GENCDPQVMTLLAVAGGLGYPPTLAESWQGNDACSNWAYVTCDSSKKNVVTLNLAKHGFA  377

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             G ISPA + LTSL+N+YLNDNNLTG +P  LT + +LQ++DVSNNNL+  +P FP  V  
Sbjct  378   GVISPAIANLTSLKNIYLNDNNLTGVVPKVLTFMSNLQLIDVSNNNLTGEIPIFPAQVKF  437

Query  1402  SFG-GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             S+  GN+L    + T  G   +G    G    A + + V++ V++ + +V FV YK  MK
Sbjct  438   SYKPGNIL----IGTDVGDSTNGGGPGGGGSKAGVIIGVIVGVLVFLAIVGFVVYKFVMK  493

Query  1225  REHKRFGRAKSPEKIKSTQMLKTNEIMG----------------------------TAIK  1130
              ++ +FGR   PEK  + +++ +++  G                              I 
Sbjct  494   NKYGKFGRT-DPEK--AGKLMVSDDKNGYGANNFNALKSPSSGDSGGDRFPLEGGNVTIP  550

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             ++VL + TN FSE ++LG GG+GVVY G+L +GTK A+K+M+  +   KG NEFQAEIA 
Sbjct  551   MEVLRQVTNNFSEANILGRGGFGVVYAGELHDGTKTAIKRMESSSMGDKGRNEFQAEIAV  610

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFE+++ G+ PLTWKQRV+IA D
Sbjct  611   LTKVRHRHLVALLGYCVNGYERLLVYEYMPQGNLGQHLFEYQELGYSPLTWKQRVSIALD  670

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTF
Sbjct  671   VARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTF  730

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA TGRVT K
Sbjct  731   GYLAPEYAATGRVTTK  746


 Score =   151 bits (382),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 119/208 (57%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  660  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  719

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME++TG+KA+D++LPDE CHLVT
Sbjct  720  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMLTGRKALDDSLPDEKCHLVT  779

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ K +D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  780  WFRRILINKENISKELDQTLEADEETLESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  839

Query  261  FAHNWRSLRPEEIVEKFGGFDL-NMSLP  181
                W+    E+  E+  G D+ NMSLP
Sbjct  840  LVEKWKPTSQEQ--EESFGIDMNNMSLP  865



>ref|XP_009102585.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=956

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/733 (53%), Positives = 497/733 (68%), Gaps = 36/733 (5%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWS--ASKDPCTWTNVNCDKPTGNVVSINIDSQSISG  2480
             + S  DD A M  L  +  P PS WS  +S D C WT V C   +G V SI+++  S+SG
Sbjct  65    TASTADDGAAMLALAKSFRPPPSDWSTTSSTDYCKWTGVKCT--SGRVNSISLEDTSLSG  122

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              LP E++ L+ L++L++Q+N LSG +PSFA +SSL+E+YLD N F  + P    GL +L+
Sbjct  123   GLPPEISTLSELKTLTLQRNKLSGKIPSFAKLSSLQEIYLDENLFDGVEPGAFAGLTSLQ  182

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             I SISDN  ++ W   S L +STSL S    N +I+GV+P+ FDSF +LQ+LRLSYNN+T
Sbjct  183   ILSISDNPNIAAWSFPSELVDSTSLTSVSLDNTTISGVLPDVFDSFASLQSLRLSYNNIT  242

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             G+LP S   S +QNLW+NNQ+ GL+GTI+V+S MT L+Q WLQ N  TGPIPDLSK  NL
Sbjct  243   GALPPSLAKSPVQNLWINNQESGLTGTIEVLSGMTSLTQAWLQKNQLTGPIPDLSK-TNL  301

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
             FDLQL DNQLTG+V  SL  L +L+NI L +NK  GP+PLF  +V  +  + N FC    
Sbjct  302   FDLQLRDNQLTGIVSPSLLPLGSLKNITLDSNKFQGPLPLFPPEVAKVSAERNYFCTAKA  361

Query  1759  GP-CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             G  CDPQV  LLA AGGLGYP TLA+SW+GNDAC NWA++TCD   KNV T+NL    F+
Sbjct  362   GENCDPQVMTLLAVAGGLGYPPTLAESWQGNDACSNWAYVTCDSSKKNVVTLNLAKHGFA  421

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             G ISPA + LTSL+N+YLNDNNLTG +P  LT + +LQ++DVSNNNL+  +P FP  V  
Sbjct  422   GVISPAIANLTSLKNIYLNDNNLTGVVPKVLTFMFNLQLIDVSNNNLTGEIPIFPAQVKF  481

Query  1402  SFG-GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             S+  GN+L    + T  G   +G    G    A + + V++ V + + +V FV YK  MK
Sbjct  482   SYKPGNIL----IGTDVGDSTNGGGPGGGGSKAGVIIGVIVGVFVFLAIVGFVVYKFVMK  537

Query  1225  REHKRFGRA-------------------------KSPEKIKSTQMLKTNEIMGTAIKIQV  1121
              ++ +FGR                          KSP  + S       E     I ++V
Sbjct  538   NKYGKFGRTDPEKAGKLMVSDDKNGYGANNFNALKSPSSVDSGGDRFPLEGGNVTIPMEV  597

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L + TN FSE ++LG GG+GVVY G+L +GTK A+K+M+  +   KG NEFQAEIA L+K
Sbjct  598   LRQVTNNFSEANILGRGGFGVVYAGELHDGTKTAIKRMESSSMGDKGRNEFQAEIAVLTK  657

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFE+++ G+ PLTWKQRV+IA DVAR
Sbjct  658   VRHRHLVALLGYCVNGYERLLVYEYMPQGNLGQHLFEYQELGYSPLTWKQRVSIALDVAR  717

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYL
Sbjct  718   GVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYL  777

Query  580   APEYATTGRVTKK  542
             APEYA TGRVT K
Sbjct  778   APEYAATGRVTTK  790


 Score =   150 bits (379),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 119/208 (57%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  704  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  763

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME++TG+KA+D++LPDE CHLVT
Sbjct  764  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMLTGRKALDDSLPDEKCHLVT  823

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ K +D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  824  WFRRVLINKENISKELDQTLEADEETLESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  883

Query  261  FAHNWRSLRPEEIVEKFGGFDL-NMSLP  181
                W+    E+  E+  G D+ NMSLP
Sbjct  884  LVEKWKPTSQEQ--EESFGIDMNNMSLP  909



>gb|KHN44469.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=892

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/735 (54%), Positives = 482/735 (66%), Gaps = 46/735 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MSKL  ALSP PSGWS S   C W  V C      V SINI SQS+ G LP +L  L+ L
Sbjct  1     MSKLAKALSPTPSGWSGSSF-CAWNGVKCS--ANRVTSINIASQSLGGMLPPDLNSLSQL  57

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
              SLS+Q N+LSG  PS AN+S LE ++L SN F+SIP     GLP+L+  S++D+  L+P
Sbjct  58    TSLSLQNNALSGAFPSLANLSMLESVFLSSNNFTSIPVGCFQGLPSLQTLSMTDSINLAP  117

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W I + L +S +L      NA++ G +P+ FD F +L  LRLSYNNLTG LP SF  S I
Sbjct  118   WTIPAELTDSINLVKLELGNANLIGTLPDVFDKFVSLVELRLSYNNLTGVLPKSFAGSAI  177

Query  2083  qnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             QN+   N    G SGTI+V++SMT LSQVWLQ N FTGPIPDLS C  LFDLQL DNQLT
Sbjct  178   QNMWLNNQNGFGFSGTIEVLASMTHLSQVWLQKNQFTGPIPDLSNCTTLFDLQLRDNQLT  237

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SL  L  L+N+ L NN L GP+P FG  VK  L   NSFC    GPCD +VT LL
Sbjct  238   GVVPPSLMSLSGLQNVTLANNALQGPVPSFGKGVKFTLDGINSFCLKDVGPCDSRVTTLL  297

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A G GYP  LA+SW GND C +W+F+ C   G  + TVNL  Q  +GTISPAF+ LT 
Sbjct  298   DIAAGFGYPFQLARSWTGNDPCDDWSFVVC--AGGKIITVNLAKQNLTGTISPAFANLTD  355

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK--  1373
             LRNL+LNDNNL G IP SLT L  L+VL+VSNN LS  +P F   V  +  GN LL +  
Sbjct  356   LRNLFLNDNNLGGSIPGSLTNLAQLEVLNVSNNKLSGDVPKFSSKVKFTTAGNDLLGRSD  415

Query  1372  -------TVATGRGSPGSGQTE---NGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                    T + G G   SG      +GSS+S      +V++ V  V VV+FVF KC+ K 
Sbjct  416   GGGGSGTTPSKGSGDAPSGSPSAGTSGSSLSPAWIAGIVVIAVFFVAVVVFVFCKCHAKN  475

Query  1222  EHKRFGRAKSPE----KIKSTQMLKTN------------------------EIMGTAIKI  1127
              H +FGR  +PE    ++K   M  TN                        E     I I
Sbjct  476   RHGKFGRVNNPENGKGEVKIDMMSVTNSNGYGGVPSELQSQGSERSDLHVFEGGNATISI  535

Query  1126  QVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFL  947
             QVL + T+ FSE+++LG GG+GVVY G+L +GT++AVK+M+  AT +KG+NEFQAEIA L
Sbjct  536   QVLRQVTDNFSEKNILGRGGFGVVYKGELHDGTQIAVKRMESVATGSKGLNEFQAEIAVL  595

Query  946   SKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDV  767
             SKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W ++G  PLTWKQRV IA DV
Sbjct  596   SKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWGENGCAPLTWKQRVAIALDV  655

Query  766   ARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFG  587
             ARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFG
Sbjct  656   ARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFG  715

Query  586   YLAPEYATTGRVTKK  542
             YLAPEYA TGRVT K
Sbjct  716   YLAPEYAATGRVTTK  730


 Score =   160 bits (404),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  644  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  703

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  704  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTVPDERSHLVS  763

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  764  WFRRVLINKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLGP  823

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  824  LVEQWKPTTHEE--EEGYGIDLHMSLP  848



>ref|XP_006601886.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=928

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/744 (54%), Positives = 488/744 (66%), Gaps = 47/744 (6%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             +  DD   MSKL  AL P+PSGW+ S   C WT V C      V  I I SQS+ G LP 
Sbjct  28    AIADDGVFMSKLAKALIPSPSGWTGSSF-CQWTGVKCS--ANRVTIIKIASQSLGGTLPP  84

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L  L+ L SLS+Q N LSG LPS AN+S LE ++LD N F+SIP     GL +L+  S+
Sbjct  85    DLNSLSQLTSLSLQNNKLSGALPSLANLSMLESVFLDGNNFTSIPDGCFQGLTSLQTLSM  144

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             +D+  L+PW I + L +S +L      NA++ G +P+ FD F +LQ LRLSYNNLTG LP
Sbjct  145   ADSVNLAPWTIPTELTDSNNLVKLDLGNANLIGTLPDVFDKFVSLQELRLSYNNLTGGLP  204

Query  2107  GSFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
              SFG SEIQNL   N    G SG+I+V++SMT LSQVWLQ N FTGPIPDLS C  LFDL
Sbjct  205   KSFGGSEIQNLWLNNQNGFGFSGSIEVLASMTHLSQVWLQKNQFTGPIPDLSNCTTLFDL  264

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPC  1751
             QL DNQLTGVVP SL  L +L+N+ L NN L GP+P F   VK  L   NSFC    GPC
Sbjct  265   QLRDNQLTGVVPPSLMSLSSLQNVSLDNNALQGPVPSFEKGVKFTLDGINSFCLKDVGPC  324

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             D +++ LL  A G GYP+ LA+SW GND C +W+F+ C   G  + TVNL  Q  +GTIS
Sbjct  325   DSRISTLLDIAAGFGYPLQLARSWTGNDPCDDWSFVVC--AGGKIITVNLAKQNLTGTIS  382

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PAF+ LT LRNL+LNDNNL G IP SLT L  L+VL+VSNNNLS  +P FP  V  +  G
Sbjct  383   PAFANLTDLRNLFLNDNNLGGSIPGSLTNLAQLEVLNVSNNNLSGDVPKFPTKVKFTTAG  442

Query  1390  NLLLEK----------TVATGRGSPGSGQTENG---SSMSARMfvvvvivvvivvlvvlf  1250
             N LL +          T + G G   SG    G   SS+S      +V++ V  V VV+F
Sbjct  443   NDLLGRSDGGGGGSGTTPSKGSGDAPSGSPSTGPGGSSLSPAWIAGIVLIAVFFVAVVVF  502

Query  1249  vFYKCYMKREHKRFGRAKSPE----KIKSTQMLKTN------------------------  1154
             VF KC+ K  H +FGR  +PE    ++K   M  TN                        
Sbjct  503   VFCKCHAKNRHGKFGRVNNPENGKGEVKIDMMSVTNSNGYGGVPSELQSQGSERSDVHVF  562

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E     I IQVL + T+ FSE+++LG GG+GVVY G+L +GT++AVK+M+  AT +KG+N
Sbjct  563   EGGNATISIQVLRQVTDNFSEKNILGRGGFGVVYKGELHDGTQIAVKRMESVATGSKGLN  622

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQAEIA LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W ++G  PLTWK
Sbjct  623   EFQAEIAVLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWGENGCAPLTWK  682

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             QRV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  V
Sbjct  683   QRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSV  742

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   ETRLAGTFGYLAPEYAATGRVTTK  766


 Score =   160 bits (404),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  680  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  739

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  740  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTVPDERSHLVS  799

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  800  WFRRVLINKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLGP  859

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  860  LVEQWKPTTHEE--EEGYGIDLHMSLP  884



>ref|XP_007221309.1| hypothetical protein PRUPE_ppa020129mg, partial [Prunus persica]
 gb|EMJ22508.1| hypothetical protein PRUPE_ppa020129mg, partial [Prunus persica]
Length=895

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/747 (55%), Positives = 502/747 (67%), Gaps = 48/747 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGN  2477
             S +  DD+ VMSKL   L   P  WS  K  C W  + CD   GN V SIN+ S S+SG+
Sbjct  22    SSTAADDSEVMSKLAEGLKNTPEDWSTGKTYCGWEGIKCD---GNRVTSINLSSMSLSGS  78

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRI  2297
             LPS L  L  L +LS+Q NSLSGP PS AN+S L+E+YLD+N F+SIP     GL +L++
Sbjct  79    LPSNLNSLTQLTTLSLQSNSLSGPFPSLANLSLLQEIYLDTNNFTSIPSGCFQGLSSLQV  138

Query  2296  FSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTG  2117
              S+S N  L PW + + L +++SL +  A NA++ G +P+ FDSFPNLQNLRLSYNN +G
Sbjct  139   LSMSQNINLVPWVLPNELTQASSLVTLDADNANLYGYLPDIFDSFPNLQNLRLSYNNFSG  198

Query  2116  SLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
              LP SF  S IQNL LNNQQ GLSGTI+V+S+MT+L+QVWL  N FTGPIPD+S+C  LF
Sbjct  199   FLPKSFSGSGIQNLGLNNQQFGLSGTIEVLSNMTQLNQVWLHKNQFTGPIPDISRCKTLF  258

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKV-KVILGDTNSFCKDTP  1760
             DLQL DN LTG+VP +L     + N+ L NNKL GP+P+FG+ V K     TNSFC+  P
Sbjct  259   DLQLRDNLLTGIVPATLMSSTAILNVSLDNNKLQGPLPVFGSIVTKATFDGTNSFCQTKP  318

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
             GPCDPQV  LL  AG L YPI LA+SW+GN+AC  W+FI CD QGK V TVN  N+ F+G
Sbjct  319   GPCDPQVNTLLEVAGALAYPILLAESWEGNNACDRWSFIVCDTQGK-VITVNFENKHFTG  377

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
              ISPAF+ LTSL+NL L +NNLTG IP SL TL  LQ+LDVSNNNL   +P FP  V + 
Sbjct  378   IISPAFANLTSLKNLVLKNNNLTGSIPASLLTLQQLQLLDVSNNNLFGAIPKFPYTVKLI  437

Query  1399  FGGNLLLEKTV-----------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvi  1271
               GN+L+E T                   T  GSP        SS+S  M   +VI VVI
Sbjct  438   TTGNVLIETTPSSGGGGGGTPSGSGSNGTTPNGSPSPAPASGDSSVSPGMIAGIVIAVVI  497

Query  1270  vvlvvlfvFYKCYMKREHKRFGRAKSP----EKIKSTQMLKTNEIMG-------------  1142
              ++V+LFV  KCY  ++H + GR  +P    +  KS  M   N   G             
Sbjct  498   FIVVILFVSIKCYASKKHGKLGRVDNPMNGIKIAKSDVMSSANGYNGVQSDLHSQSSGDL  557

Query  1141  -------TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                     AI I VL   TN FSE+++LG GG+GVVY G+L +GT++AVK+MK  A  T+
Sbjct  558   HVFEGGNVAISIHVLRDVTNNFSEDNILGRGGFGVVYKGELHDGTRIAVKRMKFVAESTE  617

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             GMNEF+AEIAFL+KV+H++LVAL+GYCIN ++ LLVYEYM  GTL  HLF W++ G  PL
Sbjct  618   GMNEFEAEIAFLAKVKHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFNWRETGVPPL  677

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TW+QR+TIA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLVK APD  
Sbjct  678   TWRQRITIALDVARGVEYLHGLAPQSFIHRDLKPSNILLGDDMRAKVADFGLVKCAPDAN  737

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
             S VETRVAGTFGYLAPEY  TGRVT +
Sbjct  738   S-VETRVAGTFGYLAPEYTATGRVTTR  763


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 116/207 (56%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS-KKLRMINL  619
            TW + ++I +     V ++   +PQ F         +++   +R ++ D+   K      
Sbjct  678  TWRQRITIALDVARGVEYLHGLAPQSFIHRDLKPSNILLGDDMRAKVADFGLVKCAPDAN  737

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    +VDVYAFGVVLM++++GKKA+D T+PDE   LVTW
Sbjct  738  SVETRVAGTFGYLAPEYTATGRVTTRVDVYAFGVVLMQLLSGKKALDYTIPDERSLLVTW  797

Query  438  FHKIIRKSHNLQKAIDPTL-DPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + + K   + KAID TL + DE+T E I KVA+LA HCT +  ++RP M +VVN+L P
Sbjct  798  FRRFLIKKEYIPKAIDETLKNHDEETMECICKVAQLAGHCTAHNPFQRPEMSYVVNMLAP  857

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
               NW+    EE  EK+ G D +MSLP
Sbjct  858  LVRNWKPTSHEE-EEKY-GIDRHMSLP  882



>ref|XP_004247046.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=941

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/737 (53%), Positives = 505/737 (69%), Gaps = 43/737 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDA++M+KL  +L P P GWS S + C W+ V+CD  +G V SI++ S+S+ G LP +L
Sbjct  39    ADDASIMAKLAKSLIPTPPGWSGS-NVCKWSGVSCDS-SGRVSSISLISKSLGGQLPPDL  96

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              QL++L+S ++QKN +SG LPS +N+ SL+E +LDSN F+S+P +FL GL NL+ FS+ +
Sbjct  97    NQLSNLQSFNIQKNRISGSLPSLSNLPSLQEAHLDSNNFTSVPTNFLSGLTNLQKFSMDE  156

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW I   L +ST+L  F ASNA+I G IP+ F SFP+L++LRLSYNNLTG LP S
Sbjct  157   NPSLPPWTIPDSLTDSTTLADFSASNANIMGQIPDIFGSFPSLESLRLSYNNLTGFLPYS  216

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQNL LNNQ+ GL+G IDV+ SM +L+Q W+  N F GPIPDLS C NL D+QL 
Sbjct  217   FAKSGIQNLVLNNQKLGLTGRIDVLGSMEQLTQAWIHVNKFEGPIPDLSLCTNLIDIQLR  276

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DN LTGVVP SLT LP L N  LQNN  LGP+P F   V+  LG+TN FC   PGPCDPQ
Sbjct  277   DNSLTGVVPPSLTSLPKLTNASLQNNIFLGPIPGFKPNVQATLGNTNHFCNPFPGPCDPQ  336

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             VT LL  AG +G P TLA+SW GN+ C+ W +ITCD +G  VT +N   Q + GTISPA 
Sbjct  337   VTILLDVAGAVGCPKTLAESWSGNNPCKGWNYITCDAKG-TVTVINFAKQNWVGTISPAV  395

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LT L++L +NDNNLTGPIPVSLT+LP LQ++DVSNNN+S  +P F P V +   GN  
Sbjct  396   ANLTGLKSLVMNDNNLTGPIPVSLTSLPELQLVDVSNNNISGKIPKFRPDVILKTSGNSF  455

Query  1381  LEKTVATGRGSPG---------------SGQTENGSSMSARMfvvvvivvvivvlvvlfv  1247
             + K V      PG               + + E+ SS+S  + V +VI VV+++LV+  V
Sbjct  456   IGKDVPLS-APPGARPSSSSSTNNNSPSAAKDEHKSSISTWVIVAIVIAVVVLILVLCLV  514

Query  1246  FYKCYMKREHKRFGRAKSPEKIK---STQMLKTNEIMGTA-------------------I  1133
              YK Y +    +  + K  +K+K   S  M     I  TA                   I
Sbjct  515   LYK-YKRNRKSKLNKGKE-QKLKNGSSKNMKGYGAIPSTASQSDTSNSEIYVYDGGHVTI  572

Query  1132  KIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIA  953
              +++L +ATN FS+E++LG GG+G+VY G+L +GT++AVK+M+      KG+ EF+AEI 
Sbjct  573   PVELLREATNNFSKENILGRGGFGIVYKGRLHDGTEIAVKRMEASIASNKGLTEFRAEIE  632

Query  952   FLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAW  773
              L+KVRH++LVAL G+C+N ++ LLVYEYM  GTLG HLF+  + GF PLTWKQR+TIA 
Sbjct  633   VLTKVRHRHLVALHGFCVNGYERLLVYEYMPQGTLGQHLFDHDQLGFLPLTWKQRLTIAL  692

Query  772   DVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGT  593
             DVARG+EYLH L  QSFIHRD+K SN+LL DD+RAKV+DFGLVK APD K  VETR+AGT
Sbjct  693   DVARGVEYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVSDFGLVKNAPDGKYSVETRLAGT  752

Query  592   FGYLAPEYATTGRVTKK  542
             FGYLAPEYA+TGRVT K
Sbjct  753   FGYLAPEYASTGRVTTK  769


 Score =   132 bits (331),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 109/207 (53%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + L+I +     V ++   + Q F         +++   +R ++ D+   K      
Sbjct  683  TWKQRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVSDFGLVKNAPDGK  742

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K+DV+AFGV+LMEI+TG+KA+DE+LP++  HLV 
Sbjct  743  YSVETRLAGTFGYLAPEYASTGRVTTKIDVFAFGVILMEILTGRKALDESLPEDRSHLVV  802

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF K++     + + +DPTLDPDE+T++SI KV ELA HC   +  +RP+M HVVNVL P
Sbjct  803  WFKKMVVNKEKIIEVLDPTLDPDEETYQSICKVVELAGHCAAREPSQRPDMGHVVNVLAP  862

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W         +     D  MSLP
Sbjct  863  LVEQWTPT--ATAGDDSFNIDFTMSLP  887



>gb|ABD96566.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/737 (53%), Positives = 488/737 (66%), Gaps = 41/737 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DDAAVMS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L 
Sbjct  24    DDAAVMSNFLISLTPPPSGWSQTTPFCQWKGIQCDS-SRHVTSISLASQSLTGTLPSDLN  82

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ LR+LS+Q NSLSG LPS +N+S L+  YL+ N F+S+PP     L +L+  S+  N
Sbjct  83    SLSQLRTLSLQDNSLSGTLPSLSNLSFLQTAYLNRNNFTSVPPSAFSSLTSLQTLSLGSN  142

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L PW   + L  S +L     +  ++TG +P+ FD F +LQ+LRLSYNNLTG+LP SF
Sbjct  143   PTLQPWSFPTDLTSSVNLIDLDLATVTLTGPLPDIFDKFTSLQHLRLSYNNLTGNLPASF  202

Query  2098  GSSE-IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
               ++ I  LWLNNQ  GLSGT+ V+S+MT L Q WL  N FTG +PDLS+C  L DLQL 
Sbjct  203   AVADNIATLWLNNQAAGLSGTLQVLSNMTALKQAWLNKNQFTGSLPDLSQCKALSDLQLR  262

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQLTGVVP SLT LP+L+ + L NN+L GP+P+FG  V   L   NSFC DTPG CDP+
Sbjct  263   DNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNFTLDGINSFCLDTPGNCDPR  322

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V  LL  A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF
Sbjct  323   VMVLLRIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAF  380

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LT LR+L+LN NNLTG IP SLTTL  LQ LDVS+NNLS  +P FPP V +   GN L
Sbjct  381   ANLTDLRSLFLNGNNLTGSIPESLTTLSQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNAL  440

Query  1381  LEKTVATGRG-----------SPGSGQTENGSSM-SARMfvvvvivvvivvlvvlfvFYK  1238
             L K ++ G G                ++  GSS+ S      +V++V+  + VVLFV +K
Sbjct  441   LGKALSPGGGPNGTTPSGSSTGGSGSESAKGSSLLSPGWIAGIVVIVLFFIAVVLFVSWK  500

Query  1237  CYMKREHKRFGRAKS----------------------PEKIKSTQMLKTNEIM---GTAI  1133
             C++ R   +F R                         P +++S      +++    G   
Sbjct  501   CFVNRRQGKFSRVNGRENGKGIFKPDAAHVSNGYGGVPSELQSQSSGDRSDLQALDGPTF  560

Query  1132  KIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIA  953
              IQVL++ TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+  A   KG+ EF+AEIA
Sbjct  561   SIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIA  620

Query  952   FLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAW  773
              LSKVRH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRV IA 
Sbjct  621   VLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIAL  680

Query  772   DVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGT  593
             DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG 
Sbjct  681   DVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGA  740

Query  592   FGYLAPEYATTGRVTKK  542
             FGYLAPEYA TGRVT K
Sbjct  741   FGYLAPEYAATGRVTTK  757


 Score =   152 bits (383),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVD+YAFG+VLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  732  SVETRLAGAFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTW  791

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + Y+RP+M H VNVL P 
Sbjct  792  FRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPL  851

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  +  GG DL MSLP
Sbjct  852  VEQWKPSSHDEEEDGSGG-DLQMSLP  876



>ref|XP_006418841.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum]
 gb|ESQ37277.1| hypothetical protein EUTSA_v10002394mg [Eutrema salsugineum]
Length=931

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/750 (51%), Positives = 493/750 (66%), Gaps = 53/750 (7%)
 Frame = -2

Query  2650  VSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
              S  DD A M  L  +  P PS WSA+ D C W+ V C   +G V SI++  +S+SG L 
Sbjct  21    ASVADDGAAMLALAKSFRPPPSDWSAA-DYCKWSGVRCT--SGRVTSISLADKSLSGGLA  77

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
              E++ L+ L+S+++Q+N LSG +PSFA +SSL+E+Y+D N F  + P    GL +L+I S
Sbjct  78    PEISTLSELKSIALQRNKLSGKIPSFAKLSSLQEIYIDENLFVGVEPGAFAGLTSLQILS  137

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSL  2111
             +SDN  LS W   S L +S+SL + +  N  I+GV+P+ FDSF +LQNLRLSYNN+TG L
Sbjct  138   LSDNANLSSWSFPSELKDSSSLTTIYLDNTQISGVLPDIFDSFASLQNLRLSYNNITGPL  197

Query  2110  PGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P S   S IQN  +   +   GLSGTI+V+S MT LSQ WLQ N F GPIPDLSK  NLF
Sbjct  198   PPSLAKSSIQNLWINNQHTGSGLSGTIEVLSGMTSLSQAWLQKNQFVGPIPDLSKSENLF  257

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG  1757
             DLQL DNQLTG+V  SL  L +L+NI L NNK  GP+P F  +V+ +  + N FC   PG
Sbjct  258   DLQLRDNQLTGIVSPSLFSLGSLKNISLDNNKFQGPLPSFPPEVEKVSLEHNDFCTTKPG  317

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
               C PQV  LLA AGGLGYP  LA+SW+G+DAC  WA++TC+  GKNV T+NLG   F+G
Sbjct  318   QSCSPQVMMLLAVAGGLGYPSMLAESWQGDDACSGWAYVTCE-GGKNVVTLNLGKHGFAG  376

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
              ISPA + LTSL+++YLNDNNLTGPIP  LT +  LQ++DVSNNNL+  +P+F P+V  +
Sbjct  377   FISPAIANLTSLKSIYLNDNNLTGPIPKELTFMSSLQLIDVSNNNLTGEIPNFAPSVKFN  436

Query  1399  FG-GNLLLEKTVATGRGSPGSGQTEN---------GSSMSARMfvvvvivvvivvlvvlf  1250
                GN+LL      G  +PG+G   +              A + V V++ V++ + ++ F
Sbjct  437   HKPGNVLLGTKAGDG-SAPGTGSKADGSPGGSSGGSGGGKAPVIVGVIVAVLVFIAILGF  495

Query  1249  vFYKCYMKREHKRFGRAKSPEKIKSTQMLKTN----------------------------  1154
             V YK  MK+++ +F R   PEK     +                                
Sbjct  496   VIYKFVMKKKYGKF-RRTDPEKAAKIMVSDAASNGNGGGYANGSGGNNFNALNSPSSGDN  554

Query  1153  ------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGAT  992
                   E     I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  A 
Sbjct  555   SDRFLLEAGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECSAM  614

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
               KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW + G+
Sbjct  615   GNKGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWGELGY  674

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PLTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK AP
Sbjct  675   SPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAP  734

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             D K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  735   DGKYSVETRLAGTFGYLAPEYAATGRVTTK  764


 Score =   152 bits (385),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 120/208 (58%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  678  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  737

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D++LPDE  HLVT
Sbjct  738  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMITGRKALDDSLPDERSHLVT  797

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KA+D TL+PDE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  798  WFRRILINKDNIPKALDQTLEPDEETLESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  857

Query  261  FAHNWR-SLRPEEIVEKFGGFDLNMSLP  181
                W+ S + EE  E FG    NMSLP
Sbjct  858  LVEKWKPSCQEEE--ESFGIDVNNMSLP  883



>ref|XP_007163803.1| hypothetical protein PHAVU_001G265500g [Phaseolus vulgaris]
 gb|ESW35797.1| hypothetical protein PHAVU_001G265500g [Phaseolus vulgaris]
Length=931

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/748 (54%), Positives = 489/748 (65%), Gaps = 52/748 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLP  2471
             +  DDAAVMSKL  ALSP PSGWS +   C W  V C    GN V SINI SQS++G LP
Sbjct  28    AIADDAAVMSKLKEALSPTPSGWSGTSF-CDWKGVGC---RGNSVTSINIASQSLTGTLP  83

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
              +L  L+ L SLS+Q N+L+G LPS AN+S L+ ++L  N F+SIP     GL +L+  S
Sbjct  84    LDLNSLSQLTSLSLQSNALAGALPSLANLSMLQTVFLGGNNFTSIPKGCFQGLTSLQTLS  143

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSL  2111
             I D   L+PW I + L +S++L      + ++ G +P+ FDSF +LQ LRLSYNNLTG L
Sbjct  144   IEDCFNLAPWSIPTELTQSSNLVKLDLGSTNLIGTLPDVFDSFVSLQELRLSYNNLTGGL  203

Query  2110  PGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P SF  S IQ L         G SGTI+V++SMT L+QVWLQ N FTGPIPDLS C  LF
Sbjct  204   PKSFAGSGIQYLWLNNQKDGFGFSGTIEVLASMTHLTQVWLQKNLFTGPIPDLSNCTTLF  263

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFC-KDT-  1763
             DLQL DNQLTGVVP SL  L +L+N+ L NN L GP P FG  VKV L   NSFC KDT 
Sbjct  264   DLQLRDNQLTGVVPPSLMSLSSLQNVSLDNNVLQGPFPSFGKGVKVTLDGVNSFCTKDTG  323

Query  1762  -PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
               GPCD +VT LL  A   GYPI LA+SW GND C +W+F+ C   GK + TVNL  Q  
Sbjct  324   PSGPCDSRVTTLLDIAKDFGYPIKLARSWSGNDPCADWSFVVC-AAGK-IVTVNLAKQNL  381

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +GTISPAF+ LT LRNLYLN NNL G IP  LT L  L+VLDVSNN+LS  +P FP  V 
Sbjct  382   TGTISPAFANLTDLRNLYLNSNNLVGSIPGGLTNLAQLEVLDVSNNDLSGDVPKFPSKVK  441

Query  1405  ISFGGNLLLEK---------TVATGRGSPGSGQ---TENGSSMSARMfvvvvivvvivvl  1262
              S  GN  L           T + G G   SG       GS +S      +V++ V  V 
Sbjct  442   FSSAGNARLGHSGGGGGNGSTPSNGSGGAPSGSPSAASGGSGLSPAWIGGIVVIAVFFVA  501

Query  1261  vvlfvFYKCYMKREHKRFGRAKSPE----KIKSTQMLKTN--------------------  1154
             VV+FVF KC+ K  H +FGR  +PE    ++K   M  TN                    
Sbjct  502   VVVFVFCKCHAKNRHGKFGRVNNPENGKGEVKIDMMSVTNSNGYGGVPSELQSQGSERSD  561

Query  1153  ----EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                 E     I IQVL + T+ FS+ ++LG GG+GVVY G+L +G+K+AVK+M+  AT +
Sbjct  562   INVFEGGNATISIQVLRQVTDNFSQNNILGRGGFGVVYKGELHDGSKIAVKRMESVATGS  621

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG+NEFQAEIA LSKVRH++LVAL+G+CIN ++ LLVYEYM  GTL  HLF+W+++G  P
Sbjct  622   KGLNEFQAEIAVLSKVRHRHLVALLGFCINGNERLLVYEYMPQGTLTQHLFDWQENGCAP  681

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD 
Sbjct  682   LTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDG  741

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  742   KYSVETRLAGTFGYLAPEYAATGRVTTK  769


 Score =   155 bits (391),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  683  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  742

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  743  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTVPDERSHLVS  802

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VNVL P
Sbjct  803  WFRRVLINKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVP  862

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D++MSLP
Sbjct  863  LVEQWKPTSHEE--EEGYGIDVHMSLP  887



>ref|XP_003601704.1| Receptor-like kinase [Medicago truncatula]
 gb|AES71955.1| LRR receptor-like kinase [Medicago truncatula]
Length=933

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/751 (52%), Positives = 487/751 (65%), Gaps = 57/751 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             +  DD A MSKL  +L+P PSGWS +   C+W  V CD  +  V S+N+ S+S++G LPS
Sbjct  28    AIADDGAFMSKLAKSLTPPPSGWSGNSF-CSWNGVKCDG-SDRVTSLNLASKSLTGTLPS  85

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L  L+ L +LS+Q NSL+G LPS AN++ L+ ++L  N F+SIP    +GL +L+  S+
Sbjct  86    DLNSLSQLTTLSLQSNSLTGALPSLANLTMLQTVFLGGNNFTSIPDGCFVGLTSLQKLSL  145

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             ++N  L PW++     +S++L        ++ G +P+ F    +LQNLRLSYNNLTG LP
Sbjct  146   TENINLKPWKLPMDFTQSSNLVELDLGQTNLIGSLPDIFVPLVSLQNLRLSYNNLTGDLP  205

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF  S I NL     N   G +G+ID+++SM+ L+QVW Q N FTG IPDLS C NLFD
Sbjct  206   NSFSGSGIVNLWLNNQNDGSGFTGSIDLLASMSHLAQVWFQKNKFTGSIPDLSNCTNLFD  265

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPG  1757
             LQL DNQLTGVVP SL  L +L N+ L NNKL GP+P FG  VKV L +  NSFCK TPG
Sbjct  266   LQLRDNQLTGVVPSSLMSLSSLANVSLDNNKLQGPLPSFGKSVKVTLDEGINSFCKTTPG  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCDP+V+ LL  A G GYP+ LA SWKGND C +W F+ C   G  + TVNL  Q  +GT
Sbjct  326   PCDPRVSTLLDIAAGFGYPLPLANSWKGNDPCDDWTFVVC--SGGKIITVNLAKQNLNGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             IS AF  LT LRNLYLN NNLTG IP SLT L  L+VLDVSNNNLS  +P F   V  + 
Sbjct  384   ISSAFGNLTDLRNLYLNGNNLTGSIPGSLTGLTQLEVLDVSNNNLSGEIPKFSGKVRFNS  443

Query  1396  GGNLLLEKTVATGRGSPGSGQT---------------ENGSSMSARMfvvvvivvvivvl  1262
              GN LL K+     G  GSG                 + GSS+S      + ++ V  V 
Sbjct  444   AGNGLLGKS----EGDGGSGTAPPTDPSGGPSGSPPEKGGSSLSPGWIAGIAVIAVFFVA  499

Query  1261  vvlfvFYKCYMK-REHKRFGRAKSPEKIKS------------------------------  1175
             VVLFVF KCY K R H +FGR  +PE  K+                              
Sbjct  500   VVLFVFCKCYAKNRRHTKFGRVNNPENGKNDVKIDVMSNVSNSNGYGGVPSELQSQGSER  559

Query  1174  TQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGA  995
             +  L+  E     I IQVL + T  F+E+++LG GG+GVVY G+L +GTK+AVK+M+  A
Sbjct  560   SDNLQVFEGGNVTISIQVLRQVTGNFNEDNILGRGGFGVVYKGELHDGTKIAVKRMESVA  619

Query  994   THTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHG  815
               TKG+NEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W ++G
Sbjct  620   VGTKGLNEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWGENG  679

Query  814   FDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKA  635
               PLTW QRV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK A
Sbjct  680   CAPLTWLQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNA  739

Query  634   PDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             PD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  740   PDGKYSVETRLAGTFGYLAPEYAATGRVTTK  770


 Score =   155 bits (393),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TWL+ ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  684  TWLQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  743

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  744  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTMPDERSHLVS  803

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TL+PDE+T ESI K+AELA HCT  + Y+RP+M H VNVL P
Sbjct  804  WFRRVLVNKENIPKAIDQTLNPDEETMESIYKIAELAGHCTAREPYQRPDMGHAVNVLVP  863

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E   G DL+MSLP
Sbjct  864  LVEQWKPSNHEE--EDGYGIDLHMSLP  888



>ref|XP_002883458.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59717.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=930

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/751 (52%), Positives = 498/751 (66%), Gaps = 56/751 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S  DD   M  L  + +P PS WS   S D C W+ V C     N++S+    +S++G +
Sbjct  22    SVADDGTAMLALAKSFNPPPSDWSTTTSTDFCKWSGVRCTGGRVNIISLA--DKSLTGFI  79

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
               E++ L+ L+S+S+Q+N LSG +PSFA +SSL+E+Y+D N F  +      GL +L+I 
Sbjct  80    APEISTLSELKSVSIQRNKLSGKIPSFAKLSSLQEIYMDDNFFVGVETGAFAGLTSLQIL  139

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+SDN  ++ W   S L +STSL   +  N +I GV+P+ FDSF +LQ+LRLSYNN+TG 
Sbjct  140   SLSDNKNITAWSFPSELVDSTSLTKIYLDNTNIVGVLPDIFDSFASLQDLRLSYNNITGV  199

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S IQNLW+NNQ+ G+SGTI+V+SSMT LSQ WL  N F GPIPDLSK  NLFD
Sbjct  200   LPPSLAKSSIQNLWINNQELGMSGTIEVLSSMTSLSQAWLHKNQFFGPIPDLSKSENLFD  259

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DNQLTG+VP +L  L +L+NI L NNK  GP+PLF ++VKV + D N FC    G 
Sbjct  260   LQLRDNQLTGIVPPTLLSLGSLKNISLDNNKFQGPLPLFPSEVKVTI-DHNDFCTTKAGQ  318

Query  1753  -CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQV  LLA AGGLGYP  LA+SW+G+DAC  WA++TCD  GKNV T+NLG   F+G 
Sbjct  319   TCSPQVMTLLAVAGGLGYPSMLAESWQGDDACSGWAYVTCDSAGKNVVTLNLGKHGFAGF  378

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPA + LTSL+++YLNDNNLTG IP  LT +  LQ++DVSNNNL   +P FP AV  ++
Sbjct  379   ISPAIANLTSLKSIYLNDNNLTGVIPKELTFMTSLQLIDVSNNNLRGEIPKFPAAVKFNY  438

Query  1396  G-GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlf-------vFY  1241
               GN LL      G  +PG+G    GS  S+      V V+V V++ VL        V Y
Sbjct  439   KPGNALLGTNAGDG-STPGTGGASGGSGGSSGGGGSKVGVIVGVIVAVLVFLAILGFVVY  497

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKTNEIM----------------------------  1145
             K  MKR++ RF R   PE  K+ ++L ++ +                             
Sbjct  498   KFVMKRKYGRFNRT-DPE--KAGKILVSDAVSNGGSGGGGYANGHGANNFNALNSPSSGD  554

Query  1144  ----------GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGA  995
                          I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  A
Sbjct  555   NSDRFLLEGGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECAA  614

Query  994   THTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHG  815
                KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW++ G
Sbjct  615   MGNKGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWRELG  674

Query  814   FDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKA  635
             + PLTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK A
Sbjct  675   YSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNA  734

Query  634   PDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             PD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  735   PDGKYSVETRLAGTFGYLAPEYAATGRVTTK  765


 Score =   155 bits (393),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 119/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  679  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  738

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEI+TG+KA+D+TLPDE  HLVT
Sbjct  739  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRKALDDTLPDERSHLVT  798

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  799  WFRRILINKENIPKALDQTLEADEETMESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  858

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  859  LVEKWKPSCQEE--EESFGIDVNMSLP  883



>ref|NP_001236021.1| Rhg4-like receptor kinase II precursor [Glycine max]
 gb|ABD96568.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/737 (52%), Positives = 486/737 (66%), Gaps = 41/737 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DDAAVMS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L 
Sbjct  24    DDAAVMSNFLISLTPPPSGWSQTTPFCQWKGIQCDS-SRHVTSISLASQSLTGTLPSDLN  82

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ LR+LS+Q NSLSG LPS +N+S L+  YL+ N F+S+PP       +L+  S+  N
Sbjct  83    SLSQLRTLSLQDNSLSGTLPSLSNLSFLQTAYLNRNNFTSVPPSAFSSPTSLQTLSLGSN  142

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L PW   + L  S +L     +  ++TG +P+ FD F +LQ+LRLSYNNLTG+LP SF
Sbjct  143   PTLQPWSFPTDLTSSVNLIDLDLATVTLTGPLPDIFDKFTSLQHLRLSYNNLTGNLPASF  202

Query  2098  GSSE-IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
               ++ I  LWLNNQ  GLSGT+ V+S+MT L Q WL  N FTG +PDLS+C  L DLQL 
Sbjct  203   AVADNIATLWLNNQAAGLSGTLQVLSNMTALKQAWLNKNQFTGSLPDLSQCKALSDLQLR  262

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQLTGVVP SLT LP+L+ + L NN+L GP+P+FG  V   L   NSFC DTPG CDP+
Sbjct  263   DNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNFTLDGINSFCLDTPGNCDPR  322

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V  LL  A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF
Sbjct  323   VMVLLRIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAF  380

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LT LR+L+LN NNLTG IP SL  L  LQ LDVS+NNLS  +P FPP V +   GN L
Sbjct  381   ANLTDLRSLFLNGNNLTGSIPESLAILSQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNAL  440

Query  1381  LEKTVATGRG-----------SPGSGQTENGSSM-SARMfvvvvivvvivvlvvlfvFYK  1238
             L K ++ G G                ++  GSS+ S      +V++V+  + VVLFV +K
Sbjct  441   LGKALSPGGGPNGTTPSGSSTGGSGSESAKGSSLLSPGWIAGIVVIVLFFIAVVLFVSWK  500

Query  1237  CYMKREHKRFGRAKS----------------------PEKIKSTQMLKTNEIM---GTAI  1133
             C++ R   +F R                         P +++S      +++    G   
Sbjct  501   CFVNRRQGKFSRVNGRENGKGSFKPDAAHVSNGYGGVPSELQSQSSGDRSDLQALDGPTF  560

Query  1132  KIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIA  953
              IQVL++ TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+  A   KG+ EF+A+IA
Sbjct  561   SIQVLQQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAKIA  620

Query  952   FLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAW  773
              LSKVRH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRV IA 
Sbjct  621   VLSKVRHRHLVALLGYCINGIERLLVYEYMPQGTLTRHLFEWQEQGYVPLTWKQRVVIAL  680

Query  772   DVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGT  593
             DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGT
Sbjct  681   DVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGT  740

Query  592   FGYLAPEYATTGRVTKK  542
             FGYLAPEYA TGRVT K
Sbjct  741   FGYLAPEYAATGRVTTK  757


 Score =   150 bits (378),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVD+YAFG+VLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  732  SVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTW  791

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + Y+RP+M H VNVL P 
Sbjct  792  FRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPL  851

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  +  GG DL M+LP
Sbjct  852  VEQWKPSSHDEEEDGSGG-DLQMNLP  876



>gb|ADO12863.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=920

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/738 (53%), Positives = 487/738 (66%), Gaps = 41/738 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDAAVMS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L
Sbjct  21    ADDAAVMSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASQSLTGTLPSDL  79

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ LR+LS+Q NSL+G LPS +N+S L+ +Y + N FSS+ P     L +L+  S+  
Sbjct  80    NSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGS  139

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP S
Sbjct  140   NPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSS  199

Query  2101  FGSSE-IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             F ++  ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL
Sbjct  200   FSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQL  259

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDP  1745
              DNQLTGVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP
Sbjct  260   RDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDP  319

Query  1744  QVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPA  1565
             +V  LL  A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPA
Sbjct  320   RVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPA  377

Query  1564  FSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL  1385
             F+ LT LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN 
Sbjct  378   FANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNA  437

Query  1384  LLEKTV------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             LL K +             +  G  G   ++  SS+S      +V++V+  + VVLFV +
Sbjct  438   LLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSW  497

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTA  1136
             KC++ +   +F R K  E  K    L                           + + G  
Sbjct  498   KCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPT  557

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
               IQVL + TN FSEE++LG GG+GVVY G L +GTK+AVK+M+  A   KG  EF+AEI
Sbjct  558   FSIQVLRQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMESVAMGNKGQKEFEAEI  617

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA
Sbjct  618   ALLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIA  677

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  678   LDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  737

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  738   TFGYLAPEYAATGRVTTK  755


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  730  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  789

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  790  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  849

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  850  VEQWKPTSHDEEEEDGSGGDLHMSLP  875



>gb|ABD96565.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/738 (53%), Positives = 487/738 (66%), Gaps = 41/738 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDAAVMS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L
Sbjct  21    ADDAAVMSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASQSLTGTLPSDL  79

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ LR+LS+Q NSL+G LPS +N+S L+ +Y + N FSS+ P     L +L+  S+  
Sbjct  80    NSLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGS  139

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP S
Sbjct  140   NPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSS  199

Query  2101  FGSSE-IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             F ++  ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL
Sbjct  200   FSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQL  259

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDP  1745
              DNQLTGVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP
Sbjct  260   RDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDP  319

Query  1744  QVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPA  1565
             +V  LL  A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPA
Sbjct  320   RVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPA  377

Query  1564  FSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL  1385
             F+ LT LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN 
Sbjct  378   FANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNA  437

Query  1384  LLEKTV------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             LL K +             +  G  G   ++  SS+S      +V++V+  + VVLFV +
Sbjct  438   LLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSW  497

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTA  1136
             KC++ +   +F R K  E  K    L                           + + G  
Sbjct  498   KCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPT  557

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
               IQVL + TN FSEE++LG GG+GVVY G L +GTK+AVK+M+  A   KG  EF+AEI
Sbjct  558   FSIQVLRQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMESVAMGNKGQKEFEAEI  617

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA
Sbjct  618   ALLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIA  677

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  678   LDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  737

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  738   TFGYLAPEYAATGRVTTK  755


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  730  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDEGSHLVTW  789

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  790  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  849

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  850  VGQWKPTSHDEEEEDGSGGDLHMSLP  875



>ref|XP_011005684.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=921

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/739 (53%), Positives = 489/739 (66%), Gaps = 40/739 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
              DD A + KL  +++P PSGWSA  S   C+W  +NCD     V SI++   S+SG LP 
Sbjct  21    ADDGATILKLANSITPLPSGWSAKSSTTFCSWHGINCDSSKSRVTSISLSKLSLSGTLPP  80

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             E++ L+ L+SLSVQ N LSG LPS AN+++L+ ++LDSN F+SIPP F  GL  L+  SI
Sbjct  81    EISTLSELQSLSVQGNQLSGDLPSLANLTNLQYIFLDSNNFTSIPPGFFQGLTGLQTLSI  140

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
              +N  LSPWQ+ + LA+ TSL +  A++  + G IP+ F S P+LQNLRLSYNNLTG LP
Sbjct  141   GNNVNLSPWQLPTDLAQCTSLTTLTANDCQLFGSIPDVFGSLPSLQNLRLSYNNLTGVLP  200

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SF +S IQNLWLNNQQ GL+G+I+VI S+T+LSQVWL  N FTGPIPDL++C ++FDLQ
Sbjct  201   PSFANSGIQNLWLNNQQIGLTGSIEVIGSITQLSQVWLHMNQFTGPIPDLTECKSIFDLQ  260

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGPC  1751
             L DNQ TG+VP SL  LPNL N+ L NNK  GP+P F   V  +  +  N +C     PC
Sbjct  261   LRDNQFTGIVPASLVSLPNLVNVSLSNNKFQGPVPQFPPSVITVKNEGINKYCAGPGVPC  320

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             D  V  LL  AGG GYP TL+  W GNDAC  W  +TCD   KNV TVNL  Q+F+G+IS
Sbjct  321   DALVMTLLEIAGGFGYPSTLSDKWDGNDAC-GWPLVTCDVGKKNVVTVNLAKQQFTGSIS  379

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN-ISFG  1394
             P+F++L+SL++LYLN+NNLTG IP SLT LP L+ LDVSNNNLS  +P FP +V  I+  
Sbjct  380   PSFAKLSSLKSLYLNENNLTGSIPGSLTKLPELETLDVSNNNLSGKIPEFPGSVKLITKP  439

Query  1393  GNLLLEKTV-----ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
             GN  L   V      T  G+   G T  GSS  +    V VI  +IV  V+  V     +
Sbjct  440   GNPFLRTDVDTSSGGTTNGTSNGGTTSGGSSAGSTKIAVGVIAGIIVAGVIFIVVLSFVL  499

Query  1228  KREHKRFGRAKSPEKIKSTQMLKTNEIMG------------------------------T  1139
              +  KR  ++    K    +    NE+ G                               
Sbjct  500   YKYKKRDPKSGKELKWDGGKAFFKNEVAGGGNGYNKVPIALHSQSSDGDNSKNIFEGGNV  559

Query  1138  AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAE  959
             A+ I+ L + T+ F E +++G GG+GVVY G+L +GTK+AVK+M+      KGM+EFQAE
Sbjct  560   AVPIEFLRQVTDNFHEINIIGRGGFGVVYRGELHDGTKIAVKRMESTVMGNKGMSEFQAE  619

Query  958   IAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTI  779
             IA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTLG HLFE   + + PLTWKQR+TI
Sbjct  620   IAVLTKVRHRHLVALLGYCINSNERLLVYEYMPQGTLGQHLFECHDYRYTPLTWKQRITI  679

Query  778   AWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVA  599
             A DVARG+EYLH L  QSFIHRD+K+SNILL DD+RAKVADFGLVK APD K  VETR+A
Sbjct  680   ALDVARGVEYLHGLAQQSFIHRDLKTSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLA  739

Query  598   GTFGYLAPEYATTGRVTKK  542
             GTFGYLAPEYA TGRVT K
Sbjct  740   GTFGYLAPEYAATGRVTSK  758


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 112/207 (54%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++   + Q F         +++   +R ++ D+   K      
Sbjct  672  TWKQRITIALDVARGVEYLHGLAQQSFIHRDLKTSNILLGDDMRAKVADFGLVKNAPDGK  731

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KAVD+T P+E  HLVT
Sbjct  732  YSVETRLAGTFGYLAPEYAATGRVTSKVDVYAFGVVLMEIITGRKAVDDTRPEEAAHLVT  791

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KAID +L PDE+T  +I  V ELA HCT    Y+RP+M H VNVL P
Sbjct  792  WFRRILINKENIPKAIDESLKPDEETLATIYTVTELAGHCTARDPYQRPDMGHAVNVLAP  851

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                WR    +E  ++  G DL+ +LP
Sbjct  852  LVKQWRPTSQQE--DQNCGTDLDTNLP  876



>ref|NP_189017.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 dbj|BAB01851.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76809.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=928

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/748 (52%), Positives = 496/748 (66%), Gaps = 52/748 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             S  DD   M  L  + +P PS WS++ D C W+ V C    G V +I++  +S++G +  
Sbjct  22    SVADDQTAMLALAKSFNPPPSDWSSTTDFCKWSGVRCTG--GRVTTISLADKSLTGFIAP  79

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             E++ L+ L+S+S+Q+N LSG +PSFA +SSL+E+Y+D N F  +      GL +L+I S+
Sbjct  80    EISTLSELKSVSIQRNKLSGTIPSFAKLSSLQEIYMDENNFVGVETGAFAGLTSLQILSL  139

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             SDN  ++ W   S L +STSL + +  N +I GV+P+ FDS  +LQNLRLSYNN+TG LP
Sbjct  140   SDNNNITTWSFPSELVDSTSLTTIYLDNTNIAGVLPDIFDSLASLQNLRLSYNNITGVLP  199

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              S G S IQNLW+NNQ  G+SGTI+V+SSMT LSQ WL  N F GPIPDLSK  NLFDLQ
Sbjct  200   PSLGKSSIQNLWINNQDLGMSGTIEVLSSMTSLSQAWLHKNHFFGPIPDLSKSENLFDLQ  259

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PC  1751
             L DN LTG+VP +L  L +L+NI L NNK  GP+PLF  +VKV + D N FC    G  C
Sbjct  260   LRDNDLTGIVPPTLLTLASLKNISLDNNKFQGPLPLFSPEVKVTI-DHNVFCTTKAGQSC  318

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
              PQV  LLA AGGLGYP  LA+SW+G+DAC  WA+++CD  GKNV T+NLG   F+G IS
Sbjct  319   SPQVMTLLAVAGGLGYPSMLAESWQGDDACSGWAYVSCDSAGKNVVTLNLGKHGFTGFIS  378

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-  1394
             PA + LTSL++LYLN N+LTG IP  LT +  LQ++DVSNNNL   +P FP  V  S+  
Sbjct  379   PAIANLTSLKSLYLNGNDLTGVIPKELTFMTSLQLIDVSNNNLRGEIPKFPATVKFSYKP  438

Query  1393  GNLLL------EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCY  1232
             GN LL        +  TG  S G G +  G      + V V++ V++ + ++ FV YK  
Sbjct  439   GNALLGTNGGDGSSPGTGGASGGPGGSSGGGGSKVGVIVGVIVAVLVFLAILGFVVYKFV  498

Query  1231  MKREHKRFGRAKSPEKIKSTQMLKTNEIM-------------------------------  1145
             MKR++ RF R   PEK+   ++L ++ +                                
Sbjct  499   MKRKYGRFNRT-DPEKVG--KILVSDAVSNGGSGNGGYANGHGANNFNALNSPSSGDNSD  555

Query  1144  -------GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                       I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  A   
Sbjct  556   RFLLEGGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECAAMGN  615

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW + G+ P
Sbjct  616   KGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWSELGYSP  675

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD 
Sbjct  676   LTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDG  735

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  736   KYSVETRLAGTFGYLAPEYAATGRVTTK  763


 Score =   154 bits (389),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 119/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  677  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  736

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEI+TG+KA+D++LPDE  HLVT
Sbjct  737  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRKALDDSLPDERSHLVT  796

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  797  WFRRILINKENIPKALDQTLEADEETMESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  856

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  857  LVEKWKPSCQEE--EESFGIDVNMSLP  881



>ref|XP_006296927.1| hypothetical protein CARUB_v10012920mg [Capsella rubella]
 gb|EOA29825.1| hypothetical protein CARUB_v10012920mg [Capsella rubella]
Length=932

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/738 (52%), Positives = 501/738 (68%), Gaps = 57/738 (8%)
 Frame = -2

Query  2605  ALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLS  2432
             + +P PS WSA  S + C WT V C    G V SI++  +S+SG +  E++ L+ L++++
Sbjct  37    SFNPPPSDWSATASANFCKWTGVRC--AGGRVTSISLADKSLSGFIAPEISTLSELKTVA  94

Query  2431  VQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQIS  2252
             +Q+N LSG +PSFA +SSL+E+YLD N F  +      GL +L+I S+SDN +++PW   
Sbjct  95    LQRNQLSGKIPSFAKLSSLQEIYLDENFFVGVEAGAFAGLTSLQILSLSDNTKITPWGFP  154

Query  2251  SYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnlw  2072
             S LA+S+SL + +  + +ITGV+PN FDSF +LQNLRLSYNN+TG LP S   S IQNLW
Sbjct  155   SELADSSSLTTIYLDSTNITGVLPNIFDSFASLQNLRLSYNNITGVLPPSLAKSSIQNLW  214

Query  2071  lnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPV  1892
             +NNQQ G+SGTI+V+SSMT LSQ WLQ N F+GPIPDLSK  NLFDLQL DN LTG+VP 
Sbjct  215   INNQQTGMSGTIEVLSSMTSLSQAWLQKNQFSGPIPDLSKSENLFDLQLRDNALTGIVPP  274

Query  1891  SLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALLAFAG  1715
             +L  L +L+NI   NNK  GP+P F  +VKV   D N FC   PG  C PQV  LLA +G
Sbjct  275   TLLSLGSLKNITFDNNKFQGPLPSFPPEVKVT-SDHNYFCTTKPGQSCSPQVMTLLAVSG  333

Query  1714  GLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNL  1535
             GLGYP  LA+SWKG+DAC  WA+++CD  GKNV T+NLG   F+G ISPA   LTSL+++
Sbjct  334   GLGYPSMLAESWKGDDACSGWAYVSCDSAGKNVVTLNLGKHGFNGFISPAIVNLTSLKSI  393

Query  1534  YLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-GNLLLEKTVATG  1358
             YLNDNNLTG IP  LT++  LQ++DVSNNNL   +P FP +V  ++  GN LL  T A  
Sbjct  394   YLNDNNLTGVIPKELTSMTSLQLIDVSNNNLKGEIPKFPGSVKFNYKPGNSLL-GTNAGD  452

Query  1357  RGSPGS---------GQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFG  1205
               +PG+         G +   S   A + + V++ +++ + ++ FV YK  MKR++ +F 
Sbjct  453   SSTPGTGSDASGGPGGSSGGHSGSKAPVIIGVIVAILVFLAILGFVVYKFVMKRKYGKFN  512

Query  1204  RAKSPEKIKSTQMLKTNEIM-------------------------------------GTA  1136
             R   PE  K+ ++L ++ +                                         
Sbjct  513   RT-DPE--KAGKILVSDALSNGGGSGGYANGHGANNFNALNSPSSGDNSDRFLLEGGSVT  569

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  A   KGM+EFQAEI
Sbjct  570   IPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECSAMGNKGMSEFQAEI  629

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW++ G+ PLTWKQRV+IA
Sbjct  630   AVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWRELGYSPLTWKQRVSIA  689

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  690   LDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  749

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  750   TFGYLAPEYAATGRVTTK  767


 Score =   150 bits (380),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  681  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  740

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEI+TG+KA+D++LPDE  HLVT
Sbjct  741  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRKALDDSLPDERSHLVT  800

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF + +    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  801  WFRRNLINKDNIPKALDQTLEADEETMESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  860

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  861  LVEKWKPSCQEE--EESFGIDVNMSLP  885



>ref|XP_010023612.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW59921.1| hypothetical protein EUGRSUZ_H02645 [Eucalyptus grandis]
Length=923

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/731 (58%), Positives = 516/731 (71%), Gaps = 42/731 (6%)
 Frame = -2

Query  2626  VMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLAS  2447
             VM+++LAAL P  SGWS+ +  C WT V+CD  +  V  I + S S+SG LPS+L+ L+ 
Sbjct  36    VMAEILAALKP--SGWSSGQTYCKWTGVSCDS-SSRVTVIKLSSASLSGVLPSDLSSLSQ  92

Query  2446  LRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELS  2267
             L+SLS+Q NSLSG +PSFA ++SL+ +YLD+N F+SI      GL +L+  S+SDN +L 
Sbjct  93    LQSLSLQSNSLSGAVPSFAGLASLQSIYLDTNNFTSITSGAFQGLTSLQTLSLSDNLDLP  152

Query  2266  PWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE  2087
              WQI + L  STSL   +A N +ITG IP+F  + P+L +LRLSYNNLTG LP SFG+S 
Sbjct  153   SWQIPAELNASTSLTVLYADNTNITGTIPDFLGTLPSLTSLRLSYNNLTGPLPSSFGTSS  212

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             IQNLW+NNQ  GLSG I V++ MT+L+QVWLQ N FTGPIPDLS+C NLFDLQL DNQ T
Sbjct  213   IQNLWINNQAVGLSGGISVLAGMTQLTQVWLQNNQFTGPIPDLSQCTNLFDLQLRDNQFT  272

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SL  LP L+N+ L NNKL GP+P   + ++V   + NSFC   PGPCDPQVTALL
Sbjct  273   GVVPASLWALPGLKNVSLDNNKLQGPVPSSSSGIRVTY-EGNSFCNSAPGPCDPQVTALL  331

Query  1726  AFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLT  1550
               AG LGYPITLA SW GNDACQ  W+ I+C  QGKNVT V    + FSGTISPAF+ LT
Sbjct  332   EVAGALGYPITLADSWTGNDACQGGWSAISC--QGKNVTAVTFSKRGFSGTISPAFANLT  389

Query  1549  SLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKT  1370
             SLR L LNDN+LTG IP SLTTL  LQ LDVSNNNL+  +P FP +V ++  GN L+ KT
Sbjct  390   SLRTLLLNDNDLTGSIPESLTTLTQLQTLDVSNNNLNGSIPVFPASVKLTTTGNPLIGKT  449

Query  1369  -------VATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CYMKREHK  1214
                      +G  S  S  + NGSS+S  +   VV+ V+I + VVLFV YK CY+ R H 
Sbjct  450   DTGGGGSGGSGTNSTDSSGSSNGSSLSGGVIAAVVVGVLIFIGVVLFVLYKFCYINRRHG  509

Query  1213  RFGRAKSPE-KIKSTQMLKTNEIMG--------------------------TAIKIQVLE  1115
             +F R  +PE  ++  +    N + G                           AI IQVL 
Sbjct  510   KFNRVDNPEIGMEVAKNGAGNGVNGHGGLPSELHSQSSGDHSDFPVFEGGNVAISIQVLR  569

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
             + T+ FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQAEI+ L+KVR
Sbjct  570   QVTHNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQAEISVLTKVR  629

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRVTIA DVARG+
Sbjct  630   HRHLVALLGYCINGDERLLVYEYMPQGTLTQHLFEWQEKGYAPLTWKQRVTIALDVARGV  689

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLAP
Sbjct  690   EYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAP  749

Query  574   EYATTGRVTKK  542
             EYA TGRVT K
Sbjct  750   EYAATGRVTTK  760


 Score =   159 bits (401),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 129/235 (55%), Gaps = 20/235 (9%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  674  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  733

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+D+ +PDE  HLVT
Sbjct  734  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDDNMPDERAHLVT  793

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID +LDPDE+T ESI KVAELA HCT  + ++RP+M H VN+LGP
Sbjct  794  WFRRVLINKENIPKAIDQSLDPDEETLESIIKVAELAGHCTAREPFQRPDMGHAVNILGP  853

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLPLVFD--------DSSIESLSFTNAQHRL  121
                W+    +E  E+  G +L+MSLP             S   ++SF+N Q  +
Sbjct  854  AVEQWKPTSHDE--EESSGINLHMSLPQALQRWQADEGTSSVFNTMSFSNTQSSI  906



>ref|XP_006366998.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=898

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/731 (53%), Positives = 500/731 (68%), Gaps = 43/731 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M+KL  +L P P GWS + + C W+ V+CD  +G V SI++ S+S+ G LP +L QL++L
Sbjct  1     MAKLAKSLIPTPPGWSGT-NVCKWSGVSCDS-SGRVSSISLISKSLGGQLPPDLNQLSNL  58

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             ++ ++QKN +SG LPS +N+ SL++++LDSN F+S+P +FL GL NL+ FSI DN  L P
Sbjct  59    QTFNIQKNRISGSLPSLSNLPSLQDVHLDSNNFTSVPTNFLSGLTNLQKFSIDDNPGLPP  118

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W I   L +STSL  F ASNA+I G IP+ F SFP+L++LRLSYNNLTG LP SF  S I
Sbjct  119   WTIPDSLTDSTSLADFSASNANIMGQIPDIFGSFPSLESLRLSYNNLTGFLPYSFAKSGI  178

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             QNL LNNQ+ GL+G IDV+ SM +L+Q W+  N F GPIPDLS C NL D+QL DN LTG
Sbjct  179   QNLILNNQKLGLTGRIDVLGSMEQLTQAWIHVNKFEGPIPDLSLCTNLVDIQLRDNSLTG  238

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             V+P SLT LP L N  LQNN  LGP+P F   V+V LG+TN FC   PGPCDPQVT LL 
Sbjct  239   VIPPSLTSLPKLTNASLQNNIFLGPIPGFKPNVQVTLGNTNHFCNPYPGPCDPQVTILLD  298

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
              AG +G P+ LA+SW GN+ C+ W +ITCD +G  V+ +N   Q + GTISPA + LT L
Sbjct  299   VAGAVGCPMILAESWAGNNPCKGWNYITCDAKG-TVSVINFAKQNWVGTISPAVANLTGL  357

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVA  1364
             ++L +NDNNLTGPIPVSLT+L  LQ++DVSNNN+S  +P F   V +   GN  + K V 
Sbjct  358   KSLVMNDNNLTGPIPVSLTSLLELQLVDVSNNNISGKIPKFRSDVILKTSGNPFMGKDVP  417

Query  1363  TGRGSPG---------------SGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
                  PG               + + E+ SS+S  + V +V+ VV+++LV+  V YK Y 
Sbjct  418   PS-APPGARPSSSSSTDNNSPSAAKDEHKSSVSTWVIVGIVLAVVVLILVLCLVIYK-YK  475

Query  1228  KREHKRFGRAKSPEKIK---STQMLKTNEIMGTA-------------------IKIQVLE  1115
             +    +  + K  +K+K   S  M     I  TA                   I +++L 
Sbjct  476   RNGKSKLNKGKE-QKLKNGSSKNMKGYGAIPSTASQSDTSNSEIYVYDGGHVTIPVELLR  534

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
             +ATN FSEE++LG GG+G+VY G+L +GT++AVK+M+      KG+ EF+AEI  L+KVR
Sbjct  535   EATNNFSEENILGRGGFGIVYKGRLHDGTEIAVKRMEASIASNKGLTEFRAEIEVLTKVR  594

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LVAL G+C+N ++ LLVYEYM  GTLG HLF+  + GF PLTWKQR+TIA DVARG+
Sbjct  595   HRHLVALHGFCVNGYERLLVYEYMPQGTLGQHLFDHDQLGFLPLTWKQRLTIALDVARGV  654

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLH L  QSFIHRD+K SN+LL DD+RAKV+DFGLVK APD K  VETR+AGTFGYLAP
Sbjct  655   EYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVSDFGLVKNAPDGKYSVETRLAGTFGYLAP  714

Query  574   EYATTGRVTKK  542
             EYA+TGRVT K
Sbjct  715   EYASTGRVTTK  725


 Score =   128 bits (322),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 119/240 (50%), Gaps = 22/240 (9%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + L+I +     V ++   + Q F         +++   +R ++ D+   K      
Sbjct  639  TWKQRLTIALDVARGVEYLHGLAQQSFIHRDLKPSNVLLGDDMRAKVSDFGLVKNAPDGK  698

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K+DV+AFGV+LMEI+TG+KA+DE+LP++  HLV 
Sbjct  699  YSVETRLAGTFGYLAPEYASTGRVTTKIDVFAFGVILMEILTGRKALDESLPEDRSHLVA  758

Query  441  WFHKIIRKSHNLQKAIDPT-LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            WF K +     + + +DPT LDPDE+T++SI KVAELA HC   +  +RP+M H VNVL 
Sbjct  759  WFKKTVVNKEKIVEVLDPTLLDPDEETYQSICKVAELAGHCAAREPSQRPDMGHAVNVLA  818

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSLPLVF------DDSSIE---SLSFTNAQHRLNQS  112
            P    W         +     D  MSLP         DDS +    S    +A  R +QS
Sbjct  819  PLVEQWTPT--AAAGDDSFNIDFTMSLPQALQKWKANDDSMLSEDTSYGAYSASTRTSQS  876



>ref|XP_011003774.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=943

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/738 (52%), Positives = 487/738 (66%), Gaps = 40/738 (5%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD A + KL  +++P PSGWSA  S   C+W  +NCD     V SI++   S+SG LP E
Sbjct  44    DDGATILKLANSITPLPSGWSAKSSTTFCSWHGINCDSSKSRVTSISLSKLSLSGTLPPE  103

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             ++ L+ L+SLSVQ N LSG LPS AN+++L+ ++LDSN F+SIPP F  GL  L+  SI 
Sbjct  104   ISTLSELQSLSVQGNQLSGDLPSLANLTNLQYIFLDSNNFTSIPPGFFQGLTGLQTLSIG  163

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             +N  LSPWQ+ + LA+ TSL +  A++  + G IP+ F S P+LQNLRLSYNNLTG LP 
Sbjct  164   NNVNLSPWQLPTDLAQCTSLTTLTANDCQLFGSIPDVFGSLPSLQNLRLSYNNLTGVLPP  223

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF +S IQNLWLNNQQ GL+G+I+VI S+T+LSQVWL  N FTGPIPDL++C ++FDLQL
Sbjct  224   SFANSGIQNLWLNNQQIGLTGSIEVIGSITQLSQVWLHMNQFTGPIPDLTECKSIFDLQL  283

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGPCD  1748
              DNQ TG+VP SL  LPNL N+ L NNK  GP+P F   V  +  +  N +C     PCD
Sbjct  284   RDNQFTGIVPASLVSLPNLVNVSLSNNKFQGPVPQFPPSVITVKNEGINKYCAGPGVPCD  343

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
               V  LL  AGG GYP TL+  W GNDAC  W  +TCD   KNV TVNL  Q+F+G+ISP
Sbjct  344   ALVMTLLEIAGGFGYPSTLSDKWDGNDAC-GWPLVTCDVGKKNVVTVNLAKQQFTGSISP  402

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN-ISFGG  1391
             +F++L+SL++LYLN+NNLTG IP SLT LP L+ LDVSNNNLS  +P FP +V  I+  G
Sbjct  403   SFAKLSSLKSLYLNENNLTGSIPGSLTKLPELETLDVSNNNLSGKIPEFPGSVKLITKPG  462

Query  1390  NLLLEKTV-----ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             N  L   V      T  G+   G T  GSS  +      VI  +IV  V+  V       
Sbjct  463   NPFLRTDVDTSSGGTTNGTSNGGTTSGGSSAGSTKIPGGVIAGIIVAGVIFIVVLSFVFY  522

Query  1225  REHKRFGRAKSPEKIKSTQMLKTNEIMG------------------------------TA  1136
             +  KR  ++    K    +    NE+ G                               A
Sbjct  523   KYKKRDPKSGKELKWDGGKAFFKNEVAGGGNGYNKVPIALHSQSSDGDNSKNIFEGGNVA  582

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             + I+ L + T+ F E +++G GG+GVVY G+L +GTK+AVK+M+      KGM+EFQAEI
Sbjct  583   VPIEFLRQVTDNFHEINIIGRGGFGVVYRGELHDGTKIAVKRMESTVMGNKGMSEFQAEI  642

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTLG HLFE   + + PLTWKQR+TIA
Sbjct  643   AVLTKVRHRHLVALLGYCINSNERLLVYEYMPQGTLGQHLFECHDYRYTPLTWKQRITIA  702

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLH L  QSFIHRD+K+SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  703   LDVARGVEYLHGLAQQSFIHRDLKTSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  762

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  763   TFGYLAPEYAATGRVTSK  780


 Score =   143 bits (360),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLMEIITG+KAVD+T P+E  HLVTW
Sbjct  755  SVETRLAGTFGYLAPEYAATGRVTSKVDVYAFGVVLMEIITGRKAVDDTRPEEAAHLVTW  814

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I+    N+ KAID +L PDE+T  +I  V ELA HCT    Y+RP+M H VNVL P 
Sbjct  815  FRRILINKENIPKAIDESLKPDEETLATIYTVTELAGHCTARDPYQRPDMGHAVNVLAPL  874

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               WR    +E  ++  G DL+ +LP
Sbjct  875  VKQWRPTSQQE--DQNCGTDLDTNLP  898



>gb|ACN59321.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=928

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/748 (52%), Positives = 495/748 (66%), Gaps = 52/748 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             S  DD   M  L  + +P PS WS++ D C W+ V C    G V +I++  +S++G +  
Sbjct  22    SVADDQTAMLALAKSFNPPPSDWSSTTDFCKWSGVRCTG--GRVTTISLADKSLTGFIAP  79

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             E++ L+ L+S+S+Q+N LSG +PSFA +SSL+E+Y+D N F  +      GL +L+I S+
Sbjct  80    EISTLSELKSVSIQRNKLSGTIPSFAKLSSLQEIYMDENNFVGVETGAFAGLTSLQILSL  139

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             SDN  ++ W   S L +STSL + +  N +I GV+P+ FDS  +LQNLRLSYNN+TG LP
Sbjct  140   SDNNNITTWSFPSELVDSTSLTTIYLDNTNIAGVLPDIFDSLASLQNLRLSYNNITGVLP  199

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              S G S IQNLW+NNQ  G+SGTI+V+SSMT LSQ WL  N F GPIPDLSK  NLFDLQ
Sbjct  200   PSLGKSSIQNLWINNQDLGMSGTIEVLSSMTSLSQAWLHKNHFFGPIPDLSKSENLFDLQ  259

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PC  1751
             L DN LTG+VP +L  L +L+NI L NNK  GP+PLF  +VKV + D N FC    G  C
Sbjct  260   LRDNDLTGIVPPTLLTLASLKNISLDNNKFQGPLPLFSPEVKVTI-DHNVFCTTKAGQSC  318

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
              PQV  LLA AGGLGYP  LA+SW+G+DAC  WA+++CD  GKNV T+NLG   F+G IS
Sbjct  319   SPQVMTLLAVAGGLGYPSMLAESWQGDDACSGWAYVSCDSAGKNVVTLNLGKHGFTGFIS  378

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-  1394
             PA + LTSL++LYLN N+LTG IP  LT +  LQ++DVSNNNL   +P FP  V  S+  
Sbjct  379   PAIANLTSLKSLYLNGNDLTGVIPKELTFMTSLQLIDVSNNNLRGEIPKFPATVKFSYKP  438

Query  1393  GNLLL------EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCY  1232
             GN LL        +  TG  S G G +  G      + V V++ V++ + ++ FV YK  
Sbjct  439   GNALLGTNGGDGSSPGTGGASGGPGGSSGGGGSKVGVIVGVIVAVLVFLAILGFVVYKFV  498

Query  1231  MKREHKRFGRAKSPEKIKSTQMLKTNEIM-------------------------------  1145
             MKR++ RF R   PEK+   ++L ++ +                                
Sbjct  499   MKRKYGRFNRT-DPEKVG--KILVSDAVSNGGSGNGGYANGHGANNFNALNSPSSGDNSD  555

Query  1144  -------GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                       I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK M+  A   
Sbjct  556   RFLLEGGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKGMECAAMGN  615

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW + G+ P
Sbjct  616   KGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWSELGYSP  675

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD 
Sbjct  676   LTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDG  735

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  736   KYSVETRLAGTFGYLAPEYAATGRVTTK  763


 Score =   154 bits (390),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 119/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  677  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  736

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEI+TG+KA+D++LPDE  HLVT
Sbjct  737  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRKALDDSLPDERSHLVT  796

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  797  WFRRILINKENIPKALDQTLEADEETMESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  856

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  857  LVEKWKPSCQEE--EESFGIDVNMSLP  881



>ref|XP_004502257.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=933

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/748 (54%), Positives = 493/748 (66%), Gaps = 52/748 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             +  DD   MSKL  +L+P PSGWS+S   C WT V CD  +  V SIN+ S+S+SG LPS
Sbjct  29    AIADDGVFMSKLSKSLNPTPSGWSSST-FCNWTGVKCDD-SNRVTSINLASKSLSGTLPS  86

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             +L  L+ L SLS+Q NSLSG LPS A++S L  ++L SN F+SI      GL +L+  SI
Sbjct  87    DLNSLSQLTSLSLQSNSLSGALPSLADLSMLVTVFLGSNNFTSITDGCFNGLTSLQKLSI  146

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
             S N  L+PW I + L +S+++        ++ G +P+ F    +LQ+LRLSYNNLTG LP
Sbjct  147   SQNINLAPWTIPTELNQSSNIVELDLGETNLVGSLPDIFVPLVSLQDLRLSYNNLTGDLP  206

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF  S IQNL     +   G +G+IDV+SSMT L+QVW Q N FTGPIPDLS C NL+D
Sbjct  207   NSFSGSGIQNLWLNNQHDGFGFTGSIDVLSSMTHLTQVWFQKNKFTGPIPDLSNCTNLYD  266

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPG  1757
             LQL DNQLTGVV  SL  L +L+N+ L NNKL GP P FG  VKV L D  NSFC++TPG
Sbjct  267   LQLRDNQLTGVVSPSLMSLSSLQNVSLDNNKLQGPFPSFGKGVKVTLDDGINSFCRNTPG  326

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCDP+VT LL  A   GYPI LA SWKGND CQ+W+F+ C   G  + TVNL  Q  +GT
Sbjct  327   PCDPKVTTLLDIAADFGYPIQLASSWKGNDPCQDWSFVVC--SGGKIITVNLAKQNLTGT  384

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPAF  LT LRNLYL  NNL+G IP SLT L  L+V DVSNNNLS  +P F   V  + 
Sbjct  385   ISPAFGNLTDLRNLYLGGNNLSGSIPGSLTGLAQLEVFDVSNNNLSGEVPKFSDKVKFNS  444

Query  1396  GGNLLL--------------EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlv  1259
              GN+LL              + +     GSP    +E  SS+SA     + ++ V  V V
Sbjct  445   AGNVLLGPSGGGGGSGTTPPKDSGGAPSGSPSGKASE--SSLSAAWIAGIAVIAVFFVAV  502

Query  1258  vlfvFYKCYMK-REHKRFGRAKSPE------KIKSTQMLKTNEIMGTA------------  1136
             VLFVF KCY K R H +FGR  +PE      KI +  +  +N   G A            
Sbjct  503   VLFVFCKCYAKNRRHGKFGRVNNPENGKVDVKIDAMSVSNSNGYAGVASELQSQGSERSD  562

Query  1135  ----------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                       I IQVL + TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+  A  T
Sbjct  563   IQVFEGGNVTISIQVLRQVTNNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESVAVGT  622

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG+NEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLF+W ++G  P
Sbjct  623   KGLNEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWGENGCAP  682

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             LTWKQRV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD 
Sbjct  683   LTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDG  742

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   KYSVETRLAGTFGYLAPEYAATGRVTTK  770


 Score =   154 bits (390),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  684  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  743

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  744  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTMPDERSHLVS  803

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TL+PDE+T ESI K+AELA HCT  + Y+RP+M H VNVL P
Sbjct  804  WFRRVLVNKENIPKAIDQTLNPDEETMESIYKIAELAGHCTAREPYQRPDMGHAVNVLVP  863

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  864  LVEQWKPTNHEE--EEGYGIDLHMSLP  888



>ref|XP_008222748.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=886

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/722 (55%), Positives = 493/722 (68%), Gaps = 32/722 (4%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLPSEL  2462
             DD+AVMSKL       P  WS  K  C W  + C    GN V S+N+ S S+SG+LPS L
Sbjct  27    DDSAVMSKLAEGHKNTPEDWSTGKTYCDWEGIEC---VGNRVASVNLSSMSLSGSLPSNL  83

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L +LS+Q NSLSGP PS AN+SSL+E+YLD+N FSSIP     GL NL++ S+S 
Sbjct  84    NSLTHLTTLSLQSNSLSGPFPSLANLSSLQEIYLDNNNFSSIPSGCFQGLSNLQVLSMSQ  143

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW   + L +++SL +  A NA+  G +P+ FDSFPNLQ+LRLSYNN +G LP S
Sbjct  144   NINLDPWVFPTELIQASSLVTLAAGNANFYGSLPDIFDSFPNLQSLRLSYNNFSGFLPKS  203

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S IQNLWLNNQQ GLSGTI+V+S+MT+L+QVWL  N FTGPIPD+SKC  LFDLQL 
Sbjct  204   FSGSGIQNLWLNNQQFGLSGTIEVLSNMTQLNQVWLHKNQFTGPIPDISKCKALFDLQLR  263

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             D  LTG+VP +L     ++N+ L NNKL GP+P+FG+ VK     TNSFC   PGPCDPQ
Sbjct  264   DKLLTGIVPATLMSSTAIQNVSLDNNKLQGPLPVFGSNVKATFDGTNSFCLTKPGPCDPQ  323

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             V  LL  AG LGYPI LA+SW+GN+ C  W+FI CD QGK V TVN   + F+G ISPAF
Sbjct  324   VNTLLEVAGALGYPILLAESWEGNNTCDGWSFIVCDTQGK-VITVNFEKKHFTGIISPAF  382

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSL+NL L +NNLTG IP SL TL  LQ+LD SNNNL   +P FP  V +   GN+L
Sbjct  383   ANLTSLKNLVLKNNNLTGSIPASLLTLQQLQLLDFSNNNLFGEIPKFPDTVKLITTGNVL  442

Query  1381  LEK-------------------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlv  1259
             +                     T   G  +P SG    GSS+S  M   +V  VVI +LV
Sbjct  443   IGTTPSSGGGGGGTPSGSGSNGTTPNGSPAPASG----GSSVSPGMIDGIVFAVVIFILV  498

Query  1258  vlfvFYKCYMKREH--KRFGRAKSPEKIKSTQM-LKTNEIMGTAIKIQVLEKATNFFsee  1088
             + FV  KCY  ++H  +          I S +  L  +E    AI I+VL K TN FSE+
Sbjct  499   LFFVSIKCYENKKHIVRIVDSENGCNGIPSDKTGLHLSEGGNVAISIEVLRKVTNNFSED  558

Query  1087  svlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVG  908
             ++LG GG+GVVY G+L +GT++AVK+M+  A  T+ MNEF+AEIAFL+KV+H++LV+L+G
Sbjct  559   NILGRGGFGVVYKGELHDGTRIAVKRMECVAVSTERMNEFEAEIAFLAKVKHRHLVSLLG  618

Query  907   YCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQ  728
             YCIN ++ LLVYEYM  GTL  HL+ W+++G  PLTW+QR+TIA DVARG+EYLH L  Q
Sbjct  619   YCINGNERLLVYEYMPQGTLTQHLYNWRENGVPPLTWRQRITIALDVARGVEYLHGLAPQ  678

Query  727   SFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVT  548
             SFIHRD+K SNILL DD+RAKVADFGLVK APD  S VETRVAGTFGYLAPEY  TGRVT
Sbjct  679   SFIHRDLKPSNILLGDDMRAKVADFGLVKHAPDANS-VETRVAGTFGYLAPEYTATGRVT  737

Query  547   KK  542
              +
Sbjct  738   TR  739


 Score =   129 bits (324),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 115/208 (55%), Gaps = 14/208 (7%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++   +PQ F         +++   +R ++ D+   K     N
Sbjct  654  TWRQRITIALDVARGVEYLHGLAPQSFIHRDLKPSNILLGDDMRAKVADFGLVKHAPDAN  713

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   + G    L       G    +VDVYAFGVVLM++++GKKA+D T+PDE   LV 
Sbjct  714  -SVETRVAGTFGYLAPEYTATGRVTTRVDVYAFGVVLMQLLSGKKALDHTIPDERSLLVI  772

Query  441  WFHKIIRKSHNLQKAIDPTL-DPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            WF + + K   + K ID TL + DE+T E I KVAELA HCT +  ++RP M +VVN+L 
Sbjct  773  WFRRFLIKKEYIPKTIDETLKNHDEETMECICKVAELAGHCTAHNPFQRPEMSYVVNILA  832

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            P   NW+    EE  EK+ G D +MSLP
Sbjct  833  PLVRNWKPTSHEE-EEKY-GIDRHMSLP  858



>ref|XP_004504378.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=912

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/733 (52%), Positives = 485/733 (66%), Gaps = 39/733 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDAAV + LL +L P PSGWS+    C W  + CD  +  V +I++ S+S++G LPS L
Sbjct  22    ADDAAVTTNLLESLKPTPSGWSSKTPFCQWQGITCDS-SNRVTTIDLHSKSLTGTLPSNL  80

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L  L++Q N+LSG LPS +N+S L+  +L SN F+S+P     GL +L+   + +
Sbjct  81    NSLSQLTILNLQNNALSGTLPSLSNLSYLQSAFLGSNNFTSVPSAAFSGLTSLQDLRLGN  140

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  LSPW   + L + +SL S   +++ I G +P+ FD FP+L +LRLSYNNLTG LP S
Sbjct  141   NINLSPWTFPTELTQCSSLNSLDLTSSGINGNLPDIFDKFPSLVSLRLSYNNLTGELPNS  200

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
               +S IQ LWLNNQ    +G+I V+S+MT+L+QVWL  N FTGPIPDLS+C NL DL+L 
Sbjct  201   LAASSIQELWLNNQGL--TGSIAVLSNMTQLTQVWLHVNQFTGPIPDLSQCKNLIDLKLR  258

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV--ILGDTNSFCKDTPGPCD  1748
             DN+LTGVVP SL  L +L+N+ L NNKL GP+P+F   V+     G  NSFC D PGPCD
Sbjct  259   DNKLTGVVPNSLMSLSSLKNVSLDNNKLQGPVPVFAKDVQFNPDFG-VNSFCLDKPGPCD  317

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
              +V  LL  A   GYP  LA  WK ND C++W F+TC+  G  + ++  G Q F GTISP
Sbjct  318   ARVMVLLQIAEAFGYPFVLANEWKENDPCKSWRFVTCN--GGKIVSLYFGKQGFQGTISP  375

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LT LR+L LN NNLTG IP SLTTL  L+ LDVSNNNLS  +P F   V +   GN
Sbjct  376   AFANLTDLRSLNLNGNNLTGSIPESLTTLSQLETLDVSNNNLSGVVPKFSSKVKLVTDGN  435

Query  1387  LLLEKTVA-TGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKR  1211
              L+ KT+   G  S GS        M+  +   +VI+VV +V  VLFV +KCY +R  ++
Sbjct  436   ALIGKTLGPDGHTSSGSAAGSGNGRMTPGLVAGIVIIVVFLVAAVLFVSFKCYARRRLRK  495

Query  1210  FGRAKSPE----------------------KIKSTQMLKTNEIMG--------TAIKIQV  1121
             F R  +PE                      +++S      +E+ G          I I V
Sbjct  496   FSRVSNPESGNGNIKLDLASVSNGYGGVPSELQSKSSGDHSELYGFDGGSGGNATISIHV  555

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L + TN FS+E++LG GG+GVVY G+L +GTK+AVK+M   AT +KG+NEFQAEIA L+K
Sbjct  556   LRQVTNNFSDENILGRGGFGVVYQGELPDGTKIAVKRMISVATGSKGLNEFQAEIAVLTK  615

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL+GYCIN ++ LLVYE+M  GTL  HLFE  +HG+ PLTWKQR+ IA DV R
Sbjct  616   VRHRHLVALLGYCINGNERLLVYEHMPQGTLTQHLFECSEHGYTPLTWKQRLAIALDVGR  675

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VET++AGTFGYL
Sbjct  676   GVEYLHSLAQQSFIHRDLKPSNILLGDDLRAKVADFGLVKNAPDGKYSVETKLAGTFGYL  735

Query  580   APEYATTGRVTKK  542
             APEYA TGRVT K
Sbjct  736   APEYAATGRVTTK  748


 Score =   150 bits (378),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 118/207 (57%), Gaps = 13/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + L+I +     V ++ + + Q F         +++   LR ++ D+   K      
Sbjct  662  TWKQRLAIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDLRAKVADFGLVKNAPDGK  721

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+  +L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVT
Sbjct  722  YSVETKLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTIPDERSHLVT  781

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ K ID TL+PDE+T ES+ KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  782  WFRRVLINKENIPKVIDQTLNPDEETMESVYKVAELAGHCTAREPYQRPDMGHAVNVLGP  841

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+ +   E  E   G D N SLP
Sbjct  842  LVELWKPITHTE--EYSYGID-NQSLP  865



>gb|ABD96567.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/738 (53%), Positives = 485/738 (66%), Gaps = 41/738 (6%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              DDAAVMS  L +L+P PSGWS +   C W  + CD  + +V SI++ S S++G LPS+L
Sbjct  21    ADDAAVMSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASHSLTGTLPSDL  79

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ LR+L +Q NSL+G LPS +N+S L+ +YL+ N FSS+ P     L +L+  S+  
Sbjct  80    NSLSQLRTLFLQDNSLTGTLPSLSNLSFLQTVYLNRNNFSSVSPTAFASLTSLQTLSLGS  139

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP S
Sbjct  140   NPALQPWSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSS  199

Query  2101  FGSSE-IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             F ++  ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL
Sbjct  200   FSAANNLETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQL  259

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDP  1745
              DNQLTGVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP
Sbjct  260   RDNQLTGVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDP  319

Query  1744  QVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPA  1565
             +V  LL  A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPA
Sbjct  320   RVMVLLQIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPA  377

Query  1564  FSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL  1385
             F+ LT LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN 
Sbjct  378   FANLTDLRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNA  437

Query  1384  LLEKTV------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             LL K +             +  G  G   ++  SS+S      +V++V+  + VVLFV +
Sbjct  438   LLGKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSW  497

Query  1240  KCYMKREHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTA  1136
             KC++ +   +F R K  E  K    L                           + + G  
Sbjct  498   KCFVNKLQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPT  557

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
               IQVL + TN FSEE++LG GG+GVVY G L +GTK+AVK+M   A   KG  EF+AEI
Sbjct  558   FSIQVLRQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMGSVAMGNKGQKEFEAEI  617

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA
Sbjct  618   ALLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIA  677

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AG
Sbjct  678   LDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAG  737

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGRVT K
Sbjct  738   TFGYLAPEYAATGRVTTK  755


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  730  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  789

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  790  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  849

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  850  VEQWKPTSHDEEEEDGSGGDLHMSLP  875



>dbj|BAH56605.1| receptor-like kinase [Glycine max]
Length=894

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/732 (53%), Positives = 483/732 (66%), Gaps = 41/732 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L  L+ L
Sbjct  1     MSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASQSLTGTLPSDLNSLSQL  59

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             R+LS+Q NSL+G LPS +N+S L+ +YL+ N FSS+ P     L +L+  S+  N  L P
Sbjct  60    RTLSLQDNSLTGTLPSLSNLSFLQTVYLNRNNFSSVSPTAFASLTSLQTLSLGSNPALQP  119

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-  2087
             W   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP SF ++  
Sbjct  120   WSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANN  179

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLT
Sbjct  180   LETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLT  239

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP+V  LL
Sbjct  240   GVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLL  299

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF+ LT 
Sbjct  300   QIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTD  357

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN LL K +
Sbjct  358   LRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPL  417

Query  1366  ------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                          +  G  G   ++  SS+S      +V++V+  + VVLFV +KC++ +
Sbjct  418   SPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNK  477

Query  1222  EHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTAIKIQVL  1118
                +F R K  E  K    L                           + + G    IQVL
Sbjct  478   LQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVL  537

Query  1117  EKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKV  938
              + TN FSEE++LG GG+GVVY G L +GTK+AVK+M+  A   KG  EF+AEIA LSKV
Sbjct  538   RQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMESVAMGNKGQKEFEAEIALLSKV  597

Query  937   RHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARG  758
             RH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA DVARG
Sbjct  598   RHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIALDVARG  657

Query  757   IEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLA  578
             +EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLA
Sbjct  658   VEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLA  717

Query  577   PEYATTGRVTKK  542
             PEYA TGRVT K
Sbjct  718   PEYAATGRVTTK  729


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  704  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  763

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  764  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  823

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  824  VEQWKPTSHDEEEEDGSGGDLHMSLP  849



>ref|XP_010512862.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=933

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/752 (51%), Positives = 498/752 (66%), Gaps = 57/752 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S  DD + M  L  + +P PS WS +     C W+ V C   +  V SI++  +S++G +
Sbjct  24    SVADDGSAMLALAKSFNPPPSDWSTTTSSGFCQWSGVRCT--SNRVTSISLADKSLAGVI  81

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
               E++ L+ L+++++Q+N L+G +PSFA +SSL+E+Y+D N F  +      GL +L+I 
Sbjct  82    APEISTLSELKTVALQRNRLTGNIPSFAKLSSLQEIYIDENFFLGVETGAFAGLTSLQIL  141

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+SD   ++PW   S L +STSL + +  + +I G +PN FDSF +LQNLRLSYNN+TG 
Sbjct  142   SLSDCKNITPWVFPSELVDSTSLTTIYLDSTNIFGALPNVFDSFASLQNLRLSYNNITGV  201

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S IQNLW+NNQQ G+SGTI+V+SSMT LSQ WLQ N F+GPIPDLSK  NLFD
Sbjct  202   LPPSLAKSSIQNLWINNQQSGMSGTIEVLSSMTSLSQAWLQKNQFSGPIPDLSKSENLFD  261

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-  1757
             LQL DNQLTG+VP +L  L +L+N+   NNKL GP P F   VK +    N FC   PG 
Sbjct  262   LQLRDNQLTGIVPPTLLSLKSLKNVTFDNNKLQGPFPFFPPDVK-LSTKGNVFCTSVPGQ  320

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQVT LLA AGGLGYP  LA+SWKG+DAC  WA+++CD  GKNV T+NLG   F+G 
Sbjct  321   SCSPQVTTLLAVAGGLGYPPMLAESWKGDDACSGWAYVSCDSGGKNVITLNLGKHGFNGF  380

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPA + LTSL+++YLNDNNL+G IP  LT +  LQ++DVSNNNL   +P FP +V  ++
Sbjct  381   ISPAIANLTSLKSVYLNDNNLSGVIPKELTLMTSLQLIDVSNNNLKGEIPKFPASVKFNY  440

Query  1396  G-GNLLLEKTVATGRGSPGSG---------QTENGSSMSARMfvvvvivvvivvlvvlfv  1247
               GN LL  T      +PG+G          +       A + V V++ V++ + ++ FV
Sbjct  441   KPGNSLL-GTKGGDDSTPGTGADTSGGPGGSSGGHGGSKAPVIVGVIVAVLVSLAILGFV  499

Query  1246  FYKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIM--------------------------  1145
              YK  MKR++ +F R   PE  K+ ++L ++ I                           
Sbjct  500   VYKFVMKRKYGKFNRT-DPE--KAGKVLVSDAISNGGGSGGYANGHGANNFNALNSPSSG  556

Query  1144  -----------GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                           I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  
Sbjct  557   DNSDRFLLESGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECS  616

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
             A   KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW++ 
Sbjct  617   AMGNKGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWREL  676

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G+ PLTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK 
Sbjct  677   GYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKN  736

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  737   APDGKYSLETRLAGTFGYLAPEYAATGRVTTK  768


 Score =   152 bits (385),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  682  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  741

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL   L G    L       G    KVDVYAFGVVLMEI+TG++A+D++LPDE  HLVT
Sbjct  742  YSLETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRRALDDSLPDERSHLVT  801

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF + +    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  802  WFRRTLINKENIPKALDQTLEADEETMESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  861

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  862  LVEKWKPSCQEE--EESFGIDVNMSLP  886



>dbj|BAH56604.1| receptor-like kinase [Glycine max]
Length=894

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/732 (52%), Positives = 482/732 (66%), Gaps = 41/732 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L  L+ L
Sbjct  1     MSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASQSLTGTLPSDLNSLSQL  59

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             R+LS+Q NSL+G LPS +N+S L+ +Y + N FSS+ P     L +L+  S+  N  L P
Sbjct  60    RTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQP  119

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-  2087
             W   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP SF ++  
Sbjct  120   WSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANN  179

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLT
Sbjct  180   LETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLT  239

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP+V  LL
Sbjct  240   GVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLL  299

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF+ LT 
Sbjct  300   QIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTD  357

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN LL K +
Sbjct  358   LRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPL  417

Query  1366  ------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                          +  G  G   ++  SS+S      +V++V+  + VVLFV +KC++ +
Sbjct  418   SPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNK  477

Query  1222  EHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTAIKIQVL  1118
                +F R K  E  K    L                           + + G    IQVL
Sbjct  478   LQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVL  537

Query  1117  EKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKV  938
              + TN FSEE++LG GG+GVVY G L +GTK+AVK+M+  A   KG  EF+AEIA LSKV
Sbjct  538   RQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMESVAMGNKGQKEFEAEIALLSKV  597

Query  937   RHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARG  758
             RH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA DVARG
Sbjct  598   RHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIALDVARG  657

Query  757   IEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLA  578
             +EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLA
Sbjct  658   VEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLA  717

Query  577   PEYATTGRVTKK  542
             PEYA TGRVT K
Sbjct  718   PEYAATGRVTTK  729


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  704  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  763

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  764  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  823

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  824  VEQWKPTSHDEEEEDGSGGDLHMSLP  849



>dbj|BAH56606.1| receptor-like kinase [Glycine max]
 dbj|BAH56607.1| receptor-like kinase [Glycine max]
Length=894

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/732 (52%), Positives = 482/732 (66%), Gaps = 41/732 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MS  L +L+P PSGWS +   C W  + CD  + +V SI++ S S++G LPS+L  L+ L
Sbjct  1     MSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASHSLTGTLPSDLNSLSQL  59

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             R+LS+Q NSL+G LPS +N+S L+ +YL+ N FSS+ P     L +L+  S+  N  L P
Sbjct  60    RTLSLQDNSLTGTLPSLSNLSFLQTVYLNRNNFSSVSPTAFASLTSLQTLSLGSNPALQP  119

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-  2087
             W   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP SF ++  
Sbjct  120   WSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANN  179

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLT
Sbjct  180   LETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLT  239

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP+V  LL
Sbjct  240   GVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLL  299

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF+ LT 
Sbjct  300   QIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTD  357

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN LL K +
Sbjct  358   LRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPL  417

Query  1366  ------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                          +  G  G   ++  SS+S      +V++V+  + VVLFV +KC++ +
Sbjct  418   SPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNK  477

Query  1222  EHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTAIKIQVL  1118
                +F R K  E  K    L                           + + G    IQVL
Sbjct  478   LQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVL  537

Query  1117  EKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKV  938
              + TN FSEE++LG GG+GVVY G L +GTK+AVK+M+  A   KG  EF+AEIA LSKV
Sbjct  538   RQVTNNFSEENILGRGGFGVVYKGVLHDGTKIAVKRMESVAMGNKGQKEFEAEIALLSKV  597

Query  937   RHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARG  758
             RH++LVAL+GYCIN ++ LLVYEYM  GTL  HLFEW++HG+ PLTWKQRV IA DVARG
Sbjct  598   RHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIALDVARG  657

Query  757   IEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLA  578
             +EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLA
Sbjct  658   VEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLA  717

Query  577   PEYATTGRVTKK  542
             PEYA TGRVT K
Sbjct  718   PEYAATGRVTTK  729


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  704  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  763

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  764  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  823

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  824  VEQWKPTSHDEEEEDGSGGDLHMSLP  849



>ref|NP_001236710.1| receptor-like kinase RHG4 [Glycine max]
 gb|AAM44275.1| receptor-like kinase RHG4 [Glycine max]
 gb|AAN80746.1| receptor-like kinase RHG4 [Glycine max]
Length=893

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/732 (52%), Positives = 483/732 (66%), Gaps = 41/732 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MS  L +L+P PSGWS +   C W  + CD  + +V SI++ SQS++G LPS+L  L+ L
Sbjct  1     MSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASQSLTGTLPSDLNSLSQL  59

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             R+LS+Q NSL+G LPS +N+S L+ +Y + N FSS+ P     L +L+  S+  N  L P
Sbjct  60    RTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQTLSLGSNPALQP  119

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-  2087
             W   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP SF ++  
Sbjct  120   WSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANN  179

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLT
Sbjct  180   LETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLT  239

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP+V  LL
Sbjct  240   GVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLL  299

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A   GYPI LA+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF+ LT 
Sbjct  300   QIAEAFGYPIRLAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTD  357

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN LL K +
Sbjct  358   LRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPL  417

Query  1366  ------------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                          +  G  G   ++  SS+S      +V++V+  + VVLFV +KC++ +
Sbjct  418   SPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNK  477

Query  1222  EHKRFGRAKSPEKIKSTQMLKT-------------------------NEIMGTAIKIQVL  1118
                +F R K  E  K    L                           + + G    IQVL
Sbjct  478   LQGKFSRVKGHENGKGGFKLDAVHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVL  537

Query  1117  EKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKV  938
             ++ TN FSEE++LG GG+GVVY G+L +GTK+AVK+M+  A   KG+ EF+AEIA LSKV
Sbjct  538   QQVTNNFSEENILGRGGFGVVYKGQLHDGTKIAVKRMESVAMGNKGLKEFEAEIAVLSKV  597

Query  937   RHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARG  758
             RH++LVAL+GYCIN  + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRV IA DVARG
Sbjct  598   RHRHLVALLGYCINGIERLLVYEYMPQGTLTQHLFEWQEQGYVPLTWKQRVVIALDVARG  657

Query  757   IEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLA  578
             +EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLA
Sbjct  658   VEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLA  717

Query  577   PEYATTGRVTKK  542
             PEYA TGRVT K
Sbjct  718   PEYAATGRVTTK  729


 Score =   151 bits (381),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVD+YAFG+VLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  704  SVETRLAGTFGYLAPEYAATGRVTTKVDIYAFGIVLMELITGRKALDDTVPDERSHLVTW  763

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID TL+PDE+T ESI KVAELA HCT  + Y+RP+M H VNVL P 
Sbjct  764  FRRVLINKENIPKAIDQTLNPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLVPL  823

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  +  GG DL MSLP
Sbjct  824  VEQWKPSSHDEEEDGSGG-DLQMSLP  848



>ref|XP_010488452.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=933

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/752 (50%), Positives = 497/752 (66%), Gaps = 57/752 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S  DD A M  L  + +P PS WS +     C W+ V C   +  V SI++  +S++G +
Sbjct  24    SVADDGAAMLALAKSFNPPPSDWSTTTSTGFCQWSGVRCT--SNRVTSISLADKSLAGVI  81

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
               E++ L+ L+++++Q+N L+G +PSFA +SSL+E+Y+D N F  +      GL +L+I 
Sbjct  82    APEISTLSELKTVALQRNRLTGKIPSFAKLSSLQEIYIDENFFLGVETGAFAGLTSLQIL  141

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+SD   ++PW   S L +STSL + +  + +I G +P+ FDSF +LQNLRLSYNN+TG 
Sbjct  142   SLSDCRNITPWGFPSELVDSTSLTTIYLDSTNIFGALPDVFDSFASLQNLRLSYNNITGV  201

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S IQNLW+NNQ  G++GTI+V+SSMT LSQ WLQ N F+GPIPDLSK  NLFD
Sbjct  202   LPPSLSKSSIQNLWINNQLVGMTGTIEVLSSMTSLSQAWLQKNQFSGPIPDLSKSENLFD  261

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-  1757
             LQL DNQLTG+VP +L  L +L+N+   NNKL GP P F   VK +    N FC   PG 
Sbjct  262   LQLRDNQLTGIVPPTLLSLKSLKNVTFDNNKLQGPFPFFPPDVK-LSTKGNVFCTSNPGQ  320

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQVT LLA AGGLGYP  LA+SWKG+DAC  WA+++CD  GKNV T+NLG   F+G 
Sbjct  321   SCSPQVTTLLAVAGGLGYPPMLAESWKGDDACGGWAYVSCDSGGKNVITLNLGKHGFNGF  380

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPA + LTSL+++YLNDNNL+G IP  LT +  LQ++DVSNNNL   +P FP +V  ++
Sbjct  381   ISPAIANLTSLKSVYLNDNNLSGVIPKELTLMTSLQLIDVSNNNLKGEIPKFPASVKFNY  440

Query  1396  G-GNLLLEKTVATGRGSPGSG---------QTENGSSMSARMfvvvvivvvivvlvvlfv  1247
               GN LL  T      +PG+G          +       A + V V++ V++ + ++ FV
Sbjct  441   KPGNSLL-GTKGGDDSTPGTGADTSGGPGGSSGGHGGSKAPVIVGVIVAVLVFLAILGFV  499

Query  1246  FYKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIM--------------------------  1145
              YK  MKR++ +F R   PE  K+ ++L ++ I                           
Sbjct  500   VYKFVMKRKYGKFNRT-DPE--KAGKVLVSDAISNGGGSGGYANGHGANNFNALNSPSSG  556

Query  1144  -----------GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                           I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  
Sbjct  557   DNSDRFLLESGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECS  616

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
             A   KGM+EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW++ 
Sbjct  617   AMGNKGMSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWREL  676

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G+ PLTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK 
Sbjct  677   GYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKN  736

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  737   APDGKYSLETRLAGTFGYLAPEYAATGRVTTK  768


 Score =   152 bits (385),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  682  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  741

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL   L G    L       G    KVDVYAFGVVLMEI+TG++A+D++LPDE  HLVT
Sbjct  742  YSLETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRRALDDSLPDERSHLVT  801

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF + +    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  802  WFRRTLINKENIPKALDQTLEADEETMESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  861

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  862  LVEKWKPSCQEE--EESFGIDVNMSLP  886



>gb|ACM89489.1| receptor-like kinase [Glycine max]
Length=854

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/700 (53%), Positives = 462/700 (66%), Gaps = 17/700 (2%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MS  L +L+P PSGWS +   C W  + CD  + +V SI++ S S++G LPS+L  L+ L
Sbjct  1     MSNFLKSLTPPPSGWSETTPFCQWKGIQCDS-SSHVTSISLASHSLTGTLPSDLNSLSQL  59

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             R+LS+Q NSL+G LPS +N+S L+ +YL+ N FSS+ P     L +L+  S+  N  L P
Sbjct  60    RTLSLQDNSLTGTLPSLSNLSFLQTVYLNRNNFSSVSPTAFASLTSLQTLSLGSNPALQP  119

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-  2087
             W   + L  S++L     +  S+TG +P+ FD FP+LQ+LRLSYNNLTG+LP SF ++  
Sbjct  120   WSFPTDLTSSSNLIDLDLATVSLTGPLPDIFDKFPSLQHLRLSYNNLTGNLPSSFSAANN  179

Query  2086  IqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             ++ LWLNNQ  GLSGT+ V+S+M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLT
Sbjct  180   LETLWLNNQAAGLSGTLLVLSNMSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLT  239

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALL  1727
             GVVP SLT LP+L+ + L NN+L GP+P+FG  V V L   NSFC DTPG CDP+V  LL
Sbjct  240   GVVPASLTSLPSLKKVSLDNNELQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLL  299

Query  1726  AFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
               A   GYPI  A+SWKGND C  W ++ C   GK + TVN   Q   GTISPAF+ LT 
Sbjct  300   QIAEAFGYPIRSAESWKGNDPCDGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTD  357

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             LR L+LN NNL G IP SL TLP LQ LDVS+NNLS  +P FPP V +   GN LL    
Sbjct  358   LRTLFLNGNNLIGSIPDSLITLPQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALL----  413

Query  1366  ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKRE--HKRFGRAKS  1193
                 G P S       +  +                 +   +    K +  H   G    
Sbjct  414   ----GKPLSPGGGPSGTTPSGSSTGGSGGESSKGNSSVSPGWIAGFKLDAVHVSNGYGGV  469

Query  1192  PEKIKSTQMLKTNEIM---GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKV  1022
             P +++S      +++    G    IQVL + TN FSEE++LG GG+GVVY G L +GTK+
Sbjct  470   PVELQSQSSGDRSDLHALDGPTFSIQVLRQVTNNFSEENILGRGGFGVVYKGVLHDGTKI  529

Query  1021  AVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGH  842
             AVK+M+  A   KG  EF+AEIA LSKVRH++LVAL+GYCIN ++ LLVYEYM  GTL  
Sbjct  530   AVKRMESVAMGNKGQKEFEAEIALLSKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQ  589

Query  841   HLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKV  662
             HLFEW++HG+ PLTWKQRV IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKV
Sbjct  590   HLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKV  649

Query  661   ADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             ADFGLVK APD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  650   ADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTK  689


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  664  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  723

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  724  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  783

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  784  VEQWKPTSHDEEEEDGSGGDLHMSLP  809



>gb|KDP32592.1| hypothetical protein JCGZ_13142 [Jatropha curcas]
Length=917

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/746 (53%), Positives = 490/746 (66%), Gaps = 46/746 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISG  2480
             S S  DD AV+ KL  +LSP PSGWS +     C+W+ + C+  +  V SI++ +Q + G
Sbjct  13    STSAADDGAVVLKLAGSLSPLPSGWSTTSSSGFCSWSGIKCE--SNRVTSISLPNQDLDG  70

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              LP EL+ L  L++L++Q N L+G LP  AN+S+L  ++LD N F+SIP  F  GL +L+
Sbjct  71    TLPPELSTLTQLKTLALQNNRLAGDLPLLANLSNLASIFLDFNNFTSIPSGFFKGLTSLQ  130

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
               S+ +N  L+PWQ+ + LAE T+L +  A+ A+I G IP+ F S  +LQNLRLSYNNLT
Sbjct  131   ELSLGNNVNLAPWQLPADLAELTALKNITANQANIYGSIPDIFGSLISLQNLRLSYNNLT  190

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             GSLP S  +S IQNLWLNNQQ GLSGTIDV+S MT+LSQVWLQ N FTGPIPDLSKC NL
Sbjct  191   GSLPQSLANSNIQNLWLNNQQMGLSGTIDVLSKMTQLSQVWLQKNQFTGPIPDLSKCDNL  250

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
             FDLQL DNQ TGVVP SL  LP L NI L NNKL GP P F + VKV     N++C  + 
Sbjct  251   FDLQLRDNQFTGVVPTSLASLPKLLNISLSNNKLQGPSPAFSSSVKVSNDGKNNYCTVSG  310

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
               CD QVT LL  A G GYP+ L+  W GNDAC  W F+ CDPQ K V TVNL  Q  +G
Sbjct  311   KACDLQVTLLLEVAEGFGYPVKLSDDWVGNDACSGWDFVNCDPQDK-VITVNLAKQGLTG  369

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN-I  1403
             TISPAF+ LTSL+NLYLN NNL G IP SLT L  LQ LDVS NNLS  +P F  +V  I
Sbjct  370   TISPAFANLTSLKNLYLNGNNLNGTIPTSLTQLTQLQTLDVSGNNLSGKVPVFRTSVKLI  429

Query  1402  SFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-----  1238
             +  GN LL K + TG G PGS  T   +   +           I   ++  +        
Sbjct  430   TKPGNSLLGKDINTG-GGPGSSDTSGSAPSGSTSPSGSGKGSGISGGIIAGIVIAIVIFV  488

Query  1237  -------CYMKREHKRFGRAKSPEKIKS-----------------TQM----------LK  1160
                    C  K+   R+G  +  E +KS                 T++           K
Sbjct  489   AVLTFVLCKYKKRRGRYGNMEKEESVKSNGKNEGPSGVNGYNGLPTELHSQSSGGDSGHK  548

Query  1159  TNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKG  980
               E     + I+VL + T+ FSE +++G GG+GVVY G+L +GTK+AVK+M+     TKG
Sbjct  549   MFEGGNVVVSIEVLRQVTDNFSESNIIGRGGFGVVYKGELHDGTKIAVKRMESTVMGTKG  608

Query  979   MNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLT  800
             MNEFQAEIA LSKVRH++LVAL+GYC+N  + LLVYEYM  GTLG HLFEW++HG+ PLT
Sbjct  609   MNEFQAEIAVLSKVRHRHLVALLGYCVNGRERLLVYEYMPRGTLGQHLFEWQEHGYPPLT  668

Query  799   WKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKS  620
             WKQRVTIA DVARG+EYLHSL  QSFIHRD+K +NILL DD+RAKVADFGLV+ APD K 
Sbjct  669   WKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPTNILLGDDMRAKVADFGLVRNAPDGKY  728

Query  619   FVETRVAGTFGYLAPEYATTGRVTKK  542
              VETR+AGTFGYLAPEYA TGRVT K
Sbjct  729   SVETRLAGTFGYLAPEYAATGRVTTK  754


 Score =   141 bits (356),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA++++L DE  HLV+W
Sbjct  729  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMITGRKALEDSLGDEKSHLVSW  788

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+  AID TL+ DE+T  SI +VAELA HCT  + Y+RP+M H VNVLGP 
Sbjct  789  FRRVLINKDNIPMAIDRTLNLDEETLASIYRVAELAGHCTAREPYQRPDMGHAVNVLGPL  848

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               WR    EE  ++  G DL++SLP
Sbjct  849  VEQWRPTSREE--DEGYGIDLHLSLP  872



>ref|XP_010466732.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=931

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/752 (50%), Positives = 498/752 (66%), Gaps = 56/752 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDP--CTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S  DD A M  L  + +P PS WS +     C W+ V C   +  V SI++  +S++G +
Sbjct  21    SVADDGAAMLALAKSFNPPPSDWSTTTSTGFCQWSGVRCT--SNRVTSISLADKSLAGVI  78

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
               E++ L+ L++L++Q+N L+G +PSFA +SSL+E+Y+D N F  +      GL +L+I 
Sbjct  79    APEISTLSELKTLALQRNRLTGKIPSFAKLSSLQEIYIDENFFLGVETGAFAGLTSLQIL  138

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+SD   ++PW   S L +STSL + +  + +I G +P+ FDSF +LQNLRLSYNN+TG 
Sbjct  139   SLSDCRNITPWGFPSELVDSTSLTTIYLDSTNIFGALPDVFDSFASLQNLRLSYNNITGV  198

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S IQNLW+NNQ  G++GTI+V+SSMT LSQ WLQ N F+GPIPDLSK  NLFD
Sbjct  199   LPPSLSKSSIQNLWINNQLMGMTGTIEVLSSMTSLSQAWLQKNQFSGPIPDLSKSENLFD  258

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-  1757
             LQL DN LTG+VP +L  L +L+N+   NNKL GP P F   VK +    N FC   PG 
Sbjct  259   LQLRDNALTGIVPPTLLSLGSLKNVTFDNNKLQGPFPFFPPDVK-LSTKGNVFCTSVPGQ  317

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQVT LLA AGGLGYP  LA+SWKG+DAC  WA+++CD  GKNV T+NLG   F+G 
Sbjct  318   SCSPQVTTLLAVAGGLGYPPMLAESWKGDDACSGWAYVSCDSGGKNVITLNLGKHGFNGF  377

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPA + LTSL+++YLNDNNL+G IP  LT +  LQ++DVSNNNL   +P FP +V  ++
Sbjct  378   ISPAIANLTSLKSVYLNDNNLSGVIPKELTLMTSLQLIDVSNNNLKGEIPKFPASVKFNY  437

Query  1396  G-GNLLL------EKTVATGRGSPGSGQTENGSSMSAR--MfvvvvivvvivvlvvlfvF  1244
               GN LL      + T  TG  + G     +G    ++  + V V++ V++ + ++ FV 
Sbjct  438   KPGNSLLGTKGGDDSTHGTGADTSGGSGGSSGGHGGSKAPVIVGVIVAVLVFLAILGFVV  497

Query  1243  YKCYMKREHKRFGRAKSPEKIKSTQMLKTN------------------------------  1154
             YK  MKR++ +F R   PE  K+ ++L ++                              
Sbjct  498   YKFVMKRKYGKFNRT-DPE--KAGKILVSDAAISNGGGSGGYANGNGANNFNALNSPSSG  554

Query  1153  --------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                     E     I ++VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  
Sbjct  555   DNSDRFLLESGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECS  614

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
             A   KG++EFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFEW++ 
Sbjct  615   AMGNKGLSEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEWREL  674

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G+ PLTWKQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK 
Sbjct  675   GYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKN  734

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  735   APDGKYSLETRLAGTFGYLAPEYAATGRVTTK  766


 Score =   152 bits (385),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 118/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  680  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  739

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL   L G    L       G    KVDVYAFGVVLMEI+TG++A+D++LPDE  HLVT
Sbjct  740  YSLETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRRALDDSLPDERSHLVT  799

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF + +    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  800  WFRRTLINKENIPKALDQTLEADEETMESIHRVAELAGHCTAREPQQRPDMGHAVNVLGP  859

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  860  LVEKWKPSCQEE--EESFGIDVNMSLP  884



>gb|KFK39671.1| hypothetical protein AALP_AA3G274200 [Arabis alpina]
Length=921

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/745 (50%), Positives = 488/745 (66%), Gaps = 46/745 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S S  DD   M  L  +  P PS WS + D C W+ + C   +G V SI++  +S+SG L
Sbjct  18    STSLADDGPAMLALAKSFLPPPSDWSTT-DHCKWSGIRCT--SGRVTSISLADKSLSGGL  74

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
               E++ L+ L+S+S+Q+N LSG +PS A +SSL+E+Y+D N F+ +      GL +L+I 
Sbjct  75    SPEISTLSELKSISIQRNKLSGTIPSLAKLSSLQEIYVDDNLFTGVATGAFAGLTSLQIL  134

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+SDN  L+ W   S L +STSL   +  N +++G +P+ FDSF +LQ+LRLSYN++TG+
Sbjct  135   SLSDNLNLTAWSFPSELVDSTSLTKIYLDNTNVSGTLPDIFDSFASLQDLRLSYNDITGA  194

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP S   S IQNLW+NNQ  G++GTIDV+S M  LSQ WL  N F GPIPDLSK  NLFD
Sbjct  195   LPPSLAKSSIQNLWINNQITGMTGTIDVLSGMASLSQAWLHKNQFAGPIPDLSKSENLFD  254

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-  1757
             LQL DN LTG+VP +L  L +L+N+ L NNK  GP+PLF  +VKV  G  N+FC D  G 
Sbjct  255   LQLRDNLLTGIVPPTLLTLGSLKNVSLDNNKFQGPLPLFPPEVKVSFG-KNAFCTDKAGQ  313

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQV  LL  AGGLGYP  L++SW+G+DAC  WA++TCD   KNV T+NL    F G 
Sbjct  314   SCSPQVMTLLEVAGGLGYPSMLSESWQGDDACSGWAYVTCDSARKNVITLNLAKHGFVGF  373

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISPA + LTSL+++YLNDN LTG IP  LT +  LQ++DVSNNNLS  +P FP +V  + 
Sbjct  374   ISPAIANLTSLKSVYLNDNKLTGVIPKELTFMTSLQLIDVSNNNLSGEIPKFPASVKFNH  433

Query  1396  G-GNLLLEKTVATGR-----GSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
               GN LL   V          + G G + +     A + + V++ V++ + ++ FV YK 
Sbjct  434   NPGNSLLGTNVGDSSTPGAGSNGGPGGSSSHGGSKAPVIIGVLVAVLVFLAILGFVVYKF  493

Query  1234  YMKREHKRFGRAKSPEKIKSTQMLKTNE--------------------------------  1151
              MKR++ +F R   PEK     +                                     
Sbjct  494   VMKRKYGKFMRT-DPEKAGKIMVSDAGSNGNGGGYGNGHGVNNFNALNSPSSGDSSDRFL  552

Query  1150  IMGTAIKI--QVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
             + G ++ I  +VL + TN FSE+++LG GG+GVVY G+L +GTK AVK+M+  A   KGM
Sbjct  553   LEGGSVTIPMEVLRQVTNNFSEKNILGRGGFGVVYAGELHDGTKTAVKRMECSAMGNKGM  612

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
             NEFQAEIA L+KVRH++LVAL+GYC+N ++ LLVYEYM  G LG HLFE+ + G+ PLTW
Sbjct  613   NEFQAEIAVLTKVRHRHLVALLGYCVNGNERLLVYEYMPQGNLGQHLFEYGELGYSPLTW  672

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
             KQRV+IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K  
Sbjct  673   KQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYS  732

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  733   LETRLAGTFGYLAPEYAATGRVTTK  757


 Score =   154 bits (389),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 119/207 (57%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + +SI +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  671  TWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  730

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             SL   L G    L       G    KVDVYAFGVVLMEIITG+KA+D++LPDE  HLVT
Sbjct  731  YSLETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDDSLPDERSHLVT  790

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KA+D TL+ DE+T ESI +VAELA HCT  +  +RP+M H VNVLGP
Sbjct  791  WFRRMLINKDNIPKALDQTLEQDEETLESIYRVAELAGHCTAREPQQRPDMGHAVNVLGP  850

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G D+NMSLP
Sbjct  851  LVEKWKPSCQEE--EESFGIDVNMSLP  875



>ref|XP_006382755.1| hypothetical protein POPTR_0005s05100g [Populus trichocarpa]
 gb|ERP60552.1| hypothetical protein POPTR_0005s05100g [Populus trichocarpa]
Length=908

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/726 (52%), Positives = 479/726 (66%), Gaps = 27/726 (4%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWS--ASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
              DD + + KL ++++P PSGWS  +S   C+W  + CD     V SI++   SISG LP 
Sbjct  22    ADDGSAIIKLASSITPLPSGWSTKSSTGFCSWRGIKCDSSNTRVTSISLSKLSISGTLPP  81

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             E++ L+ L+SL+ Q N LSG +PS AN+++L+ + LDSN F+SI P FL GL +L+  S+
Sbjct  82    EISTLSELQSLTFQDNQLSGAIPSLANLTNLQIILLDSNNFTSISPGFLQGLTSLQTLSV  141

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
              DN  L PW + + L + TSL +  A + ++ G IP+ F S P+LQNLRLSYNN TG+LP
Sbjct  142   GDNVNLFPWILPTDLEQCTSLTTLTAKDCNLFGSIPDVFGSLPSLQNLRLSYNNFTGALP  201

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SF +S IQNLWLNNQQ GL+G+I+VI SMT+L+QVWL  N FTGPIPDL++C ++FDLQ
Sbjct  202   PSFANSGIQNLWLNNQQNGLTGSIEVIGSMTQLAQVWLHKNEFTGPIPDLTECKSIFDLQ  261

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGPC  1751
             L DNQL+G+VP SL  LP L N+ L NNK  GP+P F   V  +  D  N +C      C
Sbjct  262   LRDNQLSGIVPASLVSLPKLVNVSLSNNKFQGPVPQFPPSVTKVDNDGNNKYCAPPGVSC  321

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             D QV  LL  AGG GYP  L+  W  N+AC  WAF+TCD   KNV TVNL  Q F G IS
Sbjct  322   DAQVMTLLGIAGGFGYPSILSDGWDDNNAC-GWAFVTCDVDKKNVVTVNLAKQHFPGRIS  380

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN-ISFG  1394
              +F+ LTSL+NLYLNDNNLTG IP SL  LP L   DVSNNNLS  +P+FP +V  I+  
Sbjct  381   SSFANLTSLKNLYLNDNNLTGSIPDSLIKLPELVTFDVSNNNLSGKIPNFPASVKFITKP  440

Query  1393  GNLLLEKTVATGRGSPGS---GQTENGSSMSARMfvvvvivvvivvlvvlfvFY------  1241
             GN  L   V TG G+  S   G T+    M A + V  VI + ++ +V+           
Sbjct  441   GNPFLGTKVDTGGGTTTSSDVGTTKKSGGMIASIIVAAVIFIAVLSIVLYKYRKRPRKYK  500

Query  1240  --------KCYMKREHKRFGRAKSPEKIKSTQMLKTN-----EIMGTAIKIQVLEKATNF  1100
                     K          G  +   ++ S   +  N     E    A+ I+V+ +AT+ 
Sbjct  501   KKVGWDSGKALFNNGVAGGGYNEVSIELSSQSSVGENGKNIFEDGNVALPIEVIRQATDN  560

Query  1099  FseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLV  920
             F E ++ G GG+GVVY G+L +GTK+AVK+M+     TKGM+EFQAEIA L+KVRH++LV
Sbjct  561   FHEINITGRGGFGVVYRGELHDGTKIAVKRMESTVMGTKGMSEFQAEIAVLTKVRHRHLV  620

Query  919   ALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHS  740
             AL+GYCIN ++ LLVYEYM  GTLG HLFE   +G+ PLTWKQR+TIA DVARG+EYLHS
Sbjct  621   ALLGYCINGNERLLVYEYMPQGTLGQHLFECHDYGYTPLTWKQRITIALDVARGVEYLHS  680

Query  739   LTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATT  560
             L  QSFIHRD+K SNILL D +RAKVADFGLVK APD K  VETR+AGTFGYLAPEYA T
Sbjct  681   LAQQSFIHRDLKPSNILLGDSMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAAT  740

Query  559   GRVTKK  542
             GRVT K
Sbjct  741   GRVTTK  746


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 104/186 (56%), Gaps = 10/186 (5%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  660  TWKQRITIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDSMRAKVADFGLVKNAPDGK  719

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+K +D+++PDE  HLV 
Sbjct  720  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKTLDDSMPDEEAHLVP  779

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KAID +L+PDE+T  +I  V+ELA HCT  + ++RP+M H VN+L P
Sbjct  780  WFRRILMTKENIPKAIDESLNPDEETLATIYTVSELAGHCTAREPHQRPDMGHAVNILAP  839

Query  261  FAHNWR  244
                WR
Sbjct  840  LVEQWR  845



>ref|XP_010532727.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=931

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/747 (52%), Positives = 488/747 (65%), Gaps = 54/747 (7%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             DD A M  +  A  P PSGWS+  S   C W  V C+   G V S+++  +S+SG +  E
Sbjct  27    DDGAAMLAIAKAFQPPPSGWSSTSSNGYCRWPGVVCNS-GGGVTSLSLADKSLSGEISPE  85

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             ++ L+ L+S   Q+N LSG +PSFA +SSL+E+ LD N F+ +      GL +L+  S+S
Sbjct  86    ISSLSELKSAFFQRNKLSGQIPSFAKLSSLQEISLDKNLFNGVAAGAFGGLTSLQTLSMS  145

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             DN  L+ W     L +S SL + +  N +I G +P+ FDSF +LQNLRLSYNN+TG LP 
Sbjct  146   DNQNLTSWIFPVELTDSASLTTIYLDNTNIFGTLPDIFDSFSSLQNLRLSYNNITGPLPP  205

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             S   S IQN W+NNQ  G+SGTIDV+SSM+ L QVWL  N FTGPIPDLSKC  LFDLQL
Sbjct  206   SLAKSSIQNFWINNQMSGISGTIDVLSSMSSLVQVWLHKNQFTGPIPDLSKCEGLFDLQL  265

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCD  1748
              DNQLTG+VP SL  + +L+N+ L NNKL GP+P F   VKV L D N FC    G  C 
Sbjct  266   RDNQLTGIVPPSLGSIGSLKNVSLDNNKLQGPVPSFAPDVKVTL-DNNDFCNSKAGQSCS  324

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             PQVT LL  AGG G+P  LA +W+G+DAC  WA++TCD  G+ + T+NLG   F G ISP
Sbjct  325   PQVTTLLEVAGGFGFPAMLADTWQGDDAC-GWAYVTCDSSGR-IITLNLGKHGFVGIISP  382

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG-G  1391
             A + LTSL+NL LNDNNLTG IP  LT +P LQ LDVSNNNL+  +P FP +V   +  G
Sbjct  383   AIANLTSLKNLLLNDNNLTGSIPKGLTFIPTLQSLDVSNNNLTGDIPQFPSSVKFVYKPG  442

Query  1390  NLLL----EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
             N LL    + +  +G G    G  +  S     + V VVI +++ + ++ FV YK  MKR
Sbjct  443   NALLGTDVDNSSTSGSGHNSGGNADGSSGGKTPVIVGVVIAILVFLAIMCFVVYKFIMKR  502

Query  1222  EHKRFGRAKSPEKIKSTQMLKT----------NEIMGT----------------------  1139
             ++ +FGR   PE +   +ML              + GT                      
Sbjct  503   KYGKFGRMD-PE-MAGKEMLSNAISAGSTSSGGAVRGTNGYGISNFNGLNSPSSGDNSDR  560

Query  1138  --------AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                      I ++VL + T+ FSEE+VLG GG+GVVY G+L +GTK+AVK+M+     TK
Sbjct  561   YILEGGNVTISMEVLRQVTHNFSEENVLGRGGFGVVYKGELHDGTKIAVKRMESSTVGTK  620

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             GMNEFQAEIA L+KVRH++LVAL+GYCIN ++ LLVYEYM  GTLG HLFEW++ G+ PL
Sbjct  621   GMNEFQAEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLGQHLFEWRELGYPPL  680

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TWKQRVTIA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD K
Sbjct  681   TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  740

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
               VETR+AGTFGYLAPEYA TGRVT K
Sbjct  741   YSVETRLAGTFGYLAPEYAATGRVTTK  767


 Score =   153 bits (386),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  681  TWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  740

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D++LPDE  HLVT
Sbjct  741  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEMITGRKALDDSLPDERSHLVT  800

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +I+    N+ KA+D TL+PDE+T  SI +V+ELA HCT  + ++RP+M H VNVLGP
Sbjct  801  WFRRILINKENVPKALDETLEPDEETMASIYRVSELAGHCTAREPHQRPDMGHAVNVLGP  860

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  861  LVEQWKPSSQEE--EESFGIDLHMSLP  885



>ref|XP_006830550.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
 gb|ERM97966.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
Length=922

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/756 (49%), Positives = 485/756 (64%), Gaps = 60/756 (8%)
 Frame = -2

Query  2650  VSFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             ++   D+  M  L  A++P  + GW+ S DPC W NV+C    G V +I +  Q++ G L
Sbjct  15    IAMASDSTAMLDLAKAINPVANLGWTGS-DPCNWKNVDCTN--GRVTAIRLPGQNLKGTL  71

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PS +  L+ L  L++Q NSLSGPLPSF+ MSSL+ LYLD N+FSSIP DF  GL +L+  
Sbjct  72    PSSINSLSMLSILTLQGNSLSGPLPSFSGMSSLQTLYLDGNQFSSIPGDFFRGLTSLQNV  131

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+ DN     W + S LA +  L  F ASNASI G IP +F    +L+++RLSYNNLTG 
Sbjct  132   SLDDN-PFEQWLLPSDLASADGLVLFSASNASIGGSIPEYFGGLQSLESIRLSYNNLTGG  190

Query  2113  LPGSFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             LP SF  S ++NL   N +   LSG+I V+ +MT L+QVWLQ N F+G IPDLS C +LF
Sbjct  191   LPASFDKSSLKNLWLNNQRGPMLSGSIMVLGNMTFLTQVWLQTNGFSGSIPDLSGCKSLF  250

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG  1757
             DLQL DN LTG+VP SL  L +L N+ L+NNKL GP P F + +KV  G  N FC+  PG
Sbjct  251   DLQLRDNALTGLVPSSLMELQSLMNVSLRNNKLQGPYPQFKDGIKVDNGKLNDFCRYDPG  310

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
              PCD +V  LL  A G GYP  +A +W  ND C NW ++TCDPQ KN+T +N  N + SG
Sbjct  311   VPCDDRVMVLLEIAAGFGYPAAVADAWSDNDPCSNWLYVTCDPQKKNITVLNFANAKLSG  370

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP+  +L+SLR+L L++NNLTG IP  L ++P+LQ +DV NN+L   +P+F   V + 
Sbjct  371   TISPSIGKLSSLRSLILSNNNLTGKIPDVLASMPNLQSVDVENNDLFGEVPNFRKEVTLK  430

Query  1399  FGGNLLLEKTVATGR-----------------GSPGSGQTENGSSMSARMfvvvvivvvi  1271
               GN LL  T A GR                 G P +     GS     + V V + + +
Sbjct  431   TDGNPLLGTTPAPGRGGSGSGSSGGSNSTTPSGMPTTSSI-TGSGSPTGVIVGVAVGLAV  489

Query  1270  vvlvvlfvFYKCYMKREHKRFGRAKSPEKI-------KSTQMLK----------------  1160
             ++L+ + V Y C  K+ H++F R ++P  +          Q +K                
Sbjct  490   LMLIGVGVIY-CVRKKRHQKFRRVQNPPSLLNGGSVPSDLQSIKVELSSLNGNGNASEQH  548

Query  1159  ----TNEIMGTA------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                 +   MG A      I IQVL   TN FSEE++LG GG+GVVY G+L +GTK+AVK+
Sbjct  549   SRASSGPHMGEAAGGSMVISIQVLRLVTNNFSEENILGKGGFGVVYKGELHDGTKIAVKR  608

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ G    KGMNEFQAEI  L+KVRH++LVAL+GYC+  ++ LLVYEYM  GTLG HLF+
Sbjct  609   MEAGVMG-KGMNEFQAEIGVLTKVRHRHLVALLGYCVEGNERLLVYEYMPQGTLGQHLFD  667

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             + ++G+ PL+WKQR+TIA DVARG+EYLHSL  +SFIHRD+K SN+LL DD+RAKV+DFG
Sbjct  668   YAQNGYPPLSWKQRLTIALDVARGVEYLHSLAQKSFIHRDLKPSNVLLGDDMRAKVSDFG  727

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LVK APD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  728   LVKLAPDGKYSVETRLAGTFGYLAPEYAVTGRVTTK  763


 Score =   135 bits (340),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 2/149 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV+AFGV+LME+ITG++A+DE+ P+++ HLVTW
Sbjct  738  SVETRLAGTFGYLAPEYAVTGRVTTKVDVFAFGVILMELITGRRALDESQPEDSMHLVTW  797

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++I     + K IDP +D DE+T++SI  VAELA HCT  + ++RP+M H VNVL P 
Sbjct  798  FRRVIANKEKIGKVIDPVIDLDEETYKSICTVAELAGHCTAREPHQRPDMGHAVNVLSPL  857

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
               W+    E+  E   G DL+M L  V 
Sbjct  858  VQQWKPTSTED--EDCFGIDLDMPLAQVL  884



>gb|KCW59923.1| hypothetical protein EUGRSUZ_H02647 [Eucalyptus grandis]
Length=890

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/734 (53%), Positives = 488/734 (66%), Gaps = 47/734 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             MSK+L AL P  SGWS+S+  C W  V+CD  +  V  IN+ S S+SG LPS+L+ L+ L
Sbjct  1     MSKILVALKP--SGWSSSQACCNWKGVSCDS-SSRVTGINLPSSSLSGALPSDLSFLSHL  57

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +++S+  N LSG +PSFA ++SL+ LYL++N F+SI      GL +L+  ++S+N  L+P
Sbjct  58    QTISLHNNLLSGAVPSFAGVASLQTLYLNNNNFTSITSGAFQGLTSLQTLNLSNNLCLAP  117

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             WQI   L  STSL + +A+NA+I G IP+F  S P+L NLR+SYNNLTG LP SFG+S I
Sbjct  118   WQIPLELNASTSLVTLYATNANIVGPIPDFLGSLPSLVNLRISYNNLTGPLPSSFGTSGI  177

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             + L LNNQ  GLSG I V++ MT+L  VWL+ N FTGPIPDLS+C NLFDLQL DNQ TG
Sbjct  178   KILCLNNQAMGLSGGISVLAGMTQLRLVWLENNQFTGPIPDLSQCTNLFDLQLRDNQFTG  237

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             VVP SL  LP+L+N+ L NNKL GP+P   + + +  G TNSFC   PGPCDPQVT LL 
Sbjct  238   VVPASLLALPSLKNVSLDNNKLQGPVPSNRSGIDITYGGTNSFCNSAPGPCDPQVTKLLQ  297

Query  1723  FAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTS  1547
              A  LGYPITLA SW GNDAC  +W+ I+C  QGK VT V    + FSGTISPAF+ LT 
Sbjct  298   VASALGYPITLADSWTGNDACHGSWSAISC--QGKKVTAVTFSKRGFSGTISPAFADLTL  355

Query  1546  LRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV  1367
             L  L LNDNNLTG IP SLTTL  LQVLDVSNNNLS  +P FP ++ ++  GN L+    
Sbjct  356   LDTLLLNDNNLTGSIPDSLTTLTQLQVLDVSNNNLSGLIPVFPASMKLTTTGNPLIGGGG  415

Query  1366  ATGRGSPGSGQTENGSSMSARMf-vvvvivvvivvlvvlfvFYKC-YMKREHKRFGRAKS  1193
              +  G   S    NGSS SA +   VV+I ++I + VV+  FYK  Y+   H+   R  +
Sbjct  416   GSIDGG--SPGRSNGSSRSAGVIFAVVIIGILIFIGVVVVGFYKYHYIIPRHRNVNRVDN  473

Query  1192  P-----------EKIKSTQMLKTNEIMG----------------TAIKIQVLEKATNFFs  1094
             P               +     ++E+ G                  I I+ L +ATN FS
Sbjct  474   PGIGMEVANNGAGNGMNGYGGVSSELHGQNRGDHSDFPVFNQGNVKIPIKDLRQATNNFS  533

Query  1093  eesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK----------GMNEFQAEIAFLS  944
             EE+ LGSGG+GVVY G+L +GTK+AVK+M   A  TK           M  F+AEIA L+
Sbjct  534   EENKLGSGGFGVVYKGELPDGTKIAVKRMNPEAKDTKRMKGIQTEILRMKGFKAEIAVLT  593

Query  943   KVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVA  764
             KVRH++LV L+GYCI  H+ LLVYEYM  GTL  HLFE ++ G+ PLTWKQR+TIA DVA
Sbjct  594   KVRHRHLVMLLGYCIKGHERLLVYEYMPQGTLAQHLFEGQEKGYAPLTWKQRMTIALDVA  653

Query  763   RGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGY  584
             RG+EYLHSL  Q FIHRD+K  NILL DD+RAKVADFGLVK  PD K  VET++AGTFGY
Sbjct  654   RGVEYLHSLAQQKFIHRDLKPENILLGDDMRAKVADFGLVKHVPDGKHSVETQLAGTFGY  713

Query  583   LAPEYATTGRVTKK  542
             LAPEY  TG+VT K
Sbjct  714   LAPEYVATGKVTTK  727


 Score =   149 bits (377),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 131/235 (56%), Gaps = 20/235 (9%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K +    
Sbjct  641  TWKQRMTIALDVARGVEYLHSLAQQKFIHRDLKPENILLGDDMRAKVADFGLVKHVPDGK  700

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+  +L G    L    +  G+   KVDVYAFGVVLMEIITG+KA+D T+  E   LV 
Sbjct  701  HSVETQLAGTFGYLAPEYVATGKVTTKVDVYAFGVVLMEIITGRKALDNTVSVERVQLVA  760

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N++KAID TLDPDE+T ESI KVAELA HCT  + ++RP+M+H VN+LGP
Sbjct  761  WFRRVLINKENIRKAIDQTLDPDEETLESIIKVAELAGHCTAREPFQRPDMDHAVNILGP  820

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLPLVFD--------DSSIESLSFTNAQHRL  121
                W+    +E  E+  G +L+M+LP             S   ++SF+N Q  +
Sbjct  821  AVEQWKPTSHDE--EESSGVNLHMNLPQALQRWQADEGTSSMFNTMSFSNTQSSI  873



>ref|XP_003629623.1| Receptor-like kinase [Medicago truncatula]
 gb|AET04099.1| LRR receptor-like kinase [Medicago truncatula]
Length=916

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/737 (49%), Positives = 470/737 (64%), Gaps = 41/737 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD  VM  L  +L P+P+GWS++   C W+ V C      V SIN+  Q ++G LP  L 
Sbjct  21    DDGTVMQSLRQSLKPSPNGWSSNTSFCQWSGVKCSSDN-RVTSINLSDQKLAGTLPDNLN  79

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L +L +Q N+LSGPLPS AN+SSL ++ L SN FSS+ P    GL +L+  S+ +N
Sbjct  80    SLTQLTTLYLQNNALSGPLPSLANLSSLTDVNLGSNNFSSVTPGAFSGLNSLQTLSLGEN  139

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               LSPW   + L +S++L S   + A I G +P+ F SF +L  L L+YNNL+G LP S 
Sbjct  140   INLSPWTFPTELTQSSNLNSIDINQAKINGTLPDIFGSFSSLNTLHLAYNNLSGGLPNSL  199

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
               S IQ+ W+NN   GL+G+I VIS+MT L+QVWL  N FTGPIPDLS+C ++ DLQL D
Sbjct  200   AGSGIQSFWINNNLPGLTGSITVISNMTLLTQVWLHVNKFTGPIPDLSQCNSIKDLQLRD  259

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDT--NSFCKDTPG-PCD  1748
             NQLTGVVP SL  +  L+N+ L+NN+L GP+P+FG  VK    D   N+FC +    PCD
Sbjct  260   NQLTGVVPDSLVSMSGLQNVTLRNNQLQGPVPVFGKDVKYNSDDISHNNFCNNNASVPCD  319

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
              +V  LL   GG GYPI  A+SW GND C++W  + C   G  +T +N   Q   GTISP
Sbjct  320   ARVMDLLHIVGGFGYPIQFAKSWTGNDPCKDWLCVICG--GGKITKLNFAKQGLQGTISP  377

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LT L  LYLN NNLTG IP +L TL  L+ LDVSNN+LS  +P F P V     GN
Sbjct  378   AFANLTDLTALYLNGNNLTGSIPQNLATLSQLETLDVSNNDLSGEVPKFSPKVKFITDGN  437

Query  1387  LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfv-----FYKCYMKR  1223
             + L K    G      G +  GS   A M  V +I+++++++V   V      +KCY ++
Sbjct  438   VWLGKNHGGGAPGSAPGGSPAGSGKGASMKKVWIIIIIVLIVVGFVVGGAWFSWKCYSRK  497

Query  1222  EHKRFGRAKSPE----------------------KIKSTQMLKTNEIMG--------TAI  1133
               +RF R  +PE                      +++S      +++ G          I
Sbjct  498   GLRRFARVGNPENGEGNVKLDLASVSNGYGGASSELQSQSSGDHSDLHGFDGGNGGNATI  557

Query  1132  KIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIA  953
              I VL + TN FS++++LG GG+G+VY G+L +GTK+AVK+M   A  +KG+NEFQAEI 
Sbjct  558   SIHVLRQVTNDFSDDNILGRGGFGIVYKGELPDGTKIAVKRMISVAKGSKGLNEFQAEIG  617

Query  952   FLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAW  773
              L+KVRH++LVAL+GYCIN ++ LLVYE+M  GTL  HLFE ++HG+ PLTWKQR+ IA 
Sbjct  618   VLTKVRHRHLVALLGYCINGNERLLVYEHMPQGTLTQHLFECREHGYTPLTWKQRLIIAL  677

Query  772   DVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGT  593
             DV RG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADFGLVK APD    VET++AGT
Sbjct  678   DVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGNYSVETKLAGT  737

Query  592   FGYLAPEYATTGRVTKK  542
             FGYLAPEYA TGRVT K
Sbjct  738   FGYLAPEYAATGRVTTK  754


 Score =   145 bits (366),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 108/185 (58%), Gaps = 10/185 (5%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + L I +     V ++ + + Q F         +++   +R ++ D+   K     N
Sbjct  668  TWKQRLIIALDVGRGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGN  727

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+  +L G    L       G    KVDVYAFGVVLME+ITG+KA+D+++PDE+ HLVT
Sbjct  728  YSVETKLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDSVPDESSHLVT  787

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T  SI KVAELA HCTT   Y+RP++ H VNVL P
Sbjct  788  WFRRVLTNKENIPKAIDQTLDPDEETMLSIYKVAELAGHCTTRSPYQRPDIGHAVNVLCP  847

Query  261  FAHNW  247
                W
Sbjct  848  LVQQW  852



>ref|XP_006296979.1| hypothetical protein CARUB_v10012974mg [Capsella rubella]
 gb|EOA29877.1| hypothetical protein CARUB_v10012974mg [Capsella rubella]
Length=838

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/707 (51%), Positives = 467/707 (66%), Gaps = 20/707 (3%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWS--ASKDPCTWTNVNCDKPTGNVVSINIDSQSISG  2480
             + S  DD A M  L  +  P PS WS   S   C WT + C   +G V SIN+  +S+ G
Sbjct  17    TFSVADDGAAMLALAKSFDPPPSDWSTTVSTGYCKWTGIEC--TSGRVTSINLADKSLYG  74

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              +  E++ L+ L+S+++ +N LSG +PS A +SSL+++++D N F  +      GL +L+
Sbjct  75    VIAPEISTLSELKSVALHRNKLSGNIPSLAKLSSLQKIFMDENLFVGVEVGAFAGLTSLQ  134

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             I S+SDN  ++ W   S L  STSL +    + +I GV+P+ F+SF +L+ LRLSYNN+T
Sbjct  135   ILSLSDNVNIAAWSFPSELVGSTSLTTIHLDSTNIFGVLPDIFESFESLEYLRLSYNNIT  194

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             G LP S   + IQNLW+NNQ  G+SGTI V+SSMT LSQVWL  N F+GPIPDLSK  NL
Sbjct  195   GPLPPSLAKTSIQNLWINNQDSGMSGTIQVLSSMTTLSQVWLHKNQFSGPIPDLSKSENL  254

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
             FDLQL  NQLTG++P SL    +L+NI L  NKL GP+PLF  KV+V + D N FC    
Sbjct  255   FDLQLRGNQLTGIIPPSLLTHGSLKNISLDYNKLQGPLPLFPPKVRVNI-DHNYFCTTKA  313

Query  1759  G-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             G  C  QV  LLA AGGLGYP  L +SWKG+DAC  WA++TCD  GKNV T+NLG   F+
Sbjct  314   GQSCSAQVMTLLAVAGGLGYPSMLVESWKGDDACSGWAYVTCDSTGKNVVTLNLGKHGFN  373

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             G ISP  + LTSL+++Y NDNNLTG IP  LT +  LQ++DVSNNNLS  +P FP     
Sbjct  374   GFISPTIANLTSLKSVYFNDNNLTGVIPKELTFMTSLQLIDVSNNNLSGEVPKFPMKFKY  433

Query  1402  SFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
               G +LL + + A+                 A + V V++ V+  + ++ FV YK  MKR
Sbjct  434   KPGNSLLGDGSSAS----------GGSGGSKALVVVGVIVGVLAFLAILGFVAYKFVMKR  483

Query  1222  EHKRFGRAKSPEKIKSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGK  1043
             +H       S +   S  +    E     I ++VL + TN FSE+++LG GG+GVVY G+
Sbjct  484   KHVSKSNGASGDNSDSLFI----EGGSVTIPMEVLCQVTNNFSEDNILGKGGFGVVYSGE  539

Query  1042  LDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYM  863
             L +GTK A+K+M   +   KG+ +F AEI  L+KVRH++LVAL+GYC+N  + LLVYEYM
Sbjct  540   LHDGTKTAIKRMNYASMGDKGVRQFHAEITILTKVRHRHLVALLGYCVNGDERLLVYEYM  599

Query  862   SHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLN  683
               G LG HLF W+K G+ PLT KQR++IA DVARG+EYLHSL  +SFIHRD+K +NILL 
Sbjct  600   PQGNLGQHLFWWRKFGYSPLTLKQRLSIALDVARGVEYLHSLAQESFIHRDLKPTNILLG  659

Query  682   DDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             DD+RAKVADFGLV+ APD K  VETRVAGTFGYLAPEYA TG+VT K
Sbjct  660   DDMRAKVADFGLVRNAPDGKYSVETRVAGTFGYLAPEYAATGKVTTK  706


 Score =   120 bits (300),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 88/146 (60%), Gaps = 5/146 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G+   KVDVYAFGV+LME++TG+K +D TLPD+  HLV W
Sbjct  681  SVETRVAGTFGYLAPEYAATGKVTTKVDVYAFGVILMEMLTGRKTIDNTLPDDRSHLVKW  740

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I+ +  N+ KA+D TL+ D +T ESI  VAELA HCT  +  +RP+M H V+VL   
Sbjct  741  FKRILIQKENIPKALDETLEADVETMESIYSVAELAGHCTALEPQQRPDMGHAVSVLVQL  800

Query  258  AHNWR-SLRPEEIVEKFGGFDLNMSL  184
               W+ S + EE +      D++MS 
Sbjct  801  VETWKPSCQEEETLR----IDVDMSF  822



>gb|KHN24033.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=815

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/654 (54%), Positives = 435/654 (67%), Gaps = 44/654 (7%)
 Frame = -2

Query  2377  LEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLGSFFASNAS  2198
             LE ++LD N F+SIP     GL +L+  S++D+  L+PW I + L +S +L      NA+
Sbjct  2     LESVFLDGNNFTSIPDGCFQGLTSLQTLSMADSVNLAPWTIPTELTDSNNLVKLDLGNAN  61

Query  2197  ITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl-wlnnqqqgLSGTIDVISS  2021
             + G +P+ FD F +LQ LRLSYNNLTG LP SFG SEIQNL   N    G SG+I+V++S
Sbjct  62    LIGTLPDVFDKFVSLQELRLSYNNLTGGLPKSFGGSEIQNLWLNNQNGFGFSGSIEVLAS  121

Query  2020  MTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNK  1841
             MT LSQVWLQ N FTGPIPDLS C  LFDLQL DNQLTGVVP SL  L +L+N+ L NN 
Sbjct  122   MTHLSQVWLQKNQFTGPIPDLSNCTTLFDLQLRDNQLTGVVPPSLMSLSSLQNVSLDNNA  181

Query  1840  LLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDAC  1661
             L GP+P F   VK  L   NSFC    GPCD +++ LL  A G GYP+ LA+SW GND C
Sbjct  182   LQGPVPSFEKGVKFTLDGINSFCLKDVGPCDSRISTLLDIAAGFGYPLQLARSWTGNDPC  241

Query  1660  QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTL  1481
              +W+F+ C   G  + TVNL  Q  +GTISPAF+ LT LRNL+LNDNNL G IP SLT L
Sbjct  242   DDWSFVVC--AGGKIITVNLAKQNLTGTISPAFANLTDLRNLFLNDNNLGGSIPGSLTNL  299

Query  1480  PHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK----------TVATGRGSPGSGQT  1331
               L+VL+VSNNNLS  +P FP  V  +  GN LL +          T + G G   SG  
Sbjct  300   AQLEVLNVSNNNLSGDVPKFPTKVKFTTAGNDLLGRSDGGGGGSGTTPSKGSGDAPSGSP  359

Query  1330  ENG---SSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPE----KIKST  1172
               G   SS+S      +V++ V  V VV+FVF KC+ K  H +FGR  +PE    ++K  
Sbjct  360   STGPGGSSLSPAWIAGIVLIAVFFVAVVVFVFCKCHAKNRHGKFGRVNNPENGKGEVKID  419

Query  1171  QMLKTN------------------------EIMGTAIKIQVLEKATNFFseesvlgsggy  1064
              M  TN                        E     I IQVL + T+ FSE+++LG GG+
Sbjct  420   MMSVTNSNGYGGVPSELQSQGSERSDVHVFEGGNATISIQVLRQVTDNFSEKNILGRGGF  479

Query  1063  gvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKM  884
             GVVY G+L +GT++AVK+M+  AT +KG+NEFQAEIA LSKVRH++LVAL+GYCIN ++ 
Sbjct  480   GVVYKGELHDGTQIAVKRMESVATGSKGLNEFQAEIAVLSKVRHRHLVALLGYCINGNER  539

Query  883   LLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIK  704
             LLVYEYM  GTL  HLF+W ++G  PLTWKQRV IA DVARG+EYLHSL  QSFIHRD+K
Sbjct  540   LLVYEYMPQGTLTQHLFDWGENGCAPLTWKQRVAIALDVARGVEYLHSLAQQSFIHRDLK  599

Query  703   SSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              SNILL DD+RAKVADFGLVK APD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  600   PSNILLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTK  653


 Score =   160 bits (404),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K      
Sbjct  567  TWKQRVAIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGK  626

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLME+ITG++A+D+T+PDE  HLV+
Sbjct  627  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRRALDDTVPDERSHLVS  686

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + Y+RP+M H VNVLGP
Sbjct  687  WFRRVLINKENIPKAIDQTLDPDEETMESIYKVAELAGHCTAREPYQRPDMGHAVNVLGP  746

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    EE  E+  G DL+MSLP
Sbjct  747  LVEQWKPTTHEE--EEGYGIDLHMSLP  771


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 72/302 (24%), Positives = 115/302 (38%), Gaps = 90/302 (30%)
 Frame = -2

Query  2521  NVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPLPS------------------  2396
             N+V +++ + ++ G LP    +  SL+ L +  N+L+G LP                   
Sbjct  51    NLVKLDLGNANLIGTLPDVFDKFVSLQELRLSYNNLTGGLPKSFGGSEIQNLWLNNQNGF  110

Query  2395  --------FANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLA  2240
                      A+M+ L +++L  N+F+   PD                           L+
Sbjct  111   GFSGSIEVLASMTHLSQVWLQKNQFTGPIPD---------------------------LS  143

Query  2239  ESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF---------GSSE  2087
               T+L      +  +TGV+P    S  +LQN+ L  N L G +P SF         G + 
Sbjct  144   NCTTLFDLQLRDNQLTGVVPPSLMSLSSLQNVSLDNNALQGPVP-SFEKGVKFTLDGINS  202

Query  2086  IqnlwlnnqqqgLSGTIDVISSM---TRLSQVW-----------------------LQAN  1985
                  +      +S  +D+ +      +L++ W                       L   
Sbjct  203   FCLKDVGPCDSRISTLLDIAAGFGYPLQLARSWTGNDPCDDWSFVVCAGGKIITVNLAKQ  262

Query  1984  AFTGPI-PDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNK  1808
               TG I P  +   +L +L L DN L G +P SLT L  LE + + NN L G +P F  K
Sbjct  263   NLTGTISPAFANLTDLRNLFLNDNNLGGSIPGSLTNLAQLEVLNVSNNNLSGDVPKFPTK  322

Query  1807  VK  1802
             VK
Sbjct  323   VK  324



>ref|XP_011089643.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=925

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/724 (51%), Positives = 481/724 (66%), Gaps = 32/724 (4%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             DA VM+KL  ++SP P+GW+ S   C W  ++CD  +G V SIN+ S+S+SG LPSEL Q
Sbjct  53    DADVMAKLAKSISPTPAGWTGSSF-CKWHGISCDS-SGQVTSINLASESVSGTLPSELNQ  110

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+SL+SLS+Q+N LSG LP+    SS+EE+ LD N F+S+P  FL GL +L+ FSI +N 
Sbjct  111   LSSLKSLSLQRNQLSGALPALP--SSVEEVNLDENSFNSVPSGFLSGLTSLQAFSIMNNT  168

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
             +L PW+I   L +S SL SF AS A+I G IP+ FDS  N Q LRLSYNN+TG LP SF 
Sbjct  169   DLPPWEIPVSLKDSNSLVSFNASMANIVGEIPDIFDSMLNFQTLRLSYNNMTGWLPVSFS  228

Query  2095  SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              S I+NLW+NNQ  G SGT+ V+  MT+L  VWL +N F+GPIPDLS C  L +L+L +N
Sbjct  229   KSSIENLWINNQAMGFSGTLHVLGMMTQLKTVWLHSNKFSGPIPDLSACTELSELELRNN  288

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVT  1736
              LTGV+P SLT LP L+ + LQNNK  GP+P F   V+  LG TN+FC  TPGPCDP+VT
Sbjct  289   FLTGVIPDSLTKLPKLQMVTLQNNKFQGPVPSFRRGVEANLGTTNNFCLSTPGPCDPRVT  348

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
             ALL   G +  P+ LA+SW+GND C+ W FITC  +G +VT +N G Q + G ISPA++ 
Sbjct  349   ALLEAVGAMNSPMILAESWEGNDPCKAWKFITC--EGGSVTAINFGKQNWIGIISPAYAN  406

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             LT+L+ L LNDN L G IPVSL +L  LQ LD+SNNN+S  +P FP +  +   GN  + 
Sbjct  407   LTTLKTLLLNDNKLEGVIPVSLASLKQLQTLDLSNNNISGKVPDFPSSTTVKVSGNEFIG  466

Query  1375  KTV------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHK  1214
             K +          G  G+      +S S+     + I V++  L+++ + +  Y +  +K
Sbjct  467   KDIPLRSPLERSYGGNGADIQSASASKSSVSPWGIAIPVLVSALLIVVLGFLIYRRHRNK  526

Query  1213  RFGR----AKSPEKIKSTQM----------------LKTNEIMGTAIKIQVLEKATNFFs  1094
             R       +K+ E+  S +                 L   +     I I +L +AT+ F+
Sbjct  527   RTNSYDSVSKASEEGNSGKQLIDIDPNAKSSNSASSLHVYDGGNITIPIDILREATDNFN  586

Query  1093  eesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVAL  914
             E ++LG GG+GVVY G+L +GT++AVK+M+      KG+NEF++EI  L+KVRH+NLVAL
Sbjct  587   ENNILGKGGFGVVYRGQLHDGTRIAVKRMESSFITDKGLNEFKSEIEVLTKVRHRNLVAL  646

Query  913   VGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLT  734
              G+C ND + LLVYEYM  G L  HLF+WKK G  PLTW QRV IA DVARG+EYLHSL 
Sbjct  647   HGFCNNDSERLLVYEYMPKGCLCEHLFQWKKTGSPPLTWNQRVIIALDVARGVEYLHSLA  706

Query  733   HQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGR  554
              QSFIHRD+K SNILL DDIRAKV+DFGLVK APD     ET++AGTFGYLAPEYA TG+
Sbjct  707   QQSFIHRDLKPSNILLGDDIRAKVSDFGLVKAAPDGNHSFETKLAGTFGYLAPEYAATGK  766

Query  553   VTKK  542
             VT K
Sbjct  767   VTTK  770


 Score =   133 bits (335),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 95/163 (58%), Gaps = 8/163 (5%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLV  445
            N S   +L G    L       G+   KVDVYAFGV+LME+ITG+KA+D++LP+E CHLV
Sbjct  743  NHSFETKLAGTFGYLAPEYAATGKVTTKVDVYAFGVILMEMITGRKALDDSLPEEKCHLV  802

Query  444  TWFHKIIRKSHNLQKAIDPTLDP--DEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNV  271
            TWF +++   + ++ A+DPTL    DE+ F  I KVAELA HCT  +   RP+M H VNV
Sbjct  803  TWFRRLLNDKNAVRAAVDPTLSSTMDEEGFHKIWKVAELAGHCTVREPQHRPDMSHPVNV  862

Query  270  LGPFAHNWRSLRPEEIVEKFGGFDLNMSLPLVF------DDSS  160
            L      W+        +   G D++MSLP V       DDSS
Sbjct  863  LSSLVEQWKPGAAGADEDDSFGIDVHMSLPQVLQKWKANDDSS  905



>ref|XP_010026683.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Eucalyptus grandis]
Length=912

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/737 (54%), Positives = 494/737 (67%), Gaps = 44/737 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD+AVM+++LAAL P  SGWS+S+  C WT V+CD  +  V  I + S S+SG LPS+L+
Sbjct  25    DDSAVMAEILAALKP--SGWSSSQTYCKWTGVSCDS-SSRVTVIKLSSASLSGALPSDLS  81

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ L+SLS+Q NSLSG +PSFA ++SL+ +YLD N F+SI      GL +L+  S+SDN
Sbjct  82    SLSQLQSLSLQSNSLSGAVPSFAGLASLQSIYLDGNNFTSITSGAFQGLTSLQTLSLSDN  141

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
              +L  WQI + L  STSL + +A N +I G IP+F  + P+L ++RLSYNNLTG LP SF
Sbjct  142   LDLPSWQIPAELNASTSLTTLYADNTNIIGTIPDFLGTLPSLTSMRLSYNNLTGPLPSSF  201

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
             G+S IQNLW+NNQ  GLSG I V++ MT+LSQVWLQ N FTGPIPDLS+C NLFDLQL  
Sbjct  202   GTSSIQNLWINNQAVGLSGGISVLAGMTQLSQVWLQNNQFTGPIPDLSQCTNLFDLQLMY  261

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQV  1739
             NQ TG+VP SL  LP L+N+ L NNKL GP+P   + ++V   + NSFC   PGPCDPQV
Sbjct  262   NQFTGLVPASLWALPGLKNVSLDNNKLQGPVPSNSSGIRVTY-EGNSFCNSAPGPCDPQV  320

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             T LL  AG LGYPITLA SW GNDACQ  W+ I+C  Q KNVT+V    + FSGTISPAF
Sbjct  321   TTLLEVAGALGYPITLADSWTGNDACQGGWSAISC--QEKNVTSVTFSKRGFSGTISPAF  378

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LT LR L LNDNNLTG IP SLTTL  LQVLDVSNNNL+  +P FP +V ++ G  L+
Sbjct  379   ANLTLLRTLLLNDNNLTGSIPESLTTLTQLQVLDVSNNNLNGSIPVFPASVKLTTGNPLI  438

Query  1381  LEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivv--------lvvlfvFYK-CYM  1229
                    G        + +G S  +     +   V+  V        +VVL V YK CY+
Sbjct  439   GXTDTGGGGSGGSGTNSTDGGSPGSSNGSSLSGGVIAAVVVGVLIFIVVVLLVLYKFCYV  498

Query  1228  KREHKRFGRAKSPE-KIKSTQMLKTNEIMG--------------------------TAIK  1130
              R+H++F     PE  ++  +    N + G                            I 
Sbjct  499   NRQHRKFNSVDDPEIGMEVAKNGAGNGMNGYGGLPSELHSQSSGDHSDFPVFKGGNVKIS  558

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             I+VL +AT  FSEE++LG GG+GVVY G+L +GTK+A K+M   A  TK M  FQAEIA 
Sbjct  559   IEVLRQATCNFSEENILGRGGFGVVYKGELHDGTKIAAKRMNSEAVGTKRMKGFQAEIAV  618

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             L+KVRH++LV L+GYCI   + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRVTIA D
Sbjct  619   LTKVRHRHLVMLLGYCIKGDERLLVYEYMPQGTLAQHLFEWQEKGYAPLTWKQRVTIALD  678

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  Q FIHRD+K  NILL DD+RAKVADFGLVK  PD K  +ET++AGTF
Sbjct  679   VARGVEYLHSLAQQKFIHRDLKPVNILLGDDMRAKVADFGLVKNVPDGKYSMETQLAGTF  738

Query  589   GYLAPEYA-TTGRVTKK  542
             GYLAPEYA  TGRVT K
Sbjct  739   GYLAPEYALATGRVTTK  755


 Score =   153 bits (387),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 121/208 (58%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K +    
Sbjct  668  TWKQRVTIALDVARGVEYLHSLAQQKFIHRDLKPVNILLGDDMRAKVADFGLVKNVPDGK  727

Query  621  LSLRHELLGHLVILH-QSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLV  445
             S+  +L G    L  +  L  G    KVDVYAFG VLMEIITG+KA+D T+PD   HLV
Sbjct  728  YSMETQLAGTFGYLAPEYALATGRVTTKVDVYAFGAVLMEIITGRKALDNTMPDARAHLV  787

Query  444  TWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            TWFH+++    N+ KAID TLDPDE+T ESI KVAELA HCT  K ++RP+M H VN+L 
Sbjct  788  TWFHRVLIDKENILKAIDHTLDPDEETLESIIKVAELAGHCTAEKPFQRPDMGHNVNILH  847

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            P    W     EE  E+  G +L+MSLP
Sbjct  848  PLVEQWEPTSHEE--EESSGINLHMSLP  873



>ref|XP_010023621.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Eucalyptus 
grandis]
Length=1321

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/738 (53%), Positives = 490/738 (66%), Gaps = 47/738 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D  VMSK+L AL P  SGWS+S+  C W  V+CD  +  V  IN+ S S+SG LPS+L+ 
Sbjct  428   DCTVMSKILVALKP--SGWSSSQACCNWKGVSCDS-SSRVTGINLPSSSLSGALPSDLSF  484

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+ L+++S+  N LSG +PSFA ++SL+ LYL++N F+SI      GL +L+  ++S+N 
Sbjct  485   LSHLQTISLHNNLLSGAVPSFAGVASLQTLYLNNNNFTSITSGAFQGLTSLQTLNLSNNL  544

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L+PWQI   L  STSL + +A+NA+I G IP+F  S P+L NLR+SYNNLTG LP SFG
Sbjct  545   CLAPWQIPLELNASTSLVTLYATNANIVGPIPDFLGSLPSLVNLRISYNNLTGPLPSSFG  604

Query  2095  SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
             +S I+ L LNNQ  GLSG I V++ MT+L  VWL+ N FTGPIPDLS+C NLFDLQL DN
Sbjct  605   TSGIKILCLNNQAMGLSGGISVLAGMTQLRLVWLENNQFTGPIPDLSQCTNLFDLQLRDN  664

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVT  1736
             Q TGVVP SL  LP+L+N+ L NNKL GP+P   + + +  G TNSFC   PGPCDPQVT
Sbjct  665   QFTGVVPASLLALPSLKNVSLDNNKLQGPVPSNRSGIDITYGGTNSFCNSAPGPCDPQVT  724

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
              LL  A  LGYPITLA SW GNDAC  +W+ I+C  QGK VT V    + FSGTISPAF+
Sbjct  725   KLLQVASALGYPITLADSWTGNDACHGSWSAISC--QGKKVTAVTFSKRGFSGTISPAFA  782

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LT L  L LNDNNLTG IP SLTTL  LQVLDVSNNNLS  +P FP ++ ++  GN L+
Sbjct  783   DLTLLDTLLLNDNNLTGSIPDSLTTLTQLQVLDVSNNNLSGLIPVFPASMKLTTTGNPLI  842

Query  1378  EKTVATGRGSPGSGQTENGSSMSARMf-vvvvivvvivvlvvlfvFYKC-YMKREHKRFG  1205
                  +  G   S    NGSS SA +   VV+I ++I + VV+  FYK  Y+   H+   
Sbjct  843   GGGGGSIDGG--SPGRSNGSSRSAGVIFAVVIIGILIFIGVVVVGFYKYHYIIPRHRNVN  900

Query  1204  RAKSP-----------EKIKSTQMLKTNEIMG----------------TAIKIQVLEKAT  1106
             R  +P               +     ++E+ G                  I I+ L +AT
Sbjct  901   RVDNPGIGMEVANNGAGNGMNGYGGVSSELHGQNRGDHSDFPVFNQGNVKIPIKDLRQAT  960

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK----------GMNEFQAEI  956
             N FSEE+ LGSGG+GVVY G+L +GTK+AVK+M   A  TK           M  F+AEI
Sbjct  961   NNFSEENKLGSGGFGVVYKGELPDGTKIAVKRMNPEAKDTKRMKGIQTEILRMKGFKAEI  1020

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LV L+GYCI  H+ LLVYEYM  GTL  HLFE ++ G+ PLTWKQR+TIA
Sbjct  1021  AVLTKVRHRHLVMLLGYCIKGHERLLVYEYMPQGTLAQHLFEGQEKGYAPLTWKQRMTIA  1080

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  Q FIHRD+K  NILL DD+RAKVADFGLVK  PD K  VET++AG
Sbjct  1081  LDVARGVEYLHSLAQQKFIHRDLKPENILLGDDMRAKVADFGLVKHVPDGKHSVETQLAG  1140

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEY  TG+VT K
Sbjct  1141  TFGYLAPEYVATGKVTTK  1158


 Score =   149 bits (376),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/235 (37%), Positives = 131/235 (56%), Gaps = 20/235 (9%)
 Frame = -3

Query  771   TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
             TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K +    
Sbjct  1072  TWKQRMTIALDVARGVEYLHSLAQQKFIHRDLKPENILLGDDMRAKVADFGLVKHVPDGK  1131

Query  621   LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
              S+  +L G    L    +  G+   KVDVYAFGVVLMEIITG+KA+D T+  E   LV 
Sbjct  1132  HSVETQLAGTFGYLAPEYVATGKVTTKVDVYAFGVVLMEIITGRKALDNTVSVERVQLVA  1191

Query  441   WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
             WF +++    N++KAID TLDPDE+T ESI KVAELA HCT  + ++RP+M+H VN+LGP
Sbjct  1192  WFRRVLINKENIRKAIDQTLDPDEETLESIIKVAELAGHCTAREPFQRPDMDHAVNILGP  1251

Query  261   FAHNWRSLRPEEIVEKFGGFDLNMSLPLVFD--------DSSIESLSFTNAQHRL  121
                 W+    +E  E+  G +L+M+LP             S   ++SF+N Q  +
Sbjct  1252  AVEQWKPTSHDE--EESSGVNLHMNLPQALQRWQADEGTSSMFNTMSFSNTQSSI  1304



>ref|XP_009630216.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=700

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/539 (62%), Positives = 391/539 (73%), Gaps = 48/539 (9%)
 Frame = -2

Query  2020  MTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNK  1841
             MT+LSQVWL AN FTG IPDLS C ++FDLQL DNQ TGVVP S+  LP L NI LQNNK
Sbjct  1     MTQLSQVWLHANYFTGSIPDLSNCESIFDLQLRDNQFTGVVPESVMTLPKLLNITLQNNK  60

Query  1840  LLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDAC  1661
             L GPMP F + VKV LG TNSFCKD+PGPCDPQVTALL  A G GYP++LA+SWKGNDAC
Sbjct  61    LQGPMPQFKDGVKVNLGTTNSFCKDSPGPCDPQVTALLDVASGFGYPVSLAESWKGNDAC  120

Query  1660  QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTL  1481
             ++W+FI+CD   KNVT  NLG +  SGTISPAF +LTSLRNL+LNDNNLTG IP SLTTL
Sbjct  121   KDWSFISCDTTRKNVTVANLGKRGVSGTISPAFVKLTSLRNLFLNDNNLTGTIPESLTTL  180

Query  1480  PHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGS--------------PG  1343
             P LQVLDVSNNNLS P+  FP +V  +  GNLLL K ++TG G                 
Sbjct  181   PDLQVLDVSNNNLSGPILLFPASVKFTHTGNLLLGKNISTGGGGSGSGGSGSNSGSPGEN  240

Query  1342  SGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKSTQML  1163
             S     G S+S  M   VVI  V+ VLVVLFV YKCYMKR HKRFGR ++PEK  S +M+
Sbjct  241   SSGGSKGPSVSTGMIAGVVIAAVVFVLVVLFVSYKCYMKRRHKRFGRVETPEK--SNEMV  298

Query  1162  KTN--EIMG------------------------------TAIKIQVLEKATNFFseesvl  1079
             K++   ++G                               AI IQVL + TN FSEE++L
Sbjct  299   KSSVPSVVGGSNGYTGVPSELQSQSSGDHSEIPVFEGGNVAISIQVLRQVTNNFSEENIL  358

Query  1078  gsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCI  899
             G GG+GVVY G+L +GTK+AVK+M+ GA  TKGMNEFQAEIA L+KVRH++LVAL+G C+
Sbjct  359   GRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMNEFQAEIAVLTKVRHRHLVALLGSCV  418

Query  898   NDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFI  719
             N ++ LLVYEYM  GTL  HLFEWK+ G+ PLTWK+RVTIA DVARG+EYLHSL  QSFI
Sbjct  419   NGNERLLVYEYMPQGTLSQHLFEWKELGYKPLTWKERVTIALDVARGVEYLHSLAQQSFI  478

Query  718   HRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             HRD+K SNILL DD+RAKVADFGLV+ APD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  479   HRDLKPSNILLGDDMRAKVADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTK  537


 Score =   171 bits (434),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 125/207 (60%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW E ++I +     V ++ + + Q F         +++   +R ++ D+   +      
Sbjct  451  TWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGK  510

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVT
Sbjct  511  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVT  570

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL+KAIDP LDPD++T+ESISKVAELA HCT  + ++RP+M H VNVLGP
Sbjct  571  WFRRVLINKDNLRKAIDPILDPDDETYESISKVAELAGHCTAREPFQRPDMGHAVNVLGP  630

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+ +R E+  +   G DL+MSLP
Sbjct  631  LVEQWKPIRNED--DDGYGIDLDMSLP  655



>ref|XP_010023622.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Eucalyptus 
grandis]
Length=1153

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/729 (53%), Positives = 484/729 (66%), Gaps = 47/729 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D  VMSK+L AL P  SGWS+S+  C W  V+CD  +  V  IN+ S S+SG LPS+L+ 
Sbjct  428   DCTVMSKILVALKP--SGWSSSQACCNWKGVSCDS-SSRVTGINLPSSSLSGALPSDLSF  484

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+ L+++S+  N LSG +PSFA ++SL+ LYL++N F+SI      GL +L+  ++S+N 
Sbjct  485   LSHLQTISLHNNLLSGAVPSFAGVASLQTLYLNNNNFTSITSGAFQGLTSLQTLNLSNNL  544

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L+PWQI   L  STSL + +A+NA+I G IP+F  S P+L NLR+SYNNLTG LP SFG
Sbjct  545   CLAPWQIPLELNASTSLVTLYATNANIVGPIPDFLGSLPSLVNLRISYNNLTGPLPSSFG  604

Query  2095  SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
             +S I+ L LNNQ  GLSG I V++ MT+L  VWL+ N FTGPIPDLS+C NLFDLQL DN
Sbjct  605   TSGIKILCLNNQAMGLSGGISVLAGMTQLRLVWLENNQFTGPIPDLSQCTNLFDLQLRDN  664

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVT  1736
             Q TGVVP SL  LP+L+N+ L NNKL GP+P   + + +  G TNSFC   PGPCDPQVT
Sbjct  665   QFTGVVPASLLALPSLKNVSLDNNKLQGPVPSNRSGIDITYGGTNSFCNSAPGPCDPQVT  724

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
              LL  A  LGYPITLA SW GNDAC  +W+ I+C  QGK VT V    + FSGTISPAF+
Sbjct  725   KLLQVASALGYPITLADSWTGNDACHGSWSAISC--QGKKVTAVTFSKRGFSGTISPAFA  782

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LT L  L LNDNNLTG IP SLTTL  LQVLDVSNNNLS  +P FP ++ ++  GN L+
Sbjct  783   DLTLLDTLLLNDNNLTGSIPDSLTTLTQLQVLDVSNNNLSGLIPVFPASMKLTTTGNPLI  842

Query  1378  EKTVATGRGSPGSGQTENGSSMSARMf-vvvvivvvivvlvvlfvFYKC-YMKREHKRFG  1205
                  +  G   S    NGSS SA +   VV+I ++I + VV+  FYK  Y+   H+   
Sbjct  843   GGGGGSIDGG--SPGRSNGSSRSAGVIFAVVIIGILIFIGVVVVGFYKYHYIIPRHRNVN  900

Query  1204  RAKSP-----------EKIKSTQMLKTNEIMG----------------TAIKIQVLEKAT  1106
             R  +P               +     ++E+ G                  I I+ L +AT
Sbjct  901   RVDNPGIGMEVANNGAGNGMNGYGGVSSELHGQNRGDHSDFPVFNQGNVKIPIKDLRQAT  960

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK----------GMNEFQAEI  956
             N FSEE+ LGSGG+GVVY G+L +GTK+AVK+M   A  TK           M  F+AEI
Sbjct  961   NNFSEENKLGSGGFGVVYKGELPDGTKIAVKRMNPEAKDTKRMKGIQTEILRMKGFKAEI  1020

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LV L+GYCI  H+ LLVYEYM  GTL  HLFE ++ G+ PLTWKQR+TIA
Sbjct  1021  AVLTKVRHRHLVMLLGYCIKGHERLLVYEYMPQGTLAQHLFEGQEKGYAPLTWKQRMTIA  1080

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG+EYLHSL  Q FIHRD+K  NILL DD+RAKVADFGLVK  PD K  VET++AG
Sbjct  1081  LDVARGVEYLHSLAQQKFIHRDLKPENILLGDDMRAKVADFGLVKHVPDGKHSVETQLAG  1140

Query  595   TFGYLAPEY  569
             TFGYLAPEY
Sbjct  1141  TFGYLAPEY  1149



>ref|XP_009794480.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Nicotiana 
sylvestris]
Length=704

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/541 (62%), Positives = 391/541 (72%), Gaps = 48/541 (9%)
 Frame = -2

Query  2020  MTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNK  1841
             MT+LSQVWL AN+FTG IPDLS C ++FDLQL DNQ TGVVP S+  LP L NI LQNNK
Sbjct  1     MTQLSQVWLHANSFTGSIPDLSNCESIFDLQLRDNQFTGVVPESVMTLPKLLNITLQNNK  60

Query  1840  LLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDAC  1661
             L GPMP F + VK  LG TNSFCKD+PGPCDPQVTALL  A G GYP++LA+SWKGNDAC
Sbjct  61    LQGPMPQFKDGVKFNLGTTNSFCKDSPGPCDPQVTALLDVASGFGYPVSLAESWKGNDAC  120

Query  1660  QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTL  1481
             ++W+FI+CD   KNVT  NLG + FSGTISPAF +LTSLRNL+LNDNNLTG IP SLTTL
Sbjct  121   KDWSFISCDTTRKNVTVANLGKRGFSGTISPAFVKLTSLRNLFLNDNNLTGTIPESLTTL  180

Query  1480  PHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV--------ATGRGSPGSGQTEN  1325
             P+LQVLDVSNNNLS P+P FP +V  +  GNL L K +        + G GS      EN
Sbjct  181   PNLQVLDVSNNNLSGPIPLFPASVKFTHTGNLFLGKNISSGGGGSGSGGSGSNSGSPGEN  240

Query  1324  GS------SMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKS--TQ  1169
              S      S+SA M   VVI  V+ VLVVLFV YKCYMKR HKRFGR ++PEK      +
Sbjct  241   SSGGSKRPSVSAGMIAGVVIAAVVFVLVVLFVSYKCYMKRRHKRFGRVETPEKSNEMVNE  300

Query  1168  MLKTN--EIMG------------------------------TAIKIQVLEKATNFFsees  1085
             M+K+    ++G                               AI IQVL + TN FSEE+
Sbjct  301   MVKSTVPSVVGGSNGYTGVPSELQSQSSGDHSEIPVFEGGNIAISIQVLRQVTNNFSEEN  360

Query  1084  vlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGY  905
             +LG GG+GVVY G+L +GTK+AVK+M+ G    KGMNEFQAEIA L+KVRH++LVAL+G 
Sbjct  361   ILGRGGFGVVYKGELHDGTKIAVKRMESGPMGNKGMNEFQAEIAVLTKVRHRHLVALLGS  420

Query  904   CINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQS  725
             C+N ++ LLVYEYM  GTL  HLFEW++ G+ PLTWK+RVTIA DVARG+EYLHSL  QS
Sbjct  421   CVNGNERLLVYEYMPQGTLSQHLFEWQEFGYKPLTWKERVTIALDVARGVEYLHSLAQQS  480

Query  724   FIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTK  545
             FIHRD+K SNILL DD+RAKVADFGLV+ APD K  VETR+AGTFGYLAPEYA TGRVT 
Sbjct  481   FIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGKYSVETRLAGTFGYLAPEYAATGRVTT  540

Query  544   K  542
             K
Sbjct  541   K  541


 Score =   170 bits (430),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 12/207 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW E ++I +     V ++ + + Q F         +++   +R ++ D+   +      
Sbjct  455  TWKERVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRNAPDGK  514

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDVYAFGVVLMEIITG+KA+DET+PDE  HLVT
Sbjct  515  YSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEIITGRKALDETMPDERSHLVT  574

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    NL+KAIDP LDPD++T+ESISKVAELA HCT  + ++RP+M H VNVLGP
Sbjct  575  WFRRVLISKDNLRKAIDPILDPDDETYESISKVAELAGHCTAREPFQRPDMGHAVNVLGP  634

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+  R E+  +   G DL+MSLP
Sbjct  635  LVEQWKPTRNED--DDGYGIDLDMSLP  659



>ref|XP_010690479.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=946

 Score =   557 bits (1435),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 354/752 (47%), Positives = 469/752 (62%), Gaps = 58/752 (8%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DD +VM  L  +L+P  S GWS   DPC W++V C +    V  I I  Q++ GNLP  L
Sbjct  33    DDVSVMLALKKSLNPPVSLGWS-DPDPCKWSHVVCSEEK-KVTRIQIGHQNLEGNLPPNL  90

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
             + L SL  L +Q N++SGP+PS   ++SL+ + L +N+FSSIP DF  GL +L+   + D
Sbjct  91    SLLTSLERLELQWNNISGPIPSLNGLNSLQVIMLSNNQFSSIPSDFFDGLSSLQSVDL-D  149

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N  L  W+I   L  +++L +F A++A+ITG IP+FF  DSFP + NLRLS+N+L G LP
Sbjct  150   NNPLQGWEIPESLKSASTLQNFSATSANITGKIPDFFGPDSFPGMVNLRLSFNSLEGELP  209

Query  2107  GSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF   +IQ+  +     +  L G IDVI +MT L +VWL  NAFTGP+PD S   +L  
Sbjct  210   RSFDGFQIQSLWVNGQKSEGKLHGRIDVIQNMTSLKEVWLHQNAFTGPLPDFSGLKDLQV  269

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
             L L DN+ TGVVP+SL  L +L  + L NN L GP P+F + V V    +TNSFC   PG
Sbjct  270   LSLRDNKFTGVVPMSLMNLESLAVVNLTNNLLQGPNPMFKSSVAVDSTENTNSFCLPKPG  329

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              C PQV  LL+ A  + YP  LAQ WKGND C +W  ITC     NVTTVNL     +GT
Sbjct  330   DCSPQVNTLLSVARYMDYPARLAQYWKGNDVCADWFGITC--SNGNVTTVNLEKMDLNGT  387

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F+ L SL+ L L +NNLTG IP  LTTLP L  +DVSNN L   +PSF   + +  
Sbjct  388   ISPDFASLKSLQRLILANNNLTGTIPQELTTLPSLTEVDVSNNQLYGKIPSFKKNLKLLT  447

Query  1396  GGNLLL---EKTVATGRG---SPGS--GQTENG---SSMSARMfvvvvivvvivvlvvlf  1250
              GN  +   E  V  GRG    PGS  G +++    S +S  + V + +V  ++ L++  
Sbjct  448   HGNPDIGKDESEVKHGRGISLPPGSVEGNSDDSGKKSKLSTGVIVAICVVGGVLFLLLCG  507

Query  1249  vFYKCYMKREHKRFGRAKSPE----------------------------KIKSTQMLKTN  1154
             V   C  K++  +F R +SP                              +  +  L ++
Sbjct  508   VLGFCLFKKKQNKFRRVQSPNAMVVHPRHSGSDNDSVKITVAGSSVSVGAVSESHTLPSS  567

Query  1153  EI----MGTA----IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
             +     MG A    I IQVL+  TN FSE+++LG GG+G VY G+L +GTK+AVK+M+ G
Sbjct  568   DTGGIQMGDAGNMVISIQVLKNVTNNFSEDNILGRGGFGTVYKGELHDGTKIAVKRMESG  627

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
                 KG+NEF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  G L  H+F W + 
Sbjct  628   VIAGKGLNEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGPLSRHIFNWAEE  687

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G  PL W +R++IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKVADFGLV+ 
Sbjct  688   GLKPLEWSRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRL  747

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             AP+ K+ VETR+AGTFGYLAPEYA TGRVT K
Sbjct  748   APEGKASVETRIAGTFGYLAPEYAVTGRVTTK  779


 Score =   136 bits (342),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 115/207 (56%), Gaps = 14/207 (7%)
 Frame = -3

Query  768  WLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWSKKLRMI---N  622
            W   LSI +     V ++ T + Q F         +++   +R ++ D+   +R+     
Sbjct  694  WSRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVADFGL-VRLAPEGK  752

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   + G    L       G    KVDV++FGVVLME+ITG+KA+DET P+E+ HLVT
Sbjct  753  ASVETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVVLMELITGRKALDETQPEESMHLVT  812

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAIDP +D DE+T  S+S VAELA HC   + Y+RP+M HVVNVL  
Sbjct  813  WFKRMHINKETFRKAIDPAMDLDEETLASVSTVAELAGHCCAREPYQRPDMGHVVNVLSS  872

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            F   W+    E  ++   G DL+MSLP
Sbjct  873  FVELWKP--SEASLDDCYGIDLDMSLP  897



>ref|XP_006290562.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
 gb|EOA23460.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
Length=947

 Score =   543 bits (1398),  Expect(2) = 3e-179, Method: Compositional matrix adjust.
 Identities = 338/733 (46%), Positives = 442/733 (60%), Gaps = 59/733 (8%)
 Frame = -2

Query  2581  WSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPL  2402
             WS + +PC W  V CD  +  V  I +  + I G LP +L  L+ L  L +  N +SGP+
Sbjct  48    WS-NPNPCKWVAVECDG-SNRVTKIQLKQKGIRGTLPPDLQNLSELVVLELFLNRISGPI  105

Query  2401  PSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLG  2222
             P  + +S L+ L L  N F+S+P +   G+ +L+   + +N   +PWQI   + E+TSL 
Sbjct  106   PDLSGLSRLQTLNLHDNLFTSVPKNLFAGMNSLQQVYL-ENNPFTPWQIPETIKEATSLQ  164

Query  2221  SFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--wlnnqqq  2054
             +   SN SI G IP+FF   S P+L NL+LS NNL G LP SF  + +Q+L         
Sbjct  165   NLTLSNCSIFGKIPDFFGSQSLPSLTNLKLSQNNLQGELPLSFAGTSLQSLFLNGQVGDT  224

Query  2053  gLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLP  1874
              L+G+I ++S+MT L +V LQ N F+GPIPDLS  ++L    + +NQLTGVVP SL  L 
Sbjct  225   RLNGSISILSNMTSLVEVSLQGNEFSGPIPDLSGLLSLRVFNVRENQLTGVVPQSLIRLD  284

Query  1873  NLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYP  1700
             +L  + L NN L GP PLFG  V   I   TNSFC DTPG PCDP V  LL+ A   GYP
Sbjct  285   SLTTVNLTNNLLQGPTPLFGKSVAADIFNKTNSFCTDTPGVPCDPGVDILLSVAESFGYP  344

Query  1699  ITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDN  1520
             + LA+SWKGN+ C NW  ITC   G N+T VNL  Q  SGTISP+ ++LTSL  + L+DN
Sbjct  345   VKLARSWKGNNPCVNWVGITC--SGSNITVVNLRKQDLSGTISPSLAKLTSLETINLSDN  402

Query  1519  NLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK-----------  1373
              L+GPIP  LTTLP L+ LDVSNN++    P F   VN+   GN  + K           
Sbjct  403   QLSGPIPTELTTLPKLRTLDVSNNDIFGKQPKFRDTVNVVIDGNANIGKDGPSRPSGSPD  462

Query  1372  TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKS  1193
             T   G+ S G+G +E  S  S+ + ++V +V  +V  + L     C   ++ KR  R +S
Sbjct  463   TSTDGKPSGGTGGSET-SKKSSNVKIIVPVVGGVVGALCLVGLGVCLYAKKRKRPARVQS  521

Query  1192  P--------------EKIKSTQM----------------------LKTNEIMGTAIKIQV  1121
             P              + IK T                        +   E     I IQV
Sbjct  522   PSSHMVIHPHHSGDNDDIKLTVAASSLNSGGGSDSYSHSGSAASDIHVVEAGNLVISIQV  581

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+      KG+ EF++EI  L+K
Sbjct  582   LRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESSVVSDKGLAEFKSEITVLTK  641

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             +RH++LVAL+GYC++  + LLVYEYM  GTL  HLF WK+ G  PL W +R+ IA DVAR
Sbjct  642   MRHRHLVALLGYCLDGSERLLVYEYMPQGTLSEHLFHWKEQGLKPLDWTRRLAIALDVAR  701

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ APD K  +ETRVAGTFGYL
Sbjct  702   GVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPDGKYSIETRVAGTFGYL  761

Query  580   APEYATTGRVTKK  542
             APEYA TGRVT K
Sbjct  762   APEYAVTGRVTTK  774


 Score =   116 bits (291),  Expect(2) = 3e-179, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII--RKSHNLQKAIDPT  385
            G    KVD+++ GV+LME+ITG+KA+DET P+++ HLVTWF +I   +  +  + AIDP 
Sbjct  769  GRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRIAASKDENAFKNAIDPN  828

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLR--PEEIVEKF  211
            +  D+ T  SI KV ELA HC   + Y+RP+M H+VNVL      W+     P+++    
Sbjct  829  ISLDDDTVASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWKPTETDPDDVY---  885

Query  210  GGFDLNMSLPLVFDD-SSIESLSFT  139
             G D +M LP V     + E LS T
Sbjct  886  -GIDYDMPLPQVLKKWQAFEGLSQT  909



>ref|XP_008775313.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=843

 Score =   551 bits (1420),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 356/733 (49%), Positives = 465/733 (63%), Gaps = 44/733 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M  +   L+  PS W+   DPC W  VNC   +G + +IN+  + ++G L S +++L+SL
Sbjct  1     MVDIAEKLTNLPSSWTTDSDPCQWAGVNCR--SGRIATINLALKGVAGTLSSSISKLSSL  58

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
              +L +Q+N +SGPLPS A +S LE + LD N FSSIP DF  GL  L+  S+ DN  L+P
Sbjct  59    TNLQLQQNQISGPLPSLAKLSELEIITLDGNAFSSIPNDFFSGLSALQSVSLDDN-PLAP  117

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             W I + LA+S +L  F ASN SI G IP FF +  +LQ+LR+SYNN+TG LP  F  S I
Sbjct  118   WVIPADLADSINLVRFSASNTSINGEIPEFFGTLGSLQSLRISYNNMTGGLPDLFRGSSI  177

Query  2083  qnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQL  1910
             QNL           SG+IDVI SMT+LS VWLQ+N+FTGPIPDLSK  +L    + DN L
Sbjct  178   QNLWLNNQQSPTKFSGSIDVIGSMTQLSLVWLQSNSFTGPIPDLSKLSSLASFNVRDNSL  237

Query  1909  TGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTAL  1730
             TG+VP SLT  P L+N+ L NN+L GP P F  +V   +   N+FC   PG C+ +VT L
Sbjct  238   TGLVPPSLTSCPTLKNVSLSNNQLQGPYPKFAARVDADIDKGNNFCNSAPGSCNAKVTML  297

Query  1729  LAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQL  1553
             LA A G  YP+ LA SW GND C  NW  + CD Q  N+  +N  NQ F G ISP  +  
Sbjct  298   LAVAEGFEYPLNLANSWMGNDPCGGNWFGVNCDNQ-NNIIVLNFANQHFEGIISPDIANF  356

Query  1552  TSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK  1373
             TSL  L L++NNL+GPIP SL  LP+LQ+LDV+NNNLS  +P FP  V +   GN LL  
Sbjct  357   TSLTKLILSNNNLSGPIPDSLKGLPNLQLLDVTNNNLSGIVPDFPNHVTLKLKGNHLLGS  416

Query  1372  TVATGRGSPG-------------SGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCY  1232
             +  +G GS               +G    GS  S  +   +++ V+I++   L  FY  Y
Sbjct  417   SSGSGGGSSSSSSPSDGPSESPSAGDQPTGSKSSGALIAGILVAVLILIACFLAFFYSLY  476

Query  1231  MKREHKRFGRAKS------PEKIKS----TQMLKTN-------------EIMGTAIKIQV  1121
              K+  +RFGR  +      PE IK+    T+M   N             +  G  + I+ 
Sbjct  477   RKKHAQRFGRVPTGSPPNEPESIKTGVMGTEMGVLNNQSSTGSANTYMVDPQGMHMSIRS  536

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L +ATN F+EE++LG GG+GVVY G+L NGT +AVK+ +   T TKG +EF+AEI  LSK
Sbjct  537   LRRATNNFNEENILGRGGFGVVYKGEL-NGTLIAVKRSRVDLTGTKGNDEFKAEIDVLSK  595

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL+GY  + ++ LLVYEYM  GTL  HLF++ K    PLTWKQR+TIA D+AR
Sbjct  596   VRHRHLVALLGYYDDGNERLLVYEYMPGGTLEQHLFDYNKIRCSPLTWKQRLTIALDMAR  655

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYL  581
             G+EYLHSL  +SFIHRD+K SNILL++D+RAKV+DFGLVK   D +  + TR+AGTFGYL
Sbjct  656   GVEYLHSLAQESFIHRDLKPSNILLDNDMRAKVSDFGLVKHCIDKQKSMMTRLAGTFGYL  715

Query  580   APEYATTGRVTKK  542
             APEYA+TGRVT K
Sbjct  716   APEYASTGRVTTK  728


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 1/132 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGV+LME+ITG+K +D+  PD+   LV  
Sbjct  703  SMMTRLAGTFGYLAPEYASTGRVTTKVDVYAFGVILMELITGQKVLDDRRPDDDSSLVPI  762

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            FH+ I+ K   L+   DP L+ DE+   S+ +VAELA +CT  +   RP+M + VN L P
Sbjct  763  FHRNILNKDEFLKSCPDPNLELDEKACRSLMEVAELARYCTAREPSHRPDMSYAVNKLAP  822

Query  261  FAHNWRSLRPEE  226
                W+     E
Sbjct  823  LVVTWKPTAGSE  834



>ref|XP_003552883.2| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=984

 Score =   537 bits (1384),  Expect(2) = 9e-179, Method: Compositional matrix adjust.
 Identities = 346/762 (45%), Positives = 461/762 (60%), Gaps = 70/762 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE-  2465
             DDA+ M  L  +L+P  S GWS   DPC W +V C +    ++ I I    + G LP+  
Sbjct  61    DDASAMLSLRDSLNPPESLGWS-DPDPCKWKHVACSEEVKRIIRIQIGHLGLQGTLPNAT  119

Query  2464  -LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
              +  L  L  L +Q N++SGPLPS   + SL+ L L +N+FSSIP DF  G+  L+   I
Sbjct  120   VIQTLTQLERLELQFNNISGPLPSLNGLGSLQVLILSNNQFSSIPDDFFAGMSELQSVEI  179

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
              DN    PW+I   +   +SL +F A++A+I G +P+FF S P L +L L++NNL G+LP
Sbjct  180   DDN-PFKPWKIPDSIVNCSSLQNFSANSANIVGTLPDFFSSLPTLTHLHLAFNNLQGALP  238

Query  2107  GSFGSSEIqnlwlnnqqqgLS----GTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
              SF  S+I+ LWLN Q+   S    G +DV+ +MT L+QVWL +NAFTGP+PD S  V+L
Sbjct  239   LSFSGSQIETLWLNGQKGVESNNLGGNVDVLQNMTSLTQVWLHSNAFTGPLPDFSGLVSL  298

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVIL---GDTNSFCK  1769
              DL L DN  TG VP SL  L +L+ + L NN   G +P FG+ V+V L    D+NSFC 
Sbjct  299   QDLNLRDNAFTGPVPGSLVELKSLKAVNLTNNLFQGAVPEFGSGVEVDLDLGDDSNSFCL  358

Query  1768  DTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQR  1589
                G CDP+V  LL+    LGYP   A++WKGN  C +W  +TC   G ++T VN     
Sbjct  359   SRGGKCDPRVEILLSVVRVLGYPRRFAENWKGNSPCADWIGVTCS-GGGDITVVNFKKMG  417

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
               GTI+P F  L SL+ L L DNNLTG IP  L +LP L  L+V+NN L   +PSF   V
Sbjct  418   LEGTIAPEFGLLKSLQRLVLADNNLTGSIPEELASLPGLVELNVANNRLYGKIPSFKSNV  477

Query  1408  NISFGGNLLLEKTVATGRGSPGSGQT--------------ENGSSMSARMfvvvvivvvi  1271
              ++  GN    K +   + +PG   +              ENG   S+ + V+V+ V+  
Sbjct  478   VLTTNGN----KDIGKDKPNPGPRSSPLGPLNSRAPNRSEENGGKRSSHVGVIVLAVIGG  533

Query  1270  vvlvvlfvFYKCYMKR-EHKRFGRAKSP--------------EKIKST------------  1172
             VVLV++  F  C + R + KR  + +SP              E +K T            
Sbjct  534   VVLVLVISFLVCCLFRMKQKRLSKVQSPNALVIHPRHSGSDNENVKITVAGSSLSVCDVS  593

Query  1171  ----QMLKTNEI----MGTA----IKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                 Q +  +E     MG A    I IQVL   T+ FSE+++LG GG+G VY G+L +GT
Sbjct  594   GIGMQTMAGSEAGDIQMGEAGNMVISIQVLRNVTDNFSEKNILGQGGFGTVYKGELHDGT  653

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ GA   KG  EF++EIA L+KVRH++LV+L+GYC++ ++ LLVYEYM  GTL
Sbjct  654   KIAVKRMESGAISGKGATEFKSEIAVLTKVRHRHLVSLLGYCLDGNEKLLVYEYMPQGTL  713

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               HLF W + G  PL W +R+TIA DVAR +EYLHSL HQSFIHRD+K SNILL DD+RA
Sbjct  714   SKHLFNWMEEGLKPLEWNRRLTIALDVARAVEYLHSLAHQSFIHRDLKPSNILLGDDMRA  773

Query  667   KVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             KV+DFGLV+ AP+ K+ VETR+AGTFGYLAPEYA TGRVT K
Sbjct  774   KVSDFGLVRLAPEGKASVETRIAGTFGYLAPEYAVTGRVTTK  815


 Score =   120 bits (300),  Expect(2) = 9e-179, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLD  379
            G    KVDV++FGV+LME+ITG++A+D+T P+++ HLVTWF ++     + QKAID T+D
Sbjct  810  GRVTTKVDVFSFGVILMELITGRRALDDTQPEDSMHLVTWFRRMYVNKDSFQKAIDHTID  869

Query  378  PDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKFGGFD  199
             +E+T   I  VAELA HC   + Y+RP+  H VNVL      W+    ++  E   G D
Sbjct  870  LNEETLPRIHTVAELAGHCCAREPYQRPDAGHAVNVLSSLVELWKP--SDQSSEDVYGID  927

Query  198  LNMSLP  181
            L+MSLP
Sbjct  928  LDMSLP  933



>ref|XP_011043912.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=946

 Score =   554 bits (1427),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 350/753 (46%), Positives = 461/753 (61%), Gaps = 62/753 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA VM  L  +L+ P   GWS   DPC W +V C      V  I I  Q++ G LPS L 
Sbjct  33    DAEVMLSLKKSLNVPDSLGWS-DPDPCNWNHVVCSDEK-RVTRIQIGRQNLQGTLPSNLQ  90

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L +Q N++SGPLPS   +SSL+ + L  N+F+S+P DF  GL +L+   I DN
Sbjct  91    NLTQLERLELQYNNISGPLPSLNGLSSLQVILLSDNKFTSVPSDFFAGLSSLQSVEI-DN  149

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W I   +  ++ L +F A++A+I+G IP+FF  D+FP L  LRL++N+L G LP 
Sbjct  150   NPFSNWVIPESIQNASGLQNFSANSANISGSIPSFFGPDAFPALTILRLAFNDLEGELPA  209

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S++Q+LWLN Q+   SG+I VI +MT L +VWLQ+N F+GP+PD S   +L  L L
Sbjct  210   SFSGSQVQSLWLNGQKL--SGSIYVIQNMTLLREVWLQSNGFSGPLPDFSGLKDLESLNL  267

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPCD  1748
              DN  TG VP SL  L +L+ + L NN L GPMP+F + V V ++ D+N FC  TPGPCD
Sbjct  268   RDNSFTGPVPESLVNLESLKVVNLSNNLLQGPMPVFKSSVSVDMVKDSNRFCLSTPGPCD  327

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
              +V  LL+    + YP  LA  WKGND C +W  ITC+    N+T VN      +G+ISP
Sbjct  328   SRVNTLLSIVKSMYYPHRLADGWKGNDPCADWLGITCNK--GNITVVNFEKMGLTGSISP  385

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
              F+ L SL  L L +NNLTG IP  +TTLP L+ LDVSNN L   +P+F   V ++  GN
Sbjct  386   DFASLKSLERLVLANNNLTGLIPQEITTLPRLKELDVSNNQLYGKVPAFTNNVMVNTNGN  445

Query  1387  LLLEKTVA---------------TGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvl  1253
               + K V                TG GS G+ +     S +    +V  +V  + +L ++
Sbjct  446   PHIGKDVNSSTSPGSPSASPSANTGSGSGGNSEKSGKKSSAFIGVIVFSVVGGVFLLFLI  505

Query  1252  fvFYKCYMKREHKRFGRAKSPEK----------------------------IKSTQMLKT  1157
              +   C  K++ KRF R +SP +                            I  T  + T
Sbjct  506   GLVVFCLYKKKQKRFSRVQSPNEMVIHPRHSVSDNESVKITVAGSSVSVGAISETHTIPT  565

Query  1156  NE----IMGTA----IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKD  1001
             +E     MG A    I IQVL   TN FSEE++LG GG+GVVY G+L +GTK+AVK+M  
Sbjct  566   SEQGDIQMGEAGNMVISIQVLRNVTNNFSEENILGQGGFGVVYKGELHDGTKIAVKRMGS  625

Query  1000  GATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKK  821
             G   +KG+NEF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF W +
Sbjct  626   GVISSKGLNEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWAE  685

Query  820   HGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVK  641
              G  P+ W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+
Sbjct  686   EGLKPMEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVR  745

Query  640   KAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  746   LAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  778


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+D++ P+E+ HLVTW
Sbjct  753  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDDSQPEESMHLVTW  812

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  813  FRRMHLNKDTFRKAIDPTIDLNEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  872

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  873  VELWKPT--DQSSEDIYGIDLEMSLP  896



>ref|XP_010648936.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=948

 Score =   553 bits (1425),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 350/762 (46%), Positives = 459/762 (60%), Gaps = 71/762 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +DA+VM  L  +LS + S GWS   DPC W +V C +    V  I +  Q + G LPS L
Sbjct  26    EDASVMLALKDSLSNSESLGWSG-PDPCEWKHVVCSEDK-RVTRIQVGRQGLQGTLPSSL  83

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L  L +Q N++SGPLPS   +SSL+ L L +N+F+ IP DF  GL +L+   I D
Sbjct  84    GNLTELERLELQWNNISGPLPSLKGLSSLQVLMLSNNQFTYIPVDFFSGLSSLQSVEI-D  142

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLP  2108
             N   S W+I   L  +++L +F A++A+ITG IP+F    +FP L NL L++N L G LP
Sbjct  143   NNPFSAWEIPQSLKNASALQNFSANSANITGNIPDFLGPVAFPGLVNLHLAFNALVGGLP  202

Query  2107  GSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              +   S I++  +     ++ LSGTIDVI +MT L +VWL +NAF+GP+PD S   +L  
Sbjct  203   SALSGSLIESLWVNGQMSEEKLSGTIDVIQNMTSLKEVWLHSNAFSGPLPDFSGLKDLQS  262

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPG  1757
             L L DN  TGVVPVSL  L +LE + L NN L GP+P F N V V +  D NSFC   PG
Sbjct  263   LSLRDNLFTGVVPVSLVNLGSLEAVNLTNNFLQGPVPEFKNSVAVDMTPDGNSFCLPKPG  322

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL+     GYP   A++WKGND C  W  ITC+    N+T VN      +GT
Sbjct  323   ECDPRVNILLSIVKSFGYPTKFAKNWKGNDPCTEWFGITCN--NGNITVVNFQKMGLTGT  380

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             IS  FS L SL+ L L DNN+TG IP  LTTLP L  LDVSNN L   +PSF   V ++ 
Sbjct  381   ISSNFSSLISLQKLVLADNNITGSIPKELTTLPALTQLDVSNNQLYGKIPSFKGNVLVNA  440

Query  1396  GGNLLLEKTV-------ATGRGSPG----SGQTENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  + K         A+ +GSPG    +G  ++GSSM+       +I +++  ++   
Sbjct  441   NGNPDIGKEKGGSTSQGASSQGSPGPSTNTGSQDSGSSMNGGKKSSSLIGIIVFSVIGGV  500

Query  1249  -------vFYKCYMKREHKRFGRAKSP--------------EKIKST-------------  1172
                    +   C  KR+ KRF R +SP              + +K T             
Sbjct  501   FVIFLIGLLVFCLYKRKQKRFTRVQSPNAMVIHPRHSGSDNDSVKITVAGSSVSVGAISE  560

Query  1171  ------------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                         QM++   ++   I IQVL   TN FSEE++LG GG+G VY G+L +GT
Sbjct  561   THTHPSSEPNDIQMVEAGNMV---ISIQVLRNVTNNFSEENILGQGGFGTVYRGELHDGT  617

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL
Sbjct  618   KIAVKRMESGVITGKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTL  677

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               HLF W + G  PL W +R+ IA DVARG+EYLH L HQSFIHRD+K SNILL DD+RA
Sbjct  678   SRHLFSWPEEGIKPLEWTRRLAIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRA  737

Query  667   KVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             KVADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  738   KVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  779


 Score =   136 bits (342),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  754  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  813

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D DE+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  814  FKRMHINKDTFRKAIDPTIDVDEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  873

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ +  ++  E   G DL+MSLP
Sbjct  874  VELWKPV--DQNTEDIYGIDLDMSLP  897



>ref|XP_004230827.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Solanum 
lycopersicum]
Length=940

 Score =   551 bits (1421),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 338/750 (45%), Positives = 456/750 (61%), Gaps = 52/750 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             S   DAAVM +L   +SP  S      +PC W  V C K  G V  I + +Q + G+LP 
Sbjct  28    SAATDAAVMQELKKGISPPSSLKWDDPNPCKWGKVQCTK-DGRVTRIQVGNQGLKGSLPP  86

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
              +  L  L+   VQ N+L+GP+PSFA M+SL+ + LD+N F+SIP DF  G+ NL+  ++
Sbjct  87    SMNNLTELQVFEVQNNALTGPIPSFAGMNSLQTILLDNNGFTSIPVDFFEGMTNLQTVNL  146

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGS  2114
              D    SPW +   L ++TSL SF A++A+ITG +P+FF  D+F +L +L +++NN  G 
Sbjct  147   -DTNSFSPWSVPESLKDATSLQSFSANSANITGKVPDFFGGDTFVSLTDLHMAFNNFEGP  205

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP +F  S IQ LWLN     L+G+IDV+ +MT L+Q+W   N FTGP+PD S    L +
Sbjct  206   LPSNFSGSSIQTLWLNGIHGKLNGSIDVVQNMTALTQLWFSGNQFTGPLPDFSGLTQLRE  265

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
               L DN  TG VP SL  LP+L+ + L NN   GP P F + V V +L +TNSFC   PG
Sbjct  266   CNLRDNSFTGPVPDSLVNLPSLKMVNLTNNFFQGPTPKFPSSVLVDMLDNTNSFCLSQPG  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PC+ QV ALLA A  +GYP   A++WKGND C +W  ITCD  G N+T +N      +GT
Sbjct  326   PCNSQVNALLAVAKDVGYPTGFAENWKGNDPCSSWMGITCD--GGNITVLNFQKMGLTGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP +S +TSL+ L L +N LTG IP  L +LP+L+  D+SNN +   +P F   V + +
Sbjct  384   ISPNYSSITSLQKLILANNFLTGTIPNELVSLPNLKEFDISNNLIYGKIPPFKSNVLVKY  443

Query  1396  GGNLLLEK--------TVATGRGSPGSGQTE-NGSSMSARMfvvvvivvvivvlvvlfvF  1244
              GN+ + K        + +T     G GQT  NG+  S+   VV  ++  +   V +   
Sbjct  444   DGNVNIGKDNPPPFAPSGSTPSSPDGGGQTHGNGNKKSSTGVVVGSVIGGVCGAVAIAGL  503

Query  1243  YK-CYMKREHKRFGRAKSP--------------EKIKSTQM-------------------  1166
             +  C  + +  R GR +SP              + +K T                     
Sbjct  504   FVFCLYRTKRMRSGRVQSPHTVVIHPHHSGSDQDAVKITVAGSSVNGGTTETHSCGSSAP  563

Query  1165  --LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGAT  992
               L   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+ G  
Sbjct  564   GDLHIVEAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESGVM  623

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
               KG++EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GT+  +LF WK+ G 
Sbjct  624   SEKGLDEFTSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTVSRYLFNWKEEGI  683

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PL W +R+ IA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+ AP
Sbjct  684   KPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAP  743

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + K+ + TR+AGTFGYLAPEYA TGRVT K
Sbjct  744   EGKTSLVTRLAGTFGYLAPEYAVTGRVTTK  773


 Score =   124 bits (311),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            SL   L G    L       G    K+DV++FGV+LME+ITG++A+DE+ P+E+ HLV W
Sbjct  748  SLVTRLAGTFGYLAPEYAVTGRVTTKIDVFSFGVILMELITGRRALDESQPEESMHLVPW  807

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAID T+D DE T  S+SKVAELA HC   + ++RP+M H VNVL   
Sbjct  808  FRRMHINKETFRKAIDHTIDLDEDTLASVSKVAELAGHCCAREPHQRPDMGHAVNVLSSL  867

Query  258  AHNWRSLRPEEIVE-KFGGFDLNMSLP  181
            A  W   +P E+ E +  G D +M+LP
Sbjct  868  AELW---KPAEVDEDEIYGIDYDMTLP  891



>ref|XP_008812470.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=887

 Score =   550 bits (1416),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 334/728 (46%), Positives = 458/728 (63%), Gaps = 38/728 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             CDD+A M  +  +L   P    A+ DPC+W  V+C    G+VV IN+ ++ +SG L + +
Sbjct  27    CDDSAAMQDIAKSLI-VPQWKLANGDPCSWPGVSCQG--GSVVEINLRNKGVSGELSASI  83

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
             + L+SL+SL +QKN + G LPS AN++SL+ +Y+DSN FS++P DF  GL +L+  ++ D
Sbjct  84    SNLSSLKSLQLQKNQIKGDLPSLANLASLQSVYIDSNAFSTMPADFFSGLTSLQTMTL-D  142

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
                  PW I   +++  +L  F AS+A +TG IP+FF   P LQ+L LSYN + G LP S
Sbjct  143   KNPFKPWSIPDDVSKCENLVVFSASDAGVTGNIPDFFGKMPKLQSLTLSYNTMKGELPAS  202

Query  2101  FGSSEIqnlw--lnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             F  S IQ+L          L+G IDVI+ MT+LS VWLQ+N FTGPIPDLS   +L D +
Sbjct  203   FKGSNIQSLVLNNQQAGSQLTGRIDVIARMTQLSVVWLQSNGFTGPIPDLSDLASLTDFR  262

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-C  1751
               DN LTGVVP SL   P L+N+ L NNKL GPMP F + V V +   N FC + P   C
Sbjct  263   ARDNFLTGVVPPSLISSPTLKNVTLSNNKLQGPMPKFADGVTVDIDKGNQFCVENPAEQC  322

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+VT+LL  A G  YP+ LA+SW+GND C+NW  +TC   G+++  +N  N+R+SG IS
Sbjct  323   DPRVTSLLEVAAGFEYPMDLAESWQGNDPCKNWQGVTCG--GQDIVVLNFANRRYSGIIS  380

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PA     SL+ L L++N+L+G IP SLT L  L ++DV+NN+LS  +P F   V +   G
Sbjct  381   PAIGNFASLQKLILSNNSLSGRIPDSLTKLQKLTLVDVTNNDLSGKVPEFRQTVEVRKEG  440

Query  1390  NLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM-KREHK  1214
             N  + K V    G  GS  + +    +       +++ V+V +  L     CY+ +R+ K
Sbjct  441   NPNIGKEVDPSGGDSGSNGSSSKFQAAT---AAGIVIGVLVGMGCLAAALICYIHRRKRK  497

Query  1213  RFGR------AKSPEKIK------------------STQMLKTNEIMGTAIKIQVLEKAT  1106
             +FGR      A  PE +K                     M  T +  G  + I  +  AT
Sbjct  498   KFGRVAIQTPANEPELVKIGVMGMNLNDGSWNGRYTQNNMGSTTDTQGMCMSIHAIRSAT  557

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKN  926
             N FSE++++G GG+GVVY G+L NGT +AVK+ + G    KG  EF+AEI  L +VRH++
Sbjct  558   NNFSEDNIIGRGGFGVVYKGQL-NGTMIAVKRSRVGLIGEKGNEEFRAEIDVLQRVRHRH  616

Query  925   LVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYL  746
             LVAL+GYC ++ + LLVYEYM  GTL  HLFE  ++GF PLTW+QR+ +A DVARG++YL
Sbjct  617   LVALLGYCDDEDEQLLVYEYMPGGTLEQHLFECSENGFSPLTWQQRLAVALDVARGVQYL  676

Query  745   HSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYA  566
             HSL  +SFIHRD+K  NILL++D RAKV+DFGLVK A D +  + TR+AGTFGYLAPEYA
Sbjct  677   HSLAQESFIHRDLKPLNILLDNDKRAKVSDFGLVKLALDKQKSMMTRLAGTFGYLAPEYA  736

Query  565   TTGRVTKK  542
              TG+VT K
Sbjct  737   ITGKVTTK  744


 Score = 99.4 bits (246),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 1/126 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   K+DVYAFGV+LME+ITG++ +D+T PDE  +LV  
Sbjct  719  SMMTRLAGTFGYLAPEYAITGKVTTKIDVYAFGVILMELITGERVLDDTRPDEDTNLVYV  778

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + I+ K + L+ + DP L  DE+   S+ +VAELA +CT  +  +RP+M H VN L P
Sbjct  779  FRRNILDKENFLKSSPDPNLHLDEEDLISLWEVAELARYCTAREPSQRPDMSHAVNKLAP  838

Query  261  FAHNWR  244
                W+
Sbjct  839  LVEKWK  844



>ref|XP_010551437.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   549 bits (1415),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 346/754 (46%), Positives = 464/754 (62%), Gaps = 69/754 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLPSEL  2462
             DAA M  L  +L+P PS GWS   DPC W +V C    GN V  I I   ++ G LP +L
Sbjct  34    DAAAMFALRKSLNPPPSLGWS-DPDPCKWDHVGCTD--GNRVTRIQIGHCNLQGTLPPDL  90

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L  L +Q N +SGP+PS + +SSL+ L L +N F SIP DF  GL +L+   I D
Sbjct  91    RNLSELERLELQLNKISGPVPSLSGLSSLQVLMLSNNLFDSIPRDFFSGLSSLQSVEI-D  149

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N   S W+I   L  +++L +F A++A++TG++P+F   D FP L  L L++N+L G LP
Sbjct  150   NNPFSAWEIPESLRNASALQNFSANSANVTGILPDFLGPDEFPGLSVLHLAFNDLQGELP  209

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
                  S+IQ+LWLN Q+ GL+G IDV+ +MT L +VWL +NAF+GP+P+ S    L  L 
Sbjct  210   SGLSGSQIQSLWLNGQKSGLTGRIDVLQNMTALREVWLHSNAFSGPLPEFSGLEELESLS  269

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPC  1751
             L DN  TG VPVSLT L +L+ + L NN L G +P F N V V ++ D+NSFC  +PG C
Sbjct  270   LRDNLFTGPVPVSLTNLESLKVVNLTNNLLQGSVPEFKNTVSVDLVKDSNSFCLPSPGEC  329

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+V++LL+    + YP  LAQSWKGND C +W  ITC     N+T +NL     +GTIS
Sbjct  330   DPRVSSLLSIVKSMEYPQRLAQSWKGNDPCVSWIGITC--SNGNITVINLEKMGLNGTIS  387

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             P F  + SL+ + L  NNLTG IP  LTTLP L+ LDVSNN L   +P F   V ++  G
Sbjct  388   PLFGSIKSLQRIVLGGNNLTGTIPQELTTLPELRGLDVSNNQLYGKVPEFRSNVIVNTAG  447

Query  1390  NLLLEK-----------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvF  1244
             N  + K             ++G+G+      +N  S S    ++  ++  ++ + ++ + 
Sbjct  448   NPDIGKDKTPPSPDSSSDPSSGKGN----NVKNSKSSSLAGIIIGSVIGSMLSIFLIGLL  503

Query  1243  YKCYMKREHKRFGRAKSP--------------EKIKST----------------------  1172
               C+ K+  KRF R +SP              E +K T                      
Sbjct  504   AFCWYKKRQKRFTRVQSPNAVVVHPRHSGSDNESVKITVAGSSVSVGAISETYTLPSTSE  563

Query  1171  ----QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
                  M++   ++   I IQVL   TN FSE+++LG GG+GVVY G+L +GTK+AVK+M+
Sbjct  564   AGDIHMVEAGNML---ISIQVLRCVTNNFSEQNILGQGGFGVVYKGELHDGTKIAVKRME  620

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
              G    KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF W 
Sbjct  621   SGVIPGKGFAEFRSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWS  680

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  PL WKQR+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV
Sbjct  681   EEGLKPLEWKQRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLV  740

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  741   RLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  774


 Score =   131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDVY+FGV+LMEIITG+KA+DE+ P+E+ HLV+W
Sbjct  749  SIETRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEIITGRKALDESQPEESMHLVSW  808

Query  438  FHKI-IRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F ++ I K    +KA+DP++D DE+T  S+  VAELA HC   + Y+RP+M H VN+L  
Sbjct  809  FKRMFINKESAFKKAVDPSIDLDEETLVSVHTVAELAGHCCAREPYQRPDMGHAVNILSS  868

Query  261  FAHNWR--SLRPEEIVEKFGGFDLNMSLP  181
               +W+     PE+I     G DL MSLP
Sbjct  869  LVESWKPSDQNPEDIY----GIDLEMSLP  893



>ref|XP_010528574.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   547 bits (1410),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 343/751 (46%), Positives = 461/751 (61%), Gaps = 61/751 (8%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DDA+ M  L  +L+P PS GWS   +PC W NV C   +  V  I I   ++ G LP +L
Sbjct  33    DDASAMLALRKSLNPPPSLGWSG-PNPCKWKNVGCAD-SNRVTRIQIGHCNLQGTLPPDL  90

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+ L  L +Q N +SGP+PS + +SSL+ L L +N+F SIP DF +GL +L+   I D
Sbjct  91    RNLSELERLELQWNKISGPVPSLSGLSSLQVLMLSNNQFDSIPSDFFVGLSSLQSVEI-D  149

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N   S W+I   L +++ L +  A++A++TG +P+F   D FP L  + L++N+L G LP
Sbjct  150   NNPFSAWEIPESLRDASGLQNLSANSANVTGKLPDFLGQDEFPGLSVMHLAFNDLQGELP  209

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              S   S++Q+LWLN Q+ GL+G I V+ +MT L +VWL  NAF+GP+PD S    L  L 
Sbjct  210   SSLSGSQVQSLWLNGQKSGLTGRIHVLQNMTALREVWLHLNAFSGPLPDFSGLKALESLS  269

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPC  1751
             L DN  TG VPVSLT L +L+ + L NN L GP+P F + V V ++ ++NSFC  +PG C
Sbjct  270   LRDNLFTGPVPVSLTNLESLKVVNLTNNLLQGPVPAFKSSVSVDLVEESNSFCLPSPGEC  329

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             D +V+ LL     +GYP  LAQSWKGND C +W  ITC     N+T +NL     +GTIS
Sbjct  330   DHRVSTLLLIVKSMGYPQRLAQSWKGNDPCASWIGITC--SNGNITVINLEKMGLNGTIS  387

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             P    + SL+ L L  NNLTG IP  LTTLP L+ LDVSNN L   +P+F   V ++  G
Sbjct  388   PELGSIRSLQRLVLGGNNLTGTIPQELTTLPDLRGLDVSNNQLYGKVPAFRSNVVVNTAG  447

Query  1390  NLLLEK--------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
             N  + K        + A     PGS    + SS    + +  V   ++ V ++  + + C
Sbjct  448   NPDIGKDKRPSPSGSSADPSSGPGSSGRNSKSSTLTGIIIGSVTGGILFVFLIGILAF-C  506

Query  1234  YMKREHKRFGRAKSP--------------EKIKST-------------------------  1172
             + K+  KRF R +SP              E +K T                         
Sbjct  507   WYKKNQKRFTRVQSPNTMVIHPRHSGSDNESVKITVAGSSVSVGAVSETYTLPSTSEAGD  566

Query  1171  -QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGA  995
              QM++   ++   I IQVL   T+ FS+E++LG GG+GVVY G+L +GTK+AVK+M+ G 
Sbjct  567   IQMVEAGNML---ISIQVLRSVTDNFSQENILGQGGFGVVYKGELHDGTKIAVKRMESGV  623

Query  994   THTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHG  815
                KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLV+EYM  GTL  HLF W + G
Sbjct  624   ISGKGSAEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVFEYMPQGTLSRHLFNWSEEG  683

Query  814   FDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKA  635
               PL WKQR+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+ A
Sbjct  684   LKPLEWKQRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLA  743

Query  634   PDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             P+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   PEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  774


 Score =   132 bits (333),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 7/149 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDVY+FGV+LMEIITG+KA+DET P+++ HLV+W
Sbjct  749  SIETRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEIITGRKALDETQPEDSMHLVSW  808

Query  438  FHKI-IRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F ++ I K     KAIDPT++ DE+T  SI  VAELA HC   + Y+RP+M H VN+L  
Sbjct  809  FKRMFINKDSAFNKAIDPTIELDEETLASIQTVAELAGHCCAREPYQRPDMGHAVNILSS  868

Query  261  FAHNWR--SLRPEEIVEKFGGFDLNMSLP  181
                W+     PE+I     G DL+MSLP
Sbjct  869  LVELWKPSDQNPEDIY----GIDLDMSLP  893



>ref|XP_010043988.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW85995.1| hypothetical protein EUGRSUZ_B02699 [Eucalyptus grandis]
Length=939

 Score =   547 bits (1410),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 342/750 (46%), Positives = 456/750 (61%), Gaps = 64/750 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLPSEL  2462
             D   M  L  +++ P+   WS + DPC W  V+C   TGN V  I I  + +SG LP ++
Sbjct  36    DVNAMQALKKSVTLPSSLDWSDA-DPCKWPQVSC---TGNRVTRIQIGMRGVSGTLPPDI  91

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
             + L  L    V  +  SGPLPSFA ++ L+ L L+ N F+SIP DF  G+ +L+   +S 
Sbjct  92    SNLTELTRFEVMNSQFSGPLPSFAGLAQLQVLLLNRNNFTSIPADFFTGMSSLQAVDLSY  151

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLP  2108
             N   + W+I + L +  +L +F A+ A++ G IPNF ++  FP+L  L+L++NNL G LP
Sbjct  152   N-SFAAWEIPASLKDCNALQNFTATQANVIGQIPNFINAENFPSLFALQLAFNNLEGGLP  210

Query  2107  GSFGS--SEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF +   +I  L        L+GTIDVI++MT+L+QVWL +N FTG IPD+S   NL+D
Sbjct  211   ASFATLTIQILWLNGKAGNSQLNGTIDVIANMTQLAQVWLHSNQFTGSIPDVSNFKNLWD  270

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNK-VKVILGDTNSFCKDTPG  1757
               + DNQLTGVVP SL  LP+L+ + L NN L G MP F  K V+V +  TNSFC   PG
Sbjct  271   FSVRDNQLTGVVPESLVKLPSLKVVNLTNNLLQGSMPAFDTKAVQVDMTGTNSFCSSNPG  330

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
              PCDP V  LL+ A  +GYP+  AQ W GN AC +W  I+C   G N+  +N  N   SG
Sbjct  331   IPCDPMVNILLSIARPMGYPVKFAQGWLGNSACNSWTGISC--SGGNIVVINFQNMGLSG  388

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TI+P +S +TSL  L L+ N+LTG IP  LTTL +L+VLDVS NNLS  +P+F   VNI 
Sbjct  389   TIAPEYSNITSLERLLLSHNSLTGTIPSELTTLSNLKVLDVSYNNLSGKVPTFRSNVNII  448

Query  1399  FGGNLLLEKTV-------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
               GN  + K +        T  GSPG   ++N  S  AR+   +V    ++ L+ L  +Y
Sbjct  449   KDGNPNIGKDIAPPASPTTTPPGSPGG--SDNKKSSVARIVAPLVGGASLIALLGLVFWY  506

Query  1240  KCYMKREHKRFGRAKSPEKI-----------------------------------KSTQM  1166
                 ++  K  G+ +SP  +                                     T  
Sbjct  507   ----RKRPKSSGKVQSPNNVLVIHPRHSGDQNGVKITVAGSSANGGSSETHSQGSGGTGD  562

Query  1165  LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
             +   E     I IQVL   TN FS++++LG GG+G VY G+L +GTK+AVK+M+ G    
Sbjct  563   IHVVEAGNMVISIQVLRNVTNNFSQDNILGRGGFGTVYKGELHDGTKIAVKRMESGVISE  622

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG NEF+AEIA L+KVRH++LVAL+GYC+  ++ LLVYEYM  GTL  HLF WK  G  P
Sbjct  623   KGFNEFKAEIAVLTKVRHRHLVALLGYCLEGNERLLVYEYMPQGTLSRHLFNWKDEGLKP  682

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPD-  629
             L W +R++IA DVARG+EYLH L HQ+FIHRD+K SNILL DD+RAKVADFGLV+ AP+ 
Sbjct  683   LEWTRRLSIALDVARGVEYLHGLAHQTFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEG  742

Query  628   DKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
              K  +ETR+AGTFGYLAPEYA TGRVT K+
Sbjct  743   GKGSIETRLAGTFGYLAPEYAVTGRVTTKA  772


 Score =   128 bits (322),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K DV++FGV+LME+ITG++A+DET P+++ HLVTW
Sbjct  746  SIETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMEMITGRRALDETQPEDSVHLVTW  805

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDP +D DE+T  S+S +AELA HC   + Y+RP+M H V+VL   
Sbjct  806  FRRMHLNKDTFRKAIDPVIDLDEETLASVSTIAELAGHCCGREPYQRPDMGHAVSVLSSL  865

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+   P+   E   G DL M+LP
Sbjct  866  VELWKPSEPDS--EDMYGIDLEMTLP  889



>ref|XP_011070545.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Sesamum 
indicum]
Length=930

 Score =   546 bits (1408),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 340/746 (46%), Positives = 448/746 (60%), Gaps = 55/746 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAAVM +L  +L +P   GW    +PC W  V C +  G V  I I +Q++ G+LPS L 
Sbjct  24    DAAVMQELKKSLNAPIQLGW-GDANPCNWKYVQCSR-DGRVTRIQIKNQNLQGSLPSTLN  81

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+SL+   VQ N L GP+PSF+ +SSL+ + L  N F+SIPPDF  GL +L+  ++ D 
Sbjct  82    KLSSLQVFEVQDNHLGGPVPSFSGLSSLQSVILSRNNFTSIPPDFFDGLTSLQSMTL-DY  140

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W I   L  +T+L +F A++ +ITG +P+ F  D FP+L  LRLSYNNL G LP 
Sbjct  141   NPFSSWVIPDGLKSATTLQAFSATSTNITGPMPDIFGSDKFPSLTVLRLSYNNLEGPLPS  200

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S IQ+L          L+G+I V+ +MT+L+ VWL  N+F+GPIPDLS    L DL
Sbjct  201   SFAGSSIQSLWLNGQKSSSRLNGSIAVLQNMTQLAVVWLHGNSFSGPIPDLSALTQLQDL  260

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-P  1754
              L DN LTG VP SL GL +L+ + L NN L G  P F   ++V +   NSFC   PG  
Sbjct  261   SLRDNSLTGPVPDSLVGLKSLKVVNLTNNMLQGKTPKFSGSIQVDMAGLNSFCLSVPGLE  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQRFSGT  1577
             CDP+V  LL  A  +GYP + A++WKGND C N W  ITC     N+T VN       GT
Sbjct  321   CDPRVNILLDVARDVGYPTSFAENWKGNDPCTNSWRGITC--SNGNITVVNFNGMGLVGT  378

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP+FSQ+TSL+ L L++N L+G IP  LT LP+L +LD+SNN +   +P F   VN+  
Sbjct  379   ISPSFSQITSLQRLVLSNNYLSGKIPNELTNLPNLVLLDISNNEIYGKVPPFQSTVNVKT  438

Query  1396  GGNLLLEKTV-------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
              GN+ + K           G    G G   +    S++  +V   V  +   +       
Sbjct  439   DGNVNIGKDTPPPTRHGGDGNSPGGDGSGNSHGKKSSKGVIVGSAVGGVCAFLAAGGLVF  498

Query  1237  CYMKREHKRFGRAKSPEKIKSTQMLKTNE------IMGTA--------------------  1136
             C  KR+  R  + KSP  +     L  ++      I G++                    
Sbjct  499   CLYKRKQNR--KVKSPNTMVIHPRLSGSDDTVKITIAGSSANGGTTGSSSNGSNGQNDIH  556

Query  1135  --------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKG  980
                     I IQVL   TN FS E+VLG GG+G VY G+L +GTK+AVK+M+ G    KG
Sbjct  557   IVEAGNMVISIQVLRSVTNDFSAENVLGRGGFGTVYKGELHDGTKIAVKRMESGVMSEKG  616

Query  979   MNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLT  800
             ++EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL   LF WK+ G  PL 
Sbjct  617   LDEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRFLFHWKEEGLKPLE  676

Query  799   WKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKS  620
             W +R+ IA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K+
Sbjct  677   WTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPDGKA  736

Query  619   FVETRVAGTFGYLAPEYATTGRVTKK  542
              V TR+AGTFGYLAPEYA TGRV+ K
Sbjct  737   SVATRLAGTFGYLAPEYAVTGRVSTK  762


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K+DV++FGV+LME+ITG+KA+DETLP+++ HLV W
Sbjct  737  SVATRLAGTFGYLAPEYAVTGRVSTKIDVFSFGVILMEMITGRKALDETLPEDSQHLVPW  796

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++       KAIDP +D +++T  S+S VAELA HCT  + ++RP+M H VNVL   
Sbjct  797  FRRMLINKDAFPKAIDPAIDLNKETLASLSTVAELAGHCTAREPFQRPDMGHAVNVLSSL  856

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
            A  W+   P +  E   G D +M+LP
Sbjct  857  AELWKPSEPAD-PEDLYGIDYDMTLP  881



>ref|XP_007225345.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
 gb|EMJ26544.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
Length=941

 Score =   545 bits (1404),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 351/744 (47%), Positives = 455/744 (61%), Gaps = 51/744 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D   M  L  ++ P   GWS S D C W+ V+C K    V  I I +Q ++G+LP+EL +
Sbjct  32    DGVAMEALRKSIGPNSLGWSGS-DYCKWSKVSC-KNDNKVFKIQIGNQKLTGSLPTELQK  89

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             LA L+ L VQ N L+GP PS + ++SL+ L   +N FSS PPDF +GL NL    I D  
Sbjct  90    LAYLQQLEVQSNELTGPFPSLSGLTSLQVLIAHNNNFSSFPPDFFVGLTNLYSIDI-DYN  148

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLPGS  2102
               S WQI   +  +T L  F A++A+ITG IP+FF   +FP+L +L +S+N L G LP S
Sbjct  149   PFSAWQIPGTITNATVLKHFSATSANITGKIPDFFTGTNFPSLIDLHMSFNYLEGELPAS  208

Query  2101  FGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             F  S IQ+L          L+GTIDV+ +MT L  VWL  N+FTGPIPD SK  NL  L 
Sbjct  209   FSGSMIQSLWLNGQQGTNKLNGTIDVLQNMTNLHDVWLHGNSFTGPIPDFSKLSNLAALS  268

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-C  1751
             L DN+ TGVVP SL  L +L  + L NN L GPMP FG+ VKV +   NSFC D PG  C
Sbjct  269   LRDNKFTGVVPASLVNLNSLTAVNLTNNMLQGPMPKFGDGVKVDITGLNSFCNDKPGSDC  328

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+V  LL+    +GYP T A++WK ND C NW  ITC+  G+NVT +N  N   +GTIS
Sbjct  329   DPRVNILLSIVKDMGYPTTFAENWKKNDPCDNWKGITCN--GRNVTVINFPNLGLAGTIS  386

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
               FS LTSLR L L+ N+LTG IP  LT LP LQ +D+ NN L   +P+F   V +   G
Sbjct  387   SNFSLLTSLRTLRLDSNHLTGTIPKELTQLPDLQEIDLRNNQLYGKIPAFKSNVIVKTEG  446

Query  1390  NLLLEK----TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CYMK  1226
             N  + K           +P  G   +G+   +R  VVV  V+  V  +V+  F   C +K
Sbjct  447   NPDIGKDHISPNTPPGPNPTPGPPSDGAGKKSRTAVVVGAVIGSVGGLVVLGFVAFCLLK  506

Query  1225  REHKR-FGRAKSP-------------EKIKSTQM----------------------LKTN  1154
             R+HK   GR +SP             + +K T                        +   
Sbjct  507   RKHKHSSGRVQSPNTLVIHPRHSGDQDAVKVTVASSRVNGGGNEYYNSPTSSGPNDIHVV  566

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E     I IQVL   TN FSE+++LG GG+G VY G+L +GTK+AVK+M+ G    KG+N
Sbjct  567   EAGNMVISIQVLRNVTNNFSEDNILGKGGFGTVYKGELHDGTKIAVKRMESGVVAGKGLN  626

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF WK+ G  PL W 
Sbjct  627   EFKSEIAVLTKVRHRHLVGLLGYCLDGNERLLVYEYMPQGTLSQHLFNWKEDGLKPLEWT  686

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             +R+TIA DVARG+EYLH L +Q+FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+ +
Sbjct  687   RRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKASI  746

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGR+T K
Sbjct  747   ETRLAGTFGYLAPEYAATGRMTLK  770


 Score =   144 bits (364),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  745  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRKAIDESQPEESLHLVTW  804

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++     L+KAIDPT+D  E+T  SIS VAELA HCT  + Y+RP+M H VNVL   
Sbjct  805  FRRMLINKDALRKAIDPTIDISEETLSSISTVAELAGHCTARESYQRPDMGHAVNVLSSL  864

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
              +W+   PE+  + + G DL M+LP
Sbjct  865  VEHWKPSEPEDYDDMY-GIDLEMTLP  889



>ref|XP_002533475.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF28907.1| receptor protein kinase, putative [Ricinus communis]
Length=951

 Score =   544 bits (1401),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 342/759 (45%), Positives = 453/759 (60%), Gaps = 69/759 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +DA VM  L  +L+ P   GWS   DPC W +V C      V  I I  Q++ G LPS L
Sbjct  34    EDAPVMFALRKSLNVPDSLGWS-DPDPCNWKHVTCSDEK-RVTRIQIGRQNLEGTLPSNL  91

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L  L +Q NS+SGPLP+   ++SL  + L  N+F+SIP DF  GL +L+   I D
Sbjct  92    QNLTQLERLELQWNSISGPLPTLKGLASLLVVMLSGNQFTSIPSDFFTGLSSLQSVEIDD  151

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N   S W I   + ++++L +F A++A+++G IP+FF  DSFP L  L L+ N L G LP
Sbjct  152   N-PFSTWVIPESIKDASALQNFSANSANLSGSIPDFFGPDSFPGLTILHLALNELQGGLP  210

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             G+F  S+IQ+L       +  L+G IDVI +MT L  VWL +N F+GP+PD S   +L  
Sbjct  211   GTFSGSQIQSLWLNGQTSKGKLTGGIDVIKNMTLLKDVWLHSNGFSGPLPDFSGLKDLEV  270

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVIL-GDTNSFCKDTPG  1757
             L + DN  TG +P+SLT L +L+ + L NN   GPMP+F   V V L  D+NSFC  +PG
Sbjct  271   LSIRDNSFTGPIPLSLTALASLKAVNLSNNLFQGPMPVFKRLVSVDLTADSNSFCLPSPG  330

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CD +V  LL  A  +GYP   A+SWKGND C +W  ITC   G N+T VN      +GT
Sbjct  331   DCDSRVKTLLLIAKSVGYPQRFAESWKGNDPCADWVGITC--TGGNITVVNFQKMGLTGT  388

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ++P F+ L SL+ L L++NNLTG IP  LTTLP L+ LDVSNN +S  +P+F   V ++ 
Sbjct  389   VAPEFAMLLSLQRLVLDNNNLTGSIPQELTTLPALKQLDVSNNQISGKIPTFKSNVMVNT  448

Query  1396  GGNLLLEKTV--ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-----  1238
              GN  + K V  +T  GSP SG T  G+   +             + V+LF         
Sbjct  449   NGNPDIGKDVNTSTTPGSP-SGATMAGTGSGSGNSGNGGKKSSSNIGVILFSVIGGVFVI  507

Query  1237  --------CYMKREHKRFGRAKSP--------------EKIKST----------------  1172
                     C  K++ KRF + +SP              E +K T                
Sbjct  508   SLIGLLIFCIYKKKQKRFSKVQSPNAMVIHPRHSGSDNESVKITVAGSSVSVGAISETHT  567

Query  1171  ---------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVA  1019
                      QM+++  ++   I IQVL   TN FSE+++LG GG+G VY G+L +GTK+A
Sbjct  568   FPASEQGDIQMVESGNMV---ISIQVLRNVTNNFSEDNLLGQGGFGKVYKGELHDGTKIA  624

Query  1018  VKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHH  839
             VK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYE+M  G L  H
Sbjct  625   VKRMESGVISGKGLAEFKSEIAVLNKVRHRHLVALLGYCLDGNEKLLVYEFMPQGALSRH  684

Query  838   LFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVA  659
             LF W   G  PL W +R+ IA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVA
Sbjct  685   LFHWADDGLKPLEWTRRLIIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVA  744

Query  658   DFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             DFGLV+ APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  745   DFGLVRLAPDGKGSIETRIAGTFGYLAPEYAVTGRVTTK  783


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 91/148 (61%), Gaps = 2/148 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+D++ P+E+ HLVTW
Sbjct  758  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDDSQPEESMHLVTW  817

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAIDP +D DE+T  S+S VAELA HC   + Y+RP+M H VNVL   
Sbjct  818  FRRVHINKDSFRKAIDPAIDVDEETLASVSTVAELAGHCCAREPYQRPDMGHAVNVLSSL  877

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLV  175
               W+    ++  E   G DL++SLP V
Sbjct  878  VELWKP--SDQYPEDVYGIDLDLSLPQV  903



>ref|XP_010424954.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=948

 Score =   527 bits (1358),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 336/752 (45%), Positives = 446/752 (59%), Gaps = 59/752 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D + M  L ++L+  +   WS + +PC W +V CD  +  V  I +  + I G LP +L 
Sbjct  29    DDSTMKALKSSLNLTSDVDWS-NPNPCKWVSVECDG-SNRVTKIQLKQKGILGTLPPDLQ  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ L  L +  N +SGP+P  + +S L+ L L  N F+S+P +   G+ +L+   + +N
Sbjct  87    NLSELVILELFLNRISGPIPDLSGLSRLQTLNLHDNLFTSVPKNLFAGMNSLQEVYL-EN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPG  2105
               LSPWQI   + E+TSL +   SN SI G IP+ F S   P+L+NL+LS N L G LP 
Sbjct  146   NPLSPWQIPDTIKEATSLQNLTLSNCSIFGEIPDLFGSVSLPSLKNLKLSQNRLQGGLPQ  205

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  + +Q L          L+G+I V+S+MT L +V LQ N F+GPIPDLS  ++L   
Sbjct  206   SFAGTSLQTLFLNGQMSDSKLNGSISVLSNMTSLVEVSLQGNDFSGPIPDLSGLLSLRSF  265

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTP-G  1757
              + +NQLTG+VP SL  +  L  + L NN   GP PLFG  V V I   TNSFC D P G
Sbjct  266   NVRENQLTGLVPQSLIRMNTLATVNLTNNHFQGPTPLFGKSVGVDIFKKTNSFCTDAPGG  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCD +V  LL+ A   GYP+ LA SWKGND C NW  ITC   G N+T VNL  Q  SGT
Sbjct  326   PCDTRVDILLSVAESFGYPVKLADSWKGNDPCVNWVGITC--SGSNITVVNLRKQGLSGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             IS + + LTSL  + L+DN+L+GPIP  LTTLP L+ LDVSNN++    P F   VN+  
Sbjct  384   ISSSLANLTSLETINLSDNDLSGPIPAELTTLPKLRTLDVSNNDIFGTPPKFRETVNVVI  443

Query  1396  GGNLLLEKT-VATGRGSPGSG----------QTENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  + K   +   G+PG+                S  S+ + ++V +V  +V  + L 
Sbjct  444   TGNANIGKDGPSRPSGTPGASPGGNKPSGGSGGSETSKKSSNVKIIVPVVGGVVGALCLV  503

Query  1249  vFYKCYMKREHKRFGRAKSP--------------EKIKSTQM------------------  1166
                 C   ++ KR  R +SP              + IK T                    
Sbjct  504   GLGVCLYAKKRKRPARVQSPTSNMVIHPHHSGDNDDIKLTVAASSLNSGGGSDSYSHSGS  563

Query  1165  ----LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                 +   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+  
Sbjct  564   GGSDIHVVEAGNLVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESS  623

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
                 KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF+WK+ 
Sbjct  624   VVSDKGLAEFKSEITVLTKMRHRHLVALLGYCLDGNERLLVYEYMPQGTLSEHLFQWKER  683

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G  PL W +R+ IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ 
Sbjct  684   GLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRL  743

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             APD K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  744   APDGKYSIETRVAGTFGYLAPEYAVTGRVTTK  775


 Score =   116 bits (291),  Expect(2) = 1e-174, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII--RKSHNLQKAIDPT  385
            G    KVD+++ GV+LME+ITG+KA+DET P+++ HLVTWF ++   +  +  + AIDP 
Sbjct  770  GRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRVAASKDENAFKNAIDPN  829

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLR--PEEIVEKF  211
            +  D++T  SI KV ELA HC   + Y+RP+M H+VNVL      W+     P+++    
Sbjct  830  ISLDDETVASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWKPTETDPDDVY---  886

Query  210  GGFDLNMSLPLVFDD-SSIESLSFT  139
             G D +M LP V     + E LS T
Sbjct  887  -GIDYDMPLPQVLKKWQAFEGLSQT  910



>ref|XP_011038249.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=945

 Score =   543 bits (1400),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 345/756 (46%), Positives = 457/756 (60%), Gaps = 68/756 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA VM  L  +L+ P   GWS   DPC W +V C      V  I I  Q++ G LPS L 
Sbjct  33    DAEVMFSLKKSLNVPDSLGWS-DPDPCNWNHVVCSDEK-RVTRIQIGRQNLQGTLPSNLQ  90

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L +Q N++SGPLPS   +SSL+ + L  N+F S+P DF  GL +L+   I DN
Sbjct  91    NLTQLERLELQYNNISGPLPSLNGLSSLQVILLSDNKFISVPSDFFTGLSSLQSVEI-DN  149

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W I   +  +++L +F A++A+I+G IP FF  DSFP L  LRL++N+L G LP 
Sbjct  150   NPFSNWVIPESIKNASALQNFSANSANISGSIPGFFGPDSFPGLTILRLAFNDLEGELPA  209

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  S++Q+LWLN Q+   SG IDVI +MT L +VWL +N F+GP+PD S   +L  L L
Sbjct  210   SFSGSQVQSLWLNGQKL--SGGIDVIQNMTSLREVWLHSNGFSGPLPDFSGLKDLESLSL  267

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPCD  1748
              DN  TG+VP SL  L +L+ + L NN L GPMP+F + V V ++ D+N FC  TPG CD
Sbjct  268   RDNSFTGLVPESLVDLESLKFVNLSNNLLQGPMPVFKSSVSVDMVKDSNRFCLPTPGLCD  327

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
              +V  LL+    + YP  LA SWKGND C +W  ITC+    N+T VN      +G+ISP
Sbjct  328   SRVNTLLSIVKSMDYPQRLADSWKGNDPCADWIGITCN--NGNITVVNFEKMGLTGSISP  385

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
              F+ + SL  L L +NNLTG IP  +TTLP L+VLDVSNN+L   +P+F   V ++  GN
Sbjct  386   DFAWVKSLERLVLANNNLTGSIPQEITTLPGLKVLDVSNNHLYGRVPAFTSNVIVNTNGN  445

Query  1387  LLLEKTV--ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK--------  1238
               + K V  +T   SP +  + N  S S             ++++++F            
Sbjct  446   PEIGKDVNSSTSLESPSASPSANTGSGSGGSSRKSGKKSSTLIVIIIFAVIGGVFLLSLI  505

Query  1237  -----CYMKREHKRFGRAKSP--------------EKIKST-------------------  1172
                  C  K++ KRF R +SP              E +K T                   
Sbjct  506   GLLVFCLYKKKQKRFSRVQSPNEMVIHPRHSGSDNESVKITVAGSSISVGAISETHTIPA  565

Query  1171  ------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                   QM++   ++   I IQVL   TN FSE ++LG GG+GVVY G+L +GTK+AVK+
Sbjct  566   SEQGDIQMVEAGNMV---ISIQVLRNVTNNFSEGNILGWGGFGVVYKGELHDGTKIAVKR  622

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  H+F 
Sbjct  623   MESGVISGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHIFN  682

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFG
Sbjct  683   WAEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFG  742

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   LVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  778


 Score =   126 bits (317),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 88/147 (60%), Gaps = 6/147 (4%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE  P+E+ HLVTW
Sbjct  753  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDERQPEESLHLVTW  812

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  813  FRRMHLNKDTFRKAIDPTIDLNEETLASISTVAELAGHCCAREPYQRPDMGHNVNVLSSL  872

Query  258  AHNWRSL--RPEEIVEKFGGFDLNMSL  184
               W+    R E+I     G DL MSL
Sbjct  873  VELWKPTDQRSEDIY----GIDLEMSL  895



>ref|XP_008795408.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=919

 Score =   542 bits (1397),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 336/721 (47%), Positives = 460/721 (64%), Gaps = 27/721 (4%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DAA M  L  AL P+    WSAS DPCT W  V C   +G V  + + +  ISG+LP ++
Sbjct  43    DAATMRTLAKALDPSGKLNWSASSDPCTSWGGVRCT--SGRVTGVLVSNSGISGSLPPDV  100

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L++L  L +  N LSGPLPS A + +L  L+L +N FSSIP DF  GL +L    + D
Sbjct  101   RNLSALTRLELMINKLSGPLPSLAGLGALTTLFLANNSFSSIPEDFFSGLNSLTNVYL-D  159

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS-FPNLQNLRLSYNNLTGSLPG  2105
                L+ W I S L  ++ L +F A+  ++TG IP+F  + FP+  +L L+ NNLTG +P 
Sbjct  160   TNPLASWTIPSSLRTASGLVNFSANGVNLTGTIPDFLGTGFPSFYHLALAGNNLTGPIPS  219

Query  2104  SFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             SFG+S + +L   N +  GLSG IDVI +MT L  ++L +N+F+GPIPDLS+  NL+DL 
Sbjct  220   SFGASPLNSLWLNNQKGSGLSGRIDVIQNMTNLKLLYLMSNSFSGPIPDLSRLENLYDLD  279

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVIL-GDTNSFCKDTPGPC  1751
             L DNQLTG VP SLT L +L+ + L NN L G +P+F N V+V L  DT  FC      C
Sbjct  280   LRDNQLTGPVPSSLTSLKSLKRVVLTNNLLQGQVPVFPNTVEVELDADTERFCLTNGTAC  339

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+V  LL+ A    YP  LA  WKGND C  +  ITCDP G N+T+V L    F+GTIS
Sbjct  340   DPRVNVLLSIAKSFYYPTYLANQWKGNDPCNGFTGITCDPSG-NITSVVLQKLAFNGTIS  398

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             P F  L  L+ L L+ NNLTG IP  LT L +LQ+LDVSNN L   +PSF   V+++  G
Sbjct  399   PDFQLLPKLQKLILSGNNLTGTIPSELTNLKYLQLLDVSNNALWGKVPSFGGNVSVNTDG  458

Query  1390  NLLLEKTVATGRGSPGSGQTENGSS------MSARMfvvvvivvvivvlvvlfvFYKCYM  1229
             N  + K    G G+PG+    +G+S       S  + +  ++  V   L + F+ + C+ 
Sbjct  459   NPNIGKDTGNG-GTPGTNSPNSGNSGDGGRKKSTGVIMGSIVAAVCGALFIGFLGFWCWK  517

Query  1228  KREHKRFGRAKS-----PEKIKSTQMLKTN------EIMGTAIKIQVLEKATNFFseesv  1082
             +++H +  +              TQ+ K +      E     + IQ+L + TN FSE ++
Sbjct  518   RKKHIKVQKTNDMVIDLKHSGSDTQLSKVDSGLIIAEPGSMVVSIQLLREVTNNFSEVNI  577

Query  1081  lgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYC  902
             LG GG+G VY G+L +G+ +AVK+M+ G   +KG+NEF++EI+ L+KVRH+NLV+L+GYC
Sbjct  578   LGRGGFGTVYKGELHDGSMIAVKRMETGVMGSKGLNEFKSEISVLTKVRHRNLVSLLGYC  637

Query  901   INDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSF  722
             + +++ +LVYE+M  GTL HHLF+W +    PL WK+R+TIA DVARG+EYLHSL +Q+F
Sbjct  638   LEENERILVYEHMPQGTLSHHLFDWMELELKPLEWKKRLTIALDVARGVEYLHSLANQTF  697

Query  721   IHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             IHRD+K SNILL D++RAKVADFGLV+ AP+D   +ETR+AGTFGYLAPEYA  GRVT K
Sbjct  698   IHRDLKPSNILLGDNMRAKVADFGLVRLAPEDNRSIETRLAGTFGYLAPEYAVMGRVTTK  757

Query  541   S  539
             +
Sbjct  758   A  758


 Score =   117 bits (294),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 4/152 (3%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLV  445
            N S+   L G    L       G    K DV++FGV+LME+IT +KA+  T P+E+ HL 
Sbjct  730  NRSIETRLAGTFGYLAPEYAVMGRVTTKADVFSFGVILMELITSRKAIVTTQPEESMHLA  789

Query  444  TWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            TWF ++       QKAIDP +  DE+T ESI  VA LA HCT  + Y+RP+M + VNVL 
Sbjct  790  TWFRRMHLNKDAFQKAIDPNIILDEETLESIKTVANLAGHCTMREPYQRPDMAYAVNVLS  849

Query  264  PFAHNWRSLRPEEIVEKFG-GFDLNMSLPLVF  172
              A  W   +P +     G G DL   LP V 
Sbjct  850  SLAEIW---KPTDAYSDDGYGIDLETPLPEVL  878



>ref|XP_010936890.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=958

 Score =   543 bits (1400),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 335/763 (44%), Positives = 456/763 (60%), Gaps = 68/763 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAA M  L   L    + GW+ + DPC WT V C +  G V +I + ++S++G LP+E+ 
Sbjct  33    DAAAMRALAKGLEADRALGWTGTTDPCAWTGVTCTE--GRVTAIQVGNRSLAGTLPAEVR  90

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPP-DFLLGLPNLRIFSISD  2282
              L +L  L V  N LSG LPS A +SSL+ L L  N FS +PP DF  GL +L+   + D
Sbjct  91    NLTALLRLEVHDNQLSGVLPSLAGLSSLQALLLHGNRFSGVPPPDFFSGLSSLQSAYLDD  150

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPG  2105
             N    PW I + L ++ +L +F A++A+++G +P+F   +FP+L +L L++N L+G +P 
Sbjct  151   N-PFDPWPIPANLKDAAALVNFSANSANVSGELPDFLATAFPSLDHLALAFNLLSGPVPA  209

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF ++ +++L          LSG I  +++MT L ++WL +N F GP+PD S   +L DL
Sbjct  210   SFATAPLRSLWLNNQLGSSRLSGGIAFVANMTSLEEIWLNSNDFFGPLPDFSALQHLQDL  269

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVI--LGDTNSFCKDTPG  1757
             QL DN+LTG VP SLT L +L  + L NN L GP+P+F N VK +  +  T SFC   PG
Sbjct  270   QLRDNRLTGPVPASLTSLKSLNRVTLTNNLLQGPVPVFPNSVKTVDLMPRTESFCLQKPG  329

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC--QNWAFITCDPQGKNVTTVNLGNQRFS  1583
              CDP+V  LL+ A   GYP   A++W GND C    W  I+CD  G N+T +N      +
Sbjct  330   DCDPRVDILLSIAKSFGYPNRFAENWNGNDPCGGGGWPGISCD-SGGNITVINFQKMGLN  388

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTISP F  + SL+ L L+ NNLTG IP +LT LP L+ LDVS+N L   +P+F   + +
Sbjct  389   GTISPDFGSIPSLQKLLLSHNNLTGTIPSTLTKLPSLKELDVSSNFLWGQVPTFNKNIMV  448

Query  1402  SFGGNLLLEKTVATG---RGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK--  1238
             +  GN  + K V+T     G+PG   +++  + SA             V V +       
Sbjct  449   NISGNPNIGKDVSTAPTSAGAPGGASSDSNPTGSADATQSSSSGKSSSVPVGVIAGSVVA  508

Query  1237  -------------CYMKREHKRFGRAKS--------------PEKIKSTQMLKTNEIMGT  1139
                          CY KR+ + FGR +S              P+ +K T    T    GT
Sbjct  509   VVVGISVIGLLGLCYYKRKKQAFGRVQSPNTTVIHPRHSGSDPDTVKITVAGSTLNGGGT  568

Query  1138  A-----------------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
             A                       I IQVL   TN FS E++LG GG+GVVY G+L +GT
Sbjct  569   ASDAYSRTSSGPSDVHVVDAGNMVISIQVLRNVTNNFSRENILGEGGFGVVYKGELHDGT  628

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G   TKG+NEF++EIA LSKVRH+NLV+L+GYC++  + LLVYEYM  GTL
Sbjct  629   KIAVKRMEAGVMGTKGLNEFKSEIAVLSKVRHRNLVSLLGYCLDGSERLLVYEYMPQGTL  688

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               HLF WK+ G  PL WK+R++IA DVARG+EYLHSL HQSFIHRD+K SNILL DD++A
Sbjct  689   SRHLFNWKEEGLKPLEWKKRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKA  748

Query  667   KVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             KV+DFGLV+ A      +ET++AGTFGYLAPEYA TGRVT K+
Sbjct  749   KVSDFGLVRLADGKGGSIETKLAGTFGYLAPEYAVTGRVTTKA  791


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K DV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  765  SIETKLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDESQPEESVHLVTW  824

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D DE+T  SI+ VAELA HC   + Y+RP+M H VNVL   
Sbjct  825  FRRMQLNKDTFRKAIDPTMDLDEETLASITTVAELAGHCCAREPYQRPDMGHAVNVLSSL  884

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
            A  W+   P+   E   G DL+M+LP
Sbjct  885  AELWKPSDPDS--EDSYGIDLDMTLP  908



>ref|XP_011070546.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Sesamum 
indicum]
Length=775

 Score =   537 bits (1384),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 338/744 (45%), Positives = 445/744 (60%), Gaps = 57/744 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAAVM +L  +L +P   GW    +PC W  V C +  G V  I I +Q++ G+LPS L 
Sbjct  24    DAAVMQELKKSLNAPIQLGW-GDANPCNWKYVQCSR-DGRVTRIQIKNQNLQGSLPSTLN  81

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+SL+   VQ N L GP+PSF+ +SSL+ + L  N F+SIPPDF  GL +L+  ++ D 
Sbjct  82    KLSSLQVFEVQDNHLGGPVPSFSGLSSLQSVILSRNNFTSIPPDFFDGLTSLQSMTL-DY  140

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W I   L  +T+L +F A++ +ITG +P+ F  D FP+L  LRLSYNNL G LP 
Sbjct  141   NPFSSWVIPDGLKSATTLQAFSATSTNITGPMPDIFGSDKFPSLTVLRLSYNNLEGPLPS  200

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S IQ+L          L+G+I V+ +MT+L+ VWL  N+F+GPIPDLS    L DL
Sbjct  201   SFAGSSIQSLWLNGQKSSSRLNGSIAVLQNMTQLAVVWLHGNSFSGPIPDLSALTQLQDL  260

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-P  1754
              L DN LTG VP SL GL +L+ + L NN L G  P F   ++V +   NSFC   PG  
Sbjct  261   SLRDNSLTGPVPDSLVGLKSLKVVNLTNNMLQGKTPKFSGSIQVDMAGLNSFCLSVPGLE  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQRFSGT  1577
             CDP+V  LL  A  +GYP + A++WKGND C N W  ITC     N+T VN       GT
Sbjct  321   CDPRVNILLDVARDVGYPTSFAENWKGNDPCTNSWRGITC--SNGNITVVNFNGMGLVGT  378

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP+FSQ+TSL+ L L++N L+G IP  LT LP+L +LD+SNN +   +P F   VN+  
Sbjct  379   ISPSFSQITSLQRLVLSNNYLSGKIPNELTNLPNLVLLDISNNEIYGKVPPFQSTVNVKT  438

Query  1396  GGNLLLEKTV-------ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
              GN+ + K           G    G G   +    S++  +V   V  +   +       
Sbjct  439   DGNVNIGKDTPPPTRHGGDGNSPGGDGSGNSHGKKSSKGVIVGSAVGGVCAFLAAGGLVF  498

Query  1237  CYMKREHKRFGRAKSPEKIKSTQMLKTNE------IMGTA--------------------  1136
             C  KR+  R  + KSP  +     L  ++      I G++                    
Sbjct  499   CLYKRKQNR--KVKSPNTMVIHPRLSGSDDTVKITIAGSSANGGTTGSSSNGSNGQNDIH  556

Query  1135  --------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKG  980
                     I IQVL   TN FS E+VLG GG+G VY G+L +GTK+AVK+M+ G    KG
Sbjct  557   IVEAGNMVISIQVLRSVTNDFSAENVLGRGGFGTVYKGELHDGTKIAVKRMESGVMSEKG  616

Query  979   MNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLT  800
             ++EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL   LF WK+ G  PL 
Sbjct  617   LDEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRFLFHWKEEGLKPLE  676

Query  799   WKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKS  620
             W +R+ IA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+ APD K+
Sbjct  677   WTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPDGKA  736

Query  619   FVETRVAGTFGYLAPEYATTGRVT  548
              V TR+AGTFGYLAPEYA  GR T
Sbjct  737   SVATRLAGTFGYLAPEYA--GRAT  758



>ref|XP_008787910.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=955

 Score =   542 bits (1397),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 333/759 (44%), Positives = 455/759 (60%), Gaps = 65/759 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAA M  L   L    + GW+ + DPCTWT V C      V +I I ++S+ G LP+E+ 
Sbjct  36    DAAAMRALAKGLGADRALGWTGTADPCTWTGVTCTD--ARVAAIQIGNRSLVGTLPAEVR  93

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFS-SIPPDFLLGLPNLRIFSISD  2282
              L SL  L +Q+N LSG LPS A +SSL+ L L  N FS ++PPDF  GL +L+   + D
Sbjct  94    NLTSLLRLELQENQLSGHLPSLAGLSSLQTLLLHGNRFSGALPPDFFAGLSSLQSVYL-D  152

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPG  2105
                  PW I + L ++T+L +F A++A+++G +P F   +F +L +L L++N L+G++P 
Sbjct  153   GNPFDPWSIPANLKDATALVNFSANSANVSGELPGFLATAFASLDHLALAFNLLSGAVPA  212

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             +F S+ +++L          LSG +  +++MT L ++WLQ+N FTGP+PD S   +L +L
Sbjct  213   AFASAPLRSLWLNNQLGSSRLSGGVAFVANMTSLEELWLQSNDFTGPLPDFSGLQHLANL  272

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD--TNSFCKDTPG  1757
             QL DN+LTG +P SLT L +L+ + L NN L GP P F + VK +  D  T  FC    G
Sbjct  273   QLRDNRLTGPIPASLTALKSLKRVTLTNNLLQGPAPAFPDSVKTLDLDLETERFCLAKAG  332

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLGNQRFSG  1580
              CDP+VT LL+ A   GYP  LA++W+GND C   W  I+CD  G N+T +N      +G
Sbjct  333   DCDPRVTVLLSIAKSFGYPDRLAENWRGNDPCGGRWLGISCDGAG-NITVINFQKMGLNG  391

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP    +TSL+ L L++NNLTG IP++L  LP L+ LDVSNN L   +P+    V ++
Sbjct  392   TISPDLGSITSLQKLLLSNNNLTGTIPLTLAKLPSLKELDVSNNFLRGQVPTLSTDVLVN  451

Query  1399  FGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK------  1238
               GN    K  +T   +PG+  T +G S SA              + +  +         
Sbjct  452   TAGNPNFGKNASTAP-APGAASTASGKSTSADARQSSSSGKSSSSVPLGVIVGSMVAAVL  510

Query  1237  ----------CYMKREHKRFGRAKSP--------EKIKSTQMLKTNEI-----MGTA---  1136
                       CY K++ + FGR +SP          +    M+KT         GTA   
Sbjct  511   GMNIVGLLGFCYYKKKKQAFGRVQSPNTMATHPQHSVSDPDMVKTTVAGSSSNGGTASDA  570

Query  1135  --------------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAV  1016
                                 I IQVL   TN F EE++LG GG+GVVY G+L +GTK+AV
Sbjct  571   YSRTSSSPSDVHVVDAGSMVISIQVLRNVTNNFGEENILGEGGFGVVYKGELHDGTKIAV  630

Query  1015  KKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHL  836
             K+M+ G   TKG+NEF++EIA LSKVRH++LV+L+GYC+   + LLVYEYM  GTL  HL
Sbjct  631   KRMEAGVMGTKGLNEFKSEIAVLSKVRHRHLVSLLGYCLEGSERLLVYEYMPQGTLSRHL  690

Query  835   FEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVAD  656
             FEW++ G  PL WK+R++IA DVARG+EYLH L HQSFIHRD+K SNILL DD++AKVAD
Sbjct  691   FEWREGGLKPLEWKKRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMKAKVAD  750

Query  655   FGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             FGLV+ A      VET++AGTFGYLAPEYA TGRVT K+
Sbjct  751   FGLVRLADGKGGSVETKLAGTFGYLAPEYAVTGRVTTKA  789


 Score =   125 bits (314),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K DV++FGV+LME+ITG+KA+DE  P+E+ HLVTW
Sbjct  763  SVETKLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDERQPEESVHLVTW  822

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDP +D DE  F SIS V ELA HC   + Y+RP M H VNVL   
Sbjct  823  FRRMQLNKDTFRKAIDPAIDLDED-FGSISTVTELAGHCCAREPYQRPEMGHAVNVLSSL  881

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
            A  W+   P+   E   G DL+++LP
Sbjct  882  AELWKPSDPDS--EDSYGIDLDLTLP  905



>ref|XP_010502174.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Camelina 
sativa]
 ref|XP_010502175.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Camelina 
sativa]
Length=948

 Score =   524 bits (1349),  Expect(2) = 8e-174, Method: Compositional matrix adjust.
 Identities = 335/752 (45%), Positives = 444/752 (59%), Gaps = 59/752 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D + M  L ++L+  +   WS + +PC W +V CD  +  V  I +  + I G LP  L 
Sbjct  29    DDSTMKALKSSLNLTSDVDWS-NPNPCKWVSVECDG-SNRVTKIQLKQKGILGTLPPNLQ  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ L  L +  N +SGP+P  + +S L+ L L  N F+S+P +   G+ +L+   + +N
Sbjct  87    NLSELVILELFLNRISGPIPDLSGLSRLQTLNLHDNLFTSVPKNLFAGMNSLQEVYL-EN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPG  2105
               LSPWQI   + E+TSL +   SN SI G IP+ F S   P+L+NL+LS N L G LP 
Sbjct  146   NPLSPWQIPDTIKEATSLQNLTLSNCSIFGEIPDLFGSVSLPSLKNLKLSQNRLQGGLPL  205

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  + +Q L          L+G+I ++S+MT L +V LQ N F+GPIPDLS  ++L   
Sbjct  206   SFAGTSLQTLFLNGQMSDSKLNGSISILSNMTSLVEVSLQGNDFSGPIPDLSGLLSLRAF  265

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTP-G  1757
              + +NQLTG+VP SL  +  L  + L NN   GP PLFG  V V I   TNSFC D P G
Sbjct  266   NVRENQLTGLVPQSLIRMNTLATVNLTNNHFQGPTPLFGKSVGVDIFKKTNSFCTDAPGG  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCD +V  LL+ A   GYP+ LA SWKGND C NW  ITC   G N+T VNL  Q  SGT
Sbjct  326   PCDTRVDILLSVAESFGYPVKLAYSWKGNDPCVNWVGITC--SGSNITVVNLRKQGLSGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             IS + + LTSL  + L+DN+L+GPIP  LTTLP L+ LDVSNN++    P F   VN+  
Sbjct  384   ISSSLANLTSLETINLSDNDLSGPIPAELTTLPKLRTLDVSNNDIFGTPPKFRETVNVVI  443

Query  1396  GGNLLLEKT-VATGRGSPGSG----------QTENGSSMSARMfvvvvivvvivvlvvlf  1250
              GN  + K   +   G+PG+                S  S+ + ++V +V  +V  + L 
Sbjct  444   TGNANIGKDGPSRPSGTPGASPGGNKPSGGSGGSETSKKSSNVKIIVPVVGGVVGALCLV  503

Query  1249  vFYKCYMKREHKRFGRAKSP--------------EKIKSTQM------------------  1166
                 C   ++ KR  R +SP              + IK T                    
Sbjct  504   GLGVCLYAKKRKRPARVQSPSSNMVIHPHHSGDNDDIKLTVAASSLNSGGGSDSYSHSGS  563

Query  1165  ----LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                 +   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+  
Sbjct  564   GGSDIHVVEAGNLVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESS  623

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
                 KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF WK+ 
Sbjct  624   VVSDKGLAEFKSEITVLTKMRHRHLVALLGYCLDGNERLLVYEYMPQGTLSEHLFHWKEQ  683

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G  PL W +R+ IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ 
Sbjct  684   GLKPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRL  743

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             APD K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  744   APDGKYSIETRVAGTFGYLAPEYAVTGRVTTK  775


 Score =   117 bits (292),  Expect(2) = 8e-174, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 88/145 (61%), Gaps = 9/145 (6%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII--RKSHNLQKAIDPT  385
            G    KVD+++ GV+LME+ITG+KA+DET P+++ HLVTWF +I   ++ +  + AIDP 
Sbjct  770  GRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRIAASKEENAFKNAIDPN  829

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLR--PEEIVEKF  211
            +  D+ T  SI KV ELA HC   + Y+RP+M H+VNVL      W+     P+++    
Sbjct  830  ISLDDDTVASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWKPTETDPDDVY---  886

Query  210  GGFDLNMSLPLVFDD-SSIESLSFT  139
             G D +M LP V     + E LS T
Sbjct  887  -GIDYDMPLPQVLKKWQAFEGLSQT  910



>ref|XP_009414792.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   514 bits (1323),  Expect(2) = 2e-173, Method: Compositional matrix adjust.
 Identities = 333/762 (44%), Positives = 449/762 (59%), Gaps = 69/762 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSP--APS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             D   M  L A L    +PS  WS S DPC  W  V+C    G V +I      +SG+L  
Sbjct  30    DLQAMRVLAAGLGADRSPSLAWSLSADPCAAWAGVSCSD--GRVTAIQAGKCGLSGSLSP  87

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
              +  L +L  L +Q+N L+GPLPS A++SSL+ L L  N FSS+P  F  GL +L+   +
Sbjct  88    AVRNLTALVRLELQQNRLAGPLPSLADLSSLQVLLLHGNRFSSLPDGFFAGLSSLQSAFL  147

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSL  2111
              DN  L+PW +   L ++ +L +F  + A ++G +P F   +FP L +L L++N L+G +
Sbjct  148   DDN-PLAPWPLPDSLRDAAALVNFSVNTAGVSGPLPAFLATAFPALDHLGLAFNRLSGPV  206

Query  2110  PGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P +F ++ +++L          LSG I  + +MT L ++WL +N F+GP+P+ S+  +L 
Sbjct  207   PAAFAAAPLRSLWLNNQRGPARLSGGIAFVENMTALEELWLHSNDFSGPLPNFSQLTSLR  266

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD--TNSFCKDT  1763
             DLQL DN+LTGVVP SLT LP+L  + L NN L G +P+F + VK +  D    SFC  +
Sbjct  267   DLQLRDNRLTGVVPKSLTQLPSLTKVTLTNNLLQGAVPVFPSSVKEVDVDPKDESFCLPS  326

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             PG CDP+V  LLA A  LGYP   A++WKGND C  W  I+C+  G N+T +N      +
Sbjct  327   PGACDPRVNVLLAVAKDLGYPARFAENWKGNDPC-GWLGISCNDNG-NITVINFQRMGLN  384

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTISP F  + SL+ L L++NNLTG IP  L +LP L+ LDVSNN+L   +PSF   V +
Sbjct  385   GTISPEFGSIVSLQKLLLSNNNLTGTIPAKLASLPSLKELDVSNNSLWGQVPSFSKNVLV  444

Query  1402  SFGGNLLLEKTVA---TGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK--  1238
             +  GN  + K V     G  S G G   N S  +             V   +        
Sbjct  445   NTAGNQNIGKIVVGGDAGSASAGQGSNSNPSGSTDSRSRGSGKSSSAVAGAIAGSVIAAV  504

Query  1237  -----------CYMKREHKRFGRAKSP---------------------------------  1190
                        C+ +R+ +  GR +SP                                 
Sbjct  505   LGIILVGLLVFCHYRRKQQNLGRVQSPNTTVIHPRHSGSDPDIIKITVAGSSVNGGAAAS  564

Query  1189  EKIKSTQMLKTNEIM-----GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
             E I S     T+++         I IQVL   T+ FSEE+VLG GG+G VY G+L +GTK
Sbjct  565   ETITSPTTSGTSDVHVLEAGNMVISIQVLRNVTDNFSEENVLGHGGFGTVYKGELHDGTK  624

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+ GA  TKG+NEF++EIA L+KVRH+NLV+L+GYC++ ++ LLVYEYM  GTL 
Sbjct  625   IAVKRMEAGAMGTKGLNEFKSEIAVLTKVRHRNLVSLLGYCLDGNERLLVYEYMPQGTLS  684

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLF+WK+ G  PL WK+R++IA DVARG+EYLHSL  QSFIHRD+K SNILL DD++AK
Sbjct  685   RHLFDWKEGGQKPLEWKKRLSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMKAK  744

Query  664   VADFGLVKKAPDDKSF-VETRVAGTFGYLAPEYATTGRVTKK  542
             VADFGLV+ APD K   VETR+AGTFGYLAPEYA TGRVT K
Sbjct  745   VADFGLVRLAPDGKGCSVETRIAGTFGYLAPEYAVTGRVTTK  786


 Score =   125 bits (315),  Expect(2) = 2e-173, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKIIRKSHNLQK-AIDPTL  382
            G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTWF +++      +K AIDP +
Sbjct  781  GRVTTKVDVFSFGVILMEMITGRKALDESQPEESMHLVTWFRRMLLDKEAFRKAAIDPAI  840

Query  381  DPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKFGGF  202
            D DE+T  S+  VAELA HC   + ++RP+M H VNVL   +  W+   P+   E+  G 
Sbjct  841  DMDEETTASVGTVAELAGHCCAREPHQRPDMGHAVNVLSSLSELWKPCDPDS--EESYGI  898

Query  201  DLNMSLP  181
            DL+M+LP
Sbjct  899  DLDMTLP  905



>ref|XP_006346490.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=942

 Score =   538 bits (1387),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 336/753 (45%), Positives = 449/753 (60%), Gaps = 56/753 (7%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             S   DAAVM +L   +SP  S      DPC W  V C K  G V  I + +Q + G+LP 
Sbjct  28    SAATDAAVMQELKKGISPPSSLNWDDPDPCKWGKVTCTK-DGRVTRIQVGNQGLKGSLPP  86

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
              +  L  L+   VQ N+L+G +P+FA M+SL+ + L++N F+SIP DF  G+ NL+  ++
Sbjct  87    NMNNLTELQVFEVQHNALTGAIPTFAGMNSLQSILLNNNGFTSIPSDFFEGMTNLQNVNL  146

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGS  2114
              D+   SPW +   L ++TSL SF A++A+ITG IP+FF  D+F +L +L L++NN  G 
Sbjct  147   -DSNSFSPWSVPESLKDATSLQSFSANSANITGKIPDFFGGDTFVSLTDLHLAFNNFEGP  205

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP +F  S IQ LWLN     L+G+IDV+ +MT L+Q+W   N FTGP+PD S    L +
Sbjct  206   LPSNFSGSSIQTLWLNGLHSKLNGSIDVVQNMTSLTQLWFSGNKFTGPLPDFSGLTQLRE  265

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
               L DN  TG VP SL  LP+L+ + L NN   GP P F + V V +L +TNSFC   PG
Sbjct  266   CNLRDNSFTGPVPDSLVNLPSLKMVNLTNNFFQGPTPNFPSSVLVDMLDNTNSFCLSQPG  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCD QV  LL  A  +GYP   A++WKGND C +W  ITCD  G N+T +N      +GT
Sbjct  326   PCDSQVNTLLGVAKAVGYPTGFAENWKGNDPCSSWIGITCD--GGNITVLNFQKMGLTGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP +S +TSL+ L L +N LTG IP  L  LP+L+  DVSNN L   +P F   V + +
Sbjct  384   ISPNYSSITSLQKLILANNFLTGTIPNELALLPNLKEFDVSNNQLYGKIPPFKSNVLVKY  443

Query  1396  GGNLLLEKT----VATGRGSPGS---------GQTENGSSMSARMfvvvvivvvivvlvv  1256
              GN+ + K     VA    +P S             N  S +  +   V+  V   V V 
Sbjct  444   DGNVNIGKDSPPPVAPSGSTPSSPDGGGGGQTHGNGNKKSSTGVVVGSVIGGVCGAVAVA  503

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKI-------------------------KSTQM-----  1166
                 + C  + +  + GR +SP  +                          +T+      
Sbjct  504   GLFVF-CLYRTKRMQSGRVQSPHAVVIHPHHSGSDQDAVKITVAGSSVNGGTTETYSCGS  562

Query  1165  -----LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKD  1001
                  L   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+ 
Sbjct  563   SAPGDLHIVEAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMES  622

Query  1000  GATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKK  821
             G    KG++EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GT+  +LF WK+
Sbjct  623   GVMSEKGLDEFTSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTVSRYLFNWKE  682

Query  820   HGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVK  641
              G +PL W +R+ IA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+
Sbjct  683   EGINPLEWTRRLIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVR  742

Query  640   KAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              AP+ K+ + TR+AGTFGYLAPEYA TGRVT K
Sbjct  743   LAPEGKTSLVTRLAGTFGYLAPEYAVTGRVTTK  775


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            SL   L G    L       G    K+DV++FGV+LME+ITG++A+DE+ P+E+ HLV W
Sbjct  750  SLVTRLAGTFGYLAPEYAVTGRVTTKIDVFSFGVILMELITGRRALDESQPEESMHLVPW  809

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAID T+D DE+T  S+S VAELA HC   + ++RP+M H VNVL   
Sbjct  810  FRRMHINKETFRKAIDHTIDLDEETLASVSTVAELAGHCCAREPHQRPDMGHAVNVLSSL  869

Query  258  AHNWRSLRPEEIVE-KFGGFDLNMSLP  181
            A  W   +P E+ E +  G D +M+LP
Sbjct  870  AELW---KPAEVDEDEIYGIDYDMTLP  893



>ref|XP_011099938.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=945

 Score =   538 bits (1387),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 347/753 (46%), Positives = 457/753 (61%), Gaps = 64/753 (8%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DDA+ M  L  +L+P      +  DPC W +V C +    V  I I  Q+++G LP EL+
Sbjct  35    DDASAMFALKKSLNPPDELSWSDPDPCKWGHVLCSE--NRVTRIQIGHQNLAGTLPKELS  92

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L VQ N++SGPLPS   +SSL+ L L +N+F+ IP DF  G+ +L+   I DN
Sbjct  93    SLTQLERLEVQWNNISGPLPSLKGLSSLQVLMLSNNQFTLIPDDFFSGMSSLQSVEI-DN  151

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
               LS W+I   L  +++L +F A++A+ITG IP+F   D FP L NL L+ N+L G LP 
Sbjct  152   NPLSAWEIPESLRNASTLQNFSANSANITGKIPSFLGPDEFPGLTNLHLALNHLEGELPS  211

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             +F  S+IQ+LWLN Q+   SG IDV+ +MT L +VWL +N F+GP+PD S   NL  L L
Sbjct  212   AFSGSQIQSLWLNGQKL--SGGIDVLQNMTLLKEVWLHSNGFSGPLPDFSGLKNLETLNL  269

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGPCD  1748
              DN  TG VP+SL  L  L+ + L NN L GPMP F   V V +  DTNSFC   PG CD
Sbjct  270   RDNSFTGPVPMSLVNLDTLKVVNLTNNLLQGPMPKFREAVSVDMAKDTNSFCLPQPGDCD  329

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             P++  LL+    + YP   +++WKGND C +W  ITC+    N+T VN  N   +GTISP
Sbjct  330   PRIDTLLSIIKSMDYPRKFSENWKGNDPCADWFGITCN--NGNITIVNFENMGLTGTISP  387

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
              F+ L SL+ L L +NNLTG IP  LTTLP L   DVSNN+L   +P+F   + +  GGN
Sbjct  388   DFASLKSLQRLVLANNNLTGTIPEELTTLPGLMEFDVSNNHLYGKIPAFRSNMIVKTGGN  447

Query  1387  LLLEK------------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvF  1244
               + K            T  +  GS  + Q  +  S +    VV  +V  + VL ++ V 
Sbjct  448   PDIGKDKVDSNSTGTSSTGTSSTGSETNAQKNHDKSRNWVGVVVFSVVGGLFVLCLILVA  507

Query  1243  YKCYMKREHKRFGRAKSP--------------EKIKST----------------------  1172
               C  K + KRF R +SP              + +K T                      
Sbjct  508   AFCLYKSKQKRFSRVQSPNATVIHPRHSGSDNDSVKITVAGSSVSVGAVSETHTVSAGES  567

Query  1171  ---QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKD  1001
                QM++   ++   I IQVL+  TN FSEE++LG GG+G VY G+L +GTK+AVK+M+ 
Sbjct  568   SDIQMVEAGNMV---ISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMEC  624

Query  1000  GATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKK  821
             G    KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF W  
Sbjct  625   GVITGKGTAEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWAD  684

Query  820   HGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVK  641
              G  PL WK+R+T+A DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+
Sbjct  685   EGLQPLEWKRRLTVALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVR  744

Query  640   KAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  745   LAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  777


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  752  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  811

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D DE+T  +IS VAELA HC   + Y+RP+M H VNVL   
Sbjct  812  FRRMQLNKDTFRKAIDPTIDLDEETLANISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  871

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  +   G DL MSLP
Sbjct  872  VELWKPT--DQSSDDIYGIDLEMSLP  895



>gb|KDO41052.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=948

 Score =   538 bits (1385),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 340/759 (45%), Positives = 456/759 (60%), Gaps = 71/759 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNC--DKPTGNVVSINIDSQSISGNLPSE  2465
             DAAVM  L  +L+P  S GWS + DPC W +V C  DK    +  I I  Q++ G LPS 
Sbjct  32    DAAVMLALKKSLNPPESLGWSDT-DPCKWNHVVCIEDK---RITRIQIGHQNLQGTLPSN  87

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L  L  L +Q NS+SGPLPS   ++SLE + L +N+F+S+P DF  GL +L+   I 
Sbjct  88    LQNLTKLERLELQWNSISGPLPSLNGLASLEVVMLSNNQFTSVPSDFFTGLSSLQSIEI-  146

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             DN   S W+I   L  ++ L +F A++A+ITG IP+FF  D FP L  L L++N L G L
Sbjct  147   DNNPFSSWEIPQSLRNASGLQNFSANSANITGQIPSFFGPDEFPGLTILHLAFNQLIGGL  206

Query  2110  PGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P SF  S+IQ+  +   N    L G IDVI +MT L ++WL +NAF+GP+PD S    L 
Sbjct  207   PASFSGSQIQSLWVNGQNGNAKLGGGIDVIQNMTSLKEIWLHSNAFSGPLPDFSGVKQLE  266

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTP  1760
              L L DN  TG VP SL  L +L+ + + NN L GP+P F   V + +   +N+FC  +P
Sbjct  267   SLSLRDNFFTGPVPDSLVKLESLKIVNMTNNLLQGPVPEFDRSVSLDMAKGSNNFCLPSP  326

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
             G CDP++ ALL+    +GYP   A++WKGND C +W  +TC     N+T +N      +G
Sbjct  327   GACDPRLNALLSVVKLMGYPQRFAENWKGNDPCSDWIGVTCTK--GNITVINFQKMNLTG  384

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP F+   SL+ L L DNNL+G IP  L+ L  L+ LDVSNN L   +PSF     ++
Sbjct  385   TISPEFASFKSLQRLILADNNLSGMIPEGLSVLGALKELDVSNNQLYGKIPSFKSNAIVN  444

Query  1399  FGGNLLLEKTVA-----------TGRGSPGSGQTENGSSMSARMfvvvv--ivvvivvlv  1259
               GN  + K  +           TG GS  +  TENG   S+ +  V++  ++    V+ 
Sbjct  445   TDGNPDIGKEKSSSFQGSPSGSPTGTGSGNASSTENGVKNSSALITVILFCVIGGAFVIS  504

Query  1258  vlfvFYKCYMKREHKRFGRAKSP---------------EKIKST----------------  1172
             +  V   C  K++ KRF R +SP               E +K T                
Sbjct  505   LTGVLVFCLCKKKQKRFSRVQSPNAMVIHPRHSGSENSESVKITVAGSNVSVGAISETHT  564

Query  1171  ---------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVA  1019
                      QML+   ++   I IQVL   TN FSEE++LG GG+G VY G+L +GTK+A
Sbjct  565   VPSSEPGDIQMLEAGNMV---ISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIA  621

Query  1018  VKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHH  839
             VK+M+ G    KG+ EF++EIA L+KVRH++LVAL+G+C++ ++ LLV+EYM  GTL  H
Sbjct  622   VKRMEAGVISGKGLTEFKSEIAVLTKVRHRHLVALLGHCLDGNEKLLVFEYMPQGTLSRH  681

Query  838   LFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVA  659
             +F W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVA
Sbjct  682   IFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVA  741

Query  658   DFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             DFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  742   DFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  780


 Score =   129 bits (323),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  755  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  814

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I     +  KAIDPT+D +E    SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  815  FRRIHLSKDSFHKAIDPTIDLNEGILASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  874

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  875  VELWKPT--DQNSEDIYGIDLEMSLP  898



>ref|XP_010908591.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=901

 Score =   536 bits (1381),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 357/734 (49%), Positives = 464/734 (63%), Gaps = 43/734 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D   M  +   L+  P  W+   DPC W+ V C   +G + +IN+  + +SG L S +++
Sbjct  37    DRQAMLDIAKKLTNLPPSWTTGTDPCQWSGVTCR--SGRIDTINLALKGVSGTLSSSISK  94

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+SL +L +Q+N +SGPLPS +N+S LE + LD N FSS+P  F  GL +L+  S+ DN 
Sbjct  95    LSSLSNLQLQQNQISGPLPSLSNLSGLETIVLDGNAFSSVPNGFFTGLSSLQSVSLDDN-  153

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L+PW I + LA+STSL +F ASN SI G IP FF +  +LQ+LR+SYNN+TG LP SFG
Sbjct  154   PLAPWVIPADLAQSTSLMTFSASNTSINGEIPAFFGTLLSLQSLRISYNNMTGGLPDSFG  213

Query  2095  SSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
              S IQNL           SG+IDVI SMT+LS VWLQ+N+FTGPIPDLSK ++L    + 
Sbjct  214   GSTIQNLWLNNQQSPTKFSGSIDVIGSMTQLSLVWLQSNSFTGPIPDLSKLISLASFNVR  273

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DN LTGVVP SLT  P L+N+ L NN+L GP P F   V   +   N+FC   PGPC+  
Sbjct  274   DNSLTGVVPPSLTSCPTLKNVSLSNNQLQGPYPKFAGGVDGDIDKGNNFCNSAPGPCNAV  333

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPA  1565
             VTALLA A G GYP+ LA SW G+D C  NW  + CD Q  N+  +N  NQ F G ISP 
Sbjct  334   VTALLAVAEGFGYPLKLATSWTGSDPCGGNWFGVNCDNQ-NNINVLNFANQHFEGFISPD  392

Query  1564  FSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL  1385
              S  TSL  L L++NNL+GPIP SL  LP L++LDV+NNNLS  LP FP  V +   GN 
Sbjct  393   ISNFTSLTRLILSNNNLSGPIPDSLKVLPKLRLLDVTNNNLSGILPHFPDYVTLKLSGNP  452

Query  1384  LLEKTVATGRGSPG------------SGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             LL  T  +G GS              +G   +GS     +   +VI V+I++  +L  FY
Sbjct  453   LLGHTSGSGGGSSSSSPSDGPSGSSSAGNQPSGSKSPGAVIAGIVIAVLILIACLLAFFY  512

Query  1240  KCYMKREHKRFGRAKS------PEKIKSTQM-LKTNEI----------------MGTAIK  1130
               Y K+  +RFG+  +      PE  K+  M ++  EI                 G  + 
Sbjct  513   SIYRKKHVRRFGQVPTRTPPNEPELAKTAVMGIEMGEIYSQSSTGGANTYMIDPQGMHMS  572

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             IQ + +ATN FSEE++LG GG+GVVY G   NGT +AVK+ +      KG +EF+AEI  
Sbjct  573   IQSVRRATNNFSEENILGRGGFGVVYKGN-HNGTLIAVKRSRVDLPGNKGGDEFKAEIDV  631

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             LSKVRH++LVAL+GY  + ++ LLVYE+M  GTL  HLF++      PLTWKQR+TIA D
Sbjct  632   LSKVRHRHLVALLGYYDDGNERLLVYEFMPGGTLEQHLFDYNNIKCSPLTWKQRLTIALD  691

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  +SFIHRD+K SNILL++D+RAKV+DFGLVK   D +  + TR+AGTF
Sbjct  692   VARGVEYLHSLAQESFIHRDLKPSNILLDNDMRAKVSDFGLVKHCVDKQKSMMTRLAGTF  751

Query  589   GYLAPEYATTGRVT  548
             GYLAPEYA TG+VT
Sbjct  752   GYLAPEYAFTGKVT  765


 Score = 90.5 bits (223),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 1/126 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+    VDVYAFGV+LME+ITG+K +D+  PD   +LV  
Sbjct  742  SMMTRLAGTFGYLAPEYAFTGKVTTMVDVYAFGVILMELITGQKVLDDRRPDGDTNLVPI  801

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + I+ K   L+   DP L+ DE+ + S+ +VAELA +CT      RP+M + VN L  
Sbjct  802  FQRNIVNKDEFLKSCPDPNLNLDEEAYTSLMEVAELARYCTARVANHRPDMSYAVNKLAL  861

Query  261  FAHNWR  244
                W+
Sbjct  862  LVERWK  867



>ref|XP_004289581.1| PREDICTED: probable receptor protein kinase TMK1-like [Fragaria 
vesca subsp. vesca]
Length=954

 Score =   538 bits (1385),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 346/768 (45%), Positives = 457/768 (60%), Gaps = 67/768 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S  +DA+VM  L  +L+P  S GWS   +PC W+ V C      V  I I  Q+I G LP
Sbjct  34    SSSNDASVMLALKKSLNPPASFGWS-DPNPCKWSYVGCSDDK-RVTRIQIGHQNIQGTLP  91

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
               L  L  L  L +Q N++SGPLPS + + SL+ L L +N F+SIP DF  G+ +L+   
Sbjct  92    PSLQNLTQLERLELQWNNISGPLPSLSGLGSLQVLLLSNNLFTSIPSDFFTGMTSLQSVE  151

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTG  2117
             I DN   + W+I   L  ++SL +F A++A+ITG IP+FF  D+FP L NL L++N L G
Sbjct  152   I-DNNPFTAWEIPQTLQNASSLQNFSANSANITGKIPDFFNTDAFPGLVNLHLAFNYLEG  210

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF  SE+Q+L          L G+I V+S+MT L++VWL +N F+GP+PD S   +
Sbjct  211   QLPESFSGSEMQSLWLNGQQSVGKLVGSIGVLSNMTTLTEVWLHSNGFSGPLPDFSGLTD  270

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L  L L DN  TG V VSL  L +LE++ L NN L GPMP F   V V +  D+N+FC  
Sbjct  271   LRSLSLRDNLFTGPVSVSLLNLKSLESVNLTNNLLQGPMPEFPKGVSVDMTKDSNNFCLP  330

Query  1765  TPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
             +PG CDP+V  LL     + YP   A++WKGND C +W  +TC  +  N+T +N      
Sbjct  331   SPGQCDPRVDTLLLIVSSMSYPQKFAENWKGNDPCADWIGVTC--RNGNITVLNFQKMGL  388

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA-V  1409
             +GTISPAF+ L SL+ + L DNNLTG IP  L TLP L  LDVSNN L   +P+F  A V
Sbjct  389   TGTISPAFASLKSLQRVVLADNNLTGSIPEELATLPALTQLDVSNNLLYGKIPAFTKANV  448

Query  1408  NISFGGNLLLEKTVATGRGSPGSGQTE-------NGSSMSARMfvvvvivvvivvlvvlf  1250
              ++  GN  + K  +T   S  S           NGS    +    +V V+V  V+  +F
Sbjct  449   IVNTDGNPDIRKEKSTNGPSQNSTNPSTSISGNGNGSGPHGKKSSNLVGVIVFSVIGGVF  508

Query  1249  vFYK------CYMKREHKRFGRAKSP--------------EKIKST--------------  1172
             V +       C  + + KR  R +SP              E +K T              
Sbjct  509   VMFLIALLVICLYRTKQKRLSRVQSPNAMVIHPRHSGSDNESMKITVAGSSVSVGALSEA  568

Query  1171  -----------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
                        QM++   ++   I IQVL   TN FSEE++LG GG+  VY G+L +GTK
Sbjct  569   HTVPSSEPSDIQMVEAGNMV---ISIQVLRNVTNNFSEENILGRGGFVTVYKGELHDGTK  625

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ +K LLVYEYM  GTL 
Sbjct  626   IAVKRMEAGVIAGKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNKRLLVYEYMPQGTLS  685

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              ++F W + G  PL W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAK
Sbjct  686   RYIFNWPEEGLKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAK  745

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKSRCLCIR  521
             VADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K      R
Sbjct  746   VADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFR  793


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 88/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++F V+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  761  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFRVILMELITGRKALDESQPEESMHLVTW  820

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I     + +KA+DPT+D DE T  S+S VAEL  HC+  + Y+RP+M H VNVL   
Sbjct  821  FRRIFINKDSFRKAVDPTIDLDEGTLASVSTVAELVGHCSAREPYQRPDMSHAVNVLSSL  880

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  881  VELWKP--SDQSFEDIYGIDLEMSLP  904



>ref|XP_002876780.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53039.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
Length=946

 Score =   518 bits (1335),  Expect(2) = 4e-172, Method: Compositional matrix adjust.
 Identities = 334/750 (45%), Positives = 447/750 (60%), Gaps = 57/750 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D + M  L ++L+  +   WS + +PC W +V CD  +  V  I +  + I G LP++L 
Sbjct  29    DDSTMEALKSSLNLTSDVDWS-NPNPCKWESVECDG-SNRVTKIQLKQKGIRGTLPTDLQ  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+ L  L +  N +SGP+P  + +S L+ L L  N F S+P +   G+ +L+   + +N
Sbjct  87    KLSELVVLELFLNRISGPIPDLSGLSRLQTLNLHDNLFDSVPNNLFSGMSSLQEVYL-EN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                +PWQI   + E+TSL +   SN SI G IP+FF   S P+L NL+LS N L G LP 
Sbjct  146   NPFNPWQIPDSIKEATSLQNLTLSNCSIFGKIPDFFGSQSLPSLTNLKLSQNRLQGELPV  205

Query  2104  SF-GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             SF G+S           + L+G+I ++ +MT L +V LQ N F+GPIPDLS  ++L    
Sbjct  206   SFAGTSLQSLFLNGQVGEQLNGSISILRNMTSLVEVSLQGNKFSGPIPDLSGLLSLRVFN  265

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-P  1754
             + +NQLTGVVP SL  L +L  + L NN L GP PLFG  V V I  +TNSFC    G  
Sbjct  266   VRENQLTGVVPQSLISLNSLTTVNLTNNLLQGPTPLFGKSVGVDIFNNTNSFCTSIAGEA  325

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP+V  L++ A   GYP+ LA SWKGN+ C NW  ITC   G N+T VNL  Q  SGTI
Sbjct  326   CDPRVDTLVSVAESFGYPVKLASSWKGNNPCVNWVGITC--SGGNITVVNLRKQDLSGTI  383

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             S + + LTSL  + L+DN L+GPIP  LTTL  L+ LDVSNN+L   +P FP  V++   
Sbjct  384   SASLANLTSLETINLSDNELSGPIPTELTTLSKLRTLDVSNNDLYGVVPKFPNTVHLVTE  443

Query  1393  GNLLLEKT-VATGRGSPGS---------GQTENGSSMSARMfvvvvivvvivvlvvlfvF  1244
             GN+ + KT   +  GSPG+               S  S+ + ++V +V  +V  + L   
Sbjct  444   GNVNIGKTGPISPSGSPGASPGSKPSGGSGGSETSKKSSNVKIIVPVVGGVVGALCLVGL  503

Query  1243  YKCYMKREHKRFGRAKSP--------------EKIKSTQM--------------------  1166
               C   ++ KR  R +SP              + IK T                      
Sbjct  504   GVCLYAKKRKRPARVQSPSSNMVIHPHHSGDNDDIKLTVAASSLNSGGGSESYSHSGSAA  563

Query  1165  --LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGAT  992
               +   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+    
Sbjct  564   SDIHVVEAGNLVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESSVV  623

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
               KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF WK+ G 
Sbjct  624   SDKGLTEFKSEITVLTKMRHRHLVALLGYCLDGNERLLVYEYMPQGTLSQHLFHWKEEGR  683

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PL W +R+ IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ AP
Sbjct  684   KPLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAP  743

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             D K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  744   DGKYSIETRVAGTFGYLAPEYAVTGRVTTK  773


 Score =   117 bits (292),  Expect(2) = 4e-172, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII--RKSHNLQKAIDPT  385
            G    KVD+++ GV+LME+ITG+KA+DET P+++ HLVTWF +I   +  +  + AIDP 
Sbjct  768  GRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRIAASKDENAFKNAIDPN  827

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLR--PEEIVEKF  211
            +  D+ T  SI KV ELA HC   + Y+RP+M H+VNVL      W+     P+++    
Sbjct  828  ISLDDDTLASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWKPTETDPDDVY---  884

Query  210  GGFDLNMSLPLVFDD-SSIESLSFT  139
             G D +M LP V     + E LS T
Sbjct  885  -GIDYDMPLPQVLKKWQAFEGLSQT  908



>ref|XP_009404143.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=957

 Score =   537 bits (1384),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 344/764 (45%), Positives = 469/764 (61%), Gaps = 75/764 (10%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             D A M  L  AL    +  WSAS DPCT W  V C    G V +I + ++S++G+LP+++
Sbjct  37    DLASMQVLATALGADKALDWSASADPCTAWAGVACSD--GRVTAIQVGNRSLAGSLPADV  94

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L SL  L +Q N L+GPLPS A ++SL+ L    N FSSIPPDF  GL +L+   + D
Sbjct  95    RNLTSLVRLELQNNRLAGPLPSLAGLASLQVLLFHGNLFSSIPPDFFSGLSSLQAVFLDD  154

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPG  2105
             N  L+ W + + L+++ +L +F A+NA+++G +P+F   +FP L +L L++N L+G +P 
Sbjct  155   N-PLAAWPLPASLSDAAALVNFSANNANVSGPLPDFLATAFPGLDHLGLAFNLLSGPVPS  213

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             +F ++  ++L          L+G I  + +MT L ++WLQ+N F+GP+PD S   NL +L
Sbjct  214   AFAAASFRSLWLNNQVGPSRLNGGIAFVENMTALEELWLQSNGFSGPLPDFSALTNLRNL  273

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGP  1754
             +L DNQLTGVVP SL  L +L  + L NN L GP+P+F + V + ++  + SFC  + G 
Sbjct  274   ELRDNQLTGVVPRSLVELKSLSKVTLTNNLLQGPVPVFPDSVTLDLVPGSESFCLKSAGE  333

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD +VT LL+ A   GYP   A++WKGND C  W  I+CD  G N+T +N      +GTI
Sbjct  334   CDDRVTLLLSIAKSFGYPERFAENWKGNDPC-GWLGISCDADG-NITVINFSRMSLNGTI  391

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP FS  TSL+ L L +NNLTG IP +LT L  L+ LDVSNN L   +PSF   V +  G
Sbjct  392   SPDFSAFTSLQRLLLPNNNLTGTIPSTLTNLTSLKELDVSNNMLWGKIPSFSKNVLVMTG  451

Query  1393  GNLLLEKTVATGRGSPG--SGQTENG-------------------SSMSARMfvvvvivv  1277
             GN+ + K VA     PG  SG   NG                   SS S  +    VI V
Sbjct  452   GNVNMGKDVA----PPGSDSGSAPNGSDSDPAGSVDVSGNSSGKASSGSVGVIAGSVIAV  507

Query  1276  vivvlvvlfvFYKCYMKREHKRFGRAKSPEKI-------KSTQMLKTNEIMGTA------  1136
             V  V +V  + + CY K++ +  GR +SP           S Q +    ++G++      
Sbjct  508   VAGVSLVGLLSF-CYYKKKLQNSGRVQSPNTTVIHPRHSGSDQDMVKITVVGSSMNGGAT  566

Query  1135  ------------------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                                     I IQVL   TN FSEE++LG GG+G VY G+L +GT
Sbjct  567   ASESYSQASSGPSDVHVVDAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGT  626

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G   TKG+NEF++EIA L+KVRH+NLV+L+GYC++ ++ LLVYEYM  GTL
Sbjct  627   KIAVKRMEAGVMGTKGLNEFKSEIAVLTKVRHRNLVSLLGYCLDGNERLLVYEYMPQGTL  686

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               HL +WK+ G  PL WK+R++IA DVARG+EYLH+L HQSFIHRD+K SNILL DD++A
Sbjct  687   SRHLLDWKEEGLKPLEWKKRLSIALDVARGVEYLHNLAHQSFIHRDLKPSNILLGDDMKA  746

Query  667   KVADFGLVKKAPDDKSF-VETRVAGTFGYLAPEYATTGRVTKKS  539
             KVADFGLV+ APD K   VETR+AGTFGYLAPEYA TGRVT K+
Sbjct  747   KVADFGLVRLAPDGKGCSVETRLAGTFGYLAPEYAVTGRVTTKA  790


 Score =   138 bits (347),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 94/159 (59%), Gaps = 8/159 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K DVY+FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  764  SVETRLAGTFGYLAPEYAVTGRVTTKADVYSFGVILMELITGRKALDESQPEESVHLVTW  823

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D DE+T  SIS VAELA HC   + ++RP+M H V VL   
Sbjct  824  FRRMQLNKDTFRKAIDPTIDLDEETITSISTVAELAGHCCGREPHQRPDMSHAVTVLASL  883

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
            A  W+   P+   E   G DL+MSLP        FDDSS
Sbjct  884  AELWKPSDPDS--EDSYGIDLDMSLPQALKKWQAFDDSS  920



>emb|CDY52761.1| BnaC02g47770D [Brassica napus]
Length=872

 Score =   525 bits (1352),  Expect(2) = 8e-172, Method: Compositional matrix adjust.
 Identities = 326/706 (46%), Positives = 439/706 (62%), Gaps = 57/706 (8%)
 Frame = -2

Query  2581  WSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPL  2402
             WS + +PC W  V CD  +  V  I ++++ I G LP  L  L  L  L + +N +SGP+
Sbjct  46    WS-NPNPCKWPTVQCDA-SNRVTRIQLNNKGIRGTLPPNLQTLTELTVLELFQNQISGPI  103

Query  2401  PSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLG  2222
             P  + ++ L+ L L +N F S+P +   GL +L+   +  N   SPW+I   L E+TSL 
Sbjct  104   PDLSGLTRLQTLNLHNNLFDSVPKNLFSGLTSLQAAYLEYN-PFSPWEIPETLKEATSLQ  162

Query  2221  SFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSSEIqnlwlnnqqqgL  2048
             +   ++ ++TG IP+FF S   P+L  L+LS N L G LP SFG+S +Q+L+LN Q+   
Sbjct  163   NLSLTSCNVTGKIPDFFSSQTLPSLTRLQLSQNLLQGELPPSFGASSLQSLYLNGQKL--  220

Query  2047  SGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNL  1868
             +G++ ++ +MT L +V LQ NAF+GPIPDLS   +L    + +NQLTGVVP SLTG  +L
Sbjct  221   NGSVSLLQNMTSLVEVDLQGNAFSGPIPDLSGLQSLSVFNVRENQLTGVVPPSLTGSKSL  280

Query  1867  ENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYPIT  1694
               + L NN   GP P FG  V V ++ +TN FC +TPG PCDP+V+ LL+ A  LGYP+ 
Sbjct  281   TIVNLTNNYFQGPTPQFGKSVGVDVITNTNRFCLETPGTPCDPRVSTLLSVAESLGYPVK  340

Query  1693  LAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNL  1514
             LA SWKGND C +W  ITC   G NVT VNLG Q  +GTISP+F+++TSL  + L+DN L
Sbjct  341   LATSWKGNDPCNSWLGITC--SGSNVTVVNLGRQGLTGTISPSFAKITSLETINLSDNYL  398

Query  1513  TGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPG-SG  1337
             TG IP  LTTLP L+ LDVS+NN+   +P F   VN+   GN  + K    G   PG S 
Sbjct  399   TGSIPNELTTLPKLKTLDVSDNNIYGYVPKFGGGVNVVTTGNANIGK---DGPSPPGVSP  455

Query  1336  QTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKT  1157
               + GSS  +R+ V                   C   ++  R  + +SP          +
Sbjct  456   DGDGGSSKMSRLGV-------------------CLYAKKRARPAKVQSPNSHMVIHPDHS  496

Query  1156  NEIMGTAIKIQ---------------------VLEKATNFFseesvlgsggygvvylGKL  1040
              +  G AIK+                      VL   TN FSEE++LG GG+G VY G+L
Sbjct  497   GD--GDAIKLSVAASSVGGGGGTESSSSDIHVVLRNVTNNFSEENILGRGGFGTVYKGEL  554

Query  1039  DNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMS  860
              +GTK+AVK+M+  A   KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYEYM 
Sbjct  555   HDGTKIAVKRMEPSAVSDKGLEEFKSEITVLTKMRHRHLVALLGYCLDGNEKLLVYEYMP  614

Query  859   HGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLND  680
              GTL  HLF WK+    PL W +R+ +A DVARG+EYLH+L HQSFIHRD+K SNILL D
Sbjct  615   QGTLSQHLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRDLKPSNILLGD  674

Query  679   DIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             D+RAKV+DFGLV+ AP+ K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  675   DMRAKVSDFGLVRLAPEGKYSIETRVAGTFGYLAPEYAVTGRVTTK  720


 Score =   109 bits (273),  Expect(2) = 8e-172, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 79/130 (61%), Gaps = 6/130 (5%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII----RKSHNLQKAID  391
            G    KVD+++ GV+LME+ITG+KA+D T P+++ HLVTWF ++     +     + AID
Sbjct  715  GRVTTKVDIFSLGVILMELITGRKALDVTQPEDSVHLVTWFRRVAASKDKDKDAFKNAID  774

Query  390  PTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKF  211
            P ++ DE+T  S+ KV +LA HC   + Y+RP+M H+VNVL      W  +  E   +  
Sbjct  775  PNIELDEETLASVQKVWDLAGHCCAREPYQRPDMGHIVNVLSSLTVQW--IPSEADPDDL  832

Query  210  GGFDLNMSLP  181
             G D +M LP
Sbjct  833  YGIDYDMPLP  842



>ref|XP_008220934.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=941

 Score =   535 bits (1379),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 347/744 (47%), Positives = 449/744 (60%), Gaps = 51/744 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D   M  L  ++ P   GWS S D C W+ V+C   +  V  I I +Q ++G+LP EL  
Sbjct  32    DGVAMEALRKSIGPNSLGWSGS-DHCKWSQVSCTSDS-KVFKIQIGNQKLTGSLPPELKN  89

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             LA L+ L VQ N L+GP PS + ++SL+ L   +N FSS P DF +GL NL    I D  
Sbjct  90    LAYLQQLEVQSNQLTGPFPSLSGLTSLQVLLAHNNNFSSFPQDFFVGLTNLVSIDI-DYN  148

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLPGS  2102
               S WQI   +  +T+L  F A++A+ITG IP+ F   +FP+L +L +S+N L G LP S
Sbjct  149   PFSAWQIPGTITNATALKDFSATDANITGKIPDLFTGTNFPSLIDLHMSFNYLEGELPAS  208

Query  2101  FGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             F  S IQ+L          L+GTIDV+ +MT L +VWL  N+FTGPIPD SK  NL  L 
Sbjct  209   FSGSMIQSLWLNGQKGTNKLNGTIDVLQNMTNLHEVWLHGNSFTGPIPDFSKLSNLASLS  268

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-C  1751
             L DN+ TGVVP SL  L +L  + L NN L GPMP FG+ VKV +   NSFC D PG  C
Sbjct  269   LRDNKFTGVVPASLVSLNSLTTVNLTNNMLQGPMPKFGDGVKVDMTGLNSFCNDKPGSDC  328

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             +P V  LL+    +GYP   A SWK NDAC NW  +TC+  G N+T +N  N   +GTIS
Sbjct  329   NPFVNILLSIVKDMGYPTIFADSWKKNDACDNWKGVTCN--GGNITVINFQNLGLAGTIS  386

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
               FS LTSLR L L+ N+LTG IP  LT LP LQ +D+ NN L   +PSF   V +   G
Sbjct  387   SNFSLLTSLRTLRLDSNHLTGTIPKELTQLPDLQEIDLMNNQLYGKIPSFKSNVIVKTEG  446

Query  1390  NLLLEK----TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CYMK  1226
             N  + K           +P  G   +G+   +R  VVV  V+  V  +V+  F   C +K
Sbjct  447   NPDIGKDHISPNTPPGPNPTPGPPSDGAGKKSRTAVVVGAVIGSVGGLVVLGFVAFCLLK  506

Query  1225  REHKR-FGRAKSP-------------EKIKSTQM----------------------LKTN  1154
             R+HK   GR +SP             + +K T                        +   
Sbjct  507   RKHKHSSGRVQSPNTLVIHPRHSGDQDAVKVTVASSRVNGGGNESYNSPTSSGPNDIHVV  566

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E     I IQVL   TN FSE+ +LG GG+G VY G+L +GTK+AVK+M+ G    KG+N
Sbjct  567   EAGNMVISIQVLRNVTNNFSEDDILGKGGFGTVYKGELHDGTKIAVKRMESGVVAGKGLN  626

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF WK+ G  PL W 
Sbjct  627   EFKSEIAVLTKVRHRHLVGLLGYCLDGNERLLVYEYMPQGTLSQHLFNWKEDGLKPLEWT  686

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
             +R+TIA DVARG+EYLH L +Q+FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+ +
Sbjct  687   RRLTIALDVARGVEYLHGLANQTFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKASI  746

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGR+T K
Sbjct  747   ETRLAGTFGYLAPEYAATGRMTLK  770


 Score =   142 bits (359),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  745  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRKAIDESQPEESLHLVTW  804

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++     L+KAIDPT+D  E+T  S+S VAELA HCT  + Y+RP+M H VNVL   
Sbjct  805  FRRMLINKDALRKAIDPTIDISEETLSSVSTVAELAGHCTARESYQRPDMGHAVNVLSSL  864

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
              +W+   PE+  + + G DL ++LP
Sbjct  865  VEHWKPSEPEDYDDMY-GIDLEITLP  889



>ref|XP_009129193.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Brassica 
rapa]
 ref|XP_009129194.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Brassica 
rapa]
Length=926

 Score =   527 bits (1358),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 332/716 (46%), Positives = 451/716 (63%), Gaps = 46/716 (6%)
 Frame = -2

Query  2581  WSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPL  2402
             WS + +PC W  V CD  +  V  I ++++ I G LP  L  L  L  L + KN +SGP+
Sbjct  46    WS-NPNPCKWPTVQCDA-SNRVTRIQLNNKGIRGTLPPNLQTLTELTVLELFKNQISGPI  103

Query  2401  PSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLG  2222
             P  + ++ L+ L L  N F S+P +   GL +L+   +  N   SPW+I   L E+TSL 
Sbjct  104   PDLSGLTRLQTLNLHDNLFDSVPKNLFSGLTSLQAAYLEYN-PFSPWEIPETLKEATSLQ  162

Query  2221  SFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSSEIqnlwlnnqqqgL  2048
             +   ++ ++TG IP+FF S   P+L  L+LS N L G LP SFG+S +Q+L+LN Q+   
Sbjct  163   NLSLASCNVTGKIPDFFSSQTLPSLTRLQLSQNLLQGELPPSFGASSLQSLYLNGQKL--  220

Query  2047  SGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNL  1868
             +G++ ++ +MT L +V LQ NAF+GPIPDLS   +L    + +NQLTGVVP SLTG  +L
Sbjct  221   NGSVSLLQNMTSLVEVDLQGNAFSGPIPDLSGLQSLRVFNVRENQLTGVVPPSLTGSKSL  280

Query  1867  ENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYPIT  1694
               + L NN   GP P FG  V V ++ +TN FC +TPG PCDP+V+ LL+ A  LGYP+ 
Sbjct  281   TTVNLTNNYFQGPTPQFGKAVGVDVITNTNRFCLETPGTPCDPRVSTLLSVAESLGYPVK  340

Query  1693  LAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNL  1514
             LA SWKGND C +W  ITC   G NVT VNLG Q  +GTISP+F+++TSL  + L+DN L
Sbjct  341   LATSWKGNDPCNSWLGITC--SGSNVTVVNLGRQGLTGTISPSFAKITSLETINLSDNYL  398

Query  1513  TGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPGSGQ  1334
             TG IP  LTTLP L+ LDVS+NN+   +P F   VN+   GN  + K    G   PG   
Sbjct  399   TGSIPNELTTLPKLKTLDVSDNNIYGDVPKFGIGVNVVTTGNANIGK---DGPSPPGVSP  455

Query  1333  TENG--SSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSP----------  1190
               +G  S MS+++ ++V +V  +V+++ L     C   ++  R  + +SP          
Sbjct  456   DGDGGSSKMSSKVKIIVPVVGGVVLVLCLVGLGVCLYAKKRARPAKVQSPSSHMVIHPDH  515

Query  1189  ----EKIK----------------STQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsg  1070
                 + IK                S+  +   E     I IQVL   TN FSEE++LG G
Sbjct  516   SGDGDAIKLSVAASSVGGGGGTESSSSDIHVVESGNLVISIQVLRNVTNNFSEENILGRG  575

Query  1069  gygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDH  890
             G+G VY G+L +GTK+AVK+M+  A   KG+ EF++EI  L+K+RH++LVAL+GYC++ +
Sbjct  576   GFGTVYKGELHDGTKIAVKRMEPSAVSDKGLEEFKSEITVLTKMRHRHLVALLGYCLDGN  635

Query  889   KMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRD  710
             + LLVYEYM  GTL  HLF WK+    PL W +R+ +A DVARG+EYLH+L HQSFIHRD
Sbjct  636   EKLLVYEYMPQGTLSQHLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRD  695

Query  709   IKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             +K SNILL DD+RAKV+DFGLV+ AP+ K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  696   LKPSNILLGDDMRAKVSDFGLVRLAPEGKYSIETRVAGTFGYLAPEYAVTGRVTTK  751


 Score =   106 bits (264),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII----RKSHNLQKAID  391
            G    KVD+++ GV+LME+ITG+KA+D T P+++ HLVTWF ++     +     + AID
Sbjct  746  GRVTTKVDIFSLGVILMELITGRKALDVTQPEDSVHLVTWFRRVAASKDKDKDAFKNAID  805

Query  390  PTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKF  211
            P ++ +E+T  S+ KV +LA HC   + Y+RP+M H+VNVL      W     E   +  
Sbjct  806  PNIELEEETLVSVQKVWDLAGHCCAREPYQRPDMGHIVNVLSSLTVQWTP--SEADPDDL  863

Query  210  GGFDLNMSLP  181
             G D +M LP
Sbjct  864  YGIDYDMPLP  873



>ref|NP_001238698.1| NAK-type protein kinase precursor [Glycine max]
 gb|ACM89508.1| NAK-type protein kinase [Glycine max]
Length=941

 Score =   535 bits (1378),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 339/758 (45%), Positives = 451/758 (59%), Gaps = 69/758 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DDA+VM  L  +L+P   GWS   DPC W  V C      V  I I   ++ G LP+ L 
Sbjct  25    DDASVMLALKNSLNPP--GWS-DPDPCKWARVLCSDDK-RVTRIQIGRLNLQGTLPTTLQ  80

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L  L  L +Q N++SGPLPS   ++SL      +N FS++P DF  G+  L+   I D+
Sbjct  81    KLTHLEHLELQYNNISGPLPSLNGLTSLRVFLASNNRFSAVPADFFAGMSQLQAVEI-DS  139

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                 PW+I   L  ++ L +F A++A++ G IP FF  D FP L  L L+ NNL G+LP 
Sbjct  140   NPFEPWEIPQSLRNASGLQNFSANSANVGGSIPEFFGSDVFPGLTLLHLAMNNLEGTLPL  199

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S+IQ+L          L G+++V+ +MT L+ VWLQ+NAFTGP+PDLS   +L DL
Sbjct  200   SFSGSQIQSLWLNGQKSVNKLGGSVEVLQNMTFLTDVWLQSNAFTGPLPDLSGLKSLRDL  259

Query  1930  QLGDNQLTGVVPV-SLTGLPNLENIRLQNNKLLGPMPLFGNKVKVI-LGDTNSFCKDTPG  1757
              L DN+ TG VPV S  GL  L+ + L NN   GPMP+FG+ V V  + D+NSFC  +PG
Sbjct  260   SLRDNRFTGPVPVASFVGLKTLKVVNLTNNLFQGPMPVFGDGVVVDNVKDSNSFCLPSPG  319

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL+  G +GYP   A+SWKGND C  W  ITC      +T VN      SG 
Sbjct  320   DCDPRVDVLLSVVGVMGYPPRFAESWKGNDPCAYWIGITC--SNGYITVVNFQKMELSGV  377

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F++L SL+ + L DNNLTG IP  L TLP L  L+V+NN L   +PSF   V +S 
Sbjct  378   ISPEFAKLKSLQRIVLADNNLTGSIPEELATLPALTQLNVANNQLYGKVPSFRKNVVVST  437

Query  1396  GGNL-------------LLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvv  1256
              GN              L+       +G  G      G   S+ + V+V  V+  V +V 
Sbjct  438   NGNTDIGKDKSSLSPQGLVPPMAPNAKGDSGGVSGIGGKKSSSHVGVIVFSVIGAVFVVS  497

Query  1255  lfvFYK-CYMKREHKRFGRAKSP--------------EKIKST-----------------  1172
             +  F   C  + + K+  R +SP              E +K T                 
Sbjct  498   MIGFLVFCLFRMKQKKLSRVQSPNALVIHPRHSGSDNESVKITVAGSSVSVGAASETRTV  557

Query  1171  --------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAV  1016
                     QM++   ++   I IQVL+  T+ FSE++VLG GG+G VY G+L +GT++AV
Sbjct  558   PGSEASDIQMVEAGNMV---ISIQVLKNVTDNFSEKNVLGQGGFGTVYRGELHDGTRIAV  614

Query  1015  KKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHL  836
             K+M+ GA   KG  EF++EIA L+KVRH++LV+L+GYC++ ++ LLVYEYM  GTL  HL
Sbjct  615   KRMECGAIAGKGAAEFKSEIAVLTKVRHRHLVSLLGYCLDGNEKLLVYEYMPQGTLSRHL  674

Query  835   FEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVAD  656
             F+W + G +PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVAD
Sbjct  675   FDWPEEGLEPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVAD  734

Query  655   FGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             FGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  735   FGLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  772


 Score =   125 bits (313),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  747  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTW  806

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAID T++ +E+T  SI  VAELA HC   + Y+RP+M H VNVL   
Sbjct  807  FRRMSINKDSFRKAIDSTIELNEETLASIHTVAELAGHCGAREPYQRPDMGHAVNVLSSL  866

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL+MSLP
Sbjct  867  VELWKP--SDQNSEDIYGIDLDMSLP  890



>ref|XP_008798481.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=956

 Score =   534 bits (1376),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 330/743 (44%), Positives = 449/743 (60%), Gaps = 65/743 (9%)
 Frame = -2

Query  2584  GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGP  2405
             GW+   DPCTWT V C +  G V +I + ++S++G LP E+  L SL  L V +N LSGP
Sbjct  51    GWTGPADPCTWTGVTCTE--GRVTAIQVGNRSLAGKLPPEVRNLTSLLRLEVYENQLSGP  108

Query  2404  LPSFANMSSLEELYLDSNEFSSIPP-DFLLGLPNLRIFSISDNGELSPWQISSYLAESTS  2228
             LPS A +SSL+ L L  N FS  PP DF  GL +L+   + DN    PW I + L ++ +
Sbjct  109   LPSLAGLSSLQALLLHGNSFSGAPPKDFFSGLSSLQSAYLDDN-PFDPWPIPANLKDAAA  167

Query  2227  LGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--wlnnqq  2057
             L +F A++A+++G +P+F   +FP+L +L L++N L+G +P SF ++ +++L        
Sbjct  168   LVNFSANSANVSGELPDFLATAFPSLDHLALAFNLLSGPVPASFATAPLRSLWLNNQLGS  227

Query  2056  qgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGL  1877
               LSG I  +++MT L ++WL +N F+GP+PD S   +L +LQL DN+LTG+VP SLT L
Sbjct  228   SRLSGGIAFVANMTSLEELWLNSNDFSGPLPDFSALQHLQNLQLRDNRLTGLVPASLTSL  287

Query  1876  PNLENIRLQNNKLLGPMPLFGNKVKVI--LGDTNSFCKDTPGPCDPQVTALLAFAGGLGY  1703
              +L  + L NN L GP+P+F   VK +       SFC   PG CDP+V  LL+ A   GY
Sbjct  288   KSLNRVSLTNNLLQGPVPVFPKTVKTVDLTPQGESFCLPEPGDCDPRVDVLLSIAKSFGY  347

Query  1702  PITLAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLN  1526
             P   A+SWKGND C   W  I+CD  G N+T +N      +GTISP F  +TSL+ L L+
Sbjct  348   PNRFAESWKGNDPCGGGWPGISCD-SGGNITVINFPKMGLNGTISPDFGSITSLQKLLLS  406

Query  1525  DNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVAT-----  1361
             +NNLTG IP +LT LP L+ LDVS+N L   +PSF  ++ ++  GN  + K   T     
Sbjct  407   NNNLTGTIPSTLTKLPSLKELDVSSNFLWGQVPSFSKSIAVNTSGNPNIGKNDGTAPAPA  466

Query  1360  -GRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK------------CYMKRE  1220
                G P S     GS+ +++         V V ++   V               CY KR+
Sbjct  467   GASGGPISDSNSTGSADASQSSSSGRSSSVPVGVIAGSVVAVVVGVGVIGLLGFCYYKRK  526

Query  1219  HKRFGRAKSPEKI--------KSTQMLKTNEIMGT-------------------------  1139
              + FGR +SP               M+K      T                         
Sbjct  527   KQAFGRVQSPNTTVIHPRHSGSDPDMVKVTVAGSTLNGGTASDTYSRTSSGPSDVHVVDA  586

Query  1138  ---AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                 I IQVL   TN FS+E++LG GG+GVVY G+L +GTK+AVK+M+ G   TKG+NEF
Sbjct  587   GNMVISIQVLRNVTNNFSKENILGEGGFGVVYKGELHDGTKIAVKRMEAGVMGTKGLNEF  646

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
             ++EIA LSKVRH+NLV+L+GYC++  + LLVYEYM  GTL  HLF WK+ G  PL WK+R
Sbjct  647   KSEIAVLSKVRHRNLVSLLGYCLDGSERLLVYEYMPQGTLSRHLFSWKEEGLKPLEWKKR  706

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             +++A DVARG+EYLHSL HQSFIHRD+K SNILL DD++AKV+DFGLV+ A    + VET
Sbjct  707   LSLALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKAKVSDFGLVRLADGKGASVET  766

Query  607   RVAGTFGYLAPEYATTGRVTKKS  539
             ++AGTFGYLAPEYA TGRVT K+
Sbjct  767   KLAGTFGYLAPEYAVTGRVTTKA  789


 Score =   137 bits (345),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 96/159 (60%), Gaps = 8/159 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K DV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  763  SVETKLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDESQPEESVHLVTW  822

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D DE+T  SI+ VAELA HC   + Y+RP+M H VNVL   
Sbjct  823  FRRMQLNKETFRKAIDPTIDLDEETLASITTVAELAGHCCAREPYQRPDMGHAVNVLSSL  882

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
            A  W+   P+   E   G DL+M+LP        F+DSS
Sbjct  883  AELWKPSDPDS--EDSYGIDLDMTLPQALKKWQAFEDSS  919



>ref|XP_007032165.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
 gb|EOY03091.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
Length=953

 Score =   534 bits (1376),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 342/762 (45%), Positives = 455/762 (60%), Gaps = 68/762 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S  DDAAVM  L   L+P  S GWS + DPC W++V C +    V  I I  Q++ G LP
Sbjct  32    SASDDAAVMLALRKTLNPPESLGWSDT-DPCKWSHVVCSEGK-RVTRIQIGHQNLQGTLP  89

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
             S L  L  L  L +Q N++SG +PS   +SSL+ + L +N F+S P DF  GL +L+   
Sbjct  90    SNLQNLTELERLELQWNNISGSVPSLNGLSSLQVVMLSNNRFTSFPDDFFSGLSSLQSVE  149

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTG  2117
             I D    S W+I   L  +++L +F A++A+I+G IP+ F  D FP L  L L++N+L G
Sbjct  150   I-DKNPFSAWEIPHSLKNASALQNFSANSANISGKIPDIFGPDEFPGLTILHLAFNSLEG  208

Query  2116  SLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF  S IQ+  +        L+G+I VI +MT L +VWLQ+N+F+GP+PD S   +
Sbjct  209   ELPSSFSGSPIQSLWVNGQESNGKLTGSIAVIQNMTSLKEVWLQSNSFSGPLPDFSGLKD  268

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L  L L DN  TG VP+SL  L +L+ + L NN L GP+P F N + V ++ D+NSFC  
Sbjct  269   LQSLSLRDNSFTGPVPISLVNLGSLKTVNLTNNLLQGPVPEFKNSISVDMVKDSNSFCLP  328

Query  1765  TPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
             +PG CDP+VT LL     +GYP  LA++WKGND C +W  ITC     N+T VN      
Sbjct  329   SPGECDPRVTVLLTVVKPMGYPQKLAENWKGNDPCADWLGITCG--NGNITVVNFEKIGL  386

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +GTISP F+ L SL+ L L DNNLTG IP  LT+L  L+ LDVSNN L   +P+F   V 
Sbjct  387   TGTISPDFASLKSLQRLILADNNLTGSIPEELTSLIALKELDVSNNQLYGKIPTFKSNVI  446

Query  1405  ISFGGN--LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvi-------------  1271
             ++  GN  +  EK+ +T  G+      E   S S+                         
Sbjct  447   LNTNGNPDIGKEKSSSTSPGTTADNPMEGKGSNSSGSSGNSGKKSSALIGIIVVSVLGGL  506

Query  1270  vvlvvlfvFYKCYMKREHKRFGRAKSP--------------EKIKST-------------  1172
             VV+ +  +   C  K++ KRF R +SP              E +K T             
Sbjct  507   VVVGLFGLLLFCLYKKKQKRFSRVQSPNAMVIHPRHSGSDNESVKITVAGSSVSVGAVSE  566

Query  1171  ------------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                         QM++   ++   I IQVL   TN FSEE++LG GG+GVVY G+L +GT
Sbjct  567   THTIPNSEPGDIQMVEAGNMV---ISIQVLRNVTNNFSEENILGRGGFGVVYKGELHDGT  623

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL
Sbjct  624   KIAVKRMESGVISGKGLAEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTL  683

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               H+F W + G  PL W +R+ IA DVARG+EYLH L HQSFIHRD+K SNILL DD+RA
Sbjct  684   SRHIFNWAEEGLKPLEWTKRLIIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRA  743

Query  667   KVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             KVADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   KVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  785


 Score =   126 bits (317),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG++A+DE+ P+E+ HLVTW
Sbjct  760  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRRALDESQPEESMHLVTW  819

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D  E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  820  FKRMHINKDLFRKAIDPTIDLIEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLASL  879

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+     +  E   G DL MSLP
Sbjct  880  VELWKPTY--QCSEDIYGIDLEMSLP  903



>ref|XP_004140293.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004155738.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51072.1| hypothetical protein Csa_5G429450 [Cucumis sativus]
Length=953

 Score =   534 bits (1376),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 331/761 (43%), Positives = 448/761 (59%), Gaps = 71/761 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA  M+ L  +L+P  S GWS   +PC W +V C      V  I I  Q++ G LP  L 
Sbjct  33    DAPAMTALKKSLNPTESLGWS-DPNPCKWNHVLCSD-DNRVTRIQIGRQNLQGMLPLNLQ  90

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L  L +Q N +SGPLPS + ++SL+ L L  N+F+SIP DF  G+ +L+   I +N
Sbjct  91    NLTALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQAVEIDEN  150

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W+I + L  +++L +F A++A++TG IP F   +  P L NL L++NNL G LP 
Sbjct  151   -PFSAWEIPASLRNASTLQNFSANSANVTGRIPEFLGGEDIPGLTNLHLAFNNLEGGLPS  209

Query  2104  SFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S++++  +   N    LSG+IDV+ +MT L +VWL +N+F+GP+PD S+  +L  L
Sbjct  210   SFSGSQLESLWVNGQNSADKLSGSIDVLQNMTSLIEVWLHSNSFSGPLPDFSRLKDLQAL  269

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGP  1754
              L DN+ TG VP SL   P+L+ + L NN L GP+PLF   V V +  D+NSFC   PG 
Sbjct  270   SLRDNKFTGPVPSSLVNSPSLKVVNLTNNLLQGPIPLFKTGVVVDMTNDSNSFCLQDPGE  329

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD +V  LL+    +GYP   A++WKGND C  W  I+C  + +++T VN      SG I
Sbjct  330   CDSRVNTLLSIVKFMGYPQRFAENWKGNDPCAEWIGISC--RNQSITIVNFQKMGLSGMI  387

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP F+ L  L  L L DN+LTG IP  LTTLP L  LDVSNN LS  +P F   V ++  
Sbjct  388   SPEFASLKGLERLVLADNHLTGSIPEELTTLPFLTELDVSNNQLSGKIPKFRSNVMMTIT  447

Query  1393  GN--LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK------  1238
             GN  +  EKT ++  G+  S  + +     +               +V  +         
Sbjct  448   GNPDIGKEKTDSSSNGASPSASSNDTKEAGSNGGGNSGDGEKKPSSMVGVIVLSVVGGVF  507

Query  1237  ----------CYMKREHKRFGRAKSP--------------EKIKST--------------  1172
                       C  K + KRF + +SP              E +K T              
Sbjct  508   VLFLIGLVVLCVYKMKQKRFSQVQSPNAMVIHPRHSGSDNESVKITVAGSSVRVGAISET  567

Query  1171  -----------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
                        QM++   ++   I IQVL+  TN FSEE++LG GG+G VY G+L +GTK
Sbjct  568   QNGASSETGDIQMVEAGNMV---ISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTK  624

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL 
Sbjct  625   IAVKRMESGVIKGKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLS  684

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLF W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAK
Sbjct  685   RHLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAK  744

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             VADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  745   VADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  785


 Score =   131 bits (330),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  760  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  819

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAIDPT+D  E+TF SI+ VAELA HC   + Y+RP+M H VNVL   
Sbjct  820  FRRMQINKDSFHKAIDPTIDLTEETFASINTVAELAGHCCAREPYQRPDMGHAVNVLSSL  879

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  880  VEFWKPT--DQNSEDIYGIDLEMSLP  903



>emb|CDY09413.1| BnaA02g25970D [Brassica napus]
Length=915

 Score =   525 bits (1352),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 332/709 (47%), Positives = 450/709 (63%), Gaps = 43/709 (6%)
 Frame = -2

Query  2581  WSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPL  2402
             WS + +PC W  V CD  +  V  I ++++ I G LP  L  L  L  L + KN +SGP+
Sbjct  46    WS-NPNPCKWPTVQCDA-SNRVTRIQLNNKGIRGTLPPNLQTLTELTVLELFKNQISGPI  103

Query  2401  PSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLG  2222
             P  + ++ L+ L L  N F S+P +   GL +L+   +  N   SPW+I   L E+TSL 
Sbjct  104   PDLSGLTRLQTLNLHDNLFDSVPKNLFSGLTSLQAAYLEYN-PFSPWEIPETLKEATSLQ  162

Query  2221  SFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSSEIqnlwlnnqqqgL  2048
             +   ++ ++TG IP+FF S   P+L  L+LS N L G LP SFG+S +Q+L+LN Q+   
Sbjct  163   NLSLASCNVTGKIPDFFSSQTLPSLTRLQLSQNLLQGELPPSFGASSLQSLYLNGQKL--  220

Query  2047  SGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNL  1868
             +G++ ++ +MT L +V LQ NAF+GPIPDLS   +L    + +NQLTGVVP SLT   +L
Sbjct  221   NGSVSLLQNMTSLVEVDLQGNAFSGPIPDLSGLQSLRVFNVRENQLTGVVPPSLTASKSL  280

Query  1867  ENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYPIT  1694
               + L NN   GP P FG  V V ++ +TN FC +TPG PCDP+VT LL+ A  LGYP+ 
Sbjct  281   TTVNLTNNYFQGPTPQFGKSVGVDVITNTNRFCLETPGTPCDPRVTTLLSVAESLGYPVK  340

Query  1693  LAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNL  1514
             LA SWKGND C +W  ITC   G NVT VNLG Q  +GTISP+F+++TSL  + L+DN L
Sbjct  341   LATSWKGNDPCSSWLGITC--SGSNVTVVNLGRQGLTGTISPSFAKITSLETINLSDNYL  398

Query  1513  TGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPGSGQ  1334
             TG IP  LTTLP L+ LDVS+NN+   +P F   VN+   GN  + K    G   PG   
Sbjct  399   TGSIPNELTTLPKLKTLDVSDNNIYGDVPKFGIGVNVVTTGNANIGKD---GPSPPGVSP  455

Query  1333  TENG--SSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKSTQML-  1163
               +G  S MS+++ ++V +V  +VV++ L     C   ++  R  + +SP    S+ M+ 
Sbjct  456   DGDGGSSKMSSKVKIIVPVVGGVVVVLCLVGLGVCLYAKKRARPAKVQSP----SSHMVI  511

Query  1162  -KTNEIMGTAIKIQ---------------------VLEKATNFFseesvlgsggygvvyl  1049
                +   G AIK+                      VL   TN FSEE++LG GG+G VY 
Sbjct  512   HPDHSGDGDAIKLSVAASSVGGGGGTESSSSDIHVVLRNVTNNFSEENILGRGGFGTVYK  571

Query  1048  GKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYE  869
             G+L +GTK+AVK+M+  A   KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYE
Sbjct  572   GELHDGTKIAVKRMEPSAVSDKGLEEFKSEITVLTKMRHRHLVALLGYCLDGNEKLLVYE  631

Query  868   YMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNIL  689
             YM  GTL  HLF WK+    PL W +R+ +A DVARG+EYLH+L HQSFIHRD+K SNIL
Sbjct  632   YMPQGTLSQHLFHWKEEERKPLDWTRRLAVALDVARGVEYLHTLAHQSFIHRDLKPSNIL  691

Query  688   LNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             L DD+RAKV+DFGLV+ AP+ K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  692   LGDDMRAKVSDFGLVRLAPEGKYSIETRVAGTFGYLAPEYAVTGRVTTK  740


 Score =   106 bits (264),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII----RKSHNLQKAID  391
            G    KVD+++ GV+LME+ITG+KA+D T P+++ HLVTWF ++     +     + AID
Sbjct  735  GRVTTKVDIFSLGVILMELITGRKALDVTQPEDSVHLVTWFRRVAASKDKDKDAFKNAID  794

Query  390  PTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKF  211
            P ++ +E+T  S+ KV +LA HC   + Y+RP+M H+VNVL      W     E   +  
Sbjct  795  PNIELEEETLVSVQKVWDLAGHCCAREPYQRPDMGHIVNVLSSLTVQWTP--SEADPDDL  852

Query  210  GGFDLNMSLP  181
             G D +M LP
Sbjct  853  YGIDYDMPLP  862



>ref|NP_178291.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
 gb|AAD21776.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59281.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05504.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
Length=943

 Score =   515 bits (1326),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 336/749 (45%), Positives = 446/749 (60%), Gaps = 58/749 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D + M  L ++L+  +   WS + +PC W +V CD  +  V  I +  + I G LP+ L 
Sbjct  29    DDSTMQSLKSSLNLTSDVDWS-NPNPCKWQSVQCDG-SNRVTKIQLKQKGIRGTLPTNLQ  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+ L  L +  N +SGP+P  + +S L+ L L  N F+S+P +   G+ +L+   + +N
Sbjct  87    SLSELVILELFLNRISGPIPDLSGLSRLQTLNLHDNLFTSVPKNLFSGMSSLQEMYL-EN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                 PW I   + E+TSL +   SN SI G IP+FF   S P+L NL+LS N L G LP 
Sbjct  146   NPFDPWVIPDTVKEATSLQNLTLSNCSIIGKIPDFFGSQSLPSLTNLKLSQNGLEGELPM  205

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
             SF  + IQ+L+LN Q+   +G+I V+ +MT L +V LQ N F+GPIPDLS  V+L    +
Sbjct  206   SFAGTSIQSLFLNGQKL--NGSISVLGNMTSLVEVSLQGNQFSGPIPDLSGLVSLRVFNV  263

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PC  1751
              +NQLTGVVP SL  L +L  + L NN L GP PLFG  V V I+ + NSFC +  G  C
Sbjct  264   RENQLTGVVPQSLVSLSSLTTVNLTNNYLQGPTPLFGKSVGVDIVNNMNSFCTNVAGEAC  323

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+V  L++ A   GYP+ LA+SWKGN+ C NW  ITC   G N+T VN+  Q  SGTIS
Sbjct  324   DPRVDTLVSVAESFGYPVKLAESWKGNNPCVNWVGITC--SGGNITVVNMRKQDLSGTIS  381

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             P+ ++LTSL  + L DN L+G IP  LTTL  L++LDVSNN+     P F   V +   G
Sbjct  382   PSLAKLTSLETINLADNKLSGHIPDELTTLSKLRLLDVSNNDFYGIPPKFRDTVTLVTEG  441

Query  1390  NLLL-----EKTVATGRGSPGSGQT--ENGSSMSARMfvvvvivvvivvlvvlfvFYK--  1238
             N  +      KT      SPGS  +   +GS  S +   V +IV V+  +V         
Sbjct  442   NANMGKNGPNKTSDAPGASPGSKPSGGSDGSETSKKSSNVKIIVPVVGGVVGALCLVGLG  501

Query  1237  -CYMKREHKRFGRAKSP--------------EKIKSTQM---------------------  1166
              C   ++ KR  R +SP              + IK T                       
Sbjct  502   VCLYAKKRKRPARVQSPSSNMVIHPHHSGDNDDIKLTVAASSLNSGGGSDSYSHSGSAAS  561

Query  1165  -LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATH  989
              +   E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+     
Sbjct  562   DIHVVEAGNLVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESSVVS  621

Query  988   TKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFD  809
              KG+ EF++EI  L+K+RH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF WK+ G  
Sbjct  622   DKGLTEFKSEITVLTKMRHRHLVALLGYCLDGNERLLVYEYMPQGTLSQHLFHWKEEGRK  681

Query  808   PLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPD  629
             PL W +R+ IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ APD
Sbjct  682   PLDWTRRLAIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPD  741

Query  628   DKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              K  +ETRVAGTFGYLAPEYA TGRVT K
Sbjct  742   GKYSIETRVAGTFGYLAPEYAVTGRVTTK  770


 Score =   115 bits (289),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKII--RKSHNLQKAIDPT  385
            G    KVD+++ GV+LME+ITG+KA+DET P+++ HLVTWF ++   +  +  + AIDP 
Sbjct  765  GRVTTKVDIFSLGVILMELITGRKALDETQPEDSVHLVTWFRRVAASKDENAFKNAIDPN  824

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLR--PEEIVEKF  211
            +  D+ T  SI KV ELA HC   + Y+RP+M H+VNVL      W+     P+++    
Sbjct  825  ISLDDDTVASIEKVWELAGHCCAREPYQRPDMAHIVNVLSSLTVQWKPTETDPDDVY---  881

Query  210  GGFDLNMSLPLVFDD-SSIESLSFT  139
             G D +M LP V     + E LS T
Sbjct  882  -GIDYDMPLPQVLKKWQAFEGLSQT  905



>ref|XP_009408496.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408504.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=929

 Score =   533 bits (1372),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 343/740 (46%), Positives = 463/740 (63%), Gaps = 47/740 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALSP--APS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             D A M  + A L    +PS  WS S +PC+ W  V+C    G V +I   + S+SG+LPS
Sbjct  27    DLAAMQVIAAGLGANLSPSLAWSPSAEPCSAWAGVSCTG--GRVTAIRAGNCSLSGSLPS  84

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
              +  L +L  L +Q+NSLSGPLPS A +++L+ L L  N FSS+P DF  GL +L    I
Sbjct  85    AVRSLTALTRLELQQNSLSGPLPSLAGLAALQVLLLHGNSFSSLPADFFTGLTSLESAFI  144

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSL  2111
              DN  L+PW +   L ++ +L +F A+ A ++G +P F   +FP L +L L++N L+G +
Sbjct  145   -DNNPLAPWSLPDSLRDAAALVNFSANFARVSGPLPAFLGTAFPALDHLGLAFNLLSGPV  203

Query  2110  PGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P +F ++ +++L           SG+I  + +MT L ++WL +N F+GP+PD S+   L 
Sbjct  204   PAAFAATPLRSLWLNNQQGAARFSGSISFVENMTALEELWLHSNDFSGPLPDFSQLTRLR  263

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDT--NSFCKDT  1763
             DLQL DN+LTGVVP SLT LP+L N+ L NN L GP+P+F + VK +  D     FC   
Sbjct  264   DLQLRDNRLTGVVPRSLTQLPSLSNVTLTNNLLQGPVPVFPSSVKEVNVDPKGERFCLPN  323

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             PG CDP+VT LL+     GYP   A++W GN+ C  W  I+CD  G N+T +NL     +
Sbjct  324   PGDCDPRVTVLLSVVKDFGYPARFAENWVGNEPC-GWLGISCD-DGGNITVINLQKMGLN  381

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTISP F  + SL+ L L++NNLTG IP SL +LP L+ LDVSNNNL   +PSF   V +
Sbjct  382   GTISPDFGSIASLQRLLLSNNNLTGTIPASLASLPSLRQLDVSNNNLWGQIPSFSKNVLV  441

Query  1402  SFGGNLLLEKTVATGRGS-----PGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
             +  GN  + K +     S       +  + NG   S  + V+VV V+ +VV + L V   
Sbjct  442   NTAGNQNIGKDLTGYSNSNPNVLSDASSSHNGHPSSVPVSVIVVSVIAVVVGISLAVVLG  501

Query  1237  -CYMKREHKRFGRAKS--------------PEKIKSTQM------------LKTNEIMGT  1139
              CY KR+ ++  R +S              P+ IK T              +   E    
Sbjct  502   FCYYKRKLQQRSRVQSPNTTVILPRHSRSDPDTIKITVAGSSVDDGTTLGNVHVVETGNM  561

Query  1138  AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAE  959
              I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M  G   TKG+NEF++E
Sbjct  562   VISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMDAGVMGTKGLNEFKSE  621

Query  958   IAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTI  779
             I+ L+KVRH+NLV+L+GYC++ ++ LLVYEYM  GTL  HLFEWK+ G  PL WK+R++I
Sbjct  622   ISVLTKVRHRNLVSLLGYCLDANERLLVYEYMPQGTLSCHLFEWKESGLKPLEWKKRLSI  681

Query  778   AWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF-VETRV  602
             A DVARG+EYLHSL  QSFIHRD+K SNILL DD++AKVADFGLV+ APD+K   V+TRV
Sbjct  682   ALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMKAKVADFGLVRLAPDEKGCSVQTRV  741

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGYLAPEYA TGRVT K
Sbjct  742   AGTFGYLAPEYAVTGRVTTK  761


 Score =   132 bits (332),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 2/150 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S++  + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E  HLVTW
Sbjct  736  SVQTRVAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEENVHLVTW  795

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++       KAIDPT+D DE T  SIS VAELA HC   + ++RP+M H VNVL   
Sbjct  796  FWRMLLNKDAFHKAIDPTIDLDEDTSASISTVAELAGHCCAREPHQRPDMSHAVNVLSSL  855

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFD  169
            A  W+   P+   E+  G DL+M+LP   +
Sbjct  856  AELWKPSDPDS--EESYGIDLDMTLPQALE  883



>gb|AID55112.1| leucine-rich repeat receptor-like protein kinase [Cocos nucifera]
Length=885

 Score =   531 bits (1367),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 357/736 (49%), Positives = 461/736 (63%), Gaps = 44/736 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D   M  +   L+  P  W+ + DPC W+ V C   +G + +IN+  + +SG L S +++
Sbjct  35    DRQAMLDIAKKLANLPPSWTGT-DPCQWSGVTCR--SGRIDTINLALKGVSGTLSSSISK  91

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+SL SL +Q+N +SGPLPS +N+S LE ++L  N FSSIP DF  GL  L+  S+ DN 
Sbjct  92    LSSLSSLQLQQNQISGPLPSLSNLSDLETIFLHGNAFSSIPNDFFTGLSALQSVSLDDN-  150

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFG  2096
              L+PW I + LA+S  L +F ASN SI G IP FF +  +LQ+LR+SYNN+TG LP SFG
Sbjct  151   PLAPWVIPADLAKSADLMTFSASNTSINGEIPEFFGTLSSLQSLRISYNNMTGGLPDSFG  210

Query  2095  SSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
              S IQ+L           SG+IDVI SMT+LS VWLQ+N+FTGPIPDLSK  +L    + 
Sbjct  211   GSGIQSLWLNNQQSPTKFSGSIDVIGSMTQLSLVWLQSNSFTGPIPDLSKLGSLASFNVR  270

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DN LTGVVP SLT    L+N+ L NN+L GP P F   V   +   N+FC   PGPC+  
Sbjct  271   DNSLTGVVPPSLTSCLTLKNVSLSNNQLQGPYPKFAGGVNADIDKGNNFCNSVPGPCNAV  330

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPA  1565
             VTALLA A G  YP+ LA SW G+D C  NW  + CD +  N+  +N  NQ F G ISP 
Sbjct  331   VTALLAVAEGFEYPLKLATSWTGSDPCGGNWFGVNCDNE-NNINVLNFANQHFPGFISPD  389

Query  1564  FSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL  1385
              S  TSL  L L++NNL+GPIP +L  LP LQ+LDV+NNNLS  +P FP  V +  GGN 
Sbjct  390   ISNFTSLTRLILSNNNLSGPIPDTLKMLPKLQLLDVTNNNLSGIVPHFPDYVTLKLGGNP  449

Query  1384  LLEKTVATGRGSPGSGQTE------------NGSSMSARMfvvvvivvvivvlvvlfvFY  1241
             LL +T  +G GS  S  +             +GS  S  +    V+ V+I++  +L  FY
Sbjct  450   LLGRTSGSGGGSSSSSPSGGPSESSSSGNQPSGSKSSGAVIAGTVVAVLILIACLLAFFY  509

Query  1240  KCYMKREHKRFGRAKS------PEKIKSTQMLK-------------TNEIM----GTAIK  1130
               Y K+  +RFG+  +      PE  K   M +              N  M    G  + 
Sbjct  510   SIYRKKHLRRFGQVPTRTPPNEPELGKIGVMGREMGEIYRQSSPGSANTFMIDPQGMHMS  569

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             IQ + +ATN FSEE++LG GG+GVVY G   NGT +AVKK +      KG NEF+AEI  
Sbjct  570   IQSVRRATNNFSEENILGRGGFGVVYKGN-HNGTLIAVKKSRVDLAGNKGSNEFKAEIDV  628

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             LSKVRH++LVAL+GY  + ++ LLVYEYM  GTL  HLF++      PLTWKQR+TIA D
Sbjct  629   LSKVRHRHLVALLGYYDDGNERLLVYEYMPGGTLEQHLFDYNNIKCSPLTWKQRLTIALD  688

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  +SFIHRD+K SNILL++D+RAKV+DFGLVK   D +  + TR+AGTF
Sbjct  689   VARGVEYLHSLAQESFIHRDLKPSNILLDNDMRAKVSDFGLVKHCVDKQKSMMTRLAGTF  748

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA TG+VT K
Sbjct  749   GYLAPEYALTGKVTTK  764


 Score = 93.6 bits (231),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 71/132 (54%), Gaps = 1/132 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   KVDVYAFGV+LME+ITG+K +D++ PD   +LV  
Sbjct  739  SMMTRLAGTFGYLAPEYALTGKVTTKVDVYAFGVILMELITGQKVLDDSRPDGDTNLVPI  798

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + I+ K   L+   DP L+ DE+    + +VAELA HCT    + RP+M + VN L  
Sbjct  799  FQRNIVNKDEFLKSCPDPILNLDEEACTGLMEVAELARHCTARVPHHRPDMSYAVNKLAL  858

Query  261  FAHNWRSLRPEE  226
                W+     E
Sbjct  859  LVERWKPATGNE  870



>gb|KDP25825.1| hypothetical protein JCGZ_22547 [Jatropha curcas]
Length=951

 Score =   533 bits (1372),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 345/756 (46%), Positives = 450/756 (60%), Gaps = 67/756 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAAVM  L  +L+ P   GWS   DPC W  V C +    V  I I  Q + G LPS L 
Sbjct  37    DAAVMFSLKKSLNVPDSLGWS-DPDPCNWNRVTCTEK--RVTRIQIGRQGLQGTLPSNLQ  93

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L VQ N++SGP+PS + +SSL+ + L  N+F+SIP DF  GL +L+   I DN
Sbjct  94    NLTQLVRLEVQWNNISGPVPSLSGLSSLQVVMLSGNQFTSIPSDFFTGLSSLQGLEI-DN  152

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
                S W I   +  +++L +F A++A+I+G IP FF  FP L  L L++N L G LP SF
Sbjct  153   NPFSTWVIPESIRNASALQNFSANSANISGSIPQFFGDFPGLTILHLAFNELEGGLPASF  212

Query  2098  GSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
               S+IQ+L       +  L+GTIDVI +MT L  +WL +N F+GP+PD S   +L  L +
Sbjct  213   SGSQIQSLWLNGQTSRNKLTGTIDVIQNMTLLKDIWLHSNGFSGPLPDFSGLKDLQVLSI  272

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGPCD  1748
              DN  TG VP+SL  L +L  + L NN   G MP+F + V V +  D+NSFC  +P  CD
Sbjct  273   RDNSFTGPVPLSLVNLESLTVVNLTNNLFQGRMPVFKSSVAVDMSKDSNSFCLPSPDDCD  332

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
              +V  LL     +GY    A++WKGND C +W  ITC  QG N+T VN  +   +GTISP
Sbjct  333   SRVNTLLKIVESMGYRQRFAENWKGNDPCADWVGITC-IQG-NITVVNFQHMGLTGTISP  390

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             AF+ LTSL+ L+L++NNLTG IP  LT+L  L+ LD+SNN LS  +P F   V ++  GN
Sbjct  391   AFASLTSLQRLFLDNNNLTGSIPQELTSLTALKELDLSNNQLSGKIPVFKNNVILNTNGN  450

Query  1387  LLLEKTVATG--RGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK--------  1238
               + K V T    GSP      N SS S+            +V VV              
Sbjct  451   PNIGKEVDTSILPGSPSGAPVTNTSSGSSGGSGNGGKKSSTLVGVVAVSVIGGVFVIFLI  510

Query  1237  -----CYMKREHKRFGRAKSP--------------EKIKST-------------------  1172
                  C  K++ KRF R +SP              E +K T                   
Sbjct  511   GCLIFCLYKKKQKRFSRVQSPNAMVIHPRHSGSDNESVKITVAGSSVSVGAISETHTIPA  570

Query  1171  ------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                   QM++   ++   I IQVL   TN FSEE++LGSGG+GVVY G+L +GTK+AVK+
Sbjct  571   SEQGDIQMVEAGNMV---ISIQVLRNVTNNFSEENILGSGGFGVVYKGELHDGTKIAVKR  627

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYE+M  GTL  HLF 
Sbjct  628   MESGVISGKGLAEFKSEIAILNKVRHRHLVALLGYCLDGNEKLLVYEFMPQGTLSMHLFN  687

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             W   G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFG
Sbjct  688   WANEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFG  747

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  748   LVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  783


 Score =   132 bits (332),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 91/151 (60%), Gaps = 6/151 (4%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+D++ P+E+ HLVTW
Sbjct  758  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDDSQPEESMHLVTW  817

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I       +KAIDPT+D +E+T  S+S VAELA HC   + Y+RP+M H VNVL   
Sbjct  818  FRRIHLNKDTFRKAIDPTIDLNEETLASVSTVAELAGHCCAREPYQRPDMGHAVNVLSSL  877

Query  258  AHNWRSL--RPEEIVEKFGGFDLNMSLPLVF  172
               W+     PE+I     G DL MSLP V 
Sbjct  878  VELWKPADQNPEDIY----GIDLEMSLPQVL  904



>ref|XP_006494664.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X1 [Citrus sinensis]
Length=948

 Score =   532 bits (1370),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 334/754 (44%), Positives = 453/754 (60%), Gaps = 61/754 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAAVM  L  +L+P  S GWS + DPC W +V C +    +  I I  Q++ G LPS L 
Sbjct  32    DAAVMLALKKSLNPPESLGWSDT-DPCKWNHVVCTEDK-RITRIQIGHQNLQGTLPSNLQ  89

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L +Q NS+SGPL S   ++SLE + L +N+F+S+P DF  GL +L+   I DN
Sbjct  90    NLTKLERLELQWNSISGPLRSLNGLASLEVVMLSNNQFTSVPSDFFTGLSSLQSIEI-DN  148

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W+I   L  ++ L +F A++A+ITG IP+FF  D FP L  L L++N L G LP 
Sbjct  149   NPFSSWEIPQSLRNASGLQNFSANSANITGQIPSFFGPDEFPGLTILHLAFNQLIGGLPA  208

Query  2104  SFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S+IQ+  +   N    L G IDVI +MT L ++WL +NAF+GP+PD S    L  L
Sbjct  209   SFSGSQIQSLWVNGQNGNAKLGGGIDVIQNMTSLKEIWLHSNAFSGPLPDFSGVKQLESL  268

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGP  1754
              L DN  TG VP SL  L +L+ + + NN L GP+P F   V + +   +N+FC  +PG 
Sbjct  269   SLRDNFFTGPVPDSLVKLESLKIVNMTNNLLQGPVPEFDRSVSLDMAKGSNNFCLPSPGA  328

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP++ ALL+    +GYP   A++WKGND C +W  +TC     N+T +N      +GTI
Sbjct  329   CDPRLNALLSIVKLMGYPQRFAENWKGNDPCSDWIGVTCTK--GNITVINFQKMNLTGTI  386

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP F+   SL+ L L DNNL+G IP  L+ L  L+ LDVSNN L   +PSF     ++  
Sbjct  387   SPEFASFKSLQRLILADNNLSGMIPEGLSVLGALKELDVSNNQLYGKIPSFKSNAIVNTD  446

Query  1393  GNLLLEKTVA-----------TGRGSPGSGQTENGSSMSARMfvvvv--ivvvivvlvvl  1253
             GN  + K  +           TG GS  +  TENG   S+ +  V++  ++    V+ ++
Sbjct  447   GNPDIGKEKSSSFQGSPSGSPTGTGSGNASSTENGVKNSSALITVILFCVIGGAFVISLI  506

Query  1252  fvFYKCYMKREHKRFGRAKSP------------EKIKSTQM-------------------  1166
              V   C  K++ K+F R +SP            E  KS ++                   
Sbjct  507   GVLVFCLCKKKQKQFSRVQSPNAMVIHPRHSGSENSKSVKITVAGSNVSVGAISETHTVP  566

Query  1165  ------LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
                   ++  E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+
Sbjct  567   SSEPGDIQMLEAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRME  626

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
              G    KG+ EF++EIA L+KVRH++LVAL+G+C++ ++ LLV+EYM  GTL  H+F W 
Sbjct  627   AGVISGKGLTEFKSEIAVLTKVRHRHLVALLGHCLDGNEKLLVFEYMPQGTLSRHIFNWA  686

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV
Sbjct  687   EEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLV  746

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  747   RLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  780


 Score =   129 bits (323),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  755  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  814

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I     +  KAIDPT+D +E    SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  815  FRRIHLSKDSFHKAIDPTIDLNEGILASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  874

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  875  VELWKPT--DQNSEDIYGIDLEMSLP  898



>gb|KDO41053.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=787

 Score =   526 bits (1356),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 335/755 (44%), Positives = 451/755 (60%), Gaps = 71/755 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNC--DKPTGNVVSINIDSQSISGNLPSE  2465
             DAAVM  L  +L+P  S GWS + DPC W +V C  DK    +  I I  Q++ G LPS 
Sbjct  32    DAAVMLALKKSLNPPESLGWSDT-DPCKWNHVVCIEDK---RITRIQIGHQNLQGTLPSN  87

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L  L  L +Q NS+SGPLPS   ++SLE + L +N+F+S+P DF  GL +L+   I 
Sbjct  88    LQNLTKLERLELQWNSISGPLPSLNGLASLEVVMLSNNQFTSVPSDFFTGLSSLQSIEI-  146

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             DN   S W+I   L  ++ L +F A++A+ITG IP+FF  D FP L  L L++N L G L
Sbjct  147   DNNPFSSWEIPQSLRNASGLQNFSANSANITGQIPSFFGPDEFPGLTILHLAFNQLIGGL  206

Query  2110  PGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P SF  S+IQ+  +   N    L G IDVI +MT L ++WL +NAF+GP+PD S    L 
Sbjct  207   PASFSGSQIQSLWVNGQNGNAKLGGGIDVIQNMTSLKEIWLHSNAFSGPLPDFSGVKQLE  266

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTP  1760
              L L DN  TG VP SL  L +L+ + + NN L GP+P F   V + +   +N+FC  +P
Sbjct  267   SLSLRDNFFTGPVPDSLVKLESLKIVNMTNNLLQGPVPEFDRSVSLDMAKGSNNFCLPSP  326

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
             G CDP++ ALL+    +GYP   A++WKGND C +W  +TC     N+T +N      +G
Sbjct  327   GACDPRLNALLSVVKLMGYPQRFAENWKGNDPCSDWIGVTCTK--GNITVINFQKMNLTG  384

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP F+   SL+ L L DNNL+G IP  L+ L  L+ LDVSNN L   +PSF     ++
Sbjct  385   TISPEFASFKSLQRLILADNNLSGMIPEGLSVLGALKELDVSNNQLYGKIPSFKSNAIVN  444

Query  1399  FGGNLLLEKTVA-----------TGRGSPGSGQTENGSSMSARMfvvvv--ivvvivvlv  1259
               GN  + K  +           TG GS  +  TENG   S+ +  V++  ++    V+ 
Sbjct  445   TDGNPDIGKEKSSSFQGSPSGSPTGTGSGNASSTENGVKNSSALITVILFCVIGGAFVIS  504

Query  1258  vlfvFYKCYMKREHKRFGRAKSP---------------EKIKST----------------  1172
             +  V   C  K++ KRF R +SP               E +K T                
Sbjct  505   LTGVLVFCLCKKKQKRFSRVQSPNAMVIHPRHSGSENSESVKITVAGSNVSVGAISETHT  564

Query  1171  ---------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVA  1019
                      QML+   ++   I IQVL   TN FSEE++LG GG+G VY G+L +GTK+A
Sbjct  565   VPSSEPGDIQMLEAGNMV---ISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIA  621

Query  1018  VKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHH  839
             VK+M+ G    KG+ EF++EIA L+KVRH++LVAL+G+C++ ++ LLV+EYM  GTL  H
Sbjct  622   VKRMEAGVISGKGLTEFKSEIAVLTKVRHRHLVALLGHCLDGNEKLLVFEYMPQGTLSRH  681

Query  838   LFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVA  659
             +F W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVA
Sbjct  682   IFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVA  741

Query  658   DFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGR  554
             DFGLV+ AP+ K  +ETR+AGTFGYLAPEYA   R
Sbjct  742   DFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVHTR  776



>ref|XP_010271200.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=950

 Score =   531 bits (1368),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 346/757 (46%), Positives = 457/757 (60%), Gaps = 65/757 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA+VM +L  +L+ P   GWS   DPC W +V C+     V  I I  Q + G LP  L 
Sbjct  33    DASVMQELKKSLNVPVGLGWS-DPDPCNWDHVQCND-NKQVTRIQIGGQDLQGTLPPNLG  90

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L  L +QKN +SGPLPS + +SSL+ + L +N+FS IP DF   L +L++  I DN
Sbjct  91    NLTALERLELQKNQISGPLPSLSGLSSLQVVLLGNNQFSKIPADFFAKLSSLQVIEIDDN  150

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W+I   L ++ +L +F A++A++TG IP+FF  D+FP L  L LS+N+L G LP 
Sbjct  151   -PFSAWEIPDSLRDAATLQNFSANSANVTGSIPDFFGGDTFPGLTGLHLSFNSLEGVLPQ  209

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S +Q+L          L+GTIDV+ +M  L +VWL ANAF+GP+P  S    L  L
Sbjct  210   SFAQSNLQSLWLNGQKSTNKLTGTIDVLQNMASLKEVWLHANAFSGPLPHFSGLKGLQVL  269

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGP  1754
              L DN  TG VP SL  LP+L+ + L NN L GPMP F + V V +   TNSFC  TPG 
Sbjct  270   SLRDNMFTGPVPASLISLPSLKVVNLTNNLLQGPMPKFPDSVAVDMSTQTNSFCLPTPGD  329

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP+V  LL+ A  + YP   A++WKGND C  W  ITC+    N+T +N  N   SG I
Sbjct  330   CDPRVNTLLSIASSMNYPTRFAENWKGNDPCTPWLGITCN--SGNITVINFQNMGLSGKI  387

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP FS L S++ L L +NNLTG IPV LTTLP L+ LD++NN L   +PSF   V +   
Sbjct  388   SPDFSSLKSMQKLVLANNNLTGTIPVELTTLPDLRELDLTNNQLFGNVPSFNRNVIVKTS  447

Query  1393  GNLLLEKTVATGRGSPGSGQTENGSS-----------------MSARMfvvvvivvvivv  1265
             GN  + K  A+   S GS     G S                 +   + V  VI  + ++
Sbjct  448   GNPDIGKDKASPPSSGGSENPPPGKSGGNGTNSDSSNGNNNDSVPVGVIVGSVIGGICLI  507

Query  1264  lvvlfvFYKCYMKREHKRFGRAKSPEKI--------KSTQMLKTN---------------  1154
              ++  + +  Y KR+ KRFGR +SP  +           +MLK +               
Sbjct  508   FLLGLLGFCLY-KRKQKRFGRVQSPNTMVIHPRHSGSDPEMLKISVAGSSVNAGAASETF  566

Query  1153  -------------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVK  1013
                          E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK
Sbjct  567   SRTSSGPSDIQMVEAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVK  626

Query  1012  KMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLF  833
             +M+ G    KG++EF++EIA L++VRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF
Sbjct  627   RMESGVISGKGLSEFKSEIAVLTRVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLF  686

Query  832   EWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADF  653
             +W + G  PL W +R++IA DVARG+EYLHSL  QSFIHRD+K SNILL DD+RAKVADF
Sbjct  687   DWNEEGLKPLEWTKRLSIALDVARGVEYLHSLAAQSFIHRDLKPSNILLGDDMRAKVADF  746

Query  652   GLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             GLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  747   GLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTK  783


 Score =   132 bits (333),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 113/207 (55%), Gaps = 14/207 (7%)
 Frame = -3

Query  768  WLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWSKKLRMI---N  622
            W + LSI +     V ++ + + Q F         +++   +R ++ D+   +R+     
Sbjct  698  WTKRLSIALDVARGVEYLHSLAAQSFIHRDLKPSNILLGDDMRAKVADFGL-VRLAPEGK  756

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVT
Sbjct  757  ASIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVT  816

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAIDPT+D  E T  SI+ VAELA HC   + Y+RP+M H VNVL  
Sbjct  817  WFRRMHLNKDAFRKAIDPTIDLTEDTLSSITTVAELAGHCCAREPYQRPDMGHAVNVLSS  876

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+   P+   E   G DL+M+LP
Sbjct  877  LVELWKPADPDS--EDIYGIDLDMTLP  901



>gb|KHN39482.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=912

 Score =   530 bits (1364),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 333/742 (45%), Positives = 441/742 (59%), Gaps = 67/742 (9%)
 Frame = -2

Query  2590  PSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLS  2411
             P GWS   DPC W  V C      V  I I   ++ G LP+ L +L  L  L +Q N++S
Sbjct  10    PPGWS-DPDPCKWARVLCSDDK-RVTRIQIGRLNLQGTLPTTLQKLTHLEHLELQYNNIS  67

Query  2410  GPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAEST  2231
             GPLPS   ++SL      +N FS++P DF  G+  L+   I D+    PW+I   L  ++
Sbjct  68    GPLPSLNGLTSLRVFVASNNRFSAVPADFFAGMSQLQAVEI-DSNPFEPWEIPQSLRNAS  126

Query  2230  SLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--wlnn  2063
              L +F A++A++ G IP FF  D FP L  L L+ NNL G+LP SF  S+IQ+L      
Sbjct  127   GLQNFSANSANVGGSIPEFFGSDVFPGLTLLHLAMNNLEGTLPLSFSGSQIQSLWLNGQK  186

Query  2062  qqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPV-SL  1886
                 L G+++V+ +MT L+ VWLQ+NAFTGP+PDLS   +L DL L DN+ TG VPV S 
Sbjct  187   SVNKLGGSVEVLQNMTFLTDVWLQSNAFTGPLPDLSGLKSLRDLSLRDNRFTGPVPVASF  246

Query  1885  TGLPNLENIRLQNNKLLGPMPLFGNKVKVI-LGDTNSFCKDTPGPCDPQVTALLAFAGGL  1709
              GL  L+ + L NN   GPMP+FG+ V V  + D+NSFC  +PG CDP+V  LL+  G +
Sbjct  247   VGLKTLKVVNLTNNLFQGPMPVFGDGVVVDNVKDSNSFCLPSPGDCDPRVDVLLSVVGVM  306

Query  1708  GYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYL  1529
             GYP   A+SWKGND C  W  ITC      +T VN      SG ISP F++L SL+ + L
Sbjct  307   GYPPRFAESWKGNDPCAYWIGITC--SNGYITVVNFQKMELSGVISPEFAKLKSLQRIVL  364

Query  1528  NDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNL------------  1385
              DNNLTG IP  L TLP L  L+V+NN L   +PSF   V +S  GN             
Sbjct  365   ADNNLTGSIPEELATLPALTQLNVANNQLYGKVPSFRKNVVVSTNGNTDIGKDKSSLSPQ  424

Query  1384  -LLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CYMKREHKR  1211
              L+       +G  G      G   S+ + V+V  V+  V +V +  F   C  + + K+
Sbjct  425   GLVPPMAPNAKGDSGGVSGIGGKKSSSHVGVIVFSVIGAVFVVSMIGFLVFCLFRMKQKK  484

Query  1210  FGRAKSP--------------EKIKST-------------------------QMLKTNEI  1148
               R +SP              E +K T                         QM++   +
Sbjct  485   LSRVQSPNALVIHPRHSGSDNESVKITVAGSSVSVGAASETRTVPGSEASDIQMVEAGNM  544

Query  1147  MGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
             +   I IQVL+  T+ FSE++VLG GG+G VY G+L +GT++AVK+M+ GA   KG  EF
Sbjct  545   V---ISIQVLKNVTDNFSEKNVLGQGGFGTVYRGELHDGTRIAVKRMECGAIAGKGAAEF  601

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
             ++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF+W + G +PL W +R
Sbjct  602   KSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFDWPEEGLEPLEWNRR  661

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             +TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+ AP+ K+ +ET
Sbjct  662   LTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKASIET  721

Query  607   RVAGTFGYLAPEYATTGRVTKK  542
             R+AGTFGYLAPEYA TGRVT K
Sbjct  722   RIAGTFGYLAPEYAVTGRVTTK  743


 Score =   125 bits (313),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  718  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEDSMHLVTW  777

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAID T++ +E+T  SI  VAELA HC   + Y+RP+M H VNVL   
Sbjct  778  FRRMSINKDSFRKAIDSTIELNEETLASIHTVAELAGHCGAREPYQRPDMGHAVNVLSSL  837

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL+MSLP
Sbjct  838  VELWKP--SDQNSEDIYGIDLDMSLP  861



>ref|XP_004298491.1| PREDICTED: probable receptor protein kinase TMK1-like [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   530 bits (1364),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 329/738 (45%), Positives = 466/738 (63%), Gaps = 46/738 (6%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPA-PSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGN  2477
             S   C+D   M  +L +++P  P  WS+  D CTW  V C+   G V +I I  Q++SG+
Sbjct  20    SQKLCEDQPAMEAILKSITPKLPDKWSSGSDCCTWGAVGCEN--GKVTAIMIKEQNLSGS  77

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPP-DFLLGLPNLR  2300
             L  ++ +L SL+ L + +N+L+G  PS   +S L E+Y + N F+  P  DF  GL +L 
Sbjct  78    LHPDINKLTSLQRLHIMRNNLTGSFPSLQGLSQLTEVYANDNSFTYFPDNDFFSGLDSLE  137

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             +F + +N     W+I      ++ L +F AS+A+I+G IP+FFD+ P+L  L+L+YNNL 
Sbjct  138   VFRVENN-PFQAWKIPDSTKFASKLTTFTASSANISGKIPDFFDNMPSLVTLQLAYNNLE  196

Query  2119  GSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             G LP SF  S I  LWLNN  +  +GTI V+ +MT L+QVWL  N FTGP+PD S+  NL
Sbjct  197   GELPASFSGSGIGTLWLNNNDRL-NGTISVLQNMTGLTQVWLHGNEFTGPLPDFSQLTNL  255

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDT  1763
              DL+LG N+LTG+VP SL  L +L+N+ L +N L GPMP F G  +  +   +N+FC++ 
Sbjct  256   QDLKLGSNKLTGIVPASLQNLTSLQNVSLSSNMLQGPMPNFTGGAINQVDVTSNNFCRND  315

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDAC--QNWAFITCDPQGKNVTTVNLGNQR  1589
                CDP+VTALL+ A  +GYP   A +W GND C   +W  +TC  +G ++T +N  N R
Sbjct  316   TTTCDPRVTALLSIAKDMGYPSVFADNWIGNDPCGSSHWTGVTCSGKG-DITVLNFANMR  374

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              +GTIS +FS LTSL  L + DNNLTG IP  LT+L +L+ LD+SNN L   +PSF   V
Sbjct  375   LTGTISSSFSLLTSLNRLIVKDNNLTGTIPQELTSLHNLEELDLSNNKLYGKVPSFRENV  434

Query  1408  NISFGGNLLLEKTVATGRGSPGSGQTENGSSMSAR--MfvvvvivvvivvlvvlfvFYKC  1235
              +  GGN  +      G+ SP SG  + G S  ++  M VV V++  +  +++L +    
Sbjct  435   VVKLGGNPDI------GKDSP-SGTADGGGSKKSKTGMNVVGVVMGGVAGVLLLVLLSVF  487

Query  1234  YMKREHKRFGRAKSPEKI----------KSTQMLKTNEIMGTA-----------------  1136
              +K++ +  G+ +SP  +           + ++   N + G                   
Sbjct  488   LLKKKQRGSGKVQSPNALVIHPHHSGDQNAVKITVANRVNGIGSENRSPHDIHVESGNMI  547

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             I IQVL   TN F+E+ +LG GG+G VY G+L +GTK+AVK+M+ G    KG++EF++EI
Sbjct  548   ISIQVLRSVTNNFNEDKILGKGGFGTVYEGELHDGTKIAVKRMESGMVADKGLHEFKSEI  607

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
             A L+KVRH++LV L+GYC++ ++ LLVYE+M  GTL  HLF WK+ G  PL W +R+TIA
Sbjct  608   AVLTKVRHRHLVGLLGYCLDGNEKLLVYEHMPQGTLSRHLFNWKEEGLKPLEWTRRLTIA  667

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARG++YLH L ++ FIHRD+K SNILL DD+RAKVADFGLV+ AP  K+ +ETR+AG
Sbjct  668   LDVARGVQYLHGLANEIFIHRDLKPSNILLGDDMRAKVADFGLVRLAPAGKASIETRLAG  727

Query  595   TFGYLAPEYATTGRVTKK  542
             TFGYLAPEYA TGR+T K
Sbjct  728   TFGYLAPEYAATGRMTLK  745


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG+KA+DE+ P E+CHLVTW
Sbjct  720  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRKAIDESQPGESCHLVTW  779

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F + + K+    + +DP +  +E+T  SI  VAELA HC+  + Y+RP++ H VNVL   
Sbjct  780  FRRKLIKTEAFPEIVDPRISVNEETISSICTVAELAGHCSAREPYQRPDIGHAVNVLSSL  839

Query  258  AHNWRSLRPEEIVE  217
               W+  + E+  E
Sbjct  840  VEQWKPSKQEDFDE  853



>ref|XP_010917500.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=889

 Score =   526 bits (1355),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 332/727 (46%), Positives = 448/727 (62%), Gaps = 38/727 (5%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD+A M  +  +L   P    A+ +PC+W  V+C    G+VV IN+ ++ +SG L   ++
Sbjct  28    DDSAAMQDIAKSLI-VPQWKLANGNPCSWPGVSCQG--GSVVEINLKNKGVSGELSPSIS  84

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+ L+SL +QKN + G L S AN++SLE L +D N F+++P DF  GL +L+   I D 
Sbjct  85    KLSFLKSLQLQKNQIKGDLSSLANLASLESLSIDDNAFTTMPADFFSGLTSLQTV-ILDK  143

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
                 PW I   +++  +L  F AS+A++TG IP+FF   P LQ + LSYN + G LP SF
Sbjct  144   NPFIPWSIPDDVSKCVNLVVFSASDAAVTGNIPDFFGKMPKLQTVTLSYNTMKGELPASF  203

Query  2098  GSSEIqnlw--lnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
               S IQ+L           +G IDVI+SMT+LS VWLQ+N FTGPIPDLS+  +L D ++
Sbjct  204   KGSNIQSLVLNNQQTGSQFTGRIDVIASMTQLSVVWLQSNGFTGPIPDLSELASLMDFRV  263

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-CD  1748
              DN LTGVVP SLT    L+N+ L NNKL GPMP F + V V +   N FC   P   CD
Sbjct  264   RDNSLTGVVPPSLTSSATLKNVTLSNNKLQGPMPKFADGVAVDIDKGNQFCSKNPAEQCD  323

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             P+VT LL  A G  YP+ LA+SW+GND C+NW  +TC   G+ +  +N  N+ ++GTIS 
Sbjct  324   PRVTTLLEVAEGFEYPMDLAESWQGNDPCKNWQGVTC--AGQEIVVLNFANRHYNGTISS  381

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             A     SL+ L L++N+L+G IP SLT L  L ++DV+NN+LS  +P F   V +   GN
Sbjct  382   AIGNFASLQKLILSNNSLSGRIPDSLTKLQKLTLVDVTNNDLSGKVPEFQQDVEVRKEGN  441

Query  1387  LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK-REHKR  1211
               + K V +  G  GS  + +         +  +++ V+V +  L     CY++ R+HK 
Sbjct  442   RNIGKEVDSSGGDSGSNGSSSKFQAGT---ISGIVIGVLVGIGCLVAVLACYIRSRKHKE  498

Query  1210  FGR------AKSPEKIK------------------STQMLKTNEIMGTAIKIQVLEKATN  1103
             FG       A  PE +K                   +    T +  G  + I  +  ATN
Sbjct  499   FGWVSTQTPANEPELVKIGVIGTNLNDGSWNGRYTQSSTGNTTDSQGMYMSINAIRSATN  558

Query  1102  FFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNL  923
              FSE+S++G GG+GVVY G+L N T +AVK+ K G    KG  EF+AEI  L KVRH++L
Sbjct  559   NFSEDSIIGRGGFGVVYKGQL-NETMIAVKRNKVGLMGKKGNEEFRAEIDVLQKVRHRHL  617

Query  922   VALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLH  743
             VAL+G+C    + LLVYEYM  GTL  HLFE   +GF PLTWKQR+TIA DVARG+EYLH
Sbjct  618   VALLGFCDVGDEQLLVYEYMPGGTLEQHLFECSDNGFSPLTWKQRLTIALDVARGVEYLH  677

Query  742   SLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYAT  563
             SL  +SFIHRD+K SNILL++D RAKV+DFGLVK A D +  + TR+AGTFGYLAPEYA 
Sbjct  678   SLAQESFIHRDLKPSNILLDNDKRAKVSDFGLVKLALDKQKSMMTRLAGTFGYLAPEYAI  737

Query  562   TGRVTKK  542
             TG+VT K
Sbjct  738   TGKVTTK  744


 Score = 98.2 bits (243),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   K+DVYAFGV+LME+ITG++ +D+T PDE  +LV  
Sbjct  719  SMMTRLAGTFGYLAPEYAITGKVTTKIDVYAFGVILMELITGERVLDDTRPDEDTNLVYV  778

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + I+ K + L  + DP L  DE+   S+ +VAE+A +CT  +  +RP+M H VN L P
Sbjct  779  FRRNILDKENFLMSSPDPNLRLDEEDLISLWEVAEVARYCTAREPSQRPDMSHAVNKLAP  838

Query  261  FAHNWR  244
                W+
Sbjct  839  LVEKWK  844



>ref|XP_007141936.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
 gb|ESW13930.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
Length=947

 Score =   528 bits (1359),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 331/756 (44%), Positives = 453/756 (60%), Gaps = 67/756 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD +VM  L  +L+P   GW+   DPC W +V C +    V  I I   ++ G LP+ L 
Sbjct  33    DDVSVMLALKNSLNPP--GWTG-PDPCMWDHVRCSEDK-RVTRIQIGRLNLQGTLPATLH  88

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L+ L +Q N++SGP+PS   +++L      +N FS++P DF  G+P L+   I DN
Sbjct  89    NLTQLQQLELQYNNISGPIPSLNGLTNLRVFIASNNRFSAVPADFFAGMPQLQAVEI-DN  147

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPG  2105
                 PW+I   L  ++ L +F A++A++ G +P+FF+S  FP+L  L L+ NNL G+LP 
Sbjct  148   NPFEPWEIPQTLRNASVLQNFSANSANVRGTLPDFFNSEVFPSLTLLHLAINNLEGTLPL  207

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S+IQ+L          L G++ V+ +MT L++VWL +NAFTGP+PDLS   +L  L
Sbjct  208   SFSGSQIQSLWLNGQKSVNRLGGSVAVLQNMTLLTEVWLHSNAFTGPLPDLSGLKSLQVL  267

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGP  1754
              L DN+ TG VP SL GL  LE + L NN   GPMP+FGN V+V    D+NSFC   PG 
Sbjct  268   SLRDNRFTGPVPASLVGLKTLEVVNLTNNLFQGPMPVFGNGVEVDNDKDSNSFCLSGPGD  327

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP+V  LL+  G +GYP     SWKGND C  W  I+C     N+T VN    + SG I
Sbjct  328   CDPRVQVLLSVVGLMGYPQRFGDSWKGNDPCAGWIGISCG--DGNITVVNFQKMQLSGEI  385

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP  S++ SL+ + L DNNLTG IPV LTTLP L +L+V+NN L   +PSF   V ++  
Sbjct  386   SPDLSKIKSLQRIVLADNNLTGSIPVELTTLPRLSLLNVANNQLYGKVPSFKSNVVVTTN  445

Query  1393  GNLLLEKTVAT----GRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK----  1238
             GN+ + K  ++    G  SP +  ++  +  S          V ++V  V+   +     
Sbjct  446   GNVDIGKDKSSQSPQGSVSPTAPNSKGENGGSGNGGKKSSSHVGVIVFSVIGAVFVVSMI  505

Query  1237  -----CYMKREHKRFGRAKSP--------------EKIKST-------------------  1172
                  C  + + K+  R +SP              E +K T                   
Sbjct  506   GFLVFCLFRMKQKKLSRVQSPNALVIHPRHSGSDNESVKITVAGSSVSVGGASETRTVPG  565

Query  1171  ------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                   QM++   ++   I IQVL   T+ FS +++LG GG+G VY G+L +GT++AVK+
Sbjct  566   SEAGDIQMVEAGNMV---ISIQVLRNVTDNFSAKNILGQGGFGTVYRGELHDGTRIAVKR  622

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ GA   KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF 
Sbjct  623   MECGAITGKGAAEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFN  682

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             W + G +PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFG
Sbjct  683   WPEEGLEPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFG  742

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   LVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  778


 Score =   125 bits (315),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 88/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  753  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMEVITGRKALDETQPEDSMHLVTW  812

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAID  +D +E+T  SI  VAELA HC   + Y+RP+M H VNVL   
Sbjct  813  FRRMSINKDSFRKAIDSAIDLNEETLASIHTVAELAGHCCAREPYQRPDMGHAVNVLSSL  872

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL+MSLP
Sbjct  873  VELWKP--SDQNSEDIYGIDLDMSLP  896



>gb|EYU30867.1| hypothetical protein MIMGU_mgv1a001044mg [Erythranthe guttata]
Length=905

 Score =   526 bits (1354),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 336/744 (45%), Positives = 440/744 (59%), Gaps = 57/744 (8%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASK-DPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLAS  2447
             M  L   L+P P   S S  DPC W  V+C +    V  I I  Q++ G LP+EL+ L  
Sbjct  1     MFALKKNLNPPPDALSWSDPDPCKWARVHCSE--NRVTQIQIGHQNLQGTLPNELSLLTQ  58

Query  2446  LRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELS  2267
             L  L +Q N++SGPLP+    +SL+ L L +N F+ IP DF +G+ +L+     DN   S
Sbjct  59    LERLELQWNNISGPLPNLKGFTSLQYLILSNNRFTFIPDDFFIGMSSLQSVEF-DNNPFS  117

Query  2266  PWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGSFGS  2093
              W I   L  +++L +F A++A++TG  PNFF  D FP L +L L+ NNL G LP SF  
Sbjct  118   AWAIPESLRNASTLQNFSANSANVTGAFPNFFGPDEFPGLTSLHLALNNLEGGLPLSFSG  177

Query  2092  SEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQ  1913
             S+I++LW+N Q+   SG IDV+ +MT L +VWL +N F+GP+PD S   NL  L L DN 
Sbjct  178   SQIESLWVNGQKL--SGGIDVLQNMTFLKEVWLHSNGFSGPLPDFSGLKNLESLSLRDNS  235

Query  1912  LTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPCDPQVT  1736
              TG VPVSLT L +L+ + L NN   GPMP F   V V +   TNSFC   PG CDP+V 
Sbjct  236   FTGPVPVSLTNLESLKVVNLTNNLFQGPMPKFNESVSVDMTKHTNSFCLPQPGDCDPRVN  295

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
              LL+    + YP   A++W GND C +W  ITC+    N+T VN  N    G ISP F+ 
Sbjct  296   TLLSIIKSMDYPRKFAENWNGNDPCADWFGITCN--NGNITIVNFENMGLVGPISPDFAS  353

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             L SL+ L L +NN TG IP  LT+L  L  LDVSNN+L   +PSF     +   GNL + 
Sbjct  354   LKSLQRLVLANNNFTGTIPNELTSLLGLMELDVSNNHLHGKIPSFRSNTMVKTNGNLDIG  413

Query  1375  K------TVATGRGSPGSGQTENGSSMSARM---fvvvvivvvivvlvvlfvFYKCYMKR  1223
             K      +  T    P S    + +    R     ++  +V  + VL ++ V   C  K+
Sbjct  414   KDKPDSDSTGTSAVGPASDMQRDNNRKKNRNWIGIIMFCVVGGVFVLSLIGVAAFCVYKK  473

Query  1222  EHKRFGRAKSP--------------EKIK-----------------------STQMLKTN  1154
             +  RF R +SP              E +K                        T  ++  
Sbjct  474   KQNRFSRVQSPNAMVIHPRHSGSDNEAVKVTVAGPSVTVGGVSETHTVTANNETNDIQMV  533

Query  1153  EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMN  974
             E     I IQVL+  TN FSEE++LG GG+G VY G+L +GTK+AVK+M+ G    KG  
Sbjct  534   EAGNMVISIQVLKSVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMECGVIAGKGTA  593

Query  973   EFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWK  794
             EFQ+EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  H+F W + G  PL WK
Sbjct  594   EFQSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSQHIFNWAEEGLKPLEWK  653

Query  793   QRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFV  614
              R+T+A DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+ AP+ K  +
Sbjct  654   TRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSI  713

Query  613   ETRVAGTFGYLAPEYATTGRVTKK  542
             ETR+AGTFGYLAPEYA TGRVT K
Sbjct  714   ETRIAGTFGYLAPEYAVTGRVTTK  737


 Score =   131 bits (330),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  712  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  771

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPTLD  E+T  SI+ VAELA HC+  + Y+RP+M H VNVL   
Sbjct  772  FRRMHLNKDTFRKAIDPTLDLTEETLASITTVAELAGHCSAREPYQRPDMGHAVNVLSSL  831

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ +  ++  +   G DL MSLP
Sbjct  832  VEQWKPV--DQSSDDIYGIDLEMSLP  855



>ref|XP_002281552.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=937

 Score =   526 bits (1354),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 345/758 (46%), Positives = 450/758 (59%), Gaps = 62/758 (8%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGN  2477
             S S   DA VM  L   L+ P+  GWS S DPC W  V+CD     V  I I  +++ G+
Sbjct  21    SQSSSGDADVMQVLKKNLNQPSDLGWSDS-DPCKWDGVSCDGDR-RVTRIQIGGKNLKGS  78

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRI  2297
             LPS LT L +L  L VQ N LSGPLPS + +S L+ L L +N F+S+P  F  G+ +L+ 
Sbjct  79    LPSNLTDLTALEILEVQYNQLSGPLPSLSRLSLLQRLLLSNNNFTSVPSGFFDGMTSLQT  138

Query  2296  FSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTG  2117
              ++ DN   SPW     L  + SL SF A++A I+G  P  F++FP+L +L L++N+L G
Sbjct  139   VAL-DNNPFSPWVFPVSLQAAGSLKSFSANSAGISGKFPEIFEAFPSLTDLHLAFNSLEG  197

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF  S IQ L          L+GTI+V+ +MT L+QVWL  N+FTGP+PD S   N
Sbjct  198   GLPSSFSGSSIQTLWLNGQESASKLNGTIEVLQNMTSLTQVWLNMNSFTGPLPDFSSLTN  257

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDT  1763
             L DL L DN  TG VP +L  L +L+ + L NN L GPMP F + V   +   N FC   
Sbjct  258   LQDLNLRDNGFTGPVPSTLLNLKSLKTVNLTNNLLQGPMPEFASSVAADMVGVNMFCLPE  317

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             PGPC   V  LL  A  +GYP +LA++WKGND C  W  +TCD  G  +  VNL     S
Sbjct  318   PGPCSQTVNTLLEVAKSMGYPSSLAKNWKGNDPCDQWFGLTCDDGG--IAVVNLQKMGLS  375

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTIS  FS L SL+ L L DNNLTG IP  LT L +L+ LDVSNN L   +P+F   V +
Sbjct  376   GTISSNFSTLGSLQKLILADNNLTGTIPAELTNLQNLRELDVSNNQLYGQIPNFRSNVIV  435

Query  1402  SFGGNLLLEKTVAT--GRGSPGSGQTE-----------NGSSMSARMfvvvvivvvivvl  1262
                GN  + K        G+P  G  +           NG   S  + +V  +V  +  +
Sbjct  436   KTEGNPDIGKEGGDDPNPGTPSGGPPDSPTSPDADSPGNGGKKSNTVVIVGSVVGSVGAV  495

Query  1261  vvlfvFYKCYMKREHKRFGRAKSP--------------EKIKST----------------  1172
              ++ +   C+ +   K FGR +SP              + +K T                
Sbjct  496   FLIGLVGFCFYRTRQKHFGRVQSPNTMVIHPRHSGSDNDAVKITIANSSVNGGGSETYSH  555

Query  1171  --------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAV  1016
                     QM++   ++   I IQVL   TN FSEE+VLG GG+G VY G+L +GTK+AV
Sbjct  556   ASSGPSDIQMIEAGSMV---ISIQVLRNVTNNFSEENVLGRGGFGTVYKGELHDGTKIAV  612

Query  1015  KKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHL  836
             K+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HL
Sbjct  613   KRMESGVVSEKGLTEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHL  672

Query  835   FEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVAD  656
             F WK+ G  PL W +R++IA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVAD
Sbjct  673   FNWKEEGMKPLEWMKRLSIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVAD  732

Query  655   FGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             FGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  733   FGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTK  770


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV++FGV+LMEII+G++A+DET P+E+ HLVTW
Sbjct  745  SIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMEIISGRRALDETQPEESMHLVTW  804

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + QK+ID T+D DE+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  805  FRRMQINKESFQKSIDQTIDLDEETLASISTVAELAGHCCAREPYQRPDMSHAVNVLSSL  864

Query  258  AHNWRSLRPEEI-VEKFGGFDLNMSLP  181
               W   +P ++  E   G DL+M+LP
Sbjct  865  VELW---KPADLDSEDMYGIDLDMTLP  888



>ref|XP_002527538.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34847.1| receptor protein kinase, putative [Ricinus communis]
Length=935

 Score =   525 bits (1352),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 341/750 (45%), Positives = 452/750 (60%), Gaps = 61/750 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCT--WTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DA+VM KL  +L   PS WS S DPC   W +V CD  +  V  I I  Q++ G LP EL
Sbjct  29    DASVMLKLKESLG-NPSFWSGS-DPCNDKWDHVTCDS-SNRVTDIQIGRQNLVGTLPPEL  85

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
             ++L +L+ L V  N+LSGP+PS + +SSL+ + L +NEFSS P DF  GL ++   S+ D
Sbjct  86    SKLTALKRLEVMFNNLSGPVPSLSGLSSLQVVLLHNNEFSSFPSDFFNGLNSITTVSL-D  144

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
                 +PW+I   L  +++L  F A+ ASITG IP+FF  D FP L++L L+ N+L G LP
Sbjct  145   YNPFTPWEIPVSLTNASTLKEFSANKASITGKIPDFFNNDVFPGLESLHLAMNSLEGELP  204

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             GSF  S      L    Q L+GTI V+ +MT L+++WL  N FTGP+P+ +    L  L 
Sbjct  205   GSFSRSP-TITSLWLNGQRLNGTISVLQNMTGLTEIWLHMNQFTGPLPEFNDFNGLQKLS  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-P  1754
             L DN+ TG+VP SL  LP L  + L NN L GP P F + V+V +  ++N FC   PG  
Sbjct  264   LRDNRFTGIVPESLVKLPTLSVVNLTNNLLQGPTPEFPDSVRVDMTSESNRFCTPNPGVA  323

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD +V  LL+     GYP  LA +W+GND C  W  ITC P G N+T +N      +GTI
Sbjct  324   CDHRVEVLLSIVKDFGYPANLADNWEGNDPCAQWKGITCSP-GGNITVINFQGMGLTGTI  382

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP FS + SL+ L L +N+L G IP  LTT+P L +L+V+NN L   LPSF     I+ G
Sbjct  383   SPNFSLIPSLQKLILANNSLNGTIPSELTTMPSLSLLNVANNQLYGKLPSFKQVQVITDG  442

Query  1393  GNLLLEKTV----------ATGRGSPGSGQ----TENGSSMSARMfvvvvivvvivvlvv  1256
                + + T           +T  G PG G     T N +S + ++   VV  V  + +V 
Sbjct  443   NPDIGKDTSSSIPPGSTPGSTPSGKPGGGSNSDATGNKNSSTGKIIGSVVGAVCGLCVVG  502

Query  1255  lfvFYKCYMKREHKRFGRAKSP-------------EKIKSTQM-----------------  1166
             L VF   +  R+ KR+ + +SP             + +K T                   
Sbjct  503   LGVF---FYSRKQKRYSKVQSPNMMVIHPRHSGNQDAVKITVAESSTVGRAESCTDSSGP  559

Query  1165  --LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGAT  992
               +   E     I IQVL   TN FSE+++LG GG+G VY G+L +GTK+AVK+M+ G  
Sbjct  560   SDIHVVEAGNMVISIQVLRNVTNDFSEDNILGRGGFGTVYKGELHDGTKIAVKRMESGVL  619

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
               KG+ EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL   LF WK+ G 
Sbjct  620   SEKGLAEFTSEIAVLNKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSKFLFNWKEEGV  679

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV+ AP
Sbjct  680   KPLDWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAP  739

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  740   EGKASIETRLAGTFGYLAPEYAVTGRVTTK  769


 Score =   135 bits (340),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 91/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV++FGV+LME+ITG++A+D++ P+++ HLVTW
Sbjct  744  SIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMEMITGRRALDDSQPEDSMHLVTW  803

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +K+IDPT+D DE+T  SIS VAELA HCT  + Y+RP+M HVVNVL   
Sbjct  804  FRRMHINKDTFRKSIDPTIDLDEETLASISTVAELAGHCTAREPYQRPDMGHVVNVLSSL  863

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               WR   P+   +   G DL M+LP
Sbjct  864  VELWRPAEPDS--DDIYGIDLEMTLP  887



>ref|XP_006494665.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X2 [Citrus sinensis]
Length=787

 Score =   520 bits (1340),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 329/750 (44%), Positives = 448/750 (60%), Gaps = 61/750 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAAVM  L  +L+P  S GWS + DPC W +V C +    +  I I  Q++ G LPS L 
Sbjct  32    DAAVMLALKKSLNPPESLGWSDT-DPCKWNHVVCTEDK-RITRIQIGHQNLQGTLPSNLQ  89

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L  L  L +Q NS+SGPL S   ++SLE + L +N+F+S+P DF  GL +L+   I DN
Sbjct  90    NLTKLERLELQWNSISGPLRSLNGLASLEVVMLSNNQFTSVPSDFFTGLSSLQSIEI-DN  148

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                S W+I   L  ++ L +F A++A+ITG IP+FF  D FP L  L L++N L G LP 
Sbjct  149   NPFSSWEIPQSLRNASGLQNFSANSANITGQIPSFFGPDEFPGLTILHLAFNQLIGGLPA  208

Query  2104  SFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S+IQ+  +   N    L G IDVI +MT L ++WL +NAF+GP+PD S    L  L
Sbjct  209   SFSGSQIQSLWVNGQNGNAKLGGGIDVIQNMTSLKEIWLHSNAFSGPLPDFSGVKQLESL  268

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGP  1754
              L DN  TG VP SL  L +L+ + + NN L GP+P F   V + +   +N+FC  +PG 
Sbjct  269   SLRDNFFTGPVPDSLVKLESLKIVNMTNNLLQGPVPEFDRSVSLDMAKGSNNFCLPSPGA  328

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP++ ALL+    +GYP   A++WKGND C +W  +TC     N+T +N      +GTI
Sbjct  329   CDPRLNALLSIVKLMGYPQRFAENWKGNDPCSDWIGVTCTK--GNITVINFQKMNLTGTI  386

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP F+   SL+ L L DNNL+G IP  L+ L  L+ LDVSNN L   +PSF     ++  
Sbjct  387   SPEFASFKSLQRLILADNNLSGMIPEGLSVLGALKELDVSNNQLYGKIPSFKSNAIVNTD  446

Query  1393  GNLLLEKTVA-----------TGRGSPGSGQTENGSSMSARMfvvvv--ivvvivvlvvl  1253
             GN  + K  +           TG GS  +  TENG   S+ +  V++  ++    V+ ++
Sbjct  447   GNPDIGKEKSSSFQGSPSGSPTGTGSGNASSTENGVKNSSALITVILFCVIGGAFVISLI  506

Query  1252  fvFYKCYMKREHKRFGRAKSP------------EKIKSTQM-------------------  1166
              V   C  K++ K+F R +SP            E  KS ++                   
Sbjct  507   GVLVFCLCKKKQKQFSRVQSPNAMVIHPRHSGSENSKSVKITVAGSNVSVGAISETHTVP  566

Query  1165  ------LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
                   ++  E     I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+
Sbjct  567   SSEPGDIQMLEAGNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRME  626

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
              G    KG+ EF++EIA L+KVRH++LVAL+G+C++ ++ LLV+EYM  GTL  H+F W 
Sbjct  627   AGVISGKGLTEFKSEIAVLTKVRHRHLVALLGHCLDGNEKLLVFEYMPQGTLSRHIFNWA  686

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFGLV
Sbjct  687   EEGLKPLEWNRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLV  746

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGR  554
             + AP+ K  +ETR+AGTFGYLAPEYA   R
Sbjct  747   RLAPEGKGSIETRIAGTFGYLAPEYAVHTR  776



>ref|XP_009370081.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=949

 Score =   525 bits (1353),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 332/759 (44%), Positives = 448/759 (59%), Gaps = 65/759 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S  +DA VM  L   L+P+ S GWS   DPCTWT+V C      V  I +   +I G LP
Sbjct  31    SSSNDAEVMLALKKTLNPSESLGWS-DPDPCTWTHVGCSDDK-RVTRIQLGHLNIEGTLP  88

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
               L  L  L  L +Q N ++GPLPS + +S+L+ L L +N F+SIP DF  G+ +L+   
Sbjct  89    LSLQNLTQLERLELQWNKITGPLPSLSGLSALQVLMLSNNLFTSIPGDFFSGMTSLQSVE  148

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTG  2117
             I DN     W+I   L  + S+ +F A++A+ITG IP+FF  D FP+L NL L++N L G
Sbjct  149   I-DNNPFMSWEIPETLKSAASIQNFSANSANITGKIPHFFGGDGFPSLVNLHLAFNGLQG  207

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF   +IQ+L          L G+I V+ +MT L +VWL +NAF+G +PD S   +
Sbjct  208   ELPASFSGLQIQSLWLNGQESVGKLGGSIAVLQNMTLLKEVWLHSNAFSGTLPDFSGLTD  267

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L  L L DN  TG VPVSL  L +LE + L NN L GPMP F   V V ++  +N+FC  
Sbjct  268   LRSLSLRDNLFTGPVPVSLVSLKSLEAVNLTNNLLQGPMPAFVPGVAVDLVKGSNNFCLP  327

Query  1765  TPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
             +PG CDP+V  LL+    +GYP   A++WKGN+ C +W  +TC+    N+T +N      
Sbjct  328   SPGECDPRVNTLLSIVSSVGYPQRFAENWKGNNPCADWIGVTCN--NGNITVLNFQKMGL  385

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +GTISP  + L SL+ + L DNNLTG IP  L TLP L V DVSNNNL    P+F   V 
Sbjct  386   AGTISPEIASLKSLQRVVLADNNLTGTIPAELATLPVLTVFDVSNNNLYGKTPAFKDKVL  445

Query  1405  ISFGGNLLLEKTVATGRGSPGSGQ--TENGSSMSARMfvvvvivvvivvlvvl-------  1253
             + FG   + +K   +   S  S    T  GS  S+R        ++ V++  +       
Sbjct  446   VMFGNPDIGKKKSTSAGPSQNSTNPSTSVGSGNSSRPRGKKSSTLIGVIVFSVIGGVFVT  505

Query  1252  ---fvFYKCYMKREHKRFGRAKSP--------------EKIKST----------------  1172
                 +   C  + + K+  R +SP              E +K T                
Sbjct  506   LLIVLLLICVYRTKQKQLSRVQSPNEMVIHPRHSGSDNESMKITVAGSSVSVGALSEAHT  565

Query  1171  ---------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVA  1019
                      QM++   ++   I IQVL   TN FS+E++LG GG+G VY G+L +GTK+A
Sbjct  566   LPSSEPNEIQMVEAGNMV---ISIQVLRNVTNNFSQENILGQGGFGTVYKGELHDGTKIA  622

Query  1018  VKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHH  839
             VK+M+ G    KG++EF++EI+ L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  +
Sbjct  623   VKRMEAGVIVGKGLSEFKSEISVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRY  682

Query  838   LFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVA  659
             +F W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVA
Sbjct  683   IFNWPEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVA  742

Query  658   DFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             DFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   DFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  781


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+D++ P+E+ HLVTW
Sbjct  756  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDDSQPEESMHLVTW  815

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAIDPT+D +E+T  S+S VAELA HC   + Y+RP+M H VNVL   
Sbjct  816  FRRMFINKDSFSKAIDPTIDLNEETLASVSTVAELAGHCCAREPYQRPDMGHTVNVLSTL  875

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  876  VELWKPT--DQSSEDIYGIDLEMSLP  899



>ref|XP_010553548.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Tarenaya 
hassleriana]
Length=938

 Score =   494 bits (1271),  Expect(2) = 8e-167, Method: Compositional matrix adjust.
 Identities = 323/745 (43%), Positives = 428/745 (57%), Gaps = 54/745 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA+ M  L ++L   +   WS   +PC WT+V CD  +  V  I + S+ I G LP +L 
Sbjct  29    DASSMQALKSSLKLTSDVDWS-DPNPCRWTSVQCDD-SSRVTRIQLKSKGIRGTLPPDLK  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L  L + +N LSGP+P  + +S L+ L L +N+F+S+P D   G+ +L+   + DN
Sbjct  87    NLTALTVLELFQNQLSGPIPDLSGLSQLQRLNLHNNQFTSVPKDLFTGMTSLQGVYL-DN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
               LS   I   + ++ SL      N SI+G IP+F    +  +L  L LS+N L G LP 
Sbjct  146   NPLSSSVIPDSIKDAPSLQELSLINCSISGKIPDFLGGQTHISLARLHLSFNYLEGELPA  205

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF +S  Q+L          L+G+I V+ +MT L++VWL  N+F+GPIPDLS    L   
Sbjct  206   SFATSSFQSLWLNGQQSTGKLNGSISVLQNMTSLTEVWLHGNSFSGPIPDLSGLQVLSIF  265

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFC-KDTPG  1757
              + DN+LTG+VP SL  LP+L  + L NN   G  P F N V+V +   TNSFC  D+  
Sbjct  266   SVRDNELTGIVPQSLVNLPSLSVVNLTNNMFQGRAPRFSNGVQVDMAPRTNSFCSDDSTV  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL+     GYP   A +WKGND C  W+ +TC   G N+T +N G    SGT
Sbjct  326   ACDPRVDILLSIVEAFGYPARFASNWKGNDPCSGWSGVTC--SGSNITVINFGRGGLSGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F++L SL  + L +N LTG IP  LTTLP L+ LDVSNNNL   LP F   V +  
Sbjct  384   ISPNFAKLVSLETIILANNALTGSIPAELTTLPKLRTLDVSNNNLDGALPKFRQNVALRI  443

Query  1396  GGNLLLEK----TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CY  1232
              GN  + K    +        GSG   NGSS      V ++  VV V+     V    C 
Sbjct  444   EGNSKIGKSPSGSSGASPDDKGSGNRGNGSSSGESTTVKIIGSVVGVIGAFCLVGLGVCL  503

Query  1231  MKREHKRFGRAKSPEKI-----------------------------------KSTQMLKT  1157
                + KR  R +SP  +                                        +  
Sbjct  504   YATKWKRPARVQSPANVVIHPHHSGDQAAVKLTIAASSLNGGGSESCYSHTSSGPSDIHI  563

Query  1156  NEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
              E     I I VL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+      KG+
Sbjct  564   AEAGNMVISIHVLRNVTNNFSEENILGKGGFGTVYRGELHDGTKIAVKRMESSVVSDKGL  623

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
              EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF W++ G  PL W
Sbjct  624   AEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSQHLFHWEEEGLKPLEW  683

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
              +R++IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ APD K  
Sbjct  684   TRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPDGKHS  743

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             +ETR+AGTFGYLAPEYA  GRVT K
Sbjct  744   IETRLAGTFGYLAPEYA--GRVTTK  766


 Score =   124 bits (310),  Expect(2) = 8e-167, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = -3

Query  558  GE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKI--IRKSHNLQKAIDPT  385
            G    KVD+++FGV+LME+ITG+KA+DET P+++ HLVTWF +I   +   +  KA+DP 
Sbjct  761  GRVTTKVDIFSFGVILMELITGRKALDETQPEDSMHLVTWFRRIHNGKDQDSFNKAVDPA  820

Query  384  LDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKFGG  205
            +D D+ T  S+ KV+ELA HC   + Y+RP+M HVVNVL      W+   P+   +   G
Sbjct  821  IDLDQDTLSSVGKVSELAGHCCAREPYQRPDMGHVVNVLSSLVEQWKPSEPDP--DDMYG  878

Query  204  FDLNMSLPLV  175
             D +M L  V
Sbjct  879  IDYDMPLTQV  888



>ref|XP_010673327.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=846

 Score =   520 bits (1339),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 337/706 (48%), Positives = 447/706 (63%), Gaps = 24/706 (3%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             S +  +D + M  L  + +  P GWS++ + CTW  + CD     V SIN+ SQS+S  L
Sbjct  16    STTTANDTSAMEDLYKSFTSPPFGWSSNTEFCTWEGILCDL-NNRVTSINLTSQSLSATL  74

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             P  L  L+ L SLS+Q N+ SGPLPS AN+S L+++YLD N F+SIP     GL +L+  
Sbjct  75    PPSLNSLSQLTSLSLQNNNFSGPLPSLANLSFLQQVYLDFNNFTSIPSGAFSGLTSLQTL  134

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+S N  LSPW   S L++S+SL S +ASNA+I G IP+ F SFP LQ LRLSYN+L GS
Sbjct  135   SLSFNLNLSPWPFPSELSDSSSLVSIYASNANIEGPIPDLFGSFPGLQMLRLSYNSLNGS  194

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SF  S IQNLWLNNQ+ GLSG++DV+S MT+L+QVWL AN  TG IPDLS C  +FD
Sbjct  195   LPSSFSGSAIQNLWLNNQRFGLSGSMDVVSGMTQLTQVWLHANKLTGTIPDLSACTEIFD  254

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILG--DTNSFCKDT  1763
             LQL DNQ  G VP SL  LP L N+ LQNN L GP+P F  N V V LG  +TNSFC++T
Sbjct  255   LQLRDNQFIGFVPTSLVSLPKLLNVTLQNNYLQGPLPDFPKNVVNVSLGNENTNSFCRNT  314

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
              G CDPQV+ALL  AG LGYP+ LA++W GNDAC  W F+TCD   K V +VN   Q FS
Sbjct  315   TGECDPQVSALLQVAGALGYPVKLAETWTGNDACNQWIFLTCDSTRK-VISVNFAKQGFS  373

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTISPAF+ LTSL +LYLNDNNLTG IP SLT+LP L+ +DV+NN L+  +PSF P V++
Sbjct  374   GTISPAFANLTSLTDLYLNDNNLTGIIPESLTSLPRLKKIDVTNNELNGKVPSFRPGVSL  433

Query  1402  SFGGNLLLEKTVATGRGSPGSGQTE--------NGSSMSARMfvvvvivvvivvlvvlfv  1247
                GN    K +  G   PG              GS  +  +  +++ ++ +VV+VV+FV
Sbjct  434   ITSGN----KNIGKGVTPPGGSPRSRASSSSELKGSVSAGGVSGIIIAILGLVVVVVVFV  489

Query  1246  FYKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsgg  1067
              YKC++ +  +R       E+ +S   L  +  +      + L  ATN F  ++ LG GG
Sbjct  490   SYKCFLIKRKQRIESQDDAEQEESFSHLAPDSPV--RFSYESLMTATNNFDTQNKLGVGG  547

Query  1066  ygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHK  887
             +G V+ G L NGTK+AVK++ +     +G  EF AE+  +  + H NLV LVG+C  +  
Sbjct  548   FGSVFEGSLRNGTKIAVKRLDNLG---QGRKEFLAEVQTIGCIHHINLVKLVGFCAENKH  604

Query  886   MLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDI  707
              LLVYEY+S+G+L   +F     G   LTW  +  I   +A+G+ YLH    +   H D+
Sbjct  605   RLLVYEYLSNGSLDKWIFSSNPRG--RLTWDAKRKIILQIAKGLAYLHEECQKKIAHLDV  662

Query  706   KSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEY  569
             K  NILL++ + AK++DFGL K    D S+V T++ GT GYLAPE+
Sbjct  663   KPQNILLDEALNAKLSDFGLAKLIDKDLSYVMTQMRGTRGYLAPEW  708



>ref|XP_010668632.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score =   523 bits (1346),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 326/734 (44%), Positives = 452/734 (62%), Gaps = 59/734 (8%)
 Frame = -2

Query  2596  PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNS  2417
             P+   WS + +PC W NV CD     V  I + S+ +SG L   +  L +L  L +  N+
Sbjct  52    PSSIDWS-NANPCRWDNVGCDS-NNRVTRIQLRSEGVSGTLSPAVGNLTNLEVLELMNNA  109

Query  2416  LSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAE  2237
             L+GPLPS   +SSL+ L+L +N+FSS+P +   GL +L+   + DN     W I   L  
Sbjct  110   LTGPLPSLKGLSSLQRLFLHNNQFSSVPENLFDGLTSLQEVYL-DNNPFRTWSIPEGLKA  168

Query  2236  STSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGSFG-----SSEIqn  2078
             ++SL +F A++A++ G IP+ F  D+FP + +LRLS NNLTG LP SF      S  +  
Sbjct  169   ASSLKNFSANSANVGGKIPDIFSSDNFPGMIHLRLSSNNLTGGLPSSFSGLGLQSLWLNG  228

Query  2077  lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVV  1898
                ++  + L+GTI+V+ +MT+L Q+WL  NAFTGPIPDLS   +L DL L DN LTG V
Sbjct  229   QLDSSGGRSLNGTIEVLQNMTQLVQIWLNMNAFTGPIPDLSGLADLVDLNLRDNSLTGPV  288

Query  1897  PVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG-PCDPQVTALLA  1724
             PVSLT LP L+ + L NN L GP P F + V   +L + NSFC   PG  CD +V AL++
Sbjct  289   PVSLTKLPLLKTVNLTNNALQGPTPEFPDSVAADMLPEQNSFCLPDPGVGCDSRVNALIS  348

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
                  GYP+ +AQ WKGND C NW  ITC    KN+T +NL ++  +GT+SP F+ LTS+
Sbjct  349   VMESFGYPLQIAQQWKGNDPCANWLGITC--SNKNITIINLQSRGLTGTLSPKFASLTSV  406

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVA  1364
             + L L  NN+TG IP +LT +P+L+ LDVS NNL   +P+F  A  ++  GN+ + K   
Sbjct  407   QTLILAHNNITGTIPDALTRMPNLRTLDVSFNNLYGKIPAFSHAA-VNSHGNVNIGKDRP  465

Query  1363  TGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAK----  1196
                    SG    G   S    VV  ++  + V+    +F  C+++R+ K +GR +    
Sbjct  466   NTPSGEDSGTGATGGRGSKIGVVVGSVIGSVFVISAAGLFVFCFLRRK-KLYGRVQQSNT  524

Query  1195  ---------SPEKIKST--------------------------QMLKTNEIMGTAIKIQV  1121
                      S + +K T                           +++TN ++   I IQV
Sbjct  525   VVVHPNHSGSDDAVKITITGSGVNGKAMSEDQSQGSSSGPSDVHVIETNNMI---ISIQV  581

Query  1120  LEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSK  941
             L   TN FS+E++LG GG+G VY G+L +GTK+AVK+M  G    KG+ EF++EIA L+K
Sbjct  582   LRNVTNNFSDENILGRGGFGTVYKGELPDGTKIAVKRMNSGILGDKGLAEFKSEIAVLTK  641

Query  940   VRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVAR  761
             VRH++LVAL+G+C++ ++ LLVYEY+  G L  ++F+W++    PL W QR+TIA DVAR
Sbjct  642   VRHRHLVALLGFCLDGNEKLLVYEYLPQGALSRYIFDWQEEKLKPLKWNQRLTIALDVAR  701

Query  760   GIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPD-DKSFVETRVAGTFGY  584
             G+EYLHSL HQSFIHRD+K SNILL DD+RAKVADFGLV+ APD  K+ +ETR+AGTFGY
Sbjct  702   GVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPDGGKTSIETRLAGTFGY  761

Query  583   LAPEYATTGRVTKK  542
             LAPEYA  GR+T K
Sbjct  762   LAPEYAVMGRITTK  775


 Score =   118 bits (296),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV++FGV+LME+ITG++A+DET P+++ HLVTW
Sbjct  750  SIETRLAGTFGYLAPEYAVMGRITTKVDVFSFGVILMEMITGRRALDETQPEDSVHLVTW  809

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQ-TFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F ++   + + QKAIDPT+D +E+ T  S++ VAELA HC   +  +RP M HVVN L  
Sbjct  810  FRRMY-INDSFQKAIDPTIDLEEESTLASVNTVAELAGHCCAREPNQRPEMGHVVNALSS  868

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+     E  E   G DL+M+LP
Sbjct  869  LLDVWKP--SVENSEDIYGIDLDMTLP  893



>ref|XP_002314766.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
 gb|EEF00937.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
Length=930

 Score =   521 bits (1343),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 341/756 (45%), Positives = 452/756 (60%), Gaps = 70/756 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DDAA M KL  +L +P+  GWS S DPC W +V C      V  I I +Q++ G LP EL
Sbjct  26    DDAAAMMKLRGSLGNPSTLGWSGS-DPCNWLHVGC--LDNRVTRIQIGNQNLQGTLPPEL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L    V  N L G LPS + +S L+ L+L +N FSSIPPDF  G+ +L    + D
Sbjct  83    KDLTQLTRFEVMNNQLMGALPSLSGLSFLQVLFLHNNTFSSIPPDFFAGMTSLTSVYL-D  141

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLP  2108
                   W+I   L ++++L  F A+ A++ G IP FF+S  FP ++ L L++N   G LP
Sbjct  142   YNPFESWEIPESLKDASALKEFSANGANVAGKIPEFFNSDVFPGMETLHLAFNYFEGGLP  201

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              +F  S IQ+L          L+GTI ++ +MT L ++WLQ N FTGP+PDLS  ++L D
Sbjct  202   LNFSGSTIQSLWLNGQKSNSRLNGTISILQNMTSLKEIWLQGNHFTGPLPDLSGMISLED  261

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
             L L DN LTGVVP SL  +  L  +   NNKL GP P F   V   ++  TN+FC D PG
Sbjct  262   LNLRDNSLTGVVPPSLLNISTLRVVNFTNNKLQGPTPSFARTVDADMIPGTNNFCLDNPG  321

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC---QNWAFITCDPQGKNVTTVNLGNQR  1589
               CD  V  LL+ A   GYP +LA  WKGND C   Q W  ITC   G ++  +NL    
Sbjct  322   VACDSTVNVLLSVAKNFGYPASLADLWKGNDPCTSTQAWKGITCG--GGDILVINLKKAG  379

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              SGTIS  FS ++ L+ L L+DN LTG IP  L +L +L +LDVSNN LS  +P F   V
Sbjct  380   LSGTISSDFSLISRLQKLILSDNMLTGTIPDELISLSNLALLDVSNNKLSGQIPKFRSNV  439

Query  1408  NISFGGNLLLEKTVATGRGSPGS------------GQTENGSSMSARMfvvvvivvvivv  1265
              + +GGN  + K + T    PG+              + N +S S ++   V+  V +V 
Sbjct  440   QVEYGGNPDIGK-INTSYAPPGAPGSTPSGTGGGSDGSGNKNSASGKIVGSVIGAVGVVC  498

Query  1264  lvvlfvFYKCYMKREHKRFGRAKSP-------------EKIKST----------------  1172
             +V L VF+  Y K++ KR  + +SP             +++K T                
Sbjct  499   VVGLGVFF--YSKKQ-KRSSKVQSPNMMIIHPRRSWDQDEVKITVAGSSANSGVESFTDS  555

Query  1171  ------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                   Q+++T  ++   I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+
Sbjct  556   VGPSDIQVVRTENMV---ISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKR  612

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ G    KG+ EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF 
Sbjct  613   MESGVISEKGLAEFMSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPRGTLSSHLFS  672

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             WK+ G  PL W +R+TI  DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFG
Sbjct  673   WKEEGVKPLDWTRRLTIGLDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFG  732

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  733   LVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTK  768


 Score =   134 bits (336),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 94/159 (59%), Gaps = 8/159 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  743  SIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMEMITGRKALDETQPEDSLHLVTW  802

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +K IDPT++ DE+T  SIS VA+LA HCT  + Y+RP+M HVVNVL   
Sbjct  803  FRRMHINKDTFRKTIDPTINLDEETLGSISTVADLAGHCTAREPYQRPDMGHVVNVLSSL  862

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLV------FDDSS  160
               W+   P+   ++  G D  M LP V      FD SS
Sbjct  863  VEIWKPAEPDS--DEMYGIDFEMPLPEVLLKWQAFDGSS  899



>gb|KCW59851.1| hypothetical protein EUGRSUZ_H02591 [Eucalyptus grandis]
Length=849

 Score =   519 bits (1336),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 384/730 (53%), Positives = 474/730 (65%), Gaps = 71/730 (10%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M+++LAAL P  SGWS+ +  C WT V+CD  +  V  IN+ S S+SG LPS+L+ L+ L
Sbjct  1     MAEILAALKP--SGWSSGQTYCKWTGVSCDS-SSRVTVINLSSSSLSGALPSDLSSLSQL  57

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             +SLS+Q NSLSG +PSFA + SL+ +YLD N F+SI      GL +L+  S+S+N +L  
Sbjct  58    QSLSLQSNSLSGAVPSFAGLVSLQSIYLDGNNFTSITSGAFQGLTSLQTLSLSENHDLPS  117

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEI  2084
             WQI + L  STSL   +A N +ITG IP+F  + P+L +L LSYNNLTG LP SFG+S I
Sbjct  118   WQIPAELNASTSLTVLYADNTNITGTIPDFLGTLPSLMSLSLSYNNLTGPLPSSFGTSSI  177

Query  2083  qnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTG  1904
             QNLW+NNQ  GLSG I V++ MT+LS+VWLQ N FTGPIPDLS+C NL DLQL  NQ TG
Sbjct  178   QNLWINNQAMGLSGGISVLAGMTQLSRVWLQNNQFTGPIPDLSQCTNLLDLQLSYNQFTG  237

Query  1903  VVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLA  1724
             +VP SL  LP L+N+ L NNKL GP+P   + + V  G TNSFC   PGPCDPQVT LL 
Sbjct  238   LVPASLLALPGLKNVSLDNNKLQGPVPSNSSGISVTYGGTNSFCNSAPGPCDPQVTTLLE  297

Query  1723  FAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSL  1544
              A  LG                    I+C  QGKNVT+V    + FSGTISPAF+ LT L
Sbjct  298   VASTLGA-------------------ISC--QGKNVTSVIFSKRGFSGTISPAFANLTLL  336

Query  1543  RNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVA  1364
             R L LNDNNLTG IP SLTTL  LQVLDVSNNNL+  +P FP +V           K   
Sbjct  337   RTLLLNDNNLTGSIPESLTTLTQLQVLDVSNNNLNGSIPVFPASV-----------KLTT  385

Query  1363  TGRGSPGSGQTENGSSMSARMfvvvvivvvivv-------lvvlfvFYKC-YMKREHKRF  1208
              G G  G+  T+ GS  S+    +   V+  VV       +VVL V YK  Y+ R H++F
Sbjct  386   IGSGGSGTNSTDGGSPGSSNGSSLSDGVIAAVVVGVLIFIVVVLLVLYKFRYIIRRHRKF  445

Query  1207  GRAKSPE-KIKSTQMLKTNEIMG--------------------------TAIKIQVLEKA  1109
                 +PE  ++  +    N + G                            I I+VL +A
Sbjct  446   NSVDNPEIGMEVAKNGAGNGMNGYGGLPSELHSQSSGDHSDFPVLKGGNVKISIEVLRQA  505

Query  1108  TNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHK  929
             T  FSEE++LG GG+GVVY G+L +GTK+AVK+M+ GA  TKGM  FQAEIA L+KVRH+
Sbjct  506   TCNFSEENILGRGGFGVVYKGELHDGTKIAVKRMESGAMGTKGMKGFQAEIAVLTKVRHR  565

Query  928   NLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEY  749
             +LV L+GYCI   + LLVYEYM  GTL  HLFEW++ G+ PLTWKQRVTIA DVARG+EY
Sbjct  566   HLVMLLGYCIKGDERLLVYEYMPQGTLAQHLFEWQEKGYAPLTWKQRVTIALDVARGVEY  625

Query  748   LHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEY  569
             LHSL  Q FIHRD+K  NILL DD+RAKVADFGLVK  PD K  ++T++AGTFGYLAPEY
Sbjct  626   LHSLAQQKFIHRDLKPVNILLEDDMRAKVADFGLVKNVPDGKYSMQTQLAGTFGYLAPEY  685

Query  568   A-TTGRVTKK  542
             A  TGRVT K
Sbjct  686   ALATGRVTTK  695


 Score =   147 bits (372),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 13/208 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            TW + ++I +     V ++ + + Q F         +++   +R ++ D+   K +    
Sbjct  608  TWKQRVTIALDVARGVEYLHSLAQQKFIHRDLKPVNILLEDDMRAKVADFGLVKNVPDGK  667

Query  621  LSLRHELLGHLVILH-QSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLV  445
             S++ +L G    L  +  L  G    KVDVYAFG VLMEIITG+KA+D T+PDE  HLV
Sbjct  668  YSMQTQLAGTFGYLAPEYALATGRVTTKVDVYAFGAVLMEIITGRKALDNTMPDERAHLV  727

Query  444  TWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            TWF +++    N+ KAID TLDPDE+T ESI KVAELA HCT  + ++RP+M H+VN+L 
Sbjct  728  TWFRRVLIDKENILKAIDHTLDPDEETLESIIKVAELARHCTAEEPFQRPDMGHIVNILH  787

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            P    W      E  E+  G +L+ SLP
Sbjct  788  PLVEQWEPTSHGE--EESSGINLHTSLP  813



>ref|XP_004490803.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=976

 Score =   522 bits (1345),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 329/758 (43%), Positives = 451/758 (59%), Gaps = 67/758 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DDA++M  L   L+P  S GWS   DPC W +V C      V  I I  Q++ G  P  L
Sbjct  59    DDASLMQTLKTNLNPPLSLGWS-DPDPCKWNHVTCSDDN-RVTRIQIGRQNLHGAFPQTL  116

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L+ L +Q N+ +GPLPS  +++SL+     +N F+S   +F  G   L  F I D
Sbjct  117   LNLTELQHLELQFNNFTGPLPSLTSLNSLQVFIASNNGFTSFSGEFFAGKEQLVSFEIDD  176

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N    PW++   L  ++SL +F A+NA++ G +P+FF  D+FP L  L L++N L G LP
Sbjct  177   N-PFEPWELPKSLINASSLQNFSANNANVKGELPDFFGGDAFPVLTLLHLAFNKLEGVLP  235

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF  S++++L          L G++DV+ +MT L++VWL +N F G +P+  +  +L  
Sbjct  236   KSFSGSKVESLWLNGQKSDVKLHGSVDVLQNMTSLTEVWLHSNGFNGSLPEFDELKSLKV  295

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVI-LGDTNSFCKDTPG  1757
             L L DN  TGVVP SL  L +L+ + L NN   GP+P+FG+ V+V    D+NSFC  + G
Sbjct  296   LSLRDNSFTGVVPSSLVSLKSLKVVNLTNNLFQGPLPVFGDGVEVDNSKDSNSFCLSSFG  355

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL   G + YP   A+SWKGND C NW  ITC     NV+ VN      +GT
Sbjct  356   DCDPRVNVLLNIVGAMAYPSRFAESWKGNDPCVNWIGITC--TDGNVSVVNFQKMGLTGT  413

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F++L SL+ L L+DNNLTG IP  LTTLP L  L+V+NN +   +PSF   V +S 
Sbjct  414   ISPEFAKLKSLQRLILSDNNLTGLIPDELTTLPMLTQLNVANNQIYGKVPSFRSNVIVST  473

Query  1396  GGNLLL--EKTVATGRGSPGSGQTE-----NGSSMSARMfvvvvivvvivvlvvlfvFYK  1238
              GN+ +  +K+  T +GS  S  T+      GSS++        + V++  +V       
Sbjct  474   SGNVDIGKDKSSQTSQGSVSSNGTDASGGHGGSSVTGSKKSSSHVGVIVFSVVGAVFMAS  533

Query  1237  -------CYMKREHKRFGRAKSP-------------EKIKST------------------  1172
                    C ++ + K+  R +SP             E +K T                  
Sbjct  534   LIGFLIFCLLRMKQKKLSRVQSPNALVIHPRHXXXNESVKITVAGSSVSVGGVSEVRTVA  593

Query  1171  -------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVK  1013
                    QM++   ++   I IQVL   TN FSE+++LG GG+G VY G+L +GT++AVK
Sbjct  594   GSEVGDVQMVEAGNMV---ISIQVLRSVTNNFSEKNILGQGGFGTVYKGELHDGTRIAVK  650

Query  1012  KMK-DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHL  836
             +M+  GA   KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  +L
Sbjct  651   RMECAGAITGKGATEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSRYL  710

Query  835   FEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVAD  656
             F W   G +PL W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKVAD
Sbjct  711   FNWPDEGLEPLGWNKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKVAD  770

Query  655   FGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             FGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  771   FGLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  808


 Score =   125 bits (314),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+++ HLV W
Sbjct  783  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEDSMHLVAW  842

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAIDPT++ +E+T  SI  VAELA HC+  + Y+RP+M H VNVL   
Sbjct  843  FRRMYINKDSFRKAIDPTIEINEETLASIHTVAELAGHCSAREPYQRPDMGHAVNVLSSL  902

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL++SLP
Sbjct  903  VELWKP--SDQNSEDIYGIDLDLSLP  926



>ref|XP_010906324.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=889

 Score =   520 bits (1338),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 330/729 (45%), Positives = 460/729 (63%), Gaps = 39/729 (5%)
 Frame = -2

Query  2623  MSKLLAALSPAPS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLA  2450
             M  L  AL P+    WSAS DPCT W  V C    G V  + +  + ISG+LP ++  L+
Sbjct  1     MRTLAKALDPSGKLNWSASTDPCTSWDGVRCSG--GRVTDVLVSHRGISGSLPPDIRNLS  58

Query  2449  SLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGEL  2270
             +L  L V  N+LSGPLPS A + +L  ++L +N FSSIP DF  GL +L    + D    
Sbjct  59    ALVRLEVMINNLSGPLPSLAGLGALTTVFLANNSFSSIPDDFFSGLNSLTNVYL-DTNPF  117

Query  2269  SPWQISSYLAESTSLGSFFASNASITGVIPNFFDS-FPNLQNLRLSYNNLTGSLPGSFGS  2093
             + W I S L  ++ L +F A+  ++TG IP+F  + FP+  +L L+ NNLTGS+P SF +
Sbjct  118   AAWTIPSSLRAASGLVNFSANGVNLTGTIPDFLGTDFPSFYHLALAGNNLTGSIPSSFAA  177

Query  2092  SEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
             S + +L   N +  GLSG IDV+ +MT L Q++L +N+F+GPIPDLS+  NL+DL L DN
Sbjct  178   SPLNSLWVNNQKGGGLSGRIDVVQNMTNLKQLFLMSNSFSGPIPDLSRLENLYDLDLRDN  237

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGPCDPQV  1739
             QLTG VP SLT L +L ++ L NN L G +P+F + VKV L   T  FC      CDP+V
Sbjct  238   QLTGPVPSSLTSLKSLRSVVLTNNLLQGQVPVFPSSVKVELDPTTERFCLTDGSACDPRV  297

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL+ A  + YP  LA +WKGND C  +A ITCDP G N+T+V L     +GTISP F 
Sbjct  298   NVLLSIAKSVYYPTYLANNWKGNDPCNGFAGITCDPSG-NITSVVLQKLDLNGTISPDFQ  356

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              L  L+ L L+ N+L G IP  LT L +LQ+LDVSNN L   +PSF   V+++  GN  +
Sbjct  357   LLPKLQKLVLSGNHLNGSIPSELTNLKYLQLLDVSNNALWGKVPSFGGNVSVNTDGNSNI  416

Query  1378  EKTVATGRGSPGSGQTEN------GSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREH  1217
              K    G G+PG+   ++      G   S  + V  ++  +   L++ ++  K +  R  
Sbjct  417   GKDAGNG-GNPGTDSPDSRSADNGGRKKSIGVIVSSIVGAICGALLIGYLGRKLFCWRRK  475

Query  1216  KRFGRAKSPEKI-------KSTQMLK---TNEIMGT-------------AIKIQVLEKAT  1106
             K+    K+   +         T++LK   T+   GT              + IQ+L + T
Sbjct  476   KQIKVQKTDNMVIHQKNSGSDTELLKAAATSIANGTDSGPNIIAEPGSMVVSIQLLREVT  535

Query  1105  NFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKN  926
             + FSE+++LG GG+G VY G+L +G+ +AVK+M+ GA  +KG+NEF++EI+ L+KVRH++
Sbjct  536   DNFSEDNILGRGGFGTVYKGELHDGSMIAVKRMETGAMGSKGLNEFKSEISVLTKVRHRH  595

Query  925   LVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYL  746
             LV+L+GYC+ +++ +LVYE+M  GTL HHLF+W K    PL WK+R+TIA DVARG+EYL
Sbjct  596   LVSLLGYCLEENERILVYEHMPQGTLSHHLFDWLKLQLKPLEWKKRLTIALDVARGVEYL  655

Query  745   HSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYA  566
             HSL +Q+FIHRD+K SNILL D++RAKVADFGLV+  P+D   +ETR+AGTFGYLAPEYA
Sbjct  656   HSLANQTFIHRDLKPSNILLGDNMRAKVADFGLVRLVPEDNHSIETRLAGTFGYLAPEYA  715

Query  565   TTGRVTKKS  539
               GRVT K+
Sbjct  716   VMGRVTTKA  724


 Score =   122 bits (306),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 104/186 (56%), Gaps = 12/186 (6%)
 Frame = -3

Query  768  WLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWSKKLRMI---N  622
            W + L+I +     V ++ + + Q F         +++   +R ++ D+   +R++   N
Sbjct  638  WKKRLTIALDVARGVEYLHSLANQTFIHRDLKPSNILLGDNMRAKVADFGL-VRLVPEDN  696

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K D+++FGV+LME+ITGKKA+D T P+E+ HL T
Sbjct  697  HSIETRLAGTFGYLAPEYAVMGRVTTKADIFSFGVILMELITGKKAIDTTQPEESMHLAT  756

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       QKAIDP +  DE+TFESI  VA+LA HCT  + Y+RP+M + VNVL  
Sbjct  757  WFRRMHLNKDAFQKAIDPNIIFDEETFESIKIVADLACHCTMREPYQRPDMAYAVNVLSS  816

Query  261  FAHNWR  244
             A  W+
Sbjct  817  LAEIWK  822



>ref|XP_006350960.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=938

 Score =   520 bits (1340),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 337/754 (45%), Positives = 447/754 (59%), Gaps = 67/754 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNC-DKPTGNVVSINIDSQSISGNLPSE  2465
             DD +VM  L  +L+P    GWS S DPC W +V C DK    V  I I  Q+I G LP E
Sbjct  29    DDVSVMLALKKSLNPPQEVGWSDS-DPCKWNHVGCSDK---RVTRIQIGRQNIQGTLPPE  84

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             +++L  L  L +Q N++SGPLPS   +SSL+ L L  N+FSSIP DF   + +L    + 
Sbjct  85    ISKLTELERLELQGNNISGPLPSLKGLSSLQVLLLGENQFSSIPADFFTDMSSLLSVDM-  143

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             D      W+I   L  ++SL +F A++A++ G IPNFF  D FP L NL L+ NNL G L
Sbjct  144   DKNPFVGWEIPESLRNASSLKNFSANSANVIGRIPNFFSPDEFPGLVNLHLAGNNLEGEL  203

Query  2110  PGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             P SF  S +    L    Q L+G IDV+++MT L +VWL +N F+GP+PD S    L  L
Sbjct  204   PSSF--SGLLLESLWLNGQKLNGGIDVLTNMTFLKEVWLHSNNFSGPLPDFSGLKALETL  261

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGP  1754
              L DN  TG VP SL  L +L+ + L NN   GPMP+F   V V     TNSFC   PG 
Sbjct  262   SLRDNAFTGPVPSSLMNLESLKLVNLTNNFFQGPMPVFKGSVVVDSAKGTNSFCSSQPGD  321

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP+V  LL+ A  + YP   A++WKGND C +W  +TC     N+T +N      SGTI
Sbjct  322   CDPRVNTLLSIAKAMDYPTNFAKNWKGNDPCADWFGLTC--SNGNITVINFQKMGLSGTI  379

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP F+ L SL+ + L DNNLTG IP  LTTL  L  LDVSNN +   +P+F   + + F 
Sbjct  380   SPEFASLKSLQKIVLADNNLTGTIPEELTTLTGLTELDVSNNQIYGKVPAFRKNLILKFS  439

Query  1393  GNLLLEKTVATG----RGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK----  1238
             GN  + K  +          GS  +++G++ +AR      + +V+  ++           
Sbjct  440   GNPDIGKDKSDAPSQGSSPGGSTGSDDGNAQAARKKSNRRVGIVVFSVIGGVFMLCLIGV  499

Query  1237  ---CYMKREHKRFGRAKSP--------------EKIKST---------------------  1172
                C  K + KRF R +SP              + +K T                     
Sbjct  500   AAFCLYKSKQKRFSRVQSPNTMVLHPRHSGSDNDSVKITVAGSSVSVGAVTETHTVSASE  559

Query  1171  ----QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
                 QM++   ++   I IQVL+  TN FSE+++LG GG+G VY G+L +GTK+AVK+M+
Sbjct  560   AGDVQMVEAGNMV---ISIQVLKNVTNNFSEDNILGRGGFGTVYKGELHDGTKIAVKRME  616

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
             +G    KG+ EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF W 
Sbjct  617   NGIITGKGLAEFKSEIAVLTKVRHRHLVGLLGYCLDGNEKLLVYEYMPQGTLSSHLFNWA  676

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  P+ W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKVADFGLV
Sbjct  677   EEGLKPMEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKVADFGLV  736

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  737   RLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  770


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  745  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  804

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDP +D  E+T  S+S VAELA HC+  + Y+RP+M H VNVL   
Sbjct  805  FRRMHLNKDTFRKAIDPAIDLSEETLTSVSTVAELAGHCSAREPYQRPDMGHAVNVLSSL  864

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  865  VELWKP--SDECSEDIYGIDLDMSLP  888



>ref|XP_009378958.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=950

 Score =   520 bits (1340),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 346/757 (46%), Positives = 454/757 (60%), Gaps = 64/757 (8%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +DAAVM  L   L P+ S GWS   DPC WT+V C      V  I +   +I G LP  L
Sbjct  32    NDAAVMLALKKTLKPSESLGWS-DPDPCQWTHVGCSDDK-RVTRIQLGHLNIEGTLPPSL  89

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L  L +Q N +SGPLPS + +SSL+ L + +N F+SIP DF  G+ +L+   I D
Sbjct  90    QNLTELERLELQWNKISGPLPSLSGLSSLQVLLISNNLFTSIPSDFFTGMTSLQSVEI-D  148

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLP  2108
             N     W+I   L  ++SL +F A++A+ITG IPNFFD  +FP+L NL L++N L G LP
Sbjct  149   NNPFMSWEIPETLKNASSLQNFSANSANITGKIPNFFDGDAFPSLVNLHLAFNGLEGDLP  208

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF   +IQ+L          L G+I V+ +MT L +VWL +NAF+GP+PD S   +L  
Sbjct  209   TSFSGLQIQSLWLNGQESVGKLGGSIAVLQNMTLLKEVWLHSNAFSGPLPDFSGLTDLQR  268

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
             L L DN  TG VPVSL  L +LE + L NN L GPMP F + V V ++  +N+FC  +PG
Sbjct  269   LSLRDNMFTGPVPVSLVSLKSLEAVNLTNNLLQGPMPAFVSGVAVDLVKGSNNFCLPSPG  328

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL+ A  +GYP   A++WKGND C +W  +TC     N+T +N      +GT
Sbjct  329   QCDPRVNTLLSIASSVGYPQKFAENWKGNDPCADWIGVTC--SNGNITVLNFQKMGLNGT  386

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP    L SL+ + L DNNLTG IP  L TLP L VLDVSNNNL    P+F   V +  
Sbjct  387   ISPEIVSLKSLQRVVLADNNLTGRIPAELATLPALTVLDVSNNNLYGKPPAFKDKVLVKM  446

Query  1396  GGNLLL--EKTVATGRGSPGSG----QTENGSSMSARMfvvvvivvviv----------v  1265
              GN  +  EK+ + G G+P        T  GS  SAR        ++ V          V
Sbjct  447   FGNPDIGNEKSTSAG-GAPSQNSTNLSTSIGSGNSARPHGKKSSSLIGVIVFSLIGGVFV  505

Query  1264  lvvlfvFYKCYMKREHKRFGRAKSP--------------EKIKSTQM-------------  1166
             ++++ +   C  + + K+  R +SP              E +K T               
Sbjct  506   ILLIALLLICVYRTKQKQLSRVQSPNAMVVHPRHSGSDNESMKITVAGSSVSVGALSEAH  565

Query  1165  ----LKTNEIM-----GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVK  1013
                  ++NEI         I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK
Sbjct  566   TLPSSESNEIQMVEAGNMVISIQVLRNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVK  625

Query  1012  KMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLF  833
             +M+ G    KG++EF++EI+ L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF
Sbjct  626   RMEAGVIVGKGLSEFKSEISVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRHLF  685

Query  832   EWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADF  653
              W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADF
Sbjct  686   NWPEEGLKPLEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADF  745

Query  652   GLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             GLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  746   GLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  782


 Score =   130 bits (327),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG++A+D++ P+E+ HLVTW
Sbjct  757  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRRALDDSQPEESMHLVTW  816

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAIDPT+D +E+T  S+S VAELA HC   + Y+RP+M H VNVL   
Sbjct  817  FRRMFINKDSFRKAIDPTIDLNEETLASVSTVAELAGHCCAREPYQRPDMGHTVNVLSSL  876

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  877  VELWKP--SDQSSEDIYGIDLEMSLP  900



>ref|XP_004142822.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004170157.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51453.1| hypothetical protein Csa_5G550170 [Cucumis sativus]
Length=950

 Score =   520 bits (1338),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 333/751 (44%), Positives = 448/751 (60%), Gaps = 60/751 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D +VM+ L  ++ +P+  GW+ S D C W +V CD  +  VV I I +Q++ G+LP EL 
Sbjct  37    DGSVMNLLKNSVGAPSSLGWTGS-DYCQWNHVKCDSQS-RVVKIQIGNQNLKGSLPKELF  94

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L++L  L VQ N L GP P+ A+  SL+ L    N F+S+P DF      L+   I DN
Sbjct  95    SLSALVQLEVQSNQLGGPFPNLAD--SLQILLAHDNLFTSMPADFFAKKSALQTIDI-DN  151

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLPG  2105
                S WQI   + ++++L    A+  +ITG+IP  FD  +FP L NL L+ N L G LP 
Sbjct  152   NPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPA  211

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             S   S IQ+L          L+G+I ++ +MT L +VWL  N F+GP+PD S    L  L
Sbjct  212   SLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKL  271

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPG-  1757
              L DNQLTG+VP SL  L +L  + L NN L GP P F   V++ +   TN FC D+PG 
Sbjct  272   SLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDMKPQTNKFCLDSPGE  331

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCDP+V ALL+ A  +G+P   AQ W GND CQ +  I+C     N++ +NL N   +G+
Sbjct  332   PCDPRVNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGS  391

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP+FS LTS++ L+L++N L+G IP  L T+P L  LDVSNN L   +P F   V ++ 
Sbjct  392   ISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVPVFRKNVIVNT  451

Query  1396  GGNLLLEKTVA--------TGR----GSPGSGQTENGSSMSARMfvvvvivvvivvlvvl  1253
              GN  + K  A        TGR    GS  S   +   S +  +   ++ V+V +++V  
Sbjct  452   QGNPDIGKDNASPPVPGSPTGRSPSDGSGDSAGNDEKKSNAGVVVGAIIGVIVGLLVVGT  511

Query  1252  fvFYKCYMKREHKRFGRAKSPE---------------KIKSTQM----------------  1166
              +F+ C  KR+ +R  R +SP                KI  T+                 
Sbjct  512   VIFFLC--KRKKRRGNRVQSPNTVVVHPSHSGDQNSVKITITEARSDGSAPETSRVPIAG  569

Query  1165  ---LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGA  995
                +   E     I IQVL   TN FS E++LG GG+G VY G+L +GT +AVK+M+ G 
Sbjct  570   PSDVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGV  629

Query  994   THTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHG  815
                KG+NEF+AEIA L+KVRH+NLVAL+GYC++ ++ LLVYEYM  GT    LF WK+ G
Sbjct  630   IGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEG  689

Query  814   FDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKA  635
               PL WK+R+ +  DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKVADFGLV+ A
Sbjct  690   IRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLA  749

Query  634   PDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             P+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  750   PEGKASIETRLAGTFGYLAPEYAVTGRVTTK  780


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+I+G+KA+DE+ P+E+ HLV+W
Sbjct  755  SIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSW  814

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++        KAIDP++D DE+T  SI+ VA+LA HC   + Y+RP+M H VNVL   
Sbjct  815  FRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSL  874

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+   P+   E+  G DL +SLP
Sbjct  875  VDVWKPTEPDS--EENLGIDLELSLP  898



>ref|XP_010315276.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Solanum 
lycopersicum]
Length=913

 Score =   518 bits (1335),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 325/742 (44%), Positives = 441/742 (59%), Gaps = 59/742 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S   DAAVM +    + +P P  W+   DPC W  V C K  G V+ I +  Q + G LP
Sbjct  24    SAATDAAVMQEFKKQIINPNPLNWN-DPDPCKWDKVQCSK-DGRVIRIQVGDQGLKGTLP  81

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
             S +  L  L+   VQ+N+ +GPLPSF+ ++SL+ + L+ N F+SIP +F  G+ NL+   
Sbjct  82    SNINTLTELQVFEVQRNTFTGPLPSFSGLNSLQTILLNGNGFTSIPNEFFQGMTNLQSVY  141

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTG  2117
             + D+   S W +   L  +T+L  F A +A+ITG IP+ F  ++F +L  L LS+NNL G
Sbjct  142   L-DSNPFSSWTVPESLKSATALQIFSAYSANITGKIPDLFGGNTFSSLTTLHLSFNNLEG  200

Query  2116  SLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
              LP SF  S IQ+LWLN+ +  L+G+IDVI +MTRL+Q+W   N FTGP+PD S    L 
Sbjct  201   PLPSSFSGSSIQSLWLNSIRGKLNGSIDVIQNMTRLTQLWFSGNQFTGPLPDFSGLTQLE  260

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTP  1760
             D  L DN  TG+VP SL  LP+L+ + L NN L GP P F + V+V +L +TNSFC   P
Sbjct  261   DCNLRDNSFTGLVPDSLVNLPSLKVVNLTNNILQGPTPQFPSSVRVDMLDNTNSFCLSQP  320

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
             GPCD +V+ LL     + YP   A++WKGND C  W  ITCD  G+N+T +N      +G
Sbjct  321   GPCDSRVSTLLDVLKDVRYPTKFAENWKGNDPCSRWLGITCD--GENITVLNFQKSGLTG  378

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
              IS   S +TS++ L L DN+LTG IP  LT LP L  LDVSN              N  
Sbjct  379   IISSNLSSITSIQRLILADNSLTGTIPNELTLLPKLTELDVSN--------------NQL  424

Query  1399  FGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CYMKR  1223
             +G     + ++     +   G   NG+  S+   VV  ++  +   V +   +  C  + 
Sbjct  425   YGKIPQFKSSMVNLTNNFFQGPNGNGNKKSSTGVVVGSVIGGVCGAVAIAGLFVFCLYRT  484

Query  1222  EHKRFGRAKSPEKI-------KSTQMLKTNEIMGTAIK----------------------  1130
             +  R GR +SP  +        S Q      + G+++                       
Sbjct  485   KRMRSGRVQSPHTVVIHPHHSGSDQDAVKITVAGSSVNGGTTETHSCGSSAPGDLHIVEA  544

Query  1129  ------IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                   IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+ G    KG++EF
Sbjct  545   GNMVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESGVMSEKGLDEF  604

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
              +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GT+  +LF WK+ G  PL W +R
Sbjct  605   TSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTVSRYLFNWKEEGIKPLEWTRR  664

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             + IA DVARG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+ AP+ K+ + T
Sbjct  665   LIIALDVARGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKTSLVT  724

Query  607   RVAGTFGYLAPEYATTGRVTKK  542
             R+AGTFGYLAPEYA TGRVT K
Sbjct  725   RLAGTFGYLAPEYAVTGRVTTK  746


 Score =   124 bits (312),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            SL   L G    L       G    K+DV++FGV+LME+ITG++A+DE+ P+E+ HLV W
Sbjct  721  SLVTRLAGTFGYLAPEYAVTGRVTTKIDVFSFGVILMELITGRRALDESQPEESMHLVPW  780

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAID T+D DE T  S+SKVAELA HC   + ++RP+M H VNVL   
Sbjct  781  FRRMHINKETFRKAIDHTIDLDEDTLASVSKVAELAGHCCAREPHQRPDMGHAVNVLSSL  840

Query  258  AHNWRSLRPEEIVE-KFGGFDLNMSLP  181
            A  W   +P E+ E +  G D +M+LP
Sbjct  841  AELW---KPAEVDEDEIYGIDYDMTLP  864



>ref|XP_006303733.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
 gb|EOA36631.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
Length=891

 Score =   518 bits (1333),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 326/722 (45%), Positives = 446/722 (62%), Gaps = 34/722 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQ  2456
             D A M+ L  +L+ +P GWS S +PC WT+V+CD  +  V  I I ++ ISG LP++L  
Sbjct  26    DEAAMNVLKNSLN-SPPGWSGS-NPCNWTDVDCDG-SNQVTKIQIGNKGISGMLPTDLKS  82

Query  2455  LASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG  2276
             L+SL    V  N++ G +PS A + SLE +    N F+SI  DF  GLP+L+  S+ DN 
Sbjct  83    LSSLTVFEVMNNNIIGKIPSLAGLKSLETVNFHDNGFTSIDADFFTGLPSLQHVSL-DNN  141

Query  2275  ELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGS  2102
                PWQI   L  +T+L  F A N S++G IP+     +FP+L  L+LS N+L G LP S
Sbjct  142   PFGPWQIPLSLKYATALADFSAVNCSLSGRIPDLLWGQTFPSLTTLKLSTNSLVGELPRS  201

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             F  S +Q L LN Q+   +G+I V+ +MT L++V L  N F+GPIPD S  V+L  L + 
Sbjct  202   FSESRVQTLILNGQKL--NGSISVLQNMTDLTEVRLNRNEFSGPIPDFSGHVSLKVLNIR  259

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-CDP  1745
             DNQLTG+VP SLTGL +L  + L NN L GP P F + +K+ +   NSFC DTPG  CD 
Sbjct  260   DNQLTGIVPSSLTGLASLSEVGLGNNLLQGPTPSFKDNIKIDISGLNSFCLDTPGTLCDL  319

Query  1744  QVTALLAFAGGLGYPITLAQSWKGNDACQN--WAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             +V  LL+ A   GYP+  A SWKGND C    W  ITC   G ++  +N  N   +G IS
Sbjct  320   RVNTLLSIAEAFGYPVRFANSWKGNDPCSKSPWLGITC--AGGSIIVINFKNMGLTGNIS  377

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnl-spplpsfpPAVNISFG  1394
              +F  LTSL+ + L+ NNLTG IP  LT L +L+ LDVSNN L    +      +N++ G
Sbjct  378   LSFQNLTSLQVINLSQNNLTGTIPEELTKLSNLKTLDVSNNQLCGDKVSGVNTTINVNTG  437

Query  1393  GNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKRE-H  1217
             GN  + K   +G  S   G+    SS + ++   V+ +V+ ++L+   +F+    K++ H
Sbjct  438   GNPDIGKGCPSGFSSGDGGK--KASSNAGKIIGSVIGIVLGLLLIGFAIFFLVKKKKQYH  495

Query  1216  KRFGRAKSPE----KIKSTQML-------------KTNEIMGTAIKIQVLEKATNFFsee  1088
             K   + +S +    KI    M                 E     I I VL  ATN F+E 
Sbjct  496   KMHPQQQSSDQDAFKITIGNMYVGGSESGFSGSDAHVGESGNIVISIHVLRDATNNFNEN  555

Query  1087  svlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVG  908
             ++LG GG+G+VY G+L +GTK+AVK+M+      KG++EF++EIA L++VRH+NLV L G
Sbjct  556   NILGRGGFGIVYKGELHDGTKIAVKRMESSIISGKGLDEFKSEIAVLTRVRHRNLVVLHG  615

Query  907   YCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQ  728
             YC+  ++ LLVY+YM  GTL  H+F W++ G  PL W +R+ IA DVARG+EYLH+L HQ
Sbjct  616   YCLEGNERLLVYQYMPQGTLSRHIFHWQEEGLKPLEWARRLIIALDVARGVEYLHTLAHQ  675

Query  727   SFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVT  548
             SFIHRD+K SNILL DD+ AKVADFGLV+ AP+    +ET++AGTFGYLAPEYA TGRVT
Sbjct  676   SFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGAQSIETKIAGTFGYLAPEYAVTGRVT  735

Query  547   KK  542
              K
Sbjct  736   TK  737


 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 86/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D+   +E  HL TW
Sbjct  712  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDDKRSEEEVHLATW  771

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +  KAID T++ +E+T  SI+KVAELA  C+  +  +RP+M HVVNVL   
Sbjct  772  FRRMLINKDSFSKAIDETIEVNEETLGSINKVAELANQCSAREPQQRPDMSHVVNVLVSL  831

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFDDSS  160
               W+        E   G D +   P +  DSS
Sbjct  832  VLQWKPAERSRDSEDVYGIDYDTPFPQISLDSS  864



>ref|XP_003631009.1| Kinase-like protein [Medicago truncatula]
 gb|AET05485.1| LRR receptor-like kinase [Medicago truncatula]
Length=925

 Score =   518 bits (1335),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 334/743 (45%), Positives = 454/743 (61%), Gaps = 50/743 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             C+D  VM+ L   + +P    W+   D C W +VNCD    +V++I I +Q++ G LP E
Sbjct  29    CEDVEVMNILKKTINAPVTFQWT-DPDVCKWKHVNCDSRK-HVIAIQIGNQNLQGFLPKE  86

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L +L+    Q+N L+GP P  +   SL+ L +  N+FSS+P +F  G+ NL+   I 
Sbjct  87    LVMLTTLQKFECQRNGLTGPFPYLS--KSLQRLLIHDNKFSSLPNNFFTGMSNLQEVEI-  143

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTGS  2114
             DN  L PWQIS+ L +  +L +F A + SI G IP+FF     FP L  L LS N+L G 
Sbjct  144   DNNPLPPWQISNSLKDCVALQTFSAESVSIVGTIPDFFGRDGPFPGLVFLALSGNSLEGV  203

Query  2113  LPGSFGSSEIqnlwl--nnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             LP S   S I+NL +   N    L+GT+ V+ +MT L Q+W+  N+FTGPIPDLS+   L
Sbjct  204   LPASLSGSSIENLLVNGQNSNNKLNGTLIVLQNMTSLKQIWVNDNSFTGPIPDLSQLNQL  263

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCK  1769
              D+ L DNQLTGVVP SL  LP+L+ + L NN+L GP P F + V V   I G  N FC 
Sbjct  264   SDVNLRDNQLTGVVPPSLMNLPSLQVVNLTNNRLQGPPPKFRDGVGVDNIIGGGRNEFCT  323

Query  1768  DTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGN  1595
             + PG PC P V  LL+    LGYP+  A+SW+GND C N W  I C   G N++ +N  N
Sbjct  324   NVPGQPCSPLVNILLSVVEPLGYPLKFAESWQGNDPCANKWIGIVC--SGGNISIINFQN  381

Query  1594  QRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpP  1415
                SGTISP F+ L+SL  L + +N++TG IP  LT++P LQ LDVSNNNL   +PSFP 
Sbjct  382   MGLSGTISPNFASLSSLTKLLIANNDITGAIPNQLTSMPLLQELDVSNNNLYGRVPSFPK  441

Query  1414  AVNISFGGN--LLLEKTVATGRGSPGSG----QTENGSSMSARMfvvvvivvvivvlvvl  1253
              V +  GGN  +  +K +     S G G    + E+ +  S     V +++ V+ VL + 
Sbjct  442   GVVLKIGGNPDIGKDKPITPSASSHGFGKDNDKDEDKNKNSVDGVNVGIVLGVVFVLGIG  501

Query  1252  fvFYKCYMKREHKRFGRAKSPEKIKSTQMLK-------------------------TNEI  1148
              +    + KR      + K P+ I      K                           E+
Sbjct  502   VIILFMFWKRSRNHTKKGKKPDAITIHSSYKGGENVVKASVVVSGGGNDALSPTCNAYEV  561

Query  1147  MGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEF  968
                 I IQVL + TN FSEE ++G GG+G+VY G+L +GT++AVK+M+ G    +G NEF
Sbjct  562   SNMVISIQVLRQVTNNFSEEKIVGKGGFGIVYKGELHDGTQIAVKRMQLGMM-GEGSNEF  620

Query  967   QAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQR  788
              +EI  L+KVRHK+LV+L+GYC+++++ LLVYEYM+ G L  HLF+WK+ G  PL WK R
Sbjct  621   TSEIEVLTKVRHKHLVSLLGYCLDENEKLLVYEYMTRGALSKHLFDWKEEGIKPLEWKTR  680

Query  787   VTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVET  608
             ++IA DVARGIEYLH LT Q FIHRDIK SNILL +D+RAKV+DFGLV+ AP+ K+  +T
Sbjct  681   LSIALDVARGIEYLHGLTQQIFIHRDIKPSNILLGEDMRAKVSDFGLVRLAPEGKASFQT  740

Query  607   RVAGTFGYLAPEYATTGRVTKKS  539
             R+AGTFGY+APEYA+TGR+T K+
Sbjct  741   RLAGTFGYMAPEYASTGRLTTKA  763


 Score =   127 bits (320),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S +  L G    +       G    K DVY+FGVVLMEIITG+KA+D + P+E  HLVTW
Sbjct  737  SFQTRLAGTFGYMAPEYASTGRLTTKADVYSFGVVLMEIITGRKALDGSQPEENIHLVTW  796

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    + Q  ID T++ DE+T+ SI+ VAELA HC+  + Y+RP+M HVVNVL   
Sbjct  797  FCRMLLNKDSFQSMIDRTIEVDEETYASINTVAELAGHCSAREPYQRPDMSHVVNVLSSL  856

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+  + +  V+   G + +M+LP
Sbjct  857  VEVWKPTKQD--VDDIYGINFDMTLP  880



>ref|XP_008467095.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=947

 Score =   518 bits (1335),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 333/749 (44%), Positives = 445/749 (59%), Gaps = 56/749 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D +VMS L  ++ +P+  GW+ S D C W +V CD  +  VV I I +Q++ G+LP EL 
Sbjct  35    DGSVMSLLKNSIGAPSSLGWTGS-DYCQWKHVKCDSQS-RVVKIQIGNQNLKGSLPKELF  92

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L++L  L VQ N L GP P+ A+  SL+ L    N F+S+P DF      L+   I DN
Sbjct  93    SLSALVQLEVQSNQLGGPFPNLAD--SLQILLAHDNFFTSMPADFFAKKSALQTIDI-DN  149

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTGSLPG  2105
                S WQI   + +++ L     +  +ITG IP  FD  +FP L+NL L+ N L G LP 
Sbjct  150   NPFSAWQIPDNIRDASGLQEISFNRVNITGTIPEIFDGATFPTLRNLHLAGNFLEGELPA  209

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             S   S IQ+L          L+G+I ++ +MT L +VWL  N F+GP+PD S    L  L
Sbjct  210   SLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHLNQFSGPLPDFSNLQGLAKL  269

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPG-  1757
              L DNQLTG+VP SL  L +L  + L NN L GP P F   V++ +   TN FC D+PG 
Sbjct  270   SLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDMRPQTNKFCLDSPGK  329

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCDP+V ALL+ A  +G+P   AQ W GND CQ +  I+C     N+T +N  N   +G+
Sbjct  330   PCDPRVNALLSVAEAMGFPTAFAQGWGGNDPCQGFKGISCIGTPTNITVINFKNMGLAGS  389

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP+FS LTS++ L+L+DN L+G IP  L T+P L  LDVSNN L   +P+F   V ++ 
Sbjct  390   ISPSFSLLTSVQKLFLSDNFLSGTIPNELATMPSLTELDVSNNRLHGKVPAFRKNVIVNT  449

Query  1396  GGNLLLEKT--VATGRGSP-------GSGQTENGSSMSARMfvvvvivvvivvlvvlfvF  1244
              GN  + K    A   GSP       GSG +       +   VVV  ++ ++V +++   
Sbjct  450   QGNPDIGKDNPSAPVPGSPTRRSPSDGSGDSAGNDEKKSNTGVVVGSIIGVIVGLLVVGT  509

Query  1243  YKCYMKREHKRFG-RAKSPE---------------KIKSTQMLKTNEIMGTA--------  1136
                ++ +  KR G R +SP                KI  T+      +  T+        
Sbjct  510   VIFFLCKRKKRHGSRVQSPNTVVVHPSHSGDQNSVKITITEARSDGSVAETSRVPIAGPS  569

Query  1135  -----------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATH  989
                        I IQVL   TN FS E++LG GG+G VY G+L +GT +AVK+M+ G   
Sbjct  570   DVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIG  629

Query  988   TKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFD  809
              KG+NEF+AEIA L+KVRH+NLVAL+GYC++ ++ LLVYEYM  GT    LF WK+ G  
Sbjct  630   EKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIK  689

Query  808   PLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPD  629
             PL WK+R+T+  DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKVADFGLV+ AP+
Sbjct  690   PLEWKRRLTVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPE  749

Query  628   DKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  750   GKASIETRLAGTFGYLAPEYAVTGRVTTK  778


 Score =   129 bits (325),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 88/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+I+G+KA+DE+ P+E+ HLV+W
Sbjct  753  SIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSW  812

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++        KAIDP++D DE+T  SI  VA+LA HC   + Y+RP+M H VNVL   
Sbjct  813  FRRMHINKDTFSKAIDPSIDLDEETLVSICTVADLAGHCCAREPYQRPDMSHAVNVLSSL  872

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+   P+   E+  G DL +SLP
Sbjct  873  VDVWKPTEPDS--EENLGIDLELSLP  896



>ref|XP_002893435.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69694.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=894

 Score =   516 bits (1328),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 314/724 (43%), Positives = 437/724 (60%), Gaps = 32/724 (4%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             D+A +M  L  +L+   S  WS S DPC W+ V CD  +  V +I I  + ISG LP +L
Sbjct  24    DEAVIMIALRDSLNLTGSLNWSGS-DPCKWSLVQCDDTSNRVTAIQIGGKGISGTLPPDL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L SL    V +N L+GP+PS A + SL  +Y + N+F+S+P DF  GL +L+  S+ D
Sbjct  83    GNLTSLTKFEVMRNHLTGPIPSLAGLKSLVTVYANDNDFTSVPVDFFTGLSSLQSVSL-D  141

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N     W+I   L ++T+L  F A N +++G IP F    +F +L  L+LSYN+L G LP
Sbjct  142   NNPFVSWKIPPSLEDATALADFSAVNCNLSGEIPGFLGGKNFSSLTTLKLSYNSLVGELP  201

Query  2107  GSFGSS--EIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              +F  S  EI  L      + L G+I V+ +MT L+ V LQ N+F+GP+P+ S+ V+L  
Sbjct  202   MNFSESRVEILMLNGQKGAEKLHGSISVLQNMTALTNVTLQGNSFSGPLPNCSRLVSLKS  261

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDTPG  1757
               + +NQLTG+VP SL  L +L ++ L NN L GP P F    +K  +   NSFC DTPG
Sbjct  262   FNVRENQLTGLVPPSLFELQSLSDVALGNNLLQGPTPNFTAPNIKPDMTGLNSFCLDTPG  321

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
              PCDP+V  LL+     GYP+  A+ WKGND C  W  ITC   G ++T +N  N   +G
Sbjct  322   TPCDPRVNTLLSIVEAFGYPVNFAEKWKGNDPCNRWVGITC--TGTDITVINFKNLGLNG  379

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP F+ L SL+ + L+ NNL+G IP  LT L +L+ LDVSNN L   +P     + + 
Sbjct  380   TISPLFADLASLQVINLSQNNLSGTIPQELTKLSNLKTLDVSNNRLCGEVPVSNTTIFVV  439

Query  1399  F-GGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKR  1223
                GN  + K      G  G   + N   +   +  +++ +++I   + L V  K   K+
Sbjct  440   ITSGNSDINKECPKSSGDGGKKASRNAGKIVGSVIGILLALLLIGFAIFLLVKKK---KQ  496

Query  1222  EHKRFGRAKSPE----KIKSTQML-------------KTNEIMGTAIKIQVLEKATNFFs  1094
              HK   + +S +    KI    +                 E     I IQVL  AT+ F 
Sbjct  497   YHKMHPQQQSSDQDAFKITIENLCTGGSESGFSGNDAHLGEAGNIVISIQVLRDATDNFD  556

Query  1093  eesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVAL  914
             E+++LG GG+G+VY G+L +GTK+AVK+M+      KG++EF++EIA L++VRH+NLV L
Sbjct  557   EKNILGRGGFGIVYKGELHDGTKIAVKRMESSIISGKGLDEFKSEIAVLTRVRHRNLVVL  616

Query  913   VGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLT  734
              GYC+  ++ LLVY+YM  GTL  H+F W++ G  PL W +R++IA DVARG+EYLH+L 
Sbjct  617   HGYCLEGNERLLVYQYMPQGTLSRHMFHWQEEGLKPLEWTRRLSIALDVARGVEYLHTLA  676

Query  733   HQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGR  554
             HQSFIHRD+K SNILL DD+ AKVADFGLV+ AP+    +ET++AGTFGYLAPEYA TGR
Sbjct  677   HQSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGTQSIETKIAGTFGYLAPEYAVTGR  736

Query  553   VTKK  542
             VT K
Sbjct  737   VTTK  740


 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D T  +E  HL TW
Sbjct  715  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDATRSEEEVHLATW  774

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAID T++ +E+T  SI+ VAELA  C++ +   RP+M HVVNVL   
Sbjct  775  FRRMFINKDSFPKAIDQTIEVNEETLGSINIVAELANQCSSREPRDRPDMNHVVNVLVSL  834

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFDDSS  160
               W+        +   G D +  LP +  DSS
Sbjct  835  VVQWKPTERSSDSDDIYGIDYDTPLPQLILDSS  867



>ref|XP_004297409.1| PREDICTED: probable receptor protein kinase TMK1-like [Fragaria 
vesca subsp. vesca]
Length=890

 Score =   514 bits (1325),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 336/731 (46%), Positives = 437/731 (60%), Gaps = 48/731 (7%)
 Frame = -2

Query  2623  MSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLAS  2447
             M  LL    S  P+ WS     C W N  CDK  G V  I I  Q ++G+L   +  L S
Sbjct  1     MQDLLNGFKSKPPASWSPGTYYCDWNNTRCDK-DGKVTIILIKDQGLTGSLSPAIRNLRS  59

Query  2446  LRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELS  2267
             L  L +Q N LSGP PS A +SSL+ LY   N+FSS P DF  GL +LR F I DN   +
Sbjct  60    LTRLELQGNQLSGPFPSLAGLSSLQTLYAHGNQFSSFPSDFFSGLTSLRDFVI-DNNPAA  118

Query  2266  PWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGS  2093
              W I   + E+T + +F A+N S+TG IP FF S    +L +LRL  N L G LP SF  
Sbjct  119   AWSIPDNIKEATQMATFSATNVSVTGKIPEFFGSSYMVSLTDLRLGRNQLEGGLPNSFSG  178

Query  2092  SEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQ  1913
             S IQ L LN  +   +GTIDVI +MT L  +WL  N FTGP+PD S+  ++  + L DN+
Sbjct  179   SGIQTLELNGNRL--NGTIDVIQNMTSLQVLWLHMNEFTGPLPDFSQLSSISTVSLRDNK  236

Query  1912  LTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVT  1736
              TG+VP SL   P L  + L NN L GP P F +  +V + + NSFC +  G  CDP+VT
Sbjct  237   FTGIVPQSLVDKP-LAVVNLTNNLLQGPTPKFKDTTQVDMNNGNSFCTNETGQECDPRVT  295

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
              +L+ A  +GYP   A++WKGND C  W  +TC   G N+T VN   +  +GTIS  FS 
Sbjct  296   IMLSIAKDMGYPEEFAENWKGNDPCYPWPGLTC--SGGNITRVNFQKKSLAGTISSNFSL  353

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             LT L +L LNDN+LTG IPV LT LP+L+ +D SNN L   +P F   V +   GN  + 
Sbjct  354   LTYLTDLRLNDNSLTGTIPVELTKLPNLKNVDFSNNRLYGKIPMFGDGVVVKLEGNPDIG  413

Query  1375  KTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAK  1196
             K       +P  G    G   S    ++ V+V  IV LV++     C +KR+ +R G+ +
Sbjct  414   KDQPITPTAPSGG----GDKKSNTGVIIGVVVGCIVGLVLVGALVFCMLKRKKRRSGKVQ  469

Query  1195  SPE---------------KIKSTQMLKTN------------------EIMGTAIKIQVLE  1115
             SP                KI     LK+N                  E     I IQVL 
Sbjct  470   SPNSLVIHPRHSGDQNAVKISVANTLKSNGNESVNSPPNNGPNDIHVEAGNMIISIQVLR  529

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
               TN F+E+ +LG GG+G VY G+L +GTK+AVK+M+ G    KG++EF++EIA L+KVR
Sbjct  530   TVTNNFNEDKILGKGGFGTVYEGELHDGTKIAVKRMEPGVVAEKGLHEFKSEIAVLTKVR  589

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LV LVGYC++ ++ LLVYE+M  GTL  HLF WK+ G +PL W +R+TIA DVARG+
Sbjct  590   HRHLVGLVGYCLDGNERLLVYEHMPQGTLSRHLFNWKEEGLEPLEWTRRLTIALDVARGV  649

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLH L ++ FIHRD+K SNILL DD+RAKVADFGLV+ AP  K+ +ETR+AGTFGYLAP
Sbjct  650   EYLHGLANEIFIHRDLKPSNILLGDDMRAKVADFGLVRLAPAGKASIETRLAGTFGYLAP  709

Query  574   EYATTGRVTKK  542
             EYA TGR+T K
Sbjct  710   EYAATGRMTLK  720


 Score =   132 bits (333),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG+KA+DE  P+E+CHLVTW
Sbjct  695  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRKAIDENQPEESCHLVTW  754

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F + + KS  L + +DPT+D +E+T  SI+ VAELA HC+    Y+RP+M H VNVL   
Sbjct  755  FRRKLIKSDALLEIVDPTIDVNEETISSINTVAELAGHCSARDPYQRPDMSHAVNVLSSL  814

Query  258  AHNWRSLRPEEIVE  217
               W+  + ++I E
Sbjct  815  VEQWKPSKRDDIDE  828



>gb|EYU30155.1| hypothetical protein MIMGU_mgv1a001033mg [Erythranthe guttata]
Length=907

 Score =   513 bits (1321),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 339/734 (46%), Positives = 447/734 (61%), Gaps = 55/734 (7%)
 Frame = -2

Query  2596  PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISG-NLPSELTQLASLRSLSVQKN  2420
             P+  GW A  D C W  V+C +  G V  I I + ++ G  LP  L  L SL+   VQ+N
Sbjct  11    PSELGW-ADSDTCKWKGVSCSR-DGRVTRIQIGNMNLQGGTLPPNLNNLTSLQVFEVQQN  68

Query  2419  SLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLA  2240
              L+GPLPSF+ ++SL+ L L +N F+SIPPDF  G+ +L+   + D    SPWQI   L 
Sbjct  69    QLTGPLPSFSGLNSLQSLLLSNNNFTSIPPDFFDGMTSLQDVYL-DYNPFSPWQIPDGLR  127

Query  2239  ESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--w  2072
              +++L +F A++ +ITG +P F   D+F +L  L LS+NNL G LP SF  S IQ+L   
Sbjct  128   NASTLQTFSATSTNITGPLPEFLGSDTFSSLTKLHLSFNNLEGPLPSSFAGSSIQSLWLN  187

Query  2071  lnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPV  1892
                    L+G+I V+ +MT+LS+VWL  N+F+GP+PD +  V L  L L DN  TG VP 
Sbjct  188   SRKGGSTLNGSIAVLQNMTQLSEVWLHGNSFSGPLPDFTPLVQLQKLSLRDNDFTGPVPD  247

Query  1891  SLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPG-PCDPQVTALLAFA  1718
             SL GL +L  + L NN L G  P F + V+V +  +TNSFC   PG  CDP+V  LL+ A
Sbjct  248   SLVGLKSLTVVNLTNNMLQGKTPQFSSSVQVDMSVNTNSFCLPDPGVECDPRVNNLLSVA  307

Query  1717  GGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRN  1538
               LGYP +LA++WKGND C +W  ITC+    N+T VN      SGTISPAF+++ SL+ 
Sbjct  308   QDLGYPASLAENWKGNDPCASWKGITCN--NGNITVVNFHGMGLSGTISPAFAKILSLQR  365

Query  1537  LYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV--A  1364
             L L++N LTG IP  LTTLP+L  LDVSNN +   +PSF  +V +   GN+ + K     
Sbjct  366   LILSNNFLTGTIPDELTTLPNLIELDVSNNQIYGKVPSFRTSVVVKTDGNVNIGKDTPPP  425

Query  1363  TGRGS-PGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-----CYMKREHKRFGR  1202
             T +GS PGS    NGS  S        +VV  VV  V  + +      C  K + KR GR
Sbjct  426   TKQGSPPGSDSDGNGSRNSNEKKSSTGVVVGSVVGGVCVLLFAGTLVFCLYKTKKKRSGR  485

Query  1201  AKSP-------------EKIKST---------------------QMLKTNEIMGTAIKIQ  1124
              +SP             + +K T                       L   E     I IQ
Sbjct  486   VQSPHTTVIHPRHSGSEDAVKITIAGSSVNGGTSETYSHGSSGPSDLHIVEAGNMVISIQ  545

Query  1123  VLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLS  944
             VL   T  FSE ++LG GG+G VY G+L +GTK+AVK+M+ G    KG++EFQ+EIA L+
Sbjct  546   VLRNVTGNFSEHNILGRGGFGTVYKGELHDGTKIAVKRMESGVMSEKGLDEFQSEIAVLT  605

Query  943   KVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVA  764
             KVRH++LVAL+GYC++ ++ LLVYEYM  GTL   LF WK+ G  PL W +R+T+A DVA
Sbjct  606   KVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSRFLFNWKEEGLKPLEWTKRLTVALDVA  665

Query  763   RGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGY  584
             RG+EYLH L  QSFIHRD+K SNILL DD+RAKVADFGLV+ A D ++ + TR+AGTFGY
Sbjct  666   RGVEYLHGLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVRLA-DGQASIATRLAGTFGY  724

Query  583   LAPEYATTGRVTKK  542
             LAPEYA TGRV+ K
Sbjct  725   LAPEYAVTGRVSTK  738


 Score =   132 bits (332),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 98/167 (59%), Gaps = 8/167 (5%)
 Frame = -3

Query  669  LRLQILDWS-KKLRMINLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITG  493
            +R ++ D+   +L     S+   L G    L       G    K+DV++FGV+LME+ITG
Sbjct  695  MRAKVADFGLVRLADGQASIATRLAGTFGYLAPEYAVTGRVSTKIDVFSFGVILMEMITG  754

Query  492  KKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTN  313
            +KA+DE+ PDE+ HLV WF + +       KAIDPTLD DE+T  SI+ VAELA HC+  
Sbjct  755  RKALDESQPDESQHLVPWFRRNLVSKDTFHKAIDPTLDLDEETLASITTVAELAGHCSAR  814

Query  312  KYYRRPNMEHVVNVLGPFAHNWR---SLRPEEIVEKFGGFDLNMSLP  181
            + Y+RP+M H VNVL   A  W+   S  PE+      G D +M+LP
Sbjct  815  EPYQRPDMCHAVNVLSSLAELWKPSESTDPEDAY----GIDYDMTLP  857



>ref|XP_009351578.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Pyrus 
x bretschneideri]
Length=945

 Score =   514 bits (1323),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 335/741 (45%), Positives = 432/741 (58%), Gaps = 53/741 (7%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M  L  ++     GWS + D C W  V+C    G V  I + +Q ++G LP E+ +L+ L
Sbjct  40    MEALRKSIGSNSLGWSGT-DYCKWGKVSCQD--GKVFKIQLGNQKLTGTLPPEIQKLSYL  96

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             + L VQ N L+GP PS + +  L+ L    N FSS P DF  GL +L   +I D+   + 
Sbjct  97    QQLEVQNNQLTGPFPSLSGVQPLQVLLAHDNNFSSFPSDFFTGLTSLDNINI-DHNPFAA  155

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSS  2090
             WQI   L ++T L  F A+  ++TG IP+ F+S  FP L +L L++N L G LP SF  S
Sbjct  156   WQIPDTLKDATQLKEFSATQTNLTGRIPDIFNSSNFPGLTDLHLAFNYLEGELPASFSGS  215

Query  2089  EIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              IQ+L          L+GTIDV+ +M  L +VWL  N FTGPIPDLS    L  L L DN
Sbjct  216   SIQSLWLNSQQGTNRLNGTIDVLQNMISLREVWLHGNYFTGPIPDLSNLGYLTTLSLRDN  275

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQV  1739
             +LTGVVP SL  L +L ++ L NN L GPMP FG+ V V +   NSFC D  G  CD +V
Sbjct  276   KLTGVVPASLLNLKSLTSVNLTNNMLQGPMPKFGDGVLVDMTGLNSFCSDKRGVDCDARV  335

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL+    +GYP   A SWKGND C NW  ITC+  G N+T VN  +   SGTIS  +S
Sbjct  336   NVLLSVIKDMGYPTVFADSWKGNDPCNNWKGITCN--GGNITVVNFRSLGLSGTISSNYS  393

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnl-----spplpsfpPAVNISFG  1394
              LTSLR L L++NNLTG IP  LT LP+LQ +DVSNN L              A N + G
Sbjct  394   LLTSLRTLRLDNNNLTGTIPKELTQLPNLQQIDVSNNQLFGQVPKFKNVDVKTAGNPNIG  453

Query  1393  GNLLLEKTVATGRGSPGS--GQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKRE  1220
              +             P S  G   +G   S    VV  ++  +  LVV+     C +K++
Sbjct  454   QDHPPSPATPATPTIPNSPPGFQPDGGKKSRTGVVVGAVIGSVGGLVVVGFVAFCLLKKK  513

Query  1219  HKRFGRAKSP------------------------------EKIKSTQMLKTNEIM-----  1145
             HK  GR +SP                              E   S      N+I      
Sbjct  514   HKHSGRVQSPNALVIHPRHSGDQNAVKITVANSGVNRGENESYNSPASSGPNDIHVVEAG  573

Query  1144  GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQ  965
                I IQVL   TN FSE +VLG GG+G VY G+L +GTK+AVK+M+ G    KG+NEF+
Sbjct  574   SMVISIQVLRNVTNNFSENNVLGKGGFGTVYKGELHDGTKIAVKRMESGVVAEKGLNEFK  633

Query  964   AEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRV  785
             +EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  +LF WK+ G  PL W +R+
Sbjct  634   SEIAVLTKVRHRHLVGLLGYCLDGNERLLVYEYMPQGTLSRYLFNWKEEGLKPLEWTRRL  693

Query  784   TIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETR  605
             TIA DVARG+EYLH L  Q+FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+ +ETR
Sbjct  694   TIALDVARGVEYLHGLASQTFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKASIETR  753

Query  604   VAGTFGYLAPEYATTGRVTKK  542
             +AGTFGYLAPEYA TGR+T K
Sbjct  754   LAGTFGYLAPEYAATGRMTLK  774


 Score =   136 bits (343),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG++A+DE+ P+E+ HLVTW
Sbjct  749  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRRAIDESQPEESLHLVTW  808

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++      +KAIDPT+D +E+T  SI+ VAELA HC+  + Y+RP+M H VNVL   
Sbjct  809  FRRMLINKDTFRKAIDPTIDLNEETLSSINTVAELAGHCSAREPYQRPDMGHAVNVLSSL  868

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
              +W+    E+  + + G DL M+LP
Sbjct  869  VEHWKPSEAEDSDDMY-GIDLEMTLP  893



>ref|XP_010032738.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
Length=946

 Score =   513 bits (1321),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 341/748 (46%), Positives = 451/748 (60%), Gaps = 62/748 (8%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             + K LAA  P   GWS   DPC W +V C + +  V  I I  Q + G LP +L  L  L
Sbjct  40    LRKSLAA--PESLGWS-DPDPCKWAHVVCSQ-SNRVTRIQIGHQGLEGTLPPDLNALTQL  95

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
               L +Q N +SGPLPS + +SSL+ L L +N+F S+P DF  GL +L+   + DN   + 
Sbjct  96    ERLELQFNGISGPLPSLSGLSSLQVLMLGNNQFDSVPADFFDGLSSLQSVEV-DNNPFAA  154

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSS  2090
             W+I   L  +++L +F A++A++TG +P+FF +  FP L  L L+ N+L G LP SF  S
Sbjct  155   WEIPRSLQNASALQNFSANSANVTGTVPDFFGAGDFPGLTLLHLAMNDLGGGLPASFSGS  214

Query  2089  EIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
             +I++L          LSG IDVI++MT L +VWL +N+F+GP+PD S   +L  L L DN
Sbjct  215   QIESLWLNGKAGSGKLSGRIDVIANMTSLREVWLHSNSFSGPLPDFSGLQDLQTLSLRDN  274

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPGPCDPQV  1739
                G VP SLTGL +L+++ L NN L GP+P FG+ V+V +  D+NSFC   PG CDP+V
Sbjct  275   LFAGPVPSSLTGLQSLQSVNLTNNLLQGPVPKFGSSVQVDMADDSNSFCLPGPGDCDPRV  334

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL  A  +GYP  LA++WKGND C  W  ITC+    N+T VN     F+GTISP F+
Sbjct  335   NTLLLIAKSIGYPQKLAENWKGNDPCSGWIGITCN--DGNITVVNFEKMGFNGTISPDFA  392

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LTSL+ L L  NNLTG IP  L TLP L +LDVS+N L   +P+F   V I   GN  +
Sbjct  393   SLTSLQRLILASNNLTGSIPAELATLPALALLDVSSNQLYGKVPTFKSNVIIKTDGNPDI  452

Query  1378  EKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-------------  1238
              K    G  +PGS +   G S SA            ++ V++                  
Sbjct  453   GKD-RNGISTPGSPRDAAGPSGSAHRIASRSRNKSGLIGVIVVSTIGGLFLIVLLGLLGF  511

Query  1237  CYMKREHKRFGRAKSP--------------EKIKST---------QMLKTNEIMGT----  1139
             C  K++ KRF R +SP              E +K T          + +T+ I G+    
Sbjct  512   CLYKKQQKRFTRVQSPNAMVIHPRHSGSDNESVKITVAGSSVSVGAISETHTIPGSEAGD  571

Query  1138  ---------AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
                       I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+      
Sbjct  572   IQMVEAGNMVISIQVLRNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMECAVITG  631

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG+ EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF W + G  P
Sbjct  632   KGITEFKSEIAVLTKVRHRHLVGLLGYCLDGNEKLLVYEYMPQGTLSRHLFNWPEEGRAP  691

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             L W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ AP+ 
Sbjct  692   LEWTRRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEG  751

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  752   KGSIETRIAGTFGYLAPEYAVTGRVTTK  779


 Score =   129 bits (325),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+++ HLVTW
Sbjct  754  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEDSMHLVTW  813

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  814  FRRMHINKDTFKKAIDPTIDLNEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  873

Query  258  AHNWRSL--RPEEIVEKFGGFDLNMSLP  181
               W+     P++I     G DL MSLP
Sbjct  874  VDVWKPTDQNPDDIF----GIDLEMSLP  897



>gb|EPS72320.1| hypothetical protein M569_02431, partial [Genlisea aurea]
Length=898

 Score =   510 bits (1313),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 258/394 (65%), Positives = 315/394 (80%), Gaps = 0/394 (0%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD+AVMSKLL++ SP P GWS+S   CTW NVNCD  +  V +IN++S S++G LP+EL 
Sbjct  8     DDSAVMSKLLSSFSPTPRGWSSSASFCTWPNVNCDSASAFVTAINLNSASLAGTLPAELN  67

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             QL+ L++L++QKN L+G LPSF NM+SLE +YLD+N F+S+PP FL+GL NL++FSIS+N
Sbjct  68    QLSHLKNLALQKNLLTGSLPSFQNMTSLETIYLDNNGFTSVPPGFLMGLTNLQVFSISEN  127

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L+PW I SYL +S +L +F+ASNAS+ G IP+ F SFPNLQNLRLSYNNLTGSLPGSF
Sbjct  128   FNLAPWIIPSYLTQSANLVTFYASNASVAGNIPDIFGSFPNLQNLRLSYNNLTGSLPGSF  187

Query  2098  GSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
               SEIQNLWLNNQ  GLSG+IDV+++M +L+QVWLQANAF+G IPDLSKC NLFDLQL D
Sbjct  188   SGSEIQNLWLNNQDVGLSGSIDVLANMNQLTQVWLQANAFSGGIPDLSKCTNLFDLQLRD  247

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQV  1739
             N  TGVVP SL  L  L N+ LQNN L GP+P F ++V V LG TNSFC D+PGPCDPQV
Sbjct  248   NSFTGVVPPSLATLTALTNVSLQNNMLQGPVPQFPSRVSVTLGTTNSFCLDSPGPCDPQV  307

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
             + LL  AG +GYPI+LA+SWKGN+ CQNW FI CD  GKNVT VN+G Q FSG+ISPAF+
Sbjct  308   STLLEIAGAMGYPISLAESWKGNNVCQNWRFINCDSLGKNVTIVNMGKQGFSGSISPAFA  367

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDV  1457
              LTSLRNL L+ NNLTG IP  L++LP LQ +DV
Sbjct  368   NLTSLRNLILSGNNLTGTIPPVLSSLPQLQSIDV  401


 Score =   142 bits (357),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 116/210 (55%), Gaps = 13/210 (6%)
 Frame = -3

Query  771  TWLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWS--KKLRMIN  622
            +W + ++I +     V ++ + + Q F         +++T  +R ++ D+   K      
Sbjct  651  SWKQRVTIALDVARGVEYLHSLAQQSFIHRDLKPSNILLTDDMRAKVADFGLVKNAPDGK  710

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   L G    L       G    K+DVYAFGVVLME++TG+KA+DET+PDE  HLVT
Sbjct  711  YSVETRLAGTFGYLAPEYAATGRVTTKIDVYAFGVVLMELMTGRKALDETVPDERSHLVT  770

Query  441  WFHKIIRKSHNLQKAIDPTLDPDE---QTFESISKVAELAAHCTTNKYYRRPNMEHVVNV  271
            WF +++    NL K++DP L  D    +T+ESI  V ELA HCT     +RP+M H VN+
Sbjct  771  WFRRVLINKQNLVKSLDPILGVDSGEGETYESICTVGELAGHCTARDPSQRPDMGHAVNI  830

Query  270  LGPFAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            LGP    W+    ++  E+  G DL+MSLP
Sbjct  831  LGPLVELWKPSNTDQQQEESYGIDLHMSLP  860



>ref|XP_007214949.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
 gb|EMJ16148.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
Length=954

 Score =   511 bits (1316),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 339/764 (44%), Positives = 454/764 (59%), Gaps = 70/764 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S  +DA+VM  L  +L+P+ S GWS   DP  W++V        V  I +   ++ G LP
Sbjct  31    SSSNDASVMLDLKKSLNPSESLGWS-DPDPRKWSHVGWSDDK-RVTRIQLGHLNLEGTLP  88

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
               L  L  L  L +Q N +SGPLPS   +S L+ L L +N+FSSIP DF   + +L+   
Sbjct  89    PSLQNLTKLERLELQWNKISGPLPSLNGLSLLQVLLLSNNQFSSIPSDFFTDMTSLQSVE  148

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTG  2117
             I DN     W+I + L  ++SL +F A++A+ITG +P+FFD  SF +L NL L++N L G
Sbjct  149   I-DNNPFMGWEIPATLRNASSLQNFSANSANITGNVPDFFDGDSFSSLVNLHLAFNGLLG  207

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF  S+IQ+L          L G+I VI +MT L +VWL +NAF+GP+PD S   +
Sbjct  208   ELPESFARSQIQSLWLNGQESVGKLGGSIGVIQNMTLLKEVWLHSNAFSGPLPDFSGLKD  267

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L  L L DN  TG VPVSL  L +LE + L NN L GPMP FG  V V ++  +N+FC  
Sbjct  268   LRSLSLRDNMFTGPVPVSLLNLKSLEAVNLTNNLLQGPMPAFGVGVAVDMVNGSNNFCLP  327

Query  1765  TPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
             + G CDP+V ALL     LGYP   A++WKGND C +W  +TC     N+T +N      
Sbjct  328   SLGQCDPRVNALLLIVSSLGYPQRFAENWKGNDPCADWIGVTC--SNGNITVLNFQKMGL  385

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +G ISP  + L SL+ + L DNNLTG IP  L TLP L  LDVSNN L   +P F   V 
Sbjct  386   TGMISPEIASLKSLQRVILADNNLTGTIPEELATLPALTTLDVSNNKLYGKVPDFKVNVL  445

Query  1405  ISFGGNLLLEKTVATGRG----------SPGSGQTENGSS-----MSARMfvvvvivvv-  1274
             ++  GN  + K ++T  G          SP  G   NGSS      S+ +  V+V  V+ 
Sbjct  446   VNKNGNPDIGKDMSTSSGAAPSQNSTNPSPSIGSGNNGSSGPHGKKSSTLTGVIVFSVIG  505

Query  1273  -ivvlvvlfvFYKCYMKREHKRFGRAKSP--------------EKIKST-----------  1172
              + V+ ++ +   C  + + K+  R +SP              E +K T           
Sbjct  506   GVFVIFLIALLLICIYRTKQKQLSRVQSPNAMVIHPRHSGSDNESMKITVAGSSVSVGAI  565

Query  1171  --------------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDN  1034
                           QM++   ++   I IQVL   TN FS+E++LG GG+G VY G+L +
Sbjct  566   SETHTLPSSEPSEIQMVEAGNMV---ISIQVLRNVTNNFSQENILGQGGFGTVYKGELHD  622

Query  1033  GTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHG  854
             GTK+AVK+M+ G    KG+ EF++EI+ L+KVRH++LVAL+GYC++ ++ LLVYEYM  G
Sbjct  623   GTKIAVKRMESGVIAGKGLTEFKSEISVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQG  682

Query  853   TLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDI  674
             TL  +LF W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+
Sbjct  683   TLSRYLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDM  742

Query  673   RAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             RAKVADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   RAKVADFGLVRLAPEGKFSIETRIAGTFGYLAPEYAVTGRVTTK  786


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 88/147 (60%), Gaps = 2/147 (1%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVT
Sbjct  760  FSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVT  819

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAIDPT+D  E+T  S+S VAELA HC   + Y+RP+M H VNVL  
Sbjct  820  WFRRMFINKDTFRKAIDPTIDLSEETLASVSTVAELAGHCCAREPYQRPDMGHTVNVLSS  879

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    ++  E   G DL MSLP
Sbjct  880  LVELWKP--SDQSSEDIYGIDLEMSLP  904



>ref|XP_009587166.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=943

 Score =   510 bits (1314),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 337/755 (45%), Positives = 451/755 (60%), Gaps = 65/755 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +DA+VM  L  +L SP   GW    DPC W +V C      V  I I  +++ GNLP EL
Sbjct  29    NDASVMLALKKSLNSPQELGW-LDPDPCKWNHVGCSDDK-RVTRIQIGHKNLQGNLPQEL  86

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
             ++L  L  L +Q N++SGPLPS + +SSL+ L L +N+FS IP DF  G+ +L+   + D
Sbjct  87    SKLTELERLELQWNNISGPLPSLSGLSSLQVLMLSNNQFSFIPADFFAGMSSLQSVEV-D  145

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N     W+I   L  ++SL +F A++A+++G IP+F   D FP L NL L+ NNL G LP
Sbjct  146   NNPFLGWEIPESLKNASSLKNFSANSANVSGKIPSFLSPDEFPGLVNLHLALNNLEGELP  205

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
              SF  S +    L    Q LSG IDV+ +MT L +VWL +N F+GP+PD S   +L  L 
Sbjct  206   SSF--SGLLLESLWLNGQKLSGGIDVLQNMTFLKEVWLHSNGFSGPLPDFSGLKDLEVLN  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVIL-GDTNSFCKDTPGPC  1751
             L DN  TG +P SL  L  L+ + L NN   GPMP F + V V L  DTNSFC   PG C
Sbjct  264   LRDNSFTGPLPASLVNLEFLKFVNLTNNLFQGPMPKFKDSVSVDLTKDTNSFCLPQPGDC  323

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP+V  LL+ A  + YP   A++WKGN+ C +W   TC     N+T VN      SGTI+
Sbjct  324   DPRVNTLLSIAKAMDYPRKFAENWKGNNPCADWFGFTC--TNGNITIVNFQKMGLSGTIA  381

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             P F+ L SL+ L L DNNLTG IP  LTTL  L  LDVSNN +   +P+F   + +  GG
Sbjct  382   PEFASLKSLQRLVLADNNLTGTIPEELTTLTGLAELDVSNNQIYGKVPAFRNNMILKTGG  441

Query  1390  N--LLLEKTVATGR------GSPGSGQTENGSSMSARMf-------vvvvivvvivvlvv  1256
             N  +  +K+  T +      GSPGSG   +G++ ++R         V+  ++  + VL +
Sbjct  442   NPDIGKDKSDVTSQGSTSPGGSPGSGT--DGNAQASRKKPNRWIGIVLFSVIGGVFVLCL  499

Query  1255  lfvFYKCYMKREHKRFGRAKSPEKI-----------------------------------  1181
             +     C  + + KRF + +SP  +                                   
Sbjct  500   IGAAAFCLYRSKQKRFSQVQSPNAVVMQPRNSGSDNDSVKITVAGSSVVSVGAVSEVHTV  559

Query  1180  --KSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKM  1007
                 T  ++  E     I IQVL+  TN FSEE++LG GG+G VY G+L +GTK+AVK+M
Sbjct  560   STSETGDIQMVEAGNMVISIQVLKNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRM  619

Query  1006  KDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEW  827
             + G    KG+ EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF W
Sbjct  620   ECGFIAGKGLTEFKSEIAVLTKVRHRHLVGLLGYCLDGNEKLLVYEYMPQGTLSSHLFNW  679

Query  826   KKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGL  647
             ++    PL W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAK+ADFGL
Sbjct  680   REEALKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKIADFGL  739

Query  646   VKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             V+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  740   VRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  774


 Score =   122 bits (307),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 88/147 (60%), Gaps = 3/147 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLV+W
Sbjct  749  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVSW  808

Query  438  FHKIIRKSHNLQKAIDPTLD-PDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F ++       +KAIDP +D  D++T  SI  VAELA HC   + Y+RP+M H VNVL  
Sbjct  809  FRRMHLNKDTFRKAIDPAIDLSDQETLASICTVAELAGHCCAREPYQRPDMGHAVNVLSS  868

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    E+  +   G DL++SLP
Sbjct  869  LVELWKP--SEQSSDDIYGIDLDISLP  893



>ref|XP_003572876.1| PREDICTED: probable receptor protein kinase TMK1 [Brachypodium 
distachyon]
Length=958

 Score =   510 bits (1314),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 321/755 (43%), Positives = 442/755 (59%), Gaps = 62/755 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCT---WTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             DA  M  +  AL    S GW  + DPC+   W  V+C    G V ++ +  +S++G L  
Sbjct  43    DAEAMRAVAVALGADKSLGWD-TPDPCSPKPWPGVSCSS-DGRVTAVQVGKKSLTGKLAP  100

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             E+  L  L  L V  N LSGPLPS A +SSL+ L L  N F+SIP DF  GL  L   S+
Sbjct  101   EVRNLTELMRLEVFSNKLSGPLPSLAGLSSLQVLLLHGNNFASIPADFFKGLTALVAVSL  160

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLP  2108
              +N  L+PW + + LA  TSL +F A++ ++TG +P F  S P+L+ L L+ N L+G +P
Sbjct  161   DEN-PLAPWPLPADLAACTSLTNFSANSVNVTGTLPEFLGSLPSLRQLSLAMNLLSGPVP  219

Query  2107  GSFGSS--EIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              S   +  E+  L   +   G +G+I  +++MT+  Q+WL +N FTGP+PD S   +L+D
Sbjct  220   PSLAGAPLEVLWLNGQHGSPGFTGSISFVTNMTKAQQLWLHSNDFTGPLPDFSGLSSLYD  279

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFC-KDTPG  1757
             L L DNQLTG VP SL  L +L N+ L NN L GP P+F   V   +   N FC  D   
Sbjct  280   LNLRDNQLTGPVPESLVNLKSLNNVGLGNNLLQGPTPVFATWVVPDMKGINQFCLPDAGK  339

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
             PCDP+V  LL  A G  YP  LA+ WKGND C N+  + C+    N+T++N  N+  +G+
Sbjct  340   PCDPRVNLLLEVAAGFMYPAKLAEGWKGNDPCSNYIGVECN--NGNITSLNFANKGLTGS  397

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP+  ++ +L  L L++NN+TG +P  L  LP L+ +D+SNNNL   +P+F   V +  
Sbjct  398   ISPSIGKIATLEKLILSNNNITGTVPKELAALPALKTVDLSNNNLYGDIPAFRKNVMLIT  457

Query  1396  GGNLLLEKTVAT------GRGSPGSGQTENGSSMSARMfvvvvivvvivvlvv-----lf  1250
              GN  + K             SP  G    G +  +    V +IV  +   +        
Sbjct  458   TGNPNIGKDAPAPSAPGGSSNSPAPGDGSGGGNRGSSSSSVGIIVGSVFGAIAGLGLIAA  517

Query  1249  vFYKCYMKREHKRFGRAKSPEKI--------KSTQMLKTNEIMGTA--------------  1136
             + + C+ KR+ K FGR +SP  +            M+K     G A              
Sbjct  518   LGFYCH-KRKQKPFGRVQSPHAMVIHPRHSGSDPDMVKITVARGNANGGAATSEASQASS  576

Query  1135  --------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                           I IQVL   TN FS++++LG GG+G VY G+L +GTK+AVK+M+ G
Sbjct  577   GPRDIHVVEAGNMVISIQVLRNVTNNFSQDNILGRGGFGTVYKGELHDGTKIAVKRMESG  636

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
                 KG+NEF++EIA L+KVRH+NLV+L+GYC++ ++ +LVYEYM  G +  HLFEWK+H
Sbjct  637   VMGNKGLNEFKSEIAVLTKVRHRNLVSLLGYCLDGNERILVYEYMPQGPVSQHLFEWKEH  696

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
                PL WK+R++IA DVARG+EYLHSL  Q+FIHRD+K SNILL DD++AKVADFGLV+ 
Sbjct  697   NLQPLEWKRRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKAKVADFGLVRL  756

Query  637   APDDKSFV--ETRVAGTFGYLAPEYATTGRVTKKS  539
             AP D   V  ETR+AGTFGYLAPEYA TGRVT K+
Sbjct  757   APADGKCVSIETRLAGTFGYLAPEYAVTGRVTTKA  791


 Score =   128 bits (321),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 96/160 (60%), Gaps = 8/160 (5%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
            +S+   L G    L       G    K DV++FGV+LME++TG++A+DET P+++ HLVT
Sbjct  764  VSIETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELVTGRRALDETQPEDSMHLVT  823

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAID T+D DE+TF S+S VA+LA HC   + ++RP+M H VNVL  
Sbjct  824  WFRRMQLNQDTFRKAIDMTIDLDEETFASVSTVAQLAGHCCAREPHQRPDMGHAVNVLST  883

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
             +  W+   P+   +   G DL+M+LP        F+DSS
Sbjct  884  LSDVWKPTDPDS--DDSYGIDLDMTLPQALKKWQAFEDSS  921



>gb|KHG20581.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=953

 Score =   510 bits (1313),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 337/762 (44%), Positives = 448/762 (59%), Gaps = 74/762 (10%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DDAA M  L   L P  S GW+   DPC W +V C +    V  I I  Q++ G LPS++
Sbjct  35    DDAAAMLALKKTLGPPESLGWT-DPDPCKWKHVFCSEDR-RVTRIQIGHQNLQGTLPSDI  92

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L  L VQ N++SGP+PS   +SSL  L L +N F+S P DF  GL +L+   + D
Sbjct  93    QNLTELERLEVQWNNISGPVPSLNGLSSLLVLMLSNNHFTSFPTDFFSGLSSLQSVEM-D  151

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLP  2108
             N   S W+I   L  +++L +F A++A+ITG IP+ F  D+FP L  L L++N+L G LP
Sbjct  152   NNPFSAWEIPQSLQNASALQNFSANSANITGKIPDIFGSDAFPGLTILHLAFNSLEGELP  211

Query  2107  GSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              SF  S IQ+  +        L+GT+ V+ +MT L +VWL +N+F+GP+PD S   +L  
Sbjct  212   SSFSGSSIQSLWVNGQLSNSKLNGTVAVLQNMTFLKEVWLHSNSFSGPLPDFSGLKDLQS  271

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
             L L DN  TG VPVSL  L +L+ + L NN L GP+P F + V V ++ D+N FC  +PG
Sbjct  272   LSLRDNSFTGPVPVSLMKLESLKTVNLTNNLLQGPLPEFKDSVAVDMVKDSNRFCLPSPG  331

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+VT+LL     + YP  LA +WKGND C +W  ITC     N+T +N      +GT
Sbjct  332   DCDPRVTSLLNVVKSMDYPQRLADNWKGNDPCMDWLGITC--SNGNITVINFEKMGVTGT  389

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F+ L SL+ L L  NNLTG IP  LT L  L+ LDVSNN+L   +P+F     ++ 
Sbjct  390   ISPDFASLKSLQRLILAGNNLTGTIPEELTALVALKELDVSNNHLYGKVPTFKSNFILNT  449

Query  1396  GGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-------  1238
              GN  + K  +T   SPGS ++ N S+ S                  + +          
Sbjct  450   NGNPDIGKEKST--SSPGS-ESGNPSAGSGSKSSGNSGNGGKKTSAFIGIIIASIFGGLL  506

Query  1237  ----------CYMKREHKRFGRAKSP--------------EKIKST--------------  1172
                       C  K++ KRF R +SP              E +K T              
Sbjct  507   VVGLLGLLVFCLYKKKQKRFSRVQSPNAMVIHPRHSGSDNESVKITVAGSSVSVGAVSEA  566

Query  1171  ------------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                         QM++   ++   I IQVL   TN FSEE++LG GG+GVVY G+L +GT
Sbjct  567   HTFPSSEPGGDIQMVEAGNMV---ISIQVLRNVTNNFSEENILGQGGFGVVYKGELHDGT  623

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G    KG  EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL
Sbjct  624   KIAVKRMESGVISGKGSTEFMSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTL  683

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               H+F W++ G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+RA
Sbjct  684   SRHIFNWEEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRA  743

Query  667   KVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             KVADFGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   KVADFGLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  785


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  760  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESIHLVTW  819

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     + +KAIDPT+D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  820  FKRMHINKDSFRKAIDPTIDLNEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  879

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  880  VELWKPT--DQCSEDIYGIDLEMSLP  903



>ref|XP_011021737.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=930

 Score =   509 bits (1310),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 340/756 (45%), Positives = 450/756 (60%), Gaps = 70/756 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DDAA M KL  +L +P+  GWS S DPC W +V C   T  V  I I +Q++ G LP EL
Sbjct  26    DDAAAMMKLRDSLGNPSTLGWSGS-DPCNWPHVAC--LTNRVTRIQIGNQNLQGTLPPEL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L  L    V  N L+G LPS + +SSL+ L+L++N  SSIPPDF  G+ +L    + D
Sbjct  83    KDLTQLTRFEVMNNQLTGALPSLSGLSSLQVLFLNNNTLSSIPPDFFAGMTSLTSVYL-D  141

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLP  2108
                   W+I   + ++++L  F A+ A++ G IP FF+S  FP ++ L L++N L G LP
Sbjct  142   YNPFESWEIPESVKDASALKEFSANGANVAGEIPEFFNSDVFPGMETLHLAFNYLEGGLP  201

Query  2107  GSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
              +F  S I++L          L+GTI ++ +MT L ++WLQ N FTGP+PD S  ++L D
Sbjct  202   LNFSGSTIRSLWLNGQKSNSRLNGTISILQNMTSLKEIWLQGNHFTGPLPDFSGMISLED  261

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPG  1757
             L L DN LTGVVP SL  +  L  +   NNKL GP P F   V   +L  TN+FC D PG
Sbjct  262   LNLRDNSLTGVVPPSLLNISTLRVVNFTNNKLQGPTPSFARTVDADMLPGTNNFCLDDPG  321

Query  1756  -PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC---QNWAFITCDPQGKNVTTVNLGNQR  1589
               CD  V  LL+ A   GYP +LA SWKGND C   Q W  ITC   G ++  +NL    
Sbjct  322   VACDATVNVLLSVAKNFGYPASLADSWKGNDPCTSNQAWKGITC--VGGDILVINLKKAG  379

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              SGTIS  F+ ++ L+ L L+DN LTG IP  L +L +L +LDVSNN LS  +P F   V
Sbjct  380   LSGTISSDFTLMSRLQKLILSDNMLTGTIPDELISLSNLALLDVSNNKLSGQIPKFRSNV  439

Query  1408  NISFGGNLLLEKTVATGRGSPGS------------GQTENGSSMSARMfvvvvivvvivv  1265
              + +GGN  + K+  T    PG+              + N +S S ++   V  VV  V 
Sbjct  440   QVEYGGNPDIGKS-NTSYAPPGAPGSTPSGTGGGSDDSGNKNSASGKI---VGSVVGAVG  495

Query  1264  lvvlfvFYKCYMKREHKRFGRAKSP-------------EKIKST----------------  1172
             +V +      +  R+ KR  + +SP             + +K T                
Sbjct  496   VVCVVGLGVFFYSRKQKRSSKVQSPNMMIIHPRRSWDQDAVKITVAGSSANSGVESFTDS  555

Query  1171  ------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKK  1010
                   Q+++ NE M   I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+
Sbjct  556   VGPSDIQVVR-NENM--VISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKR  612

Query  1009  MKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFE  830
             M+ G    KG+ EF +EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF 
Sbjct  613   MESGVISEKGLAEFMSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSSHLFS  672

Query  829   WKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFG  650
             WK+ G  PL W +R+TI  DVARG+EYLH L HQSFIHRD+K SNILL DD+RAKVADFG
Sbjct  673   WKEEGVKPLDWTRRLTIGLDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFG  732

Query  649   LVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  733   LVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTK  768


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 93/159 (58%), Gaps = 8/159 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  743  SIETRLAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMEMITGRKALDETQPEDSLHLVTW  802

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +K IDPT++ DE+T  SIS VA+LA HCT  + Y+RP+M HVVNVL   
Sbjct  803  FRRMHINKDTFRKTIDPTINLDEETLGSISTVADLAGHCTAREPYQRPDMGHVVNVLSSL  862

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLV------FDDSS  160
               W+   P+   +   G D  M LP V      FD SS
Sbjct  863  VEIWKPAEPDS--DDMYGIDFEMPLPEVLLKWQAFDGSS  899



>ref|XP_007153205.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
 gb|ESW25199.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
Length=929

 Score =   508 bits (1309),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 333/752 (44%), Positives = 430/752 (57%), Gaps = 60/752 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             ++C D  VM+ L  A+  +        D C W +V C      V +I I  QS+ G+LP 
Sbjct  19    AWCQDDVVMNMLKKAVKESDGLQWNDPDVCKWKHVQCSA-MKRVTAIQIGGQSLQGSLPK  77

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             EL QL+ L       N+ +GP P+     SLE L + +N F S P DF  G+ NL+  SI
Sbjct  78    ELGQLSELTRFECMSNNFTGPFPNMPK--SLEVLLIHNNNFQSFPGDFFTGMTNLQSVSI  135

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTG  2117
               N   S W I   L E  +L SF A NA   G IP+FF     FP L +L LS+N+L G
Sbjct  136   GYN-PFSQWGIPDSLKECVALRSFSAINAGFVGKIPDFFGKDGPFPGLVSLALSFNSLEG  194

Query  2116  SLPGSFGSS--EIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP +   S  E   L        L+GT+DV+ SMT L Q+W+  N+FTGPIPDLSK   
Sbjct  195   GLPATLSGSSVETLWLNGQKSSSKLNGTLDVLKSMTYLKQIWVHGNSFTGPIPDLSKHDQ  254

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFC  1772
             L+D+   DNQLTGVVP SLT LP L+ + L NN L G  PLF N V+V   +    NSFC
Sbjct  255   LYDVSFRDNQLTGVVPPSLTALPALKVVNLTNNLLQGSPPLFRNGVQVDNDLEKGINSFC  314

Query  1771  KDTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLG  1598
                 G PC P V ALL+     GYP+ LA+SWKGND C Q W  I C     NV+ +NL 
Sbjct  315   TMEAGKPCSPLVDALLSVVEPFGYPLRLAESWKGNDPCGQRWLGIVC--ANGNVSVINLQ  372

Query  1597  NQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfp  1418
             N   SG ISP+F+ LTS+  L L  N+LTG IP  LT++P L  LDVSNN L   +PSF 
Sbjct  373   NMNLSGNISPSFALLTSVTKLLLGGNSLTGTIPSQLTSMPLLVELDVSNNQLLGKVPSFR  432

Query  1417  PAVNISFGGNLLLEK---TVATGRGSPG-SGQTENGSSMSARMfvvvvivvvivvlvvlf  1250
               V +   GN  + K          SPG SG     ++  A +  V+  V ++ +   +F
Sbjct  433   GGVAVKTDGNPDIGKDKPQAPPDSSSPGKSGGQVTKNNTGAIVGTVLGGVSLLGLGAFIF  492

Query  1249  vFYKCYMKREHKRFGRAKSPEKI------------------------------------K  1178
             + Y     R+ KR G+ +SP  I                                     
Sbjct  493   LMY----SRKRKRAGKVQSPSAIVIHPRYSGDGNGLKISVADAGVSGGGGGGGGGISALS  548

Query  1177  STQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDG  998
                 ++  E     I IQVL + TN FS+ ++LG GG+G VY G+L +GTK+AVK+M+ G
Sbjct  549   PASSIQHVEAGSMVISIQVLRQVTNNFSQGNILGRGGFGTVYKGELYDGTKIAVKRMESG  608

Query  997   ATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKH  818
                 KG+ EF++EIA L+KVRH++LVAL G+C++ H+ LLVYEYM  G L  HLF+WK+ 
Sbjct  609   MMGEKGLGEFESEIAVLTKVRHRHLVALEGHCLDGHEKLLVYEYMPQGPLSKHLFDWKEE  668

Query  817   GFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKK  638
             G  PL WK+R++IA DVARG+EYLH L  Q FIHRD+K SNILL DD+RAKV+DFGLV+ 
Sbjct  669   GIQPLDWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKVSDFGLVRL  728

Query  637   APDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             AP+ ++  ETR+AGTFGYLAPEYA TGRVT K
Sbjct  729   APEGQTSFETRLAGTFGYLAPEYAVTGRVTTK  760


 Score =   120 bits (302),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 84/146 (58%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S    L G    L       G    KVDVY++GV+LME++TG++A+D + P+E  HLVTW
Sbjct  735  SFETRLAGTFGYLAPEYAVTGRVTTKVDVYSYGVILMEMLTGRRAIDNSQPEENVHLVTW  794

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +  K +DP +  DE+   S   VAELA HC   + ++RP+M HVVNVL P 
Sbjct  795  FRRMLLNKDSFGKIVDPIMCVDEEALPSCRTVAELAGHCCAREPHQRPDMSHVVNVLAPL  854

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL+M+LP
Sbjct  855  VEIWKPSETDD--EDVYGIDLDMTLP  878



>ref|XP_009380072.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=964

 Score =   508 bits (1309),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 327/742 (44%), Positives = 449/742 (61%), Gaps = 67/742 (9%)
 Frame = -2

Query  2581  WSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGP  2405
             WS S DPC+ W  V C    G V +I + +++++G+LP+++  L SL  L +Q N LSGP
Sbjct  62    WSPSADPCSDWAGVACSG--GRVTTIQVGNRNLAGSLPADVRNLTSLSRLELQNNRLSGP  119

Query  2404  LPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSL  2225
             LPS A +SSL+ L L  N FSSIPPDF  GL +L+   + +N   +PW + + L+++T+L
Sbjct  120   LPSLAGLSSLQSLLLHHNLFSSIPPDFFSGLSSLQSAYLDEN-PFAPWPLPATLSDATAL  178

Query  2224  GSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--wlnnqqq  2054
              +F A+ A+++G +P+F   SFP L +L L++N L+G +P +F  +  ++L       + 
Sbjct  179   VNFSANAANVSGPLPDFLATSFPGLDHLGLAFNLLSGPVPSAFAVAPFRSLWLNNQRGRS  238

Query  2053  gLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLP  1874
              LSG ID + +MT L ++WL +N F+GP+PD S   +L DLQL DNQLTGVVP SLT L 
Sbjct  239   RLSGGIDFVENMTALEELWLHSNEFSGPLPDFSGHTSLRDLQLRDNQLTGVVPYSLTELK  298

Query  1873  NLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPI  1697
             +L  + L NN L GP+P+F +   V ++  + SFC +T G CD +VT LL+ A    YP 
Sbjct  299   SLSKVTLTNNLLQGPVPIFPDSATVDLVPQSESFCLNTAGECDHRVTILLSIAKSFRYPS  358

Query  1696  TLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNN  1517
               A++WKGN+ C  W  I+CD  G N+T +N      +GTISP FS  T+L+ + L++NN
Sbjct  359   GFAENWKGNNPC-GWLGISCD-AGGNITVINFSRMDLNGTISPDFSLFTTLQRMMLSNNN  416

Query  1516  LTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPGSG  1337
             LTG IP +LT L  L+ LDVSNN+L   +PSF   V +   GN+ + K      GS  S 
Sbjct  417   LTGTIPSTLTNLTSLKELDVSNNSLRGQVPSFSQNVLLKTDGNVNMGKPAIAPPGS-DSD  475

Query  1336  QTENGSSMSARMfvvvvivvvivvlvvlfvFYK------------------CYMKREHKR  1211
                NGS  +    V                                     CY KR+ + 
Sbjct  476   SAHNGSDSNPAGSVDGSSGSSGKSSSGSISVIVGLVVAGVFSVSLAGLLGFCYYKRKLQN  535

Query  1210  FGRAKSPEKI-------KSTQMLKTNEIMGTA----------------------------  1136
              GR +SP           S Q +    ++G++                            
Sbjct  536   SGRVQSPNTTVIHPRLSGSDQDMVKITVVGSSMNGGMAASESYSRTSSGPSDVHVIDAGN  595

Query  1135  --IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQA  962
               I IQVL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+     TKG+NEF++
Sbjct  596   MVISIQVLRNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMEASIIGTKGLNEFKS  655

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KVRH+NLV+L+GYC++ ++ LLVYEYM  GTL  HL +WK+ G  PL WK+R++
Sbjct  656   EIAVLTKVRHRNLVSLLGYCLDGNERLLVYEYMPQGTLSRHLLDWKEEGLKPLEWKKRLS  715

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF-VETR  605
             IA DVARG+EYLH+L HQSFIHRD+K SNILL DD++AKVADFGLV+ APD K   VETR
Sbjct  716   IALDVARGVEYLHNLAHQSFIHRDLKPSNILLGDDMKAKVADFGLVRLAPDGKGCSVETR  775

Query  604   VAGTFGYLAPEYATTGRVTKKS  539
             +AGTFGYLAPEYA TGRVT K+
Sbjct  776   LAGTFGYLAPEYAVTGRVTTKA  797


 Score =   143 bits (360),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 96/159 (60%), Gaps = 8/159 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K DV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  771  SVETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDESQPEESVHLVTW  830

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++      L KAIDP +D DE+TF S+S VAELA HC   + YRRP+M H VNVL   
Sbjct  831  FRRMQLNKDTLPKAIDPMIDLDEETFASMSTVAELAGHCCARELYRRPDMGHAVNVLSSL  890

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
            A  W+   P+  +E   G DL+MSLP        FDDSS
Sbjct  891  AELWKPSDPD--LEDSYGIDLDMSLPQALKKWQAFDDSS  927



>ref|XP_009351579.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Pyrus 
x bretschneideri]
Length=807

 Score =   503 bits (1296),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 328/733 (45%), Positives = 427/733 (58%), Gaps = 53/733 (7%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M  L  ++     GWS + D C W  V+C    G V  I + +Q ++G LP E+ +L+ L
Sbjct  40    MEALRKSIGSNSLGWSGT-DYCKWGKVSCQD--GKVFKIQLGNQKLTGTLPPEIQKLSYL  96

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             + L VQ N L+GP PS + +  L+ L    N FSS P DF  GL +L   +I D+   + 
Sbjct  97    QQLEVQNNQLTGPFPSLSGVQPLQVLLAHDNNFSSFPSDFFTGLTSLDNINI-DHNPFAA  155

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSS  2090
             WQI   L ++T L  F A+  ++TG IP+ F+S  FP L +L L++N L G LP SF  S
Sbjct  156   WQIPDTLKDATQLKEFSATQTNLTGRIPDIFNSSNFPGLTDLHLAFNYLEGELPASFSGS  215

Query  2089  EIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              IQ+L          L+GTIDV+ +M  L +VWL  N FTGPIPDLS    L  L L DN
Sbjct  216   SIQSLWLNSQQGTNRLNGTIDVLQNMISLREVWLHGNYFTGPIPDLSNLGYLTTLSLRDN  275

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQV  1739
             +LTGVVP SL  L +L ++ L NN L GPMP FG+ V V +   NSFC D  G  CD +V
Sbjct  276   KLTGVVPASLLNLKSLTSVNLTNNMLQGPMPKFGDGVLVDMTGLNSFCSDKRGVDCDARV  335

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL+    +GYP   A SWKGND C NW  ITC+  G N+T VN  +   SGTIS  +S
Sbjct  336   NVLLSVIKDMGYPTVFADSWKGNDPCNNWKGITCN--GGNITVVNFRSLGLSGTISSNYS  393

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnl-----spplpsfpPAVNISFG  1394
              LTSLR L L++NNLTG IP  LT LP+LQ +DVSNN L              A N + G
Sbjct  394   LLTSLRTLRLDNNNLTGTIPKELTQLPNLQQIDVSNNQLFGQVPKFKNVDVKTAGNPNIG  453

Query  1393  GNLLLEKTVATGRGSPGS--GQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKRE  1220
              +             P S  G   +G   S    VV  ++  +  LVV+     C +K++
Sbjct  454   QDHPPSPATPATPTIPNSPPGFQPDGGKKSRTGVVVGAVIGSVGGLVVVGFVAFCLLKKK  513

Query  1219  HKRFGRAKSPEKI----------KSTQMLKTN-------------------------EIM  1145
             HK  GR +SP  +           + ++   N                         E  
Sbjct  514   HKHSGRVQSPNALVIHPRHSGDQNAVKITVANSGVNRGENESYNSPASSGPNDIHVVEAG  573

Query  1144  GTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQ  965
                I IQVL   TN FSE +VLG GG+G VY G+L +GTK+AVK+M+ G    KG+NEF+
Sbjct  574   SMVISIQVLRNVTNNFSENNVLGKGGFGTVYKGELHDGTKIAVKRMESGVVAEKGLNEFK  633

Query  964   AEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRV  785
             +EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  +LF WK+ G  PL W +R+
Sbjct  634   SEIAVLTKVRHRHLVGLLGYCLDGNERLLVYEYMPQGTLSRYLFNWKEEGLKPLEWTRRL  693

Query  784   TIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETR  605
             TIA DVARG+EYLH L  Q+FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+ +ETR
Sbjct  694   TIALDVARGVEYLHGLASQTFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKASIETR  753

Query  604   VAGTFGYLAPEYA  566
             +AGTFGYLAPEYA
Sbjct  754   LAGTFGYLAPEYA  766



>ref|XP_003529231.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=932

 Score =   507 bits (1306),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 337/754 (45%), Positives = 444/754 (59%), Gaps = 69/754 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAAL-SPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +D AVM+ L  A+  P    W+   D C W +V C+     V +I I  QS++G+LP EL
Sbjct  24    NDVAVMNTLKKAIKEPNDLQWN-DPDVCKWEHVQCNT-MKRVTAIQIGGQSLNGSLPKEL  81

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              QL+ L       N+ +GP P+     SLE L + +N F+S+  DF  G+ NL+  SI  
Sbjct  82    LQLSELTRFECMNNAFTGPFPNMPK--SLEVLLIHNNNFNSMSGDFFNGMTNLQDVSIGY  139

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTGSL  2111
             N   S W+I   L +   L SF A +A + G IP+F      FP L +L LS+N+L G L
Sbjct  140   N-PFSNWEIPDSLKDCDDLRSFSAISAGLVGRIPDFLGKDGPFPGLVSLSLSFNSLEGGL  198

Query  2110  PGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P +F  S I+   +   N    L+GT+DV+  M  L Q+W+  N+FTGPIPDLS    LF
Sbjct  199   PATFSGSSIETLWVNGQNSDGKLNGTLDVLKGMMYLKQIWVHGNSFTGPIPDLSNHDQLF  258

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCKD  1766
             D+ L DNQLTGVVP SLT LP L+ + L NN L G  PLF + V+V   +   TNSFC  
Sbjct  259   DVSLRDNQLTGVVPPSLTALPALKVVNLTNNLLQGSPPLFKDGVRVDNDLEKGTNSFCTK  318

Query  1765  TPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLGNQ  1592
               G PC P V ALL+    LGYP+ LA+SWKGND C Q+W  I C     NV+ V+  + 
Sbjct  319   KAGEPCSPLVDALLSVVEPLGYPLRLAESWKGNDPCAQSWIGIVC--SSGNVSIVSFQSL  376

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               SG ISP+FS+LTSL  L L +N+LTG IP  LT++P L+ LDVSNN L   +PSF   
Sbjct  377   NLSGKISPSFSRLTSLTKLLLANNDLTGTIPSELTSMPLLKELDVSNNKLFGKVPSFRGD  436

Query  1411  VNISFGGNLLLEKTVATGRG--SPG--SGQTENGSSMSARMfvvvvivvvivvlvvlfvF  1244
             V +  GGN  + K  +      SPG  SG      +  A +  VV    ++ +  ++F  
Sbjct  437   VVLKTGGNPDIGKDASQALPGLSPGGKSGSEGKKHNTGAIVGTVVGSFSLLGIAALVFAM  496

Query  1243  YKCYMKREHKRFGRAKSPEKI---------------------------------------  1181
             Y    +R+HKR  + +SP  I                                       
Sbjct  497   Y----RRKHKRASKVQSPSAIVVHPGHSGDGNALKISVSGTGVGVSSDGGGGGGTGVFST  552

Query  1180  -KSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
               S Q L+   ++   I IQVL + TN FSE ++LG GG+G VY G+L +GTK+AVK+M+
Sbjct  553   TSSVQHLEAGNMV---ISIQVLREVTNNFSEGNILGRGGFGTVYKGELHDGTKIAVKRME  609

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
              G    KG+ EF++EIA L++VRH++LVAL G+C++ ++ LLVYEYM  G L  HLFEWK
Sbjct  610   SGMMGEKGLTEFESEIAVLTRVRHRHLVALEGHCLDGNERLLVYEYMPQGPLSKHLFEWK  669

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  PL WK+R++IA DVARG+EYLH L  Q FIHRDIK SNILL DD+RAKV+DFGLV
Sbjct  670   EEGLLPLEWKRRLSIALDVARGVEYLHGLAQQIFIHRDIKPSNILLGDDMRAKVSDFGLV  729

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + AP+ K+  ETR+AGTFGYLAPEYA TGRVT K
Sbjct  730   RLAPEGKASFETRLAGTFGYLAPEYAVTGRVTTK  763


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S    L G    L       G    KVDVY++GV+LME+ITG+KA+D + P+E  HLVTW
Sbjct  738  SFETRLAGTFGYLAPEYAVTGRVTTKVDVYSYGVILMEMITGRKAIDNSQPEENVHLVTW  797

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +  K IDP +D DE+T  S   VAELA HC   + Y+RP+M HVVNVL P 
Sbjct  798  FRRMLLNKDSFTKLIDPIMDVDEETLPSFRTVAELAGHCCAREPYQRPDMSHVVNVLAPL  857

Query  258  AHNWR  244
               W+
Sbjct  858  VEIWK  862



>ref|XP_010939998.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=955

 Score =   507 bits (1306),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 326/759 (43%), Positives = 445/759 (59%), Gaps = 65/759 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DAA M  L   L    +  W+   DPCTWT V C      V +I I ++S+ G+LP E+ 
Sbjct  36    DAAAMRALAKGLGADRALDWTGPADPCTWTGVTCTY--ARVTAIQIGNRSLVGSLPVEVR  93

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPP-DFLLGLPNLRIFSISD  2282
              L +L  L +  N L G LPS A +SSL  L L  N FS  PP +F  GL +L+   + D
Sbjct  94    NLTALLRLELHNNQLFGTLPSLAGLSSLRALLLHGNRFSGAPPPEFFAGLSSLQSVYLDD  153

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPG  2105
             N    PW I + L ++TSL +F A++A+++G +P F   +F +L +L L++N LTG++P 
Sbjct  154   N-PFDPWSIPANLKDATSLVNFSANSANVSGELPEFLATAFASLDHLALAFNLLTGAVPA  212

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             +F ++ +++L          LSG I  +++MT L ++WLQ+N FTGPIPD S   +L DL
Sbjct  213   AFAAAPLRSLWLNNQLGSTRLSGGIAFVANMTGLEELWLQSNDFTGPIPDFSGLQHLADL  272

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNS--FCKDTPG  1757
             QL DN+LTG +P SLT L +L+ + L NN L GP+P F + VK +  D  S   C    G
Sbjct  273   QLRDNRLTGPLPASLTSLKSLKRVTLTNNLLQGPVPAFPDSVKTLDLDPESERLCLTKAG  332

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSG  1580
              CDP+V  LL+ A   GYP   A+ W+GND C   W  I+CD  G N+T +N      +G
Sbjct  333   DCDPRVNVLLSIAKSFGYPDRFAEDWRGNDPCDGRWVGISCDSAG-NITVMNFQKMGLNG  391

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
             TISP F  +TSL+ L L++NNLTG IP +L  LP L+ LDVSNN L   +P+F   V ++
Sbjct  392   TISPDFGSITSLQKLLLSNNNLTGRIPSTLAKLPSLKALDVSNNFLWGQVPTFSKDVLVN  451

Query  1399  FGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK------  1238
               GN  + K  +T   +PG+  T NG S S  +            + +  +         
Sbjct  452   TAGNPSIGKNASTAP-APGNATTTNGDSKSDDVSQSSSSGKSSSSVPLGIIVGSMVAAVL  510

Query  1237  ----------CYMKREHKRFGRAKSPE---------------------------KIKSTQ  1169
                       CY K++ + FGR + P                            +  S  
Sbjct  511   GINILGLLGFCYYKKKKQAFGRVQCPNTMVIHPQHSGSEPDVAKVTAAGSSSNGRTASDT  570

Query  1168  MLKTN---------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAV  1016
               +T+         +     I +QVL   TN F EE++LG GG+GVVY G+L +GTK+AV
Sbjct  571   YSQTSSCPSDVHVVDAGNMVISVQVLRNVTNNFGEENILGEGGFGVVYKGELHDGTKIAV  630

Query  1015  KKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHL  836
             K+M+ G   TKG+NEF++EI  LSKVRH++LV+L+GYC++  + LLVYEYM  GTL  HL
Sbjct  631   KRMEAGVMGTKGLNEFKSEITVLSKVRHRHLVSLLGYCLDGSERLLVYEYMPQGTLSRHL  690

Query  835   FEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVAD  656
             F+WK+ G  PL WK+R++IA DVARG+EYLHSL HQSFIHRD+K SNILL DD++AKVAD
Sbjct  691   FDWKEEGLKPLEWKKRLSIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMKAKVAD  750

Query  655   FGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             FGLV+ A      VET++AGTFGYLAPEYA TGRVT K+
Sbjct  751   FGLVRLADGKGGSVETKLAGTFGYLAPEYAVTGRVTTKA  789


 Score =   125 bits (313),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  +L G    L       G    K DV++FGV+LME+ITG+KA+DE  P+E+ HLVTW
Sbjct  763  SVETKLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDERQPEESVHLVTW  822

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDP +D DE  F SIS VAELA HC   +  +RP M H VNVL   
Sbjct  823  FRRMQLNKDTFRKAIDPAIDLDED-FGSISTVAELAGHCCAREPQQRPEMGHAVNVLSSL  881

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
            A  W+   P+   E   G DL+M+LP
Sbjct  882  AELWKPSDPDS--EDSYGIDLDMTLP  905



>ref|XP_010932521.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Elaeis guineensis]
Length=937

 Score =   506 bits (1304),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 325/725 (45%), Positives = 447/725 (62%), Gaps = 38/725 (5%)
 Frame = -2

Query  2614  LLAALSPAPS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLR  2441
             L  +L PA   GWS S DPCT W  V C      VV+I + ++ +SG LP +   L +L 
Sbjct  50    LARSLDPAGKLGWSDSSDPCTAWDGVRCSG--DRVVAILVSNRDLSGVLPPDFRNLTALT  107

Query  2440  SLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPW  2261
              L +  N LSGPLPS   +++LE L+L +N FSS P DF  GL +L    + D    + W
Sbjct  108   RLELMSNHLSGPLPSLTGLATLETLFLANNNFSSFPGDFFSGLFSLTNVYL-DGNPFAGW  166

Query  2260  QISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIq  2081
              I   L +++ L +F A+NA++TG IP+F  +FP+  +L L++N L G LP +F  S + 
Sbjct  167   NIPPSLGDASGLVNFSANNANLTGTIPDFLGAFPSFYHLALAFNYLEGPLPSAFSGSPLS  226

Query  2080  nl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLT  1907
             +L        + LSG+IDV+ +MT L  ++LQ+N+F+GPIPDLS+   L DL L DNQLT
Sbjct  227   SLWLNNQKGSRRLSGSIDVVQNMTNLRDLYLQSNSFSGPIPDLSRLEKLRDLNLRDNQLT  286

Query  1906  GVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD--TNSFCKDTPG-PCDPQVT  1736
             G VP SLT L +L N+ L NN L GP+P+F   VK +  D  T  FC D  G  CDP+V 
Sbjct  287   GPVPSSLTSLGSLANVTLTNNLLQGPVPVFPKTVKKVDLDPRTERFCVDQVGVDCDPRVK  346

Query  1735  ALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQ  1556
              LL+ A   GYPI LA +W+GND CQ +A ITCDP G N+T V L     +GTIS  F  
Sbjct  347   VLLSIAKSFGYPIYLANNWRGNDPCQGFAGITCDPSG-NITLVVLQKLGLNGTISQDFQL  405

Query  1555  LTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLE  1376
             L  L+ L L+ NNLTG IP  LT L +LQVLDVS+N L   +P+F   V+++  GN  + 
Sbjct  406   LPKLQKLLLSGNNLTGTIPSELTNLKYLQVLDVSHNALWGKVPTFGGNVSVNTDGNPDIG  465

Query  1375  KTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKR-FGRA  1199
             K    G  S  SG  ++G S  A   +V  IV V+   ++  +   CY KR+ +R   RA
Sbjct  466   KDGPPGLDSSNSGNADDGGSKKATGVIVGSIVTVLCGALLAGILGFCYCKRKKQRKVQRA  525

Query  1198  KSPEKIK-----STQMLKTNEIMGTA--------------------IKIQVLEKATNFFs  1094
              +  K         +M+K   I G+A                    + IQ+L + TN FS
Sbjct  526   NNVVKYHQDSGSDIKMMKAT-IEGSATGSSGLTSIESDIAEPRSMVVSIQLLREVTNNFS  584

Query  1093  eesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVAL  914
             E+++LG GG+G VY G+  +G+ +AVK+M   A  +KG+++F+ EI+ L+ VRH++LV+L
Sbjct  585   EDNILGYGGFGKVYKGEFHDGSMIAVKRMDAAAMGSKGLHDFKKEISVLTSVRHRHLVSL  644

Query  913   VGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLT  734
             +GYC+ +++ +L+YEYM  G L HHLF+W K G  PL WK R+TIA DVARG+EYLHSL 
Sbjct  645   LGYCLEENERILIYEYMPQGALSHHLFDWMKVGLKPLEWKTRLTIALDVARGVEYLHSLA  704

Query  733   HQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGR  554
             ++ FIHRD+K SNILL D++RAKVADFGLV+   +    +ET++AGTFGYLAPEYA  GR
Sbjct  705   NRCFIHRDLKPSNILLGDNMRAKVADFGLVRLVHEGNHSIETKLAGTFGYLAPEYAVLGR  764

Query  553   VTKKS  539
             +T K+
Sbjct  765   LTTKA  769


 Score =   122 bits (306),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 97/169 (57%), Gaps = 6/169 (4%)
 Frame = -3

Query  669  LRLQILDWSKKLRMI---NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEII  499
            +R ++ D+   +R++   N S+  +L G    L       G    K DV++FGV+LME+I
Sbjct  724  MRAKVADFGL-VRLVHEGNHSIETKLAGTFGYLAPEYAVLGRLTTKADVFSFGVILMELI  782

Query  498  TGKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCT  319
            TG+KA++ T P+E+ HLVTWF  + R   N QKAIDP +  DE+  ++I  VA+L+ HCT
Sbjct  783  TGRKAIERTQPEESMHLVTWFRTMHRNEENFQKAIDPNIIVDEEIVKTIKTVADLSCHCT  842

Query  318  TNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEIVEKFGGFDLNMSLPLVF  172
                YRRP+M +VVNVL   A  W+    E  +E   G DL    P V 
Sbjct  843  VRDPYRRPDMGYVVNVLSSLAGIWKPSDGE--LEDGYGIDLEGPSPQVL  889



>ref|XP_006826595.1| hypothetical protein AMTR_s00138p00056480 [Amborella trichopoda]
 gb|ERM93832.1| hypothetical protein AMTR_s00138p00056480 [Amborella trichopoda]
Length=800

 Score =   501 bits (1289),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 324/754 (43%), Positives = 441/754 (58%), Gaps = 67/754 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             +DA+VM KL  +++   + GW++  DPC+W  V C +    + SI I  QS+ G LP +L
Sbjct  41    NDASVMQKLAISINAGKTLGWTSDTDPCSWKQVYCSQ--SRIESIQIGHQSLQGTLPDDL  98

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              +L+SL  L +  N LSGPLP+   +SSL  L ++ N FSSIP DF  GL  L   S+ D
Sbjct  99    NKLSSLVRLELMSNQLSGPLPTLKGLSSLSILIIERNNFSSIPGDFFSGLIALTAVSL-D  157

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N   SPW+I   L E  SL +F A+  ++ G IP+ F + P+L  L L+YNNL G+LP S
Sbjct  158   NNPFSPWRIPESLKELISLVNFSANTVNLYGEIPDIFSALPSLNTLALAYNNLYGNLPQS  217

Query  2101  FGSSEIq-----nlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             F  S ++     N   N Q   L+G+I VI +MT L QVWL +N F+GP+PD S   +L 
Sbjct  218   FSGSPVRFLWLNNQNQNQQVSKLNGSISVIQNMTGLVQVWLHSNHFSGPLPDFSGLTSLE  277

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVI--LGDTNSFCKDT  1763
             +L+L DN+ TG+VP SLT L +L+NI L NN   GP+P F   +  +  +  TNSFC D 
Sbjct  278   ELRLRDNEFTGLVPKSLTNLKSLQNISLTNNHFQGPLPQFLPSIVSVDMVAQTNSFCLDV  337

Query  1762  PGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFS  1583
             PG CDP+V +LL+ A  LGYP   A +WKGND C  W ++TC  QG N+T +N      +
Sbjct  338   PGDCDPRVNSLLSIAEPLGYPDNFATNWKGNDPCNQWNYVTCSSQG-NITILNFQGLNLT  396

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNI  1403
             GTISP FS+  SL+ L L  NNL G IP  LT L  L VL+VS+N+LS  +P F   VN+
Sbjct  397   GTISPDFSRFESLQRLLLGRNNLHGTIPPELTKLSKLIVLNVSDNSLSGKIPDFGQNVNL  456

Query  1402  SFGGN--LLLEKTVATGRGSPGSGQTENG-----------SSMSARMfvvvvivvvivvl  1262
                GN  L  +     G   P +   ENG            S +    V VVI V++ V 
Sbjct  457   IKDGNPDLGKDGNHGGGGSEPAAPSPENGKPSPKTIGEVSKSSNVVTIVGVVIGVLVGVF  516

Query  1261  vvlfvFYKCYMKREHKRFGRAKSPEKIK------------STQMLKTNEIMGTA------  1136
             VV  + + CY +R+HK F R +SP  ++            S    +   I+G++      
Sbjct  517   VVGGLGFFCYRRRQHK-FRRVRSPRALEPHSIVVHPTHSGSGSEFQKVTILGSSPGTMEL  575

Query  1135  ----------------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKV  1022
                                   I IQ L K T  F +E+ LG GG+G VY G+L++GT +
Sbjct  576   SPGSMAHAHHGFVQMVDDRVPTIGIQTLRKITKNFDKENELGRGGFGTVYKGELEDGTMM  635

Query  1021  AVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGH  842
             AVK+M  G     G+ E++AEIA LSK+RH+NLV L+ YC    +  LVYEYM+ G L  
Sbjct  636   AVKRMAGGVIGDTGLTEYEAEIASLSKLRHRNLVTLMYYCWEGSERALVYEYMAQGALSD  695

Query  841   HLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKV  662
             HLF+WK+  + P+ W++RV +A DVARG+EYLHSL  + FIHRD+KSSN+LL +D+ AKV
Sbjct  696   HLFKWKEREWKPMDWERRVRVALDVARGVEYLHSLAREKFIHRDLKSSNVLLAEDMTAKV  755

Query  661   ADFGLVKKAPDDKSFVE-TRVAGTFGYLAPEYAT  563
              DFGLV+ AP     ++ T++AGTFGYLAPEY +
Sbjct  756   GDFGLVRLAPQGGVSIQVTKMAGTFGYLAPEYTS  789



>gb|KHM99461.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=904

 Score =   502 bits (1293),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 329/729 (45%), Positives = 432/729 (59%), Gaps = 67/729 (9%)
 Frame = -2

Query  2566  DPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPLPSFAN  2387
             D C W +V C+     V +I I  QS++G+LP EL QL+ L       N+ +GP P+   
Sbjct  20    DVCKWEHVQCNT-MKRVTAIQIGGQSLNGSLPKELLQLSELTRFECMNNAFTGPFPNMPK  78

Query  2386  MSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLGSFFAS  2207
               SLE L + +N F+S+  DF  G+ NL+  SI  N   S W+I   L +   L SF A 
Sbjct  79    --SLEVLLIHNNNFNSMSGDFFNGMTNLQDVSIGYN-PFSNWEIPDSLKDCDDLRSFSAI  135

Query  2206  NASITGVIPNFFDS---FPNLQNLRLSYNNLTGSLPGSFGSSEIqn--lwlnnqqqgLSG  2042
             +A + G IP+F      FP L +L LS+N+L G LP +F  S I+   +   N    L+G
Sbjct  136   SAGLVGRIPDFLGKDGPFPGLVSLSLSFNSLEGGLPATFSGSSIETLWVNGQNSDGKLNG  195

Query  2041  TIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLEN  1862
             T+DV+  M  L Q+W+  N+FTGPIPDLS    LFD+ L DNQLTGVVP SLT LP L+ 
Sbjct  196   TLDVLKGMMYLKQIWVHGNSFTGPIPDLSNHDQLFDVSLRDNQLTGVVPPSLTALPALKV  255

Query  1861  IRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYPIT  1694
             + L NN L G  PLF + V+V   +   TNSFC    G PC P V ALL+    LGYP+ 
Sbjct  256   VNLTNNLLQGSPPLFKDGVRVDNDLEKGTNSFCTKKAGEPCSPLVDALLSVVEPLGYPLR  315

Query  1693  LAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNN  1517
             LA+SWKGND C Q+W  I C     NV+ V+  +   SG ISP+FS+LTSL  L L +N+
Sbjct  316   LAESWKGNDPCAQSWIGIVC--SSGNVSIVSFQSLNLSGKISPSFSRLTSLTKLLLANND  373

Query  1516  LTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRG--SPG  1343
             LTG IP  LT++P L+ LDVSNN L   +PSF   V +  GGN  + K  +      SPG
Sbjct  374   LTGTIPSELTSMPLLKELDVSNNKLFGKVPSFRGDVVLKTGGNPDIGKDASQALPGLSPG  433

Query  1342  --SGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKI----  1181
               SG      +  A +  VV    ++ +  ++F  Y    +R+HKR  + +SP  I    
Sbjct  434   GKSGSEGKKHNTGAIVGTVVGSFSLLGIAALVFAMY----RRKHKRASKVQSPSAIVVHP  489

Query  1180  ------------------------------------KSTQMLKTNEIMGTAIKIQVLEKA  1109
                                                  S Q L+   ++   I IQVL + 
Sbjct  490   GHSGDGNALKISVSGTGVGVSSDGGGGGGTGVFSTTSSVQHLEAGNMV---ISIQVLREV  546

Query  1108  TNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHK  929
             TN FSE ++LG GG+G VY G+L +GTK+AVK+M+ G    KG+ EF++EIA L++VRH+
Sbjct  547   TNNFSEGNILGRGGFGTVYKGELHDGTKIAVKRMESGMMGEKGLTEFESEIAVLTRVRHR  606

Query  928   NLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEY  749
             +LVAL G+C++ ++ LLVYEYM  G L  HLFEWK+ G  PL WK+R++IA DVARG+EY
Sbjct  607   HLVALEGHCLDGNERLLVYEYMPQGPLSKHLFEWKEEGLLPLEWKRRLSIALDVARGVEY  666

Query  748   LHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEY  569
             LH L  Q FIHRDIK SNILL DD+RAKV+DFGLV+ AP+ K+  ETR+AGTFGYLAPEY
Sbjct  667   LHGLAQQIFIHRDIKPSNILLGDDMRAKVSDFGLVRLAPEGKASFETRLAGTFGYLAPEY  726

Query  568   ATTGRVTKK  542
             A TGRVT K
Sbjct  727   AVTGRVTTK  735


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 99/186 (53%), Gaps = 12/186 (6%)
 Frame = -3

Query  768  WLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWSKKLRMI---N  622
            W   LSI +     V ++   + QIF         +++   +R ++ D+   +R+     
Sbjct  650  WKRRLSIALDVARGVEYLHGLAQQIFIHRDIKPSNILLGDDMRAKVSDFGL-VRLAPEGK  708

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S    L G    L       G    KVDVY++GV+LME+ITG+KA+D + P+E  HLVT
Sbjct  709  ASFETRLAGTFGYLAPEYAVTGRVTTKVDVYSYGVILMEMITGRKAIDNSQPEENVHLVT  768

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    +  K IDP +D DE+T  S   VAELA HC   + Y+RP+M HVVNVL P
Sbjct  769  WFRRMLLNKDSFTKLIDPIMDVDEETLPSFRTVAELAGHCCAREPYQRPDMSHVVNVLAP  828

Query  261  FAHNWR  244
                W+
Sbjct  829  LVEIWK  834



>ref|XP_008389147.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=940

 Score =   502 bits (1292),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 339/745 (46%), Positives = 436/745 (59%), Gaps = 56/745 (8%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD A M  L  ++ P   GWS + D C W  V+C K  G V  I + +Q ++G LP E+ 
Sbjct  35    DDGAAMEALSKSIGPNSLGWSGT-DYCNWGQVSCTK-DGKVFKIQLGNQKLTGTLPPEIQ  92

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L++L+ L VQ N L+GP PS + +  L+ L    N FSS P DF  GL +L   +I D+
Sbjct  93    KLSNLQQLEVQNNQLTGPFPSLSGLQPLQVLLAHDNNFSSFPSDFFSGLTSLDSINI-DH  151

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                + WQI   L ++T+L  F A+  +ITG IP+ F   +FP L  L L++N   G LP 
Sbjct  152   NPFAAWQIPDTLKDATALREFSATETNITGRIPDIFTGSNFPGLTELHLAFNYFEGELPA  211

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF SS IQ+L          L+GTIDV+ +MT L +VWL  N FTGPIPDLS    L  L
Sbjct  212   SFSSSSIQSLWLNGQQGTNRLNGTIDVLQNMTSLREVWLHGNFFTGPIPDLSTLGTLTTL  271

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-P  1754
              L DN+LTGVVP SL  L +L  + L NN L GPMP FG+ V+V +   N FC D PG  
Sbjct  272   SLRDNRLTGVVPASLLXLKSLTVVNLTNNMLQGPMPKFGDGVQVDMTSQNRFCSDKPGVD  331

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD +V  LL+    +GYP   A+SWKGND C NW  I C   G N+T V   +    GTI
Sbjct  332   CDTRVNILLSVVKDMGYPTVFAESWKGNDPCNNWKGIVC--HGGNITVVIFRSLGLRGTI  389

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             S  +S +T L+ L L++NNLTG IP  LT LP+LQ +DVSNN L   +P F   V +  G
Sbjct  390   STNYSLITFLQTLRLDNNNLTGTIPKELTQLPNLQEIDVSNNQLDGQVPKFNDTVQVKTG  449

Query  1393  GNLLLEKTVATGRGSPGS------GQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCY  1232
             GN    + V  G  SP +      G    G   S    VV  ++  +  LVV+     C 
Sbjct  450   GN---PRIVKDGPPSPATPPNSPPGSHSGGGKKSRTGVVVGAVIXSVGGLVVVGFVAFCL  506

Query  1231  MKREHKRFGRAKSP------------------------------EKIKSTQMLKTNEI--  1148
             +KR+H   GR   P                              E  KS      N+I  
Sbjct  507   LKRKHS--GRVXXPNALVIHPCHSGDQNAVKISVASPGVNCGGNESYKSPASSGPNDIHV  564

Query  1147  ---MGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
                    I IQVL   TN FSE +VLG GG+G VY G+L +GTK+AVK+M+ G    KG+
Sbjct  565   VEAXSMVISIQVLRNVTNNFSENNVLGKGGFGTVYKGELHDGTKIAVKRMESGVVAEKGL  624

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
             NEF++EIA L+KVRH++LV L+GYC+  ++ LLVYEYM  GTL  +LF W + G  PL W
Sbjct  625   NEFKSEIAVLTKVRHRHLVGLLGYCLEGNERLLVYEYMPQGTLSRYLFNWXEEGLKPLEW  684

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
              +R+TIA DVARG+EYLH L  Q+FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+ 
Sbjct  685   TRRLTIALDVARGVEYLHGLAXQTFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKAS  744

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             +ETR+AGTFGYLAPEYA TGR+T K
Sbjct  745   IETRLAGTFGYLAPEYAATGRMTLK  769


 Score =   131 bits (329),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 90/148 (61%), Gaps = 5/148 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG+KA+DE+  +E  HLVTW
Sbjct  744  SIETRLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRKAIDESQAEERLHLVTW  803

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++     L+K IDPT+D +E+T  SIS VAELA HC+  + Y+RP+M H VNVL   
Sbjct  804  FRRMLVNKDALRKVIDPTIDLNEETLSSISTVAELAGHCSAREPYQRPDMGHAVNVLSSL  863

Query  258  AHNWRSLRPEEI--VEKFGGFDLNMSLP  181
               W   +P E+   +   G DL M+LP
Sbjct  864  XEQW---KPSELEDSDDMHGIDLEMTLP  888



>gb|KEH40666.1| receptor kinase TMK1-like protein [Medicago truncatula]
Length=933

 Score =   501 bits (1291),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 329/753 (44%), Positives = 441/753 (59%), Gaps = 62/753 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSG--WSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGN  2477
             ++  D A M KL  ++  + S   WS S D C W  V C+   GN V +I I   +I G+
Sbjct  22    AWSQDDAAMQKLKTSIKSSSSNLDWSNS-DYCKWEKVTCN---GNRVTAIQIADTNIQGS  77

Query  2476  LPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRI  2297
             LP EL QL  L       NSLSG  P      SL+ L + +N F+S+P DF   + NL  
Sbjct  78    LPKELMQLTELTRFECNGNSLSGDFPYMP--ISLQHLSIGNNNFASMPSDFFANMSNLID  135

Query  2296  FSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNL  2123
              SI  N     WQI S L    +L +F A NAS  G+IP FF  ++FP L +L LS+N+L
Sbjct  136   VSIGYN-PFPQWQIPSSLKNCLALQTFSAINASFVGIIPEFFGKETFPALTDLSLSFNSL  194

Query  2122  TGSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKC  1949
              G+LP S   S I N  +        L+GT+ V+ +MT L Q+W+  N+FTGPIPDLS  
Sbjct  195   EGNLPNSLSGSSILNLWVNGQKSNNKLNGTLSVLQNMTSLKQIWVHGNSFTGPIPDLSNH  254

Query  1948  VNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNS  1778
               LFD+ L DNQLTGVVP SLT L +L  + L NN L G +P F N V+V   I    NS
Sbjct  255   DQLFDVSLRDNQLTGVVPPSLTSLQSLTVVNLTNNYLQGSVPKFQNSVRVDNDIDRGINS  314

Query  1777  FCKDTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC--QNWAFITCDPQGKNVTTV  1607
             FC    G PC P V ALL+     GYP+ LA+SWKGND C   +W  I C     NV+ +
Sbjct  315   FCTKVVGQPCSPVVNALLSVVEPFGYPLELAKSWKGNDPCGGDSWKGIIC--SAGNVSVI  372

Query  1606  NLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplp  1427
             N  N  FSG+ISP+F+ L+S+  L L++N+LTG IP  L ++P L+ +DVS+N L   +P
Sbjct  373   NFQNMGFSGSISPSFASLSSVTRLLLSNNHLTGTIPKELASMPALKEIDVSSNALYGQIP  432

Query  1426  sfpPAVNISFGGNLLLEKTVATGRGSPGS-GQTENGSSMSARMfvvvvivvvivv---lv  1259
              F   V +   GN  + K       SP S G T  G         V+V +V+ +V   + 
Sbjct  433   LFRGDVVVKTSGNPDIGKD--KPHDSPNSPGSTSGGKDKKKVSVGVIVGIVMGIVGFIIA  490

Query  1258  vlfvFYKCYMKREHKRFGRAKSPEKI----------------------------------  1181
             V    +  Y +R +KR G+ ++P  I                                  
Sbjct  491   VGVFVFIMYCRRHNKRDGKIQTPNAIVIHPHHSGEGNGVKISVAAAESSGAGVTGGTGGF  550

Query  1180  KSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKD  1001
               ++ +K  E     I IQVL + T+ FSE+++LG GG+  VY G+LD+GTK+AVK+MK 
Sbjct  551   SPSRSVKNVEAGSMVISIQVLREVTDNFSEKNILGKGGFATVYKGELDDGTKIAVKRMKS  610

Query  1000  GATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKK  821
                  +G+NE ++EIA L+KVRH++LVAL+GYC+++++ LLV+EYM  GTL  HLF+WK 
Sbjct  611   EMVGDQGLNEIKSEIAVLTKVRHRHLVALLGYCLDENEKLLVFEYMPQGTLSQHLFDWKD  670

Query  820   HGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVK  641
              G  PL WK+R++IA DVARG+EYLH L  Q FIHRD+K SNILL DD+RAKVADFGLV+
Sbjct  671   DGLKPLGWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKVADFGLVR  730

Query  640   KAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              AP+ ++  +T++AGTFGY+APEYA TGRVT K
Sbjct  731   LAPEGQASFQTKLAGTFGYMAPEYAVTGRVTTK  763


 Score =   131 bits (329),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 112/207 (54%), Gaps = 14/207 (7%)
 Frame = -3

Query  768  WLEELSIFIA*LIKVSFIET*SPQIFF--------LMMT*GLRLQILDWSKKLRMI---N  622
            W   LSI +     V ++   + QIF         +++   +R ++ D+   +R+     
Sbjct  678  WKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKVADFGL-VRLAPEGQ  736

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S + +L G    +       G    KVDVY++GV+LME+ITGKKA+D +  DE  HLVT
Sbjct  737  ASFQTKLAGTFGYMAPEYAVTGRVTTKVDVYSYGVILMEMITGKKAIDNSRQDENIHLVT  796

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF +++    + +K IDP +D DE+  ES   +A LA+HC   +  +RP+M HVVNVL P
Sbjct  797  WFRRMLLNKDSFEKVIDPAMDIDEEGLESFRTIAGLASHCCAREPNQRPDMGHVVNVLAP  856

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+   P+  V+   G DL+MSLP
Sbjct  857  LVEIWKPAEPD--VDDIYGIDLDMSLP  881



>ref|XP_004981977.1| PREDICTED: probable receptor protein kinase TMK1-like [Setaria 
italica]
Length=963

 Score =   502 bits (1292),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 333/765 (44%), Positives = 452/765 (59%), Gaps = 70/765 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCT---WTNVNCDKPTGNVVSINIDSQSISG  2480
             +   D   M  +  AL    + GW  + DPC+   W  V+CD  +G V +I +  + ++G
Sbjct  40    TLASDVEAMRAVAKALGADKTLGWDIAGDPCSPKPWDRVSCDS-SGRVTAIQVGGRGLTG  98

Query  2479  NLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLR  2300
              L  E+  L +L  L V  N L+GPLPS A +SSL+ L      F+SIP DF  GL  L 
Sbjct  99    TLAPEVRNLTALTRLEVFGNFLAGPLPSLAGLSSLQVLLARDCNFTSIPADFFKGLTELA  158

Query  2299  IFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
                I DN   + W +   LA  T+L +F A+ A+ITG +P+FF + P LQ L L++N L+
Sbjct  159   AVDIDDN-PFAAWTLPDDLAACTALTNFSANTANITGTLPDFFGAIPGLQRLSLAFNQLS  217

Query  2119  GSLPGSFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
             G +P S   + +  L          +G+I  +S+MT L Q+WLQ+NAFTGP+PD +   +
Sbjct  218   GPVPASLADAPLVQLWLNGQNGVRFNGSISFVSNMTSLEQLWLQSNAFTGPLPDFTGFDS  277

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L DLQL DN+LTG VP SL  L +L+ + L NN L GPMP F   +K  ++  T  FC  
Sbjct  278   LSDLQLRDNRLTGPVPDSLVKLKSLKKLTLTNNLLQGPMPKFSGDLKPDLIATTERFCLQ  337

Query  1765  TPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQR  1589
              PG PCDP+V+ LL  A G  YP +LA  WKGND C ++  +TC  QG N+T +NL N+ 
Sbjct  338   EPGMPCDPRVSLLLDVAAGFMYPESLADVWKGNDPC-SFPDVTC-IQG-NITRLNLANKG  394

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              SG+ISPA  ++ SL+ L L +NN+TG +P  + +LP L  +++SNNNL   LP+F   V
Sbjct  395   LSGSISPAIGKIRSLQILNLANNNITGTVPEEVASLPKLTEVNLSNNNLYGKLPTFAKNV  454

Query  1408  NISFGGNLLLEKTVATGRGSPGSGQTENGSSM-----------------SARMfvvvviv  1280
              ++  GN  + K       + GSG T N S M                 SA +    V+ 
Sbjct  455   VLNTAGNPNIGKDAPA--PTAGSGDTGNDSPMGGGGSKSSGSNGGSSSSSAGVIAGSVVG  512

Query  1279  vvivvlvvlfvFYKCYMKREHKRFGRAKSPEKI-------KSTQMLKTNEIMGTA-----  1136
              V  + +V  + + CY KR+ K FGR +SP  +        S  M+K     G A     
Sbjct  513   AVAGLGLVAALGFYCY-KRKQKPFGRVQSPHAMVIHPRHSGSDDMVKITVAGGNANGGAR  571

Query  1135  ------------------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGT  1028
                                     I IQVL   TN FSE+++LG GG+G VY G+L +GT
Sbjct  572   ASETYSQASSGPRDIHVVESGNMVISIQVLRNVTNNFSEDNILGRGGFGTVYKGELHDGT  631

Query  1027  KVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTL  848
             K+AVK+M+ G    KG+NEF++EIA L+KVRH+NLV+L+GYC++ ++ +LVYEYM  GTL
Sbjct  632   KIAVKRMEAGVMGNKGLNEFKSEIAVLTKVRHRNLVSLLGYCLDGNERILVYEYMPQGTL  691

Query  847   GHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRA  668
               HLFEW ++   PL WK+R++IA DVARG+EYLHSL  Q+FIHRD+K SNILL DD++A
Sbjct  692   SQHLFEWSENNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGDDMKA  751

Query  667   KVADFGLVKKAPDDKSF--VETRVAGTFGYLAPEYATTGRVTKKS  539
             KVADFGLV+ AP D     VETR+AGTFGYLAPEYA TGRVT K+
Sbjct  752   KVADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYAVTGRVTTKA  796


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 96/160 (60%), Gaps = 8/160 (5%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
            +S+   L G    L       G    K DV++FGV+LME+ITG+KA+DET P+++ HLVT
Sbjct  769  VSVETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVT  828

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAIDP +D DE+TF S+S V+ELA HC   + ++RP+M H VNVL  
Sbjct  829  WFRRMQLNKDTFRKAIDPVIDLDEETFASVSTVSELAGHCCAREPHQRPDMGHAVNVLST  888

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
             +  W+   P+   +   G DL+M+LP        F+DSS
Sbjct  889  LSDVWKPTDPDS--DDSYGIDLDMTLPQALKKWQAFEDSS  926



>ref|XP_004498720.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=924

 Score =   501 bits (1289),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 335/748 (45%), Positives = 439/748 (59%), Gaps = 57/748 (8%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             ++  D  VM KL  A+S    GWS S D C W  V CD      + +N   Q I G LP 
Sbjct  18    AWSQDDDVMQKLKKAISTPIVGWSDS-DICKWDGVRCDGKRVKSIQMN---QIIEGTLPK  73

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             EL QL  L+        LSG  P   N  SL+ L + SN F+SIP DF   + NL+   I
Sbjct  74    ELVQLTELKYFDFMGCQLSGSFPYMPN--SLQNLRISSNNFTSIPNDFFNNMTNLKEVRI  131

Query  2287  SDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTG  2117
              D+   S W++ S L    +L +F A NA   G IP FF +   FP L +L LS+N+   
Sbjct  132   -DSNPFSQWEVPSSLKNCLALQTFSAVNAGFVGTIPEFFGNNGPFPGLVDLFLSFNSFEA  190

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
             +LP SF  S I+ L          L+GTI V+ +MT L+Q+W+  N+FTGPIPD S    
Sbjct  191   ALPLSFAGSSIEKLWLNGQKSNNKLNGTISVLQNMTSLTQIWVHGNSFTGPIPDFSNHDQ  250

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFC  1772
             LFD+ L DNQLTGVVP SLT L +L+ + L NN L G  P F + V+V   ++   N FC
Sbjct  251   LFDVSLRDNQLTGVVPPSLTSLNSLKVVNLTNNYLQGSPPKFQDGVRVDNDMVRGNNRFC  310

Query  1771  KDTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC--QNWAFITCDPQGKNVTTVNL  1601
                 G PC P V ALL+     GYP+ LA SW+GND C   NW  I C   G N++ +N 
Sbjct  311   TSKVGQPCSPLVNALLSVVEPFGYPLALADSWQGNDPCNGNNWIGIVC--SGGNISIINF  368

Query  1600  GNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsf  1421
              +  FSG+ISP+F+ LTSL  L L  NNLTG IP  L ++PHL+ LDVSNN L   +PSF
Sbjct  369   QDMHFSGSISPSFASLTSLTKLLLAKNNLTGTIPKELASMPHLKELDVSNNLLYGEIPSF  428

Query  1420  pPAVNISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
                V +  GGN  + K       S  S   E+   +     +V ++V ++ +L V  + +
Sbjct  429   RGDVVVKTGGNPDIGKDKKPPGPSGPSSGGEDKKKLGV-GAIVGIVVGIVGLLGVAVLVF  487

Query  1240  KCYMKREHKRFGRAKSPEKI----------KSTQM-------------------------  1166
               Y +R  KR G+ +SP  I          KS ++                         
Sbjct  488   VMYGRR-RKRDGKVQSPNAIVVHPHHSGDGKSLKISVAASGSSCGRVVEGTSTAFSPSSS  546

Query  1165  LKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHT  986
             ++T E     I IQVL + TN FSE+++LG GG+G VY G+LD+GTK+AVK+M+      
Sbjct  547   VQTVEAGNMVISIQVLREVTNNFSEKNILGKGGFGTVYKGELDDGTKIAVKRMQSEMVGD  606

Query  985   KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
             KG+ EF++EIA L+KVRH++LVAL+GYC++D++ LLVYEYM  G L  HLFEWK  G +P
Sbjct  607   KGLTEFRSEIAVLTKVRHRHLVALLGYCLDDNEKLLVYEYMPQGPLSQHLFEWKDDGLEP  666

Query  805   LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
             L WK+R++IA DVARG+EYLH L  Q FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ 
Sbjct  667   LGWKRRLSIALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEG  726

Query  625   KSFVETRVAGTFGYLAPEYATTGRVTKK  542
             ++  ETR+AGTFGYLAPEYA TGRVT K
Sbjct  727   QASFETRLAGTFGYLAPEYAVTGRVTTK  754


 Score =   129 bits (323),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S    L G    L       G    KVDVY++GV+LME++TG++A+D + PDE  HLVTW
Sbjct  729  SFETRLAGTFGYLAPEYAVTGRVTTKVDVYSYGVILMEMVTGRRAIDNSQPDENVHLVTW  788

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +  K IDP ++ DE+  ES   +A LA+ C   + Y+RP+M HVVNVL P 
Sbjct  789  FRRMLINKDSFAKVIDPAMEIDEEGLESFKTIAGLASQCCAREPYQRPDMGHVVNVLAPL  848

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+   P+   E   G DL+M+LP
Sbjct  849  VEIWKPTEPD--AEDLFGIDLDMTLP  872



>ref|XP_010553540.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Tarenaya 
hassleriana]
Length=940

 Score =   500 bits (1288),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 324/745 (43%), Positives = 429/745 (58%), Gaps = 52/745 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA+ M  L ++L   +   WS   +PC WT+V CD  +  V  I + S+ I G LP +L 
Sbjct  29    DASSMQALKSSLKLTSDVDWS-DPNPCRWTSVQCDD-SSRVTRIQLKSKGIRGTLPPDLK  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L  L + +N LSGP+P  + +S L+ L L +N+F+S+P D   G+ +L+   + DN
Sbjct  87    NLTALTVLELFQNQLSGPIPDLSGLSQLQRLNLHNNQFTSVPKDLFTGMTSLQGVYL-DN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
               LS   I   + ++ SL      N SI+G IP+F    +  +L  L LS+N L G LP 
Sbjct  146   NPLSSSVIPDSIKDAPSLQELSLINCSISGKIPDFLGGQTHISLARLHLSFNYLEGELPA  205

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF +S  Q+L          L+G+I V+ +MT L++VWL  N+F+GPIPDLS    L   
Sbjct  206   SFATSSFQSLWLNGQQSTGKLNGSISVLQNMTSLTEVWLHGNSFSGPIPDLSGLQVLSIF  265

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFC-KDTPG  1757
              + DN+LTG+VP SL  LP+L  + L NN   G  P F N V+V +   TNSFC  D+  
Sbjct  266   SVRDNELTGIVPQSLVNLPSLSVVNLTNNMFQGRAPRFSNGVQVDMAPRTNSFCSDDSTV  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGT  1577
              CDP+V  LL+     GYP   A +WKGND C  W+ +TC   G N+T +N G    SGT
Sbjct  326   ACDPRVDILLSIVEAFGYPARFASNWKGNDPCSGWSGVTC--SGSNITVINFGRGGLSGT  383

Query  1576  ISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISF  1397
             ISP F++L SL  + L +N LTG IP  LTTLP L+ LDVSNNNL   LP F   V +  
Sbjct  384   ISPNFAKLVSLETIILANNALTGSIPAELTTLPKLRTLDVSNNNLDGALPKFRQNVALRI  443

Query  1396  GGNLLLEK----TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK-CY  1232
              GN  + K    +        GSG   NGSS      V ++  VV V+     V    C 
Sbjct  444   EGNSKIGKSPSGSSGASPDDKGSGNRGNGSSSGESTTVKIIGSVVGVIGAFCLVGLGVCL  503

Query  1231  MKREHKRFGRAKSPEKI-----------------------------------KSTQMLKT  1157
                + KR  R +SP  +                                        +  
Sbjct  504   YATKWKRPARVQSPANVVIHPHHSGDQAAVKLTIAASSLNGGGSESCYSHTSSGPSDIHI  563

Query  1156  NEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGM  977
              E     I I VL   TN FSEE++LG GG+G VY G+L +GTK+AVK+M+      KG+
Sbjct  564   AEAGNMVISIHVLRNVTNNFSEENILGKGGFGTVYRGELHDGTKIAVKRMESSVVSDKGL  623

Query  976   NEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTW  797
              EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  HLF W++ G  PL W
Sbjct  624   AEFKSEIAVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQGTLSQHLFHWEEEGLKPLEW  683

Query  796   KQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSF  617
              +R++IA DVARG+EYLH+L HQSFIHRD+K SNILL DD+RAKV+DFGLV+ APD K  
Sbjct  684   TRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPDGKHS  743

Query  616   VETRVAGTFGYLAPEYATTGRVTKK  542
             +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   IETRLAGTFGYLAPEYAVTGRVTTK  768


 Score =   126 bits (316),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 87/147 (59%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVD+++FGV+LME+ITG+KA+DET P+++ HLVTW
Sbjct  743  SIETRLAGTFGYLAPEYAVTGRVTTKVDIFSFGVILMELITGRKALDETQPEDSMHLVTW  802

Query  438  FHKI--IRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            F +I   +   +  KA+DP +D D+ T  S+ KV+ELA HC   + Y+RP+M HVVNVL 
Sbjct  803  FRRIHNGKDQDSFNKAVDPAIDLDQDTLSSVGKVSELAGHCCAREPYQRPDMGHVVNVLS  862

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSL  184
                 W+   P+   +   G D +M L
Sbjct  863  SLVEQWKPSEPDP--DDMYGIDYDMPL  887



>ref|XP_004249911.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=937

 Score =   500 bits (1287),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 342/754 (45%), Positives = 455/754 (60%), Gaps = 67/754 (9%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNC-DKPTGNVVSINIDSQSISGNLPSE  2465
             DD +VM  L  +L+P    GWS   DPC W +V C DK    V+ I I  Q+I G LP E
Sbjct  28    DDVSVMLALKKSLNPPKEVGWS-DPDPCKWNHVGCSDK---RVIRIQIGHQNIQGTLPPE  83

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             +++L  L  L +Q N++SGPLPS + +SSL+ L L  N+FSSIP +F   + +L    I 
Sbjct  84    ISKLTELERLELQGNNISGPLPSLSGLSSLQVLLLGENQFSSIPANFFTDMSSLLSVDI-  142

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             D      W+I   L  ++SL +F A++A++ G IPNFF  D FP L NL L+ NNL G L
Sbjct  143   DKNPFVGWEIPESLRNASSLKNFSANSANVIGRIPNFFSPDEFPGLVNLHLAGNNLEGEL  202

Query  2110  PGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             P SF  S +    L    Q L+G IDVIS+MT L +VWL +N F+GP+PD S    L  L
Sbjct  203   PSSF--SGLLLESLWLNGQKLNGGIDVISNMTFLKEVWLHSNNFSGPLPDFSGLKALETL  260

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD-TNSFCKDTPGP  1754
              L DN  TG VP SL  L +L+ + L NN   GPMP+F   V V     TNSFC   PG 
Sbjct  261   SLRDNAFTGPVPSSLMNLESLKFVNLANNFFQGPMPVFKGSVVVDSAKGTNSFCLLQPGD  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CDP+V  LL+ A  + YP+  A++WK ND C +W  +TC     N+T +N      SGTI
Sbjct  321   CDPRVNTLLSIAKSMDYPMIFAKNWKENDPCADWFGLTC--SNGNITVINFQKMGLSGTI  378

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SP F+ L SL+ + L DNNLTG IP  LTTL  L  LDVSNN +   +P+F   + + + 
Sbjct  379   SPEFASLKSLQKIVLADNNLTGTIPEELTTLTGLTELDVSNNQIYGKVPAFRKNLILKYS  438

Query  1393  GN--LLLEKTVATGRG-SPG-SGQTENGSSMSARMfvvvvivvvivvlvvlf-------v  1247
             GN  +  +K+ A  +G SPG S  +++G+S +AR      + +V+  ++           
Sbjct  439   GNPDIGKDKSDAPSQGSSPGVSTGSDDGNSQAARKKSNRRVGIVVFSVIGGVFMLCLIGA  498

Query  1246  FYKCYMKREHKRFGRAKSP--------------EKIKST---------------------  1172
                C  K + KRF R +SP              + +K T                     
Sbjct  499   AAFCLYKSKQKRFSRVQSPNTMVLHPHHSGSDNDSVKITVAGSSVSVGAVGETHTVSASE  558

Query  1171  ----QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMK  1004
                 QM++   ++   I IQVL+  TN FSE+++LG GG+G VY G+L +GTK+AVK+M+
Sbjct  559   AGDVQMVEAGNMV---ISIQVLKNVTNNFSEDNILGRGGFGTVYRGELHDGTKIAVKRME  615

Query  1003  DGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWK  824
             +G    KG+ EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEYM  GTL  HLF+W 
Sbjct  616   NGIITGKGLAEFKSEIAVLTKVRHRHLVGLLGYCLDGNEKLLVYEYMPQGTLSSHLFDWA  675

Query  823   KHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLV  644
             + G  PL W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKVADFGLV
Sbjct  676   EEGLKPLEWTKRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKVADFGLV  735

Query  643   KKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             + AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  736   RLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTK  769


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  744  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  803

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDP ++  E+T  SIS VAELA HC+  + Y+RP+M H VNVL   
Sbjct  804  FRRMHLNKDTFRKAIDPAINLSEETLASISTVAELAGHCSAREPYQRPDMGHAVNVLSSL  863

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  864  VELWKP--SDECSEDIYGIDLDMSLP  887



>ref|XP_008789301.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=930

 Score =   499 bits (1286),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 325/730 (45%), Positives = 449/730 (62%), Gaps = 43/730 (6%)
 Frame = -2

Query  2623  MSKLLAALSPAPS-GWSASKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLA  2450
             M  L  +L PA   GW  S DPC  W  V C      VV+I + ++ +SG LP ++  L 
Sbjct  41    MRTLAKSLDPASKLGWLDSSDPCDHWVGVRCSG--DRVVAIQVGNRGLSGVLPPDIRNLT  98

Query  2449  SLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGEL  2270
             +L  L +  N LSGP+PS   +++LE L+L +N FSSIP DF  GL +L    + DN   
Sbjct  99    ALTRLELMSNRLSGPIPSLTGLATLETLFLANNNFSSIPGDFFSGLYSLTNVYL-DNNPF  157

Query  2269  SPWQISSYLAESTSLGSFFASNASITGVIPNFF-DSFPNLQNLRLSYNNLTGSLPGSFGS  2093
             + W I   L +++ L +F A+ A++TG IP+F  D FP+  +L L+YN L G LP +F  
Sbjct  158   AGWSIPPSLRDASGLLNFSANIANLTGTIPDFLADGFPSFYHLALAYNYLEGPLPSAFSG  217

Query  2092  SEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGD  1919
               + +L        + LSG+IDVI +MT L ++ LQ+N+F+GPIPDLS+  NL DL L D
Sbjct  218   FSLSSLWLNNQKGSRRLSGSIDVIRNMTNLKRLQLQSNSFSGPIPDLSRLENLHDLNLRD  277

Query  1918  NQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGD--TNSFCKDTPG-PCD  1748
             N+LTG VP SLT L +LEN+ L NN L GP+P+F   +K +  D  T  FC D  G  CD
Sbjct  278   NKLTGPVPSSLTSLKSLENVILTNNLLQGPVPVFPKTMKKVDLDPRTERFCVDEVGVDCD  337

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             P+V  LL+ A   GYPI LA +W+GND CQ +  ITCDP G N+T V L N   +GTIS 
Sbjct  338   PRVNVLLSIAESFGYPIYLADNWRGNDPCQGFTGITCDPSG-NITLVVLQNLGLNGTISQ  396

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
              F  L  L+ L L+ NNLTG IP  LT L +LQVLDVS N L   +P F   V+++  GN
Sbjct  397   GFQLLPKLQKLLLSGNNLTGTIPSELTNLKYLQVLDVSRNALWGKVPRFGGNVSVNTDGN  456

Query  1387  LLLEKTVATGRGSPGSGQTENGSSM--SARMfvvvvivvvivvlvvlfvFYKCYMKRE--  1220
               + +    G   P SG  ++G     +A M   +V V+  V+L  + + + CY KR   
Sbjct  457   PDIGR---DGPPPPNSGYADDGGRKKSTAVMVGSIVAVLYGVLLAGILLGF-CYCKRRKQ  512

Query  1219  ------------HKRFG------RAKSPEKIKSTQMLKT-----NEIMGTAIKIQVLEKA  1109
                         H+  G      +A       S   LK+      E    A+ +Q+L + 
Sbjct  513   SKLQRANNIVIHHQHSGSDMKLLKATIASNESSANRLKSIEPDIAEPGSMAVSMQLLREV  572

Query  1108  TNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHK  929
             TN FSE+++LG GG+G VY G+L +G+ +AVK+M+  AT +KG+++F++EI+ L+ VRH+
Sbjct  573   TNNFSEDNILGCGGFGTVYKGELHDGSMIAVKRMETRATGSKGLHQFKSEISVLTNVRHR  632

Query  928   NLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEY  749
             +LV+L+GYC+ +++ +L+YEYMS G L  HLF+W K G  PL WK+R+TIA DVARG+EY
Sbjct  633   HLVSLLGYCLEENERILIYEYMSQGELSRHLFDWMKAGLKPLEWKRRLTIALDVARGVEY  692

Query  748   LHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEY  569
             LHSL ++ FIHRD+K SNILL D++RAKVADFGLV+   +    +ETR+AGTFGYL PEY
Sbjct  693   LHSLANRCFIHRDLKPSNILLGDNMRAKVADFGLVRLVQEGNQSIETRLAGTFGYLDPEY  752

Query  568   ATTGRVTKKS  539
             A  GR+T K+
Sbjct  753   AVMGRLTTKA  762


 Score =   120 bits (301),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 97/169 (57%), Gaps = 6/169 (4%)
 Frame = -3

Query  669  LRLQILDWS--KKLRMINLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIIT  496
            +R ++ D+   + ++  N S+   L G    L       G    K DV++FGV+LME+IT
Sbjct  717  MRAKVADFGLVRLVQEGNQSIETRLAGTFGYLDPEYAVMGRLTTKADVFSFGVILMELIT  776

Query  495  GKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTT  316
            G+KA+D  LP+E+ HLVTWF ++       +K +DP +  DE+TF+SI  VA+L+ +CT 
Sbjct  777  GRKAIDRDLPEESMHLVTWFRRMHLDEETFEKTVDPNIIFDEETFKSIKTVADLSCYCTV  836

Query  315  NKYYRRPNMEHVVNVLGPFAHNWRSLRPEEI-VEKFGGFDLNMSLPLVF  172
               YRRP+M + VNVL   A  W   +P ++ +E   G  L +  P VF
Sbjct  837  RDPYRRPDMGYAVNVLSSLAGIW---KPTDVELEDGYGIGLEVRSPQVF  882



>ref|XP_010501607.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=888

 Score =   497 bits (1279),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 319/725 (44%), Positives = 428/725 (59%), Gaps = 39/725 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTN-VNCDKPTGNVVS-INIDSQSISGNLPSE  2465
             DAA M+ L  +L  P    WS   DPC W++ + CD   GN +S I I ++ ISG LP +
Sbjct  24    DAAAMTALKRSLKLPGSLNWS-DPDPCKWSSSIQCD---GNRISKIQIGNKGISGTLPPD  79

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L+SL    V  N ++G +PSFA + SL  +Y + N F SI  DF   L +L+     
Sbjct  80    LKNLSSLMIFEVMHNKITGKIPSFAGLKSLNRVYFNDNSFDSIDSDFFANLTSLQQQVYL  139

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             DN    PW+I   L  +T+L  F A+N S+ G IP+     +FP L  L+LS N+L G +
Sbjct  140   DNNPFGPWEIPQSLKNATALLIFSAANCSLNGTIPDLLWGQTFPKLNTLQLSTNSLVGEI  199

Query  2110  PGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             P +F  S      L+   Q LSG+I  + +MT L +V L  N F+GPIPD S  V+L  +
Sbjct  200   PSNFNES---LQILSLNGQKLSGSISFLQNMTALIEVRLNRNEFSGPIPDFSGHVSLKVV  256

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDTPG-  1757
              + DNQLTG+VP SLT L +L  + L NN L GP P F  N + + L   NSFC DTPG 
Sbjct  257   NIRDNQLTGIVPSSLTELTSLSEVGLGNNLLQGPTPSFKANNLTLDLTGLNSFCLDTPGT  316

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQ---NWAFITCDPQGKNVTTVNLGNQRF  1586
             PCDP+V  LL+      YP+  A SWKGND C    +W  ITC   G N+T +N  N   
Sbjct  317   PCDPRVNTLLSIVKAFDYPVKFASSWKGNDPCSKSPSWLGITC--VGSNITVINFENMGL  374

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplp-sfpPAV  1409
             +GTISP+F  L SL+ + L+ NNLTGPIP  LT L +L+ LDVSNN+L       F P V
Sbjct  375   NGTISPSFRNLLSLQVINLSRNNLTGPIPQELTELTNLKTLDVSNNHLCGSKVPGFNPTV  434

Query  1408  NISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
              ++  GN  + K  ++G      G+  N   M   +  +++ +++I   +   V  K   
Sbjct  435   IVNTSGNPDIGKGCSSGG---DGGKKANAGKMIGFVIGILLGLLLIGFAIFFLVNKKKQY  491

Query  1228  KREHKRFGRAKSPEKIKST----------------QMLKTNEIMGTAIKIQVLEKATNFF  1097
             +R H +  R      +K T                      E     I IQVL  AT+ F
Sbjct  492   RRMHPKQQRGDDQGALKITIGNLCGGGSESGFSGSDAHHVGESGNIVISIQVLRDATDNF  551

Query  1096  seesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVA  917
              E+++LG GG+G+VY G+L +GTK+AVK+M+      KG++EF++EIA L++VRH+NLV 
Sbjct  552   DEKNILGRGGFGIVYKGELHDGTKIAVKRMEPSIISGKGLDEFKSEIAVLTRVRHRNLVI  611

Query  916   LVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSL  737
             L GYC+  ++ LLVY+YM  GTL  H+F W+  G  PL W +R+ IA DVARG+EYLH+L
Sbjct  612   LHGYCLEGNERLLVYQYMPQGTLSRHIFHWQVEGLSPLEWTRRLIIALDVARGVEYLHTL  671

Query  736   THQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTG  557
              HQSFIHRD+K SNILL DD+ AKVADFGLV+ AP+    +ET++AGTFGYLAPEYA TG
Sbjct  672   AHQSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGAQSIETKIAGTFGYLAPEYAVTG  731

Query  556   RVTKK  542
             RVT K
Sbjct  732   RVTTK  736


 Score = 98.2 bits (243),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 83/152 (55%), Gaps = 1/152 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D+   +E  HL TW
Sbjct  711  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDDKRSEEEVHLATW  770

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAID T++ +E+T  SI+ VAELA  C+  +  +RP M HVVNVL   
Sbjct  771  FRRMYINKDSFPKAIDETIEFNEETLRSINTVAELANQCSAREPQQRPEMSHVVNVLVSL  830

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFDDS  163
               W+        E   G D +  LP  FD +
Sbjct  831  VLQWKPAEQSGDSEDIYGIDYDTPLP-SFDST  861



>emb|CDY03867.1| BnaC07g10920D [Brassica napus]
Length=889

 Score =   496 bits (1278),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 320/725 (44%), Positives = 439/725 (61%), Gaps = 42/725 (6%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D A M+ L  +L  P  S W+   DPC W+ V CD+ +  +  I I ++ ISG L S+L 
Sbjct  25    DLATMNALRDSLKFPKDSSWTG-PDPCKWSGVQCDR-SNRITRIQIGNKGISGTLTSDLN  82

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+SL    V  N L+G +PS A +++L+ +    N F+SI  D   GL +L+   + D 
Sbjct  83    TLSSLTVFEVMGNKLTGGIPSLAGLNALQTINAHDNSFTSISADIFTGLTSLQHVYL-DG  141

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                SPW+I   L  +TSL  F A+N  ++G IP+F    +FP+LQ LRLS N+L+G LP 
Sbjct  142   NPFSPWEIPMSLKSATSLVDFSAANCFLSGKIPDFLGGQTFPSLQKLRLSSNSLSGELPL  201

Query  2104  SFGSSEIqnlwlnnqq-qgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             SF +S +Q L LN Q  Q L+G+I V+ +MT L++V LQ NAF+GP+PD+S  V+L    
Sbjct  202   SFANSPVQTLLLNGQTPQKLNGSISVLQNMTSLTEVSLQGNAFSGPLPDMSGLVSLTKFN  261

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDT----NSFCKDTP  1760
             + +NQLTG+VP S T L +L  + + NN   G  P F  K K I  D     NSFC D+P
Sbjct  262   VRENQLTGLVPSSFTELQSLAVVNMTNNLFQGSTPTF--KAKNIAVDITPRLNSFCLDSP  319

Query  1759  G-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN---WAFITCDPQGKNVTTVNLGNQ  1592
             G PCDP+V +LLA     GYP+  AQSWKGND C +   W  ITC   G ++T +N    
Sbjct  320   GVPCDPRVNSLLAIVEAFGYPVRFAQSWKGNDPCSSKNVWVGITC--TGADITVINFKGM  377

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
                GTISP F+ LTSLR + L+ NNLTG IP  LT L  L  LDVSNN L   +P     
Sbjct  378   GLKGTISPRFADLTSLRVINLSQNNLTGVIPQELTKLSSLATLDVSNNQLYGKVPV----  433

Query  1411  VNISFGGNLLLEK-TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
                 FG N+L+       G+  PG     +GS+    +  V  +V+ ++++ ++      
Sbjct  434   ----FGPNVLITTGNPDLGKDDPGHASDSSGSNAGTVVGSVFGVVLGLLLMGLIIFLVVK  489

Query  1234  YMKREHKRFGRAKSPE----KIKSTQMLKTNEIMGT----------AIKIQVLEKATNFF  1097
               K+  K++ +  S E    KI    +       G+           + IQ+L  AT+ F
Sbjct  490   KRKQNRKKYPQQHSGEEDALKITIDNLCAGGSESGSNGLLVEPENPVMPIQILRDATDNF  549

Query  1096  seesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVA  917
             +E+++LG GG+G+VY G+L +G  VAVK+M+      KG++EF++EIA L+KVRH+NLV 
Sbjct  550   NEKNILGRGGFGIVYKGELPSGKTVAVKRMESSVISGKGLDEFKSEIAVLTKVRHRNLVK  609

Query  916   LVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSL  737
             + GYC+  ++ LLVYEYM  GTL  HLF W++ G  PL W +R+ IA DVA+G+EYLHS 
Sbjct  610   VEGYCLESNERLLVYEYMPLGTLSSHLFNWQEEGLQPLEWSRRLIIASDVAKGVEYLHSQ  669

Query  736   THQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTG  557
              HQSFIHRD+K SNILL DD+RA+VADFGLV+ AP+    +ET++AGTFGYLAPEYA TG
Sbjct  670   AHQSFIHRDLKPSNILLGDDMRARVADFGLVRLAPEGTQSIETKIAGTFGYLAPEYAVTG  729

Query  556   RVTKK  542
             RVT K
Sbjct  730   RVTTK  734


 Score =   112 bits (281),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D    +E  HLVTW
Sbjct  709  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDVKRSEEDVHLVTW  768

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    +  KAID ++D +E+T  SI+KVAELA HC+  + ++RP+M HVV VL   
Sbjct  769  FRRMLINKDSFPKAIDASIDVNEETLPSINKVAELACHCSAREPHQRPDMSHVVRVLASL  828

Query  258  AHNWRSLRPEE  226
               W   +P+E
Sbjct  829  LDQW---KPDE  836



>ref|XP_008358283.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=925

 Score =   494 bits (1271),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 327/740 (44%), Positives = 432/740 (58%), Gaps = 54/740 (7%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M  L  ++     GWS + D C W  V+C    G V  I + +Q ++G LP E+ +L++L
Sbjct  121   MEALRKSIGSNSLGWSGT-DYCKWGKVSCKD--GKVFKIQLGNQKLTGTLPPEIQKLSNL  177

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             + L VQ N L+GP PS + +  L+ L +  N  SS P DF  GL +L   +I D    + 
Sbjct  178   QQLEVQNNQLTGPFPSLSGVQPLQVLLVHDNNISSFPSDFFTGLTSLDNINI-DYNPFAA  236

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSS  2090
             WQI   L ++T L  F A+  + TG IP+ F S  FP L +L L++N L G L  SF  S
Sbjct  237   WQIPDILKDATQLKEFSATETNJTGRIPDIFSSSNFPGLTDLHLAFNYLEGELXASFSXS  296

Query  2089  EIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              IQ+L          L+GTIDV+ +MT L +VWL  N FTGPIPDLS    L  L L DN
Sbjct  297   SIQSLWLNXQQGTNRLNGTIDVLQNMTSLREVWLHGNYFTGPIPDLSNLGYLTTLSLRDN  356

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQV  1739
             +LTGVVP SL  L +L ++ L NN L GPMP FG+ V V +   NSFC D PG  CD +V
Sbjct  357   KLTGVVPASLLNLKSLTSVNLTNNMLQGPMPKFGDGVLVDMXGXNSFCSDKPGVDCDARV  416

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL+    +GYP   A SWKGND C NW  ITC+  G N+T VN  +   SGTIS  +S
Sbjct  417   NVLLSVXKDMGYPTVFADSWKGNDXCXNWXGITCN--GGNITVVNFRSLGLSGTISSNYS  474

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LTSL  L L++NNLTG IP  LT LP+LQ +DVSNN L   +P F   V++   GN  +
Sbjct  475   LLTSLXTLRLDBNNLTGTIPKELTQLPNLQQIDVSNNQLFGQVPKFKN-VDVKTDGNPNI  533

Query  1378  EK------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREH  1217
              +         T   SP +  ++ G    + + V  VI  V  ++VV FV + C +K++H
Sbjct  534   GQDHPPSPATPTIPNSPPASPSDGGKKSRSGVVVGAVIGTVGGLVVVGFVAF-CLLKKKH  592

Query  1216  KRFGRAKSPEKI----------KSTQMLKTN-------------------------EIMG  1142
             K  GR +SP  +           + ++   N                         E   
Sbjct  593   KHSGRVQSPNALVIHPRHSGDQNAVKITVANSGVNRGENESYNSPANSGPNDIHVVEAGS  652

Query  1141  TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQA  962
               I IQ L   TN FSE +VLG GG+G VY G+L +G K+AVK+M+ G    K +NEF++
Sbjct  653   MVISIQXLRDVTNNFSENNVLGKGGFGTVYKGELHDGXKIAVKRMESGVVAEKXLNEFKS  712

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KV H++LV L+GYC++ ++ LLVYEYM  GTL  +LF WK+ G  PL W +R+T
Sbjct  713   EIAVLTKVXHRHLVGLLGYCLDGNERLLVYEYMPQGTLSRYLFNWKEEGLKPLEWTRRLT  772

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRV  602
             IA DVARG+EYLH L  Q+FIHRD+K SNILL D +RAKV+DFGLV+  P+  + + T +
Sbjct  773   IALDVARGVEYLHGLASQTFIHRDLKPSNILLGDXMRAKVSDFGLVRLXPEGXASIATGL  832

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGYLAPEYA TGR+T K
Sbjct  833   AGTFGYLAPEYAATGRMTLK  852


 Score = 86.7 bits (213),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG++A+ ++ P+E+ HLVTW
Sbjct  827  SIATGLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRRAILKSEPEESLHLVTW  886

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAH  325
            F +++     L+KAIDPT+D +E+T  SI+ + + + H
Sbjct  887  FRRMLINKDALRKAIDPTIDLNEETLSSINTIVKSSTH  924



>ref|XP_008381802.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=971

 Score =   495 bits (1274),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 327/740 (44%), Positives = 433/740 (59%), Gaps = 54/740 (7%)
 Frame = -2

Query  2623  MSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASL  2444
             M  L  ++     GWS + D C W  V+C    G V  I + +Q ++G LP E+ +L++L
Sbjct  69    MEALRKSIGSNSLGWSGT-DYCKWGKVSCKD--GKVFKIQLGNQKLTGTLPPEIQKLSNL  125

Query  2443  RSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSP  2264
             + L VQ N L+GP PS + +  L+ L +  N  SS P DF  GL +L   +I D    + 
Sbjct  126   QQLEVQNNQLTGPFPSLSGVQPLQVLLVHDNNISSFPSDFFTGLTSLDNINI-DYNPFAA  184

Query  2263  WQISSYLAESTSLGSFFASNASITGVIPNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSS  2090
             WQI   L ++T L  F A+  ++TG IP+ F S  FP L +L L++N L G L  SF  S
Sbjct  185   WQIPDILKDATQLKEFSATETNLTGRIPDIFSSSNFPGLTDLHLAFNYLEGELXASFSXS  244

Query  2089  EIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDN  1916
              IQ+L          L+GTIDV+ +MT L +VWL  N FTGPIPDLS    L  L L DN
Sbjct  245   SIQSLWLNXQQGTNRLNGTIDVLQNMTSLREVWLHGNYFTGPIPDLSNLGYLTTLSLRDN  304

Query  1915  QLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQV  1739
             +LTGVVP SL  L +L ++ L NN L GPMP FG+ V V +   NSFC D PG  CD +V
Sbjct  305   KLTGVVPASLLNLKSLTSVNLTNNMLQGPMPKFGDGVLVDMXGXNSFCSDKPGVDCDARV  364

Query  1738  TALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFS  1559
               LL+    +GYP   A SWKGND C NW  ITC+  G N+T VN  +   SGTIS  +S
Sbjct  365   NVLLSVXKDMGYPTVFADSWKGNDXCXNWXGITCN--GGNITVVNFRSLGLSGTISSNYS  422

Query  1558  QLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL  1379
              LTSL  L L++NNLTG IP  LT LP+LQ +DVSNN L   +P F   V++   GN  +
Sbjct  423   LLTSLXTLRLDBNNLTGTIPKELTQLPNLQQIDVSNNQLFGQVPKFKN-VDVKTDGNPNI  481

Query  1378  EK------TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREH  1217
              +         T   SP +  ++ G    + + V  VI  V  ++VV FV + C +K++H
Sbjct  482   GQDHPPSPATPTIPNSPPASPSDGGKKSRSGVVVGAVIGTVGGLVVVGFVAF-CLLKKKH  540

Query  1216  KRFGRAKSPEKI----------KSTQMLKTN-------------------------EIMG  1142
             K  GR +SP  +           + ++   N                         E   
Sbjct  541   KHSGRVQSPNALVIHPRHSGDQNAVKITVANSGVNRGENESYNSPANSGPNDIHVVEAGS  600

Query  1141  TAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQA  962
               I IQ L   TN FSE +VLG GG+G VY G+L +G K+AVK+M+ G    K +NEF++
Sbjct  601   MVISIQXLRDVTNNFSENNVLGKGGFGTVYKGELHDGXKIAVKRMESGVVAEKXLNEFKS  660

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KV H++LV L+GYC++ ++ LLVYEYM  GTL  +LF WK+ G  PL W +R+T
Sbjct  661   EIAVLTKVXHRHLVGLLGYCLDGNERLLVYEYMPQGTLSRYLFNWKEEGLKPLEWTRRLT  720

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRV  602
             IA DVARG+EYLH L  Q+FIHRD+K SNILL D +RAKV+DFGLV+  P+  + + T +
Sbjct  721   IALDVARGVEYLHGLAXQTFIHRDLKPSNILLGDXMRAKVSDFGLVRLXPEGXASIXTXL  780

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGYLAPEYA TGR+T K
Sbjct  781   AGTFGYLAPEYAATGRMTLK  800


 Score =   135 bits (341),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 1/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVY+FGV+LME+ITG++A+DE+ P+E+ HLVTW
Sbjct  775  SIXTXLAGTFGYLAPEYAATGRMTLKVDVYSFGVILMELITGRRAIDESQPEESLHLVTW  834

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++      +KAIDPT+D +E+T  SI+ VAELA HC+  + Y+RP+M H VNVL   
Sbjct  835  FRRMLINKDAFRKAIDPTIDLNEETLSSINTVAELAGHCSAREPYQRPDMGHAVNVLSSL  894

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
              +W+    E+  + + G DL M+LP
Sbjct  895  VEHWKPSEAEDSDDMY-GIDLEMTLP  919



>ref|XP_008244390.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=947

 Score =   493 bits (1270),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 329/764 (43%), Positives = 442/764 (58%), Gaps = 70/764 (9%)
 Frame = -2

Query  2647  SFCDDAAVMSKLLAALSPAPS-GWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             S  +DA+VM  L  +L+P+ S GWS   DP  W++V        V  I +   ++ G LP
Sbjct  31    SSSNDASVMLDLKKSLNPSESLGWS-DPDPRKWSHVGWSDDQ-RVTRIQLGHLNLEGTLP  88

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
               L  L  L  L +Q N +SGPLPS + +S L+ L L +N+FSSIP DF   + +L+   
Sbjct  89    PSLQNLTKLERLELQWNKISGPLPSLSGLSLLQVLLLSNNQFSSIPSDFFTDMTSLQSVE  148

Query  2290  ISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFD--SFPNLQNLRLSYNNLTG  2117
             I DN     W+I + L  + SL +F A++A+ITG +P+FFD  SF +L NL L++N L G
Sbjct  149   I-DNNPFMGWEIPATLRNAASLQNFSANSANITGNVPDFFDVDSFSSLVNLHLAFNGLQG  207

Query  2116  SLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVN  1943
              LP SF  S+IQ+L          L G+I VI +MT L +VWL +NAF+GP+PD S   +
Sbjct  208   ELPESFARSQIQSLWLNGQESVVKLGGSIGVIQNMTLLKEVWLHSNAFSGPLPDFSGLKD  267

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTNSFCKD  1766
             L  L L DN  TG VPVSL  L +LE + L NN L GPMP FG +V V ++  +N+FC  
Sbjct  268   LRSLSLRDNMFTGPVPVSLLNLKSLEAVNLTNNLLQGPMPAFGVEVAVDMVNGSNNFCLP  327

Query  1765  TPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRF  1586
              PG CDP+V  LL     LGYP   A++WKGND C +W  +TC     N+T +N      
Sbjct  328   IPGQCDPRVNTLLLIVSSLGYPQRFAENWKGNDPCADWIGVTC--SNGNITVLNFQKMGL  385

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +G ISP  + L SL+ + L DNNLTG IP  L TLP L +LDVSNN L   +P F   V 
Sbjct  386   TGMISPEIASLKSLQRVILADNNLTGTIPEELATLPALTILDVSNNKLYGKVPDFKVNVL  445

Query  1405  ISFGGNLLLEKTVATGRG-SPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYK---  1238
             ++  GN  + K  +T  G +P    T    S+ +               ++  + +    
Sbjct  446   VNKNGNPDIGKDKSTSSGAAPSQNSTNPSPSIGSGNNGSSGSHRKKSSTLIGVIVFSVIG  505

Query  1237  -------------CYMKREHKRFGRAKSP--------------EKIKST-----------  1172
                          C  + + K+  R +SP              E +K T           
Sbjct  506   GVFVIFLIALLLICIYRTKQKQLSRVQSPNAMVIHPRHSGSDNESMKITVAGSSVSVGAI  565

Query  1171  --------------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDN  1034
                           QM++   ++   I IQVL   TN FS+E++LG GG+G VY G+L +
Sbjct  566   SETHTLPSSEPSEIQMVEAGNMV---ISIQVLRNVTNNFSQENILGQGGFGTVYKGELHD  622

Query  1033  GTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHG  854
             GTK+AVK+M+ G    KG+ EF++EI+ L+KVRH++LVAL+GYC++ ++ LLVYEYM  G
Sbjct  623   GTKIAVKRMESGVIAGKGLTEFKSEISVLTKVRHRHLVALLGYCLDGNERLLVYEYMPQG  682

Query  853   TLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDI  674
              L  +LF W + G  PL W +R+TIA DVARG+EYLH L HQSFIHRD+K SNILL DD+
Sbjct  683   MLSRYLFNWPEEGLKPLEWTKRLTIALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDM  742

Query  673   RAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             RAKVADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  743   RAKVADFGLVRLAPEGKFSIETRIAGTFGYLAPEYAVTGRVTTK  786


 Score =   132 bits (331),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 88/147 (60%), Gaps = 2/147 (1%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
             S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVT
Sbjct  760  FSIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVT  819

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       +KAIDPT+D  E+T  S+S VAELA HC   + Y+RP+M H VNVL  
Sbjct  820  WFRRMFINKDTFRKAIDPTIDLSEETLASVSTVAELAGHCCAREPYQRPDMGHTVNVLSS  879

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP  181
                W+    ++  E   G DL MSLP
Sbjct  880  LVELWKP--SDQSSEDIYGIDLEMSLP  904



>ref|XP_008803916.1| PREDICTED: uncharacterized protein LOC103717354 [Phoenix dactylifera]
Length=1708

 Score =   508 bits (1309),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 327/726 (45%), Positives = 448/726 (62%), Gaps = 46/726 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             +D   M  +  +L+  P   S + DPC+W  V+C+   G+VV IN+ S+ +SG L   ++
Sbjct  26    NDGEAMQDIAKSLN-VPDWKSTNGDPCSWPGVSCEG--GSVVGINLKSKGVSGGLSGSIS  82

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+SL+SL +Q N + G LPS AN++SLE + +D N F+++P DF  GL  L+  ++ D 
Sbjct  83    KLSSLKSLQLQGNQIRGDLPSLANLASLESVDIDGNAFTAMPADFFSGLTRLQFVTL-DR  141

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
                 PW I   ++   +L  F AS A +TG IP+FF   P LQ L LSYN + G +P SF
Sbjct  142   NPFKPWSIPDDVSRCENLVRFSASKAGVTGNIPDFFGKMPKLQMLSLSYNTMKGEIPASF  201

Query  2098  GSSEIqnlwlnnqqq--gLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQL  1925
               S IQ+L LNNQ     L+G+IDVI+ MT+LS VWLQ+N FTGPIPDLSK  +L +   
Sbjct  202   KGSNIQSLVLNNQLDGFQLTGSIDVIAWMTQLSVVWLQSNGFTGPIPDLSKLASLSEFNA  261

Query  1924  GDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFC-KDTPGPCD  1748
              DN LTGVVP SLT    L+ + L NNKL GP+P F   VK  +   N FC       CD
Sbjct  262   RDNALTGVVPSSLTSATTLKLVTLSNNKLQGPVPKFAGGVKADVETGNKFCVGGATEQCD  321

Query  1747  PQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISP  1568
             P+VT LL  A G GYP  LA+SW+GND C++W  +TC   G+ +  +N  N+ + G+ISP
Sbjct  322   PRVTKLLEVAAGFGYPADLAESWEGNDPCKSWQGVTC--SGQEIVVLNFANRHYPGSISP  379

Query  1567  AFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGN  1388
             A +   SL+ L L++N+L+G IP SLT L  L ++DV+NNNL+  +P FP  V ++  GN
Sbjct  380   AIADFASLQKLLLSNNSLSGRIPDSLTKLQKLTLVDVANNNLTGKIPKFPQGVVLNVDGN  439

Query  1387  LLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRF  1208
               + K + +  G             SA++  +V+ V+ ++      +FY    +R+HK+F
Sbjct  440   PNIGKELGSSGGD------------SAKIAGIVIAVLFVIGCSAAALFYYINHRRKHKKF  487

Query  1207  GRAKS------PEKIKSTQML------------------KTNEIMGTAIKIQVLEKATNF  1100
             GR  S      PE +K   M                    T +  G  + IQ +  AT  
Sbjct  488   GRVSSQNLQDEPELVKIGMMGMNSKDGGWNGGHTQSSTGSTVDPQGMYMPIQAVRSATKD  547

Query  1099  FseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLV  920
             FSE++++G GG+G VY G+L N T +AVK+ + G    KG  EF+AEI  L KVRH++LV
Sbjct  548   FSEDNIIGRGGFGDVYKGQL-NATAIAVKRNRAGLMGKKGNEEFRAEIDVLQKVRHRHLV  606

Query  919   ALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHS  740
             AL+GYC +  + LL+YEYM  GTL  HLF+  + GF PLTWKQR+ IA DVARG+EYLHS
Sbjct  607   ALLGYCDDGDEKLLIYEYMPGGTLEQHLFDHSETGFSPLTWKQRLVIALDVARGVEYLHS  666

Query  739   LTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATT  560
             +  +SFIHRD+K SNILL++D RAKV+DFGLVK A D +  + TR+AGTFGYLAPEYA T
Sbjct  667   MAQESFIHRDLKPSNILLDNDKRAKVSDFGLVKLAVDRQKSMMTRLAGTFGYLAPEYAIT  726

Query  559   GRVTKK  542
             G+VT K
Sbjct  727   GKVTTK  732


 Score = 85.5 bits (210),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 79/150 (53%), Gaps = 8/150 (5%)
 Frame = -2

Query  991   HTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGF  812
             H K +  F+  I+  + + H+NLV L  +  +  + LL+Y+YM  G+L   L   +  G 
Sbjct  1431  HAKSL--FRETISAFAAMDHQNLVPLQAFYYSRDEKLLIYDYMPMGSLSSLLHGNRVSGR  1488

Query  811   DPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAP  632
              PL W+ R  IA   ARGIEY+HS+      H +IKSSNILL+    A V++ GL     
Sbjct  1489  TPLDWETRSGIALSAARGIEYIHSMG-PGVSHGNIKSSNILLSKSFEAHVSEHGLANLV-  1546

Query  631   DDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
                S   +R A   GY APE     +V++K
Sbjct  1547  -GPSSTPSRAA---GYRAPEVTDIRKVSQK  1572


 Score = 45.1 bits (105),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = -3

Query  549   QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLDPDE  370
              +K DVY+FGV+L+E++TGK      L ++   L  W H +  +     +  D  L    
Sbjct  1570  SQKGDVYSFGVLLLELLTGKAPAQAFLNEDGIDLPRWVHSVAPEEWT-SEVFDLELLRYH  1628

Query  369   QTFESISKVAELAAHCTTNKYYRRPNMEHVV  277
                E + ++ +LA  C      +RP+M  VV
Sbjct  1629  NVEEEMVQLLQLAIDCAAQYPEKRPSMADVV  1659


 Score =   100 bits (248),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   K+DVYAFGV+LME+ TG++ +D+T PDE  +LV  
Sbjct  707  SMMTRLAGTFGYLAPEYAITGKVTTKIDVYAFGVILMELTTGERVLDDTRPDEDTNLVHV  766

Query  438  FHK-IIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            F + I+ K + L+ + DPTLD DE+   S+ +VAELA +CT  +  +RP+M HVVN L  
Sbjct  767  FRRNILDKKNFLKSSPDPTLDLDEEDLISLWEVAELARYCTAREPSQRPDMSHVVNKLAS  826

Query  261  FAHNWR  244
                W+
Sbjct  827  LVEQWK  832


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 7/161 (4%)
 Frame = -2

Query  2581  WSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPS-ELTQLASLRSLSVQKNSLSGP  2405
             W+AS  PCTW  V C    G V  +++    + G +P+  L  L +L+S+S++ N+LSGP
Sbjct  1128  WNASASPCTWMGVMCGAGGGRVTELHLPGARLMGQIPAGTLGNLTALQSVSLRFNALSGP  1187

Query  2404  L-PSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTS  2228
             L P       L  +YL  N FS   P     L  L   +++ N       ISS     T 
Sbjct  1188  LPPDLGGCKELRGVYLHENRFSGGIPAGFFSLGKLAHLNLASNN--ISGGISSAFNSLTR  1245

Query  2227  LGSFFASNASITGVIPNFFDSFPNLQNLRLSYNN-LTGSLP  2108
             L + +  +  ++G IP+       L N  +S+N  L GS+P
Sbjct  1246  LRTLYLESNRLSGEIPDL--DLSKLVNFNVSFNRALNGSIP  1284



>ref|XP_009103048.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=891

 Score =   489 bits (1259),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 318/723 (44%), Positives = 437/723 (60%), Gaps = 38/723 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             D A M+ L  +L  P    W+   DPC W+ V CD+ +  +  I I ++ +SG L S+L 
Sbjct  27    DLATMNALRDSLKFPKDFSWTG-PDPCKWSGVQCDR-SNRITRIQIGNKGMSGTLTSDLN  84

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+SL    V  N L+G +PS A +++L+ +    N F+SI  D   GL +L+   + D+
Sbjct  85    TLSSLTVFEVMGNKLTGGIPSLAGLNALQTINAHDNSFTSISADIFTGLTSLQHVYL-DS  143

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
                SPW+I   L  +TSL  F A+N  ++G IP+F    +FP+LQ LRLS N+L+G LP 
Sbjct  144   NPFSPWEIPMSLKSATSLADFSAANCFLSGKIPDFLGGQTFPSLQKLRLSSNSLSGELPL  203

Query  2104  SFGSSEIqnlwlnnqq-qgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
             SF +S +Q L LN Q  Q L+G+I V+ +MT L++V LQ NAF+GP+PD+S  V+L    
Sbjct  204   SFANSPVQTLLLNGQTPQKLNGSISVLQNMTSLTEVSLQGNAFSGPLPDMSGLVSLTKFN  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNK-VKV-ILGDTNSFCKDTPG-  1757
             + +NQLTG+VP S T L +L  + + NN   G  P F  K V V I    NSFC D+PG 
Sbjct  264   VRENQLTGLVPSSFTELQSLAVVNMTNNLFQGSTPTFKAKNVAVDITPRLNSFCSDSPGV  323

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN---WAFITCDPQGKNVTTVNLGNQRF  1586
             PCDP+V  LLA     GYP+  AQSWKGND C +   W  ITC   G ++T +N      
Sbjct  324   PCDPRVNTLLAIVEAFGYPVRFAQSWKGNDPCSSKNVWVGITC--TGADITVINFKGMGL  381

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
              GTISP F+ LTSLR + L+ NNLTG IP  LT L  L  LDVSNN L   +P       
Sbjct  382   KGTISPRFADLTSLRVINLSQNNLTGVIPQELTKLTSLATLDVSNNQLYGKVPV------  435

Query  1405  ISFGGNLLLEK-TVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYM  1229
               FG N+L+       G+  PG     +GS+    +  V  +V+ ++++ ++  F     
Sbjct  436   --FGPNVLITTGNPDLGKDDPGHASGSSGSNAGKVVGYVFGVVLGLLLIGLIIFFVVKKR  493

Query  1228  KREHKRFGRAKSPE----KIKSTQMLKTNEIMGT----------AIKIQVLEKATNFFse  1091
             K+  K++ +  S E    KI    +       G+           + I+VL  AT+ F E
Sbjct  494   KQNRKKYQQQHSGEEDALKITIDNLCAGGSESGSNGLLVEPENPVMSIEVLRVATDNFDE  553

Query  1090  esvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALV  911
             +++LG GG+G+VY G+L +G  VAVK+M+      KG++EF++EIA L+KVRH+NLV + 
Sbjct  554   KNILGRGGFGIVYKGELPSGKTVAVKRMESSVISGKGLDEFKSEIAVLTKVRHRNLVKVE  613

Query  910   GYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTH  731
             GYC+  ++ LLVYEYM  GTL  HLF W++ G   L W +R+ IA DVA+G+EYLHS  H
Sbjct  614   GYCLESNERLLVYEYMPLGTLSSHLFNWQEEGLQLLEWSRRLIIASDVAKGVEYLHSQAH  673

Query  730   QSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRV  551
             QSFIHRD+K SNILL DD+RA+VADFGLV+ AP+    +ET++AGTFGYLAPEYA TGRV
Sbjct  674   QSFIHRDLKPSNILLGDDMRARVADFGLVRLAPEGTQSIETKIAGTFGYLAPEYAVTGRV  733

Query  550   TKK  542
             T K
Sbjct  734   TTK  736


 Score =   111 bits (278),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 80/131 (61%), Gaps = 3/131 (2%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D    +E  HLVTW
Sbjct  711  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDVKRSEEDVHLVTW  770

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAID ++D +E+T  SI+KVAELA HC+  + ++RP+M HVV VL   
Sbjct  771  FRRMFINKDSFPKAIDASIDINEETLPSINKVAELACHCSAREPHQRPDMSHVVRVLASL  830

Query  258  AHNWRSLRPEE  226
               W   +P+E
Sbjct  831  LDQW---KPDE  838



>ref|XP_010527815.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=963

 Score =   490 bits (1262),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 329/768 (43%), Positives = 426/768 (55%), Gaps = 75/768 (10%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DA+ M  L ++L+  +   WS   +PC W +V CD  +  V  I + S+ I G LP +L 
Sbjct  29    DASSMQALKSSLNLTSYVDWS-DPNPCRWLSVQCDS-SNRVTRIQLKSKGIRGTLPPDLK  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L SL  L    N L GP+P  + +S L+ L L  N+F+S+P +   G+  L+   + DN
Sbjct  87    NLTSLTVLEFFANQLWGPVPDLSGLSQLQRLNLRDNQFTSVPNNLFAGMTMLQEVYL-DN  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSLPG  2105
               LS   I   + ++TSL  F   N +I G IP FF   + PNL  LRLSYN L   LP 
Sbjct  146   NPLSSSVIPDSIKDATSLRVFSFINCNIYGKIPEFFGGQTLPNLVKLRLSYNKLESELPM  205

Query  2104  SFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S IQ+L          L+G+I ++ +MT L++VWL  N F+G IPDLS    L D 
Sbjct  206   SFAGSSIQSLWLNGQQSTGKLNGSISILQNMTALNEVWLHGNQFSGSIPDLSGLQTLRDF  265

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILG-DTNSFCKDTPG-  1757
              + DNQLTG+VP SL  LP L  + L NN L G  P+F   V+V +    NSFC D P  
Sbjct  266   SVRDNQLTGIVPQSLVELPMLRTVNLTNNMLQGRAPMFAKGVQVDMAPRMNSFCSDDPSV  325

Query  1756  PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN---WAFITCDPQGKNVTTVNLGNQRF  1586
              CDPQV  LL+     GYP   A SWKGN+ C     W  I+C   G NVTT+   ++  
Sbjct  326   ACDPQVDILLSIVEAFGYPARFASSWKGNNPCDTNNLWDGISC--MGSNVTTIVFKSRGL  383

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             SGTISP F++LTSL  + L DN LTG IP  L  L  L  LDVSNN+LS  +P F   V 
Sbjct  384   SGTISPNFAKLTSLVTINLADNALTGSIPTELAALSKLIKLDVSNNHLSGKVPKFRDGVV  443

Query  1405  ISFGGNLLLEKTVATG---RGSP----------------------GSGQTENGSSMSARM  1301
                 GN  L K +A G    G+P                      GSG     SS  +  
Sbjct  444   FLSEGNTNLGKDLAPGLPPSGTPSSSKGSGNGGRDGSGNGGREGSGSGNAGEDSSEKSTS  503

Query  1300  fvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKI--------------------  1181
               ++  VV  V  + L     C    + KR  R +SP  +                    
Sbjct  504   VKIIGSVVGAVGALGLVGLGVCIYATKRKRPARVQSPTHMVIHPPYSGDQPAVKLTVAAS  563

Query  1180  ---------------KSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylG  1046
                                 ++  E     I IQVL   TN FS+E++LG GG+G VY+G
Sbjct  564   SVNDWGSESCYSHMSNGASDVRVVEAGNMVISIQVLRDVTNNFSDENILGQGGFGTVYMG  623

Query  1045  KLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEY  866
             +L +GTK+AVK+M+      KG+ EF++EIA L+KVRH++LV L+GYC++ ++ LLVYEY
Sbjct  624   ELHDGTKIAVKRMESSVVSDKGLGEFKSEIAVLTKVRHRHLVGLLGYCLDGNERLLVYEY  683

Query  865   MSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILL  686
             M  GTL  HLF WK+ G  PL W +R++IA DVARG+EYLH+L HQSFIHRD+K SNILL
Sbjct  684   MPQGTLSQHLFHWKEEGLKPLEWTRRLSIALDVARGVEYLHTLAHQSFIHRDLKPSNILL  743

Query  685   NDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
              DD+RAKV+DFGLV+ APD K  +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   GDDMRAKVSDFGLVRLAPDGKHSIETRLAGTFGYLAPEYAVTGRVTTK  791


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVD+++FGV+LME+ITG++A+DET P+++ HLVTW
Sbjct  766  SIETRLAGTFGYLAPEYAVTGRVTTKVDIFSFGVILMELITGRRALDETQPEDSMHLVTW  825

Query  438  FHKI--IRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLG  265
            F +I   +     + A+D T+  D+ T  S+ KV+ELA HC   + Y+RP+M H+VNVL 
Sbjct  826  FRRIHHGKDQDAFKNAVDITIHLDDDTLSSVGKVSELAGHCCAREPYQRPDMGHIVNVLS  885

Query  264  PFAHNWRSLRPEEIVEKFGGFDLNMSLPLV  175
                 W+   P+   +  GG D +M LP V
Sbjct  886  SLVEQWKPSEPDP--DDLGGIDYDMPLPQV  913



>ref|XP_006651752.1| PREDICTED: probable receptor protein kinase TMK1-like [Oryza 
brachyantha]
Length=902

 Score =   488 bits (1256),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 315/709 (44%), Positives = 429/709 (61%), Gaps = 64/709 (9%)
 Frame = -2

Query  2488  ISGNLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLP  2309
             ++G L  E+  L +L  L +  NS+SG +PS A +SSL+ L    N F+ + P F  GL 
Sbjct  32    LTGKLAPEVRNLTALARLELFDNSVSGEMPSLAGLSSLQYLLGHHNGFTGLAPGFFKGLT  91

Query  2308  NLRIFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS-FPNLQNLRLSY  2132
              L   S+ DN    PW + + LAE TSL +F A+ A++TG IP+FF +  P+LQ L L++
Sbjct  92    ELTAVSL-DNNPFHPWPLPADLAECTSLTNFSANTANVTGAIPDFFGTALPSLQRLSLAF  150

Query  2131  NNLTGSLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDL  1958
             N ++G +P S   + +Q+L           +G+I  +S+MT L Q+WL +N F+GP+PD 
Sbjct  151   NMMSGPVPPSLAGAPLQSLWLNNQLGGNQFNGSISFVSNMTSLQQLWLHSNDFSGPLPDF  210

Query  1957  SKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV-ILGDTN  1781
             +   +L DLQL DNQLTG VP SL  L +L  + L NN L GPMP F + VK  +L +T 
Sbjct  211   AGLTSLSDLQLRDNQLTGPVPDSLLNLKSLTKVSLTNNLLQGPMPKFASTVKADVLPETE  270

Query  1780  SFCKDTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVN  1604
              FC  TPG PCDP+V+ LL  A G  YP  LA +WKGND C  +  + CD    N+T +N
Sbjct  271   RFCLTTPGAPCDPRVSLLLEVAAGFQYPAKLADNWKGNDPCDGYIGVGCD--AGNITVLN  328

Query  1603  LGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplps  1424
                   SG+ISPA  ++T+L+ L L++NN+TG +P  +  LP L  +D+SNNN+   LP+
Sbjct  329   FARMGLSGSISPAVGKITTLQKLILSNNNITGTVPKEVAALPALTEVDMSNNNIYGKLPT  388

Query  1423  fpPA-VNISFGGNLLLEKTV---------------ATGRGSPGSGQTENGSSMSARMfvv  1292
             F    V +   GN  + K                 A G G+  +    + SS SAR+   
Sbjct  389   FAAKNVRVKTDGNPNIGKDAPAPSGSGGSSSNNGPADG-GNGSAESNGSSSSSSARIIAG  447

Query  1291  vvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKI-------KSTQMLK---------  1160
              V+  +  V ++  + + CY KR+ K FGR +SP  +        S  +LK         
Sbjct  448   SVVGAIAGVGLLAALGFYCY-KRKQKPFGRVQSPHAMVVHPRHSGSDDVLKITVAGGNVN  506

Query  1159  ----TNEIMGTA----------------IKIQVLEKATNFFseesvlgsggygvvylGKL  1040
                 T+E    A                I IQVL   TN FS+E+VLG GG+G VY G+L
Sbjct  507   GGAATSETYSQASSGPRDIHVVETGNMVISIQVLRNVTNNFSDENVLGRGGFGTVYKGEL  566

Query  1039  DNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMS  860
              +GTK+AVK+M+ G    KG+NEF++EIA L+KVRH+NLV+L+GYC++ ++ +LVYEYM 
Sbjct  567   HDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKVRHRNLVSLLGYCLDGNERILVYEYMP  626

Query  859   HGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLND  680
              GTL  HLFEWK+H   PL WK+R++IA DVARG+EYLHSL  Q+FIHRD+K SNILL D
Sbjct  627   QGTLSQHLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQTFIHRDLKPSNILLGD  686

Query  679   DIRAKVADFGLVKKAPDDKSF--VETRVAGTFGYLAPEYATTGRVTKKS  539
             D++AKVADFGLV+ AP D     VETR+AGTFGYLAPEYA TGRVT K+
Sbjct  687   DMKAKVADFGLVRLAPADGKCVSVETRLAGTFGYLAPEYAVTGRVTTKA  735


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
            +S+   L G    L       G    K DV++FGV+LME+ITG+KA+DET P+++ HLVT
Sbjct  708  VSVETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVT  767

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       QKAIDPT+D  E+T  S+S VAELA HC   + ++RP+M H VNVL  
Sbjct  768  WFRRMQLSKDTFQKAIDPTIDLTEETLASVSTVAELAGHCCAREPHQRPDMGHAVNVLST  827

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSLP------LVFDDSS  160
             +  W+   P+   +   G DL+M+LP        F+DSS
Sbjct  828  LSDVWKPSDPDS--DDSYGIDLDMTLPQALKKWQAFEDSS  865



>gb|KHN16510.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=897

 Score =   486 bits (1251),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 319/726 (44%), Positives = 426/726 (59%), Gaps = 38/726 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             C DA VM  L   ++   S    + D C W +V CD  +  V +I I SQ++ G+LP EL
Sbjct  30    CQDAEVMGILKIMINAPISFQWTNPDVCKWRHVTCDS-SKRVTAIQIGSQNLQGSLPKEL  88

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              +L SL     Q NSL+GP P  +   SL++L +  N+FS IP DF  G+ +L+   I D
Sbjct  89    VKLTSLERFECQFNSLTGPFPYLS--KSLQKLVIHDNKFSFIPNDFFKGMSHLQEVRIDD  146

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTGSL  2111
             N   S W I   L +  +L +F A +  + G IPNFF     FP L  L LS N L G+L
Sbjct  147   N-PFSQWHIHDTLRDCVALHTFSAQSVGLVGTIPNFFGKDGPFPGLVLLALSDNFLEGAL  205

Query  2110  PGSFGSSEIqnlwl--nnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P S   S I+NL +   N    L+GT+ V+ +M  L Q+W   N+FTGPIPDLS    L 
Sbjct  206   PTSLSDSSIENLLVNGQNSLSKLNGTLVVLQNMKSLRQIWANGNSFTGPIPDLSHHDQLS  265

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCKD  1766
             D+ L DNQLTGVVP SL  LP+L+ + L NN L G  P+F   V V   +    N +C D
Sbjct  266   DVNLRDNQLTGVVPPSLISLPSLKFVNLTNNFLQGSSPIFKYGVGVDNSMDKGKNQYCTD  325

Query  1765  TPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQ  1592
              PG PC P V +LL+    +GYP+  AQ+W+GND C N W  I C   G N++ +N  N 
Sbjct  326   VPGQPCSPLVNSLLSIVEPMGYPLKFAQNWQGNDPCANKWTGIIC--SGGNISVINFQNM  383

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               SGTI P F++ TS+  L L +N   G IP  LT+LP LQ LDVSNN+L   +P F   
Sbjct  384   GLSGTICPCFAKFTSVTKLLLANNGFIGTIPNELTSLPLLQELDVSNNHLYGKVPLFRKD  443

Query  1411  VNISFGGNLLLEKTVATGRGSPGSGQ-TENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
             V +   GN         G+  P S     NGS+ +  + + +V+VVVI+++  + +  K 
Sbjct  444   VVLKLAGN------PDIGKDKPTSSSFINNGSNHNTTIIIGIVVVVVIILISGVLILVKF  497

Query  1234  YMKREH--------------KRFGRAKSPEKIKSTQMLKTNEIMGTAIKIQVLEKATNFF  1097
               K EH              +R+G   +   +     +   E     I +QVL   TN F
Sbjct  498   KRKLEHVRKTQNPPVIMVPSRRYGDGTTSALLSPMGSVYQVEDHNMLISVQVLRNVTNNF  557

Query  1096  seesvlgsggygvvylGKLDNGTKVAVKKMKD-GATHTKGMNEFQAEIAFLSKVRHKNLV  920
             SE+++LG GG+G VY G+L +GTK+AVK+M+  G    KG++EF AEIA L+KVRH NLV
Sbjct  558   SEKNILGKGGFGTVYKGELHDGTKIAVKRMQSAGLVDEKGLSEFTAEIAVLTKVRHINLV  617

Query  919   ALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHS  740
             +L+G+C++  + LLVYE+M  G L  HL  WK  G  PL WK R+ IA DVARG+EYLH 
Sbjct  618   SLLGFCLDGSERLLVYEHMPQGALSKHLINWKSEGLKPLEWKTRLGIALDVARGVEYLHG  677

Query  739   LTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATT  560
             L  Q FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+  +T++AGTFGY+APEYA T
Sbjct  678   LAQQIFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKTSFQTKLAGTFGYMAPEYAAT  737

Query  559   GRVTKK  542
             GR+T K
Sbjct  738   GRLTTK  743


 Score =   133 bits (335),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S + +L G    +       G    KVDVY+FGV+LME+ITG+KA+D+  P+E  HLVTW
Sbjct  718  SFQTKLAGTFGYMAPEYAATGRLTTKVDVYSFGVILMEMITGRKALDDNQPEENVHLVTW  777

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F K++   ++ Q  IDPT++ D +T  +I+ VAELA HC   + Y+RP+M HVVNVL P 
Sbjct  778  FRKMLLNKNSFQTTIDPTIEVDAETLVNINIVAELAGHCCAREPYQRPDMSHVVNVLSPL  837

Query  258  AHNWRSLRPEEI-VEKFGGFDLNMSLP  181
               W   +P E  V+   G D NM+LP
Sbjct  838  VEVW---KPSETNVDDIYGIDYNMTLP  861



>ref|XP_003532526.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=897

 Score =   485 bits (1249),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 317/726 (44%), Positives = 426/726 (59%), Gaps = 38/726 (5%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             C DA VM  L   ++   S    + D C W +V CD  +  V +I I SQ++ G+LP EL
Sbjct  30    CQDAEVMGILKIMINAPISFQWTNPDVCKWRHVTCDS-SKRVTAIQIGSQNLQGSLPKEL  88

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              +L SL     Q NSL+GP P  +   SL++L +  N+FS IP DF  G+ +L+   I D
Sbjct  89    VKLTSLERFECQFNSLTGPFPYLS--KSLQKLVIHDNKFSFIPNDFFKGMSHLQEVRIDD  146

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTGSL  2111
             N   S W I   L +  +L +F A +  + G IPNFF     FP L  L LS N L G+L
Sbjct  147   N-PFSQWHIHDTLRDCVALHTFSAQSVGLVGTIPNFFGKDGPFPGLVLLALSDNFLEGAL  205

Query  2110  PGSFGSSEIqnlwl--nnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P S   S I+NL +   N    L+GT+ V+ +M  L Q+W   N+FTGPIPDLS    L 
Sbjct  206   PTSLSDSSIENLLVNGQNSLSKLNGTLVVLQNMKSLRQIWANGNSFTGPIPDLSHHDQLS  265

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCKD  1766
             D+ L DNQLTGVVP SL  LP+L+ + L NN L G  P+F   V V   +    N +C D
Sbjct  266   DVNLRDNQLTGVVPPSLISLPSLKFVNLTNNFLQGSSPIFKYGVGVDNSMDKGKNQYCTD  325

Query  1765  TPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQ  1592
              PG PC P V +LL+    +GYP+  AQ+W+G+D C N W  I C   G N++ +N  N 
Sbjct  326   VPGQPCSPLVNSLLSIVEPMGYPLKFAQNWQGDDPCANKWTGIIC--SGGNISVINFQNM  383

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               SGTI P F++ TS+  L L +N   G IP  LT+LP LQ LDVSNN+L   +P F   
Sbjct  384   GLSGTICPCFAKFTSVTKLLLANNGFIGTIPNELTSLPLLQELDVSNNHLYGKVPLFRKD  443

Query  1411  VNISFGGNLLLEKTVATGRGSPGSGQ-TENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
             V +   GN         G+  P S    +NGS+ +  + + +V+V VI+++  + +  K 
Sbjct  444   VVLKLAGN------PDIGKDKPTSSSFIDNGSNHNTAIIIGIVVVAVIILISGVLILVKF  497

Query  1234  YMKREH--------------KRFGRAKSPEKIKSTQMLKTNEIMGTAIKIQVLEKATNFF  1097
               K EH              +R+G   +   +     +   E     I +QVL   TN F
Sbjct  498   KRKWEHERKTQNPPVIMVPSRRYGDGTTSALLSPMGSVYQVEDHNMLISVQVLRNVTNNF  557

Query  1096  seesvlgsggygvvylGKLDNGTKVAVKKMKD-GATHTKGMNEFQAEIAFLSKVRHKNLV  920
             SE+++LG GG+G VY G+L +GTK+AVK+M+  G    KG++EF AEIA L+KVRH NLV
Sbjct  558   SEKNILGKGGFGTVYKGELHDGTKIAVKRMQSAGLVDEKGLSEFTAEIAVLTKVRHINLV  617

Query  919   ALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHS  740
             +L+G+C++  + LLVYE+M  G L  HL  WK  G  PL WK R+ IA DVARG+EYLH 
Sbjct  618   SLLGFCLDGSERLLVYEHMPQGALSKHLINWKSEGLKPLEWKTRLGIALDVARGVEYLHG  677

Query  739   LTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATT  560
             L  Q FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K+  +T++AGTFGY+APEYA T
Sbjct  678   LAQQIFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKTSFQTKLAGTFGYMAPEYAAT  737

Query  559   GRVTKK  542
             GR+T K
Sbjct  738   GRLTTK  743


 Score =   131 bits (330),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S + +L G    +       G    KVDVY+FGV+LME+ITG+KA+D+  P+E  HLVTW
Sbjct  718  SFQTKLAGTFGYMAPEYAATGRLTTKVDVYSFGVILMEMITGRKALDDNQPEENVHLVTW  777

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F K++   ++ Q  IDPT++ D +T  +I+ VAELA HC   + Y+RP+M HVVNVL P 
Sbjct  778  FRKMLLNKNSFQTTIDPTIEVDAETLVNINIVAELAGHCCAREPYQRPDMSHVVNVLSPL  837

Query  258  AHNWRSLRPEEI-VEKFGGFDLNMSLP  181
               W   +P E  V+   G D +M+LP
Sbjct  838  VEVW---KPSETNVDDIYGIDYDMTLP  861



>ref|XP_002299778.2| hypothetical protein POPTR_0001s22540g [Populus trichocarpa]
 gb|EEE84583.2| hypothetical protein POPTR_0001s22540g [Populus trichocarpa]
Length=936

 Score =   482 bits (1241),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 318/736 (43%), Positives = 446/736 (61%), Gaps = 62/736 (8%)
 Frame = -2

Query  2581  WSAS-KDPC---TWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSL  2414
             W A+  DPC    W +V C    G V  I + S  + G LP    QL+ L ++ +Q+N+ 
Sbjct  46    WPANGDDPCGPPLWPHVFCSD--GRVTQIQVQSMGLKGPLPQNFNQLSKLYNIGLQRNNF  103

Query  2413  SGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN--GELSPWQISSYLA  2240
             +G LP+F  +S LE  +LD N F +IP DF +GL ++R+ ++  N   E + W + S LA
Sbjct  104   TGKLPTFKGLSELEFAFLDYNNFDTIPSDFFVGLSSIRVLALDSNPLNESTGWSLPSELA  163

Query  2239  ESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnlwlnnq  2060
             +S  L +   S++++ G +P+F  S  +L NLRLSYN L+G +P SFG S +  L LNNQ
Sbjct  164   DSVQLTNLSVSSSNLAGSLPDFLGSMQSLSNLRLSYNRLSGEIPASFGKSLMSTLLLNNQ  223

Query  2059  qqg-LSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF-DLQLGDNQLTGVVPVSL  1886
             + G +SG IDVI+SMT LSQ+WL  N+FTG IP+    ++L  DL L  N+L G+VP SL
Sbjct  224   EGGGMSGPIDVIASMTSLSQLWLHGNSFTGTIPENIGGLSLLRDLNLNGNKLVGLVPQSL  283

Query  1885  TGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALLAFAGGL  1709
               +P L+N+ L NN+L+GP+P F  K   +  ++N FC+  PG  C P+V ALL F GG+
Sbjct  284   ADMP-LDNLDLNNNQLMGPVPKF--KAGKVSYESNPFCQSKPGVECAPEVNALLDFLGGV  340

Query  1708  GYPITLAQSWKGNDACQ-NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLY  1532
              YP  L   W GND CQ +W  + CD   K V+ +NL     +GT+SP+ ++L SL  + 
Sbjct  341   NYPSILTSQWSGNDPCQGSWLGLNCDSNSK-VSVINLLRHNLTGTLSPSIARLDSLIEID  399

Query  1531  LNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRG  1352
             L  N++ G IP + T L  L++LDVS NNL PPLP F  +V +   GN LL++    G  
Sbjct  400   LGGNSIKGTIPSNFTNLNSLRLLDVSGNNLGPPLPKFRTSVKLVVDGNPLLDENPPRGSA  459

Query  1351  ---------SPGSGQTENGSSMSARMfvv--vvivvvivvlvvlfvFYKCYMKRE-----  1220
                      SP S  + + ++   ++ +V  +    ++ ++++    Y C+ KR+     
Sbjct  460   PPSPSTMPFSPPSPTSISNTNQRTKLVIVGGIFAGSLLAIVLIALSLYCCFKKRKETSNP  519

Query  1219  ------HKR--------FGRAKSPEKIKS------------TQMLKTN----EIMGTAIK  1130
                   H R           A S   I+S            T  L  N    E     I 
Sbjct  520   PSSIVVHPRDPSDRENIVKIAFSNNTIRSLSTQTGISSVSNTSNLTENSSLVESGNVVIS  579

Query  1129  IQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAF  950
             +QVL K T+ F++++ LGSGG+G+VY G+L++GTK+AVK+M+ G   +K  +EFQAEIA 
Sbjct  580   VQVLRKVTDNFAQKNQLGSGGFGIVYKGELEDGTKIAVKRMEAGVMGSKAGDEFQAEIAV  639

Query  949   LSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWD  770
             LSKVRH++LV+L+GY I  ++ LLVYEYM  G L  HLF WKK   +PL+W +R++IA D
Sbjct  640   LSKVRHRHLVSLLGYSIEGNERLLVYEYMPQGALSMHLFHWKKLNLEPLSWMRRLSIALD  699

Query  769   VARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTF  590
             VARG+EYLHSL  Q+FIHRD+KSSNILL DD  AKV+DFGLVK APD +  V TR+AGTF
Sbjct  700   VARGVEYLHSLARQTFIHRDLKSSNILLGDDFHAKVSDFGLVKLAPDREQSVATRLAGTF  759

Query  589   GYLAPEYATTGRVTKK  542
             GYLAPEYA  G++T K
Sbjct  760   GYLAPEYAVMGKITTK  775


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 93/164 (57%), Gaps = 5/164 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   KVDV+++GVVLME++TG  A+DE  P+E+ +L  W
Sbjct  750  SVATRLAGTFGYLAPEYAVMGKITTKVDVFSYGVVLMELLTGLTALDEERPEESRYLAEW  809

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I      L  AIDP L+ +++TFESIS +AELA HCT+     RP+M H VNVL P 
Sbjct  810  FWRIKSSKEKLMAAIDPALNVNDETFESISSIAELAGHCTSRDPNHRPDMGHAVNVLVPL  869

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP---LVFDDSSIESLSFTN  136
               W+ +  E   E F G D +  LP    V+ D+    LS+T+
Sbjct  870  VEKWKPVNDES--EDFYGIDYSQPLPEMLKVWQDADSTGLSYTS  911



>emb|CBI39471.3| unnamed protein product [Vitis vinifera]
Length=883

 Score =   479 bits (1234),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 264/421 (63%), Positives = 322/421 (76%), Gaps = 2/421 (0%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              D+AA M+KL AALSP PSGWS +   C W+ V CD   G V+SIN+ S+S+SG LPS++
Sbjct  27    ADEAAFMTKLAAALSPTPSGWSGTNH-CKWSGVKCDA-IGQVISINLASRSLSGMLPSDI  84

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              QL  L++LS+QKN LSGPLPS +N++SL+ ++LD+N FSS+PP+FLLGL +L+ FSIS+
Sbjct  85    NQLPQLQALSLQKNQLSGPLPSLSNLTSLQSVFLDNNNFSSVPPEFLLGLNSLQTFSISE  144

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW+I  +L+ESTSL S  ASNA+I G IP  F SFPNLQ++RLSYNNLTG LP S
Sbjct  145   NPSLQPWRIPEHLSESTSLASLLASNANIFGTIPEIFGSFPNLQSVRLSYNNLTGPLPPS  204

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             FG S IQNLWLNNQ+ GLSG +DV+ +M +LSQ WL ANAF+GPIPDLS    +FDLQL 
Sbjct  205   FGGSGIQNLWLNNQKVGLSGRLDVLGAMVQLSQAWLHANAFSGPIPDLSNSSAIFDLQLR  264

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQLTGV+  SL   P L NI LQNNKL GP P F   V+V LG TN+FC   PGPCDPQ
Sbjct  265   DNQLTGVLLPSLFSHPRLVNISLQNNKLQGPYPNFSKTVEVTLGSTNNFCNPQPGPCDPQ  324

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             VTALL  A  LGYP+ LAQSW+GNDAC+ W+FI+CD QGKNVT VN G Q +SG+ISPAF
Sbjct  325   VTALLEVAKALGYPMILAQSWEGNDACKGWSFISCDAQGKNVTIVNFGKQEWSGSISPAF  384

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSLRNL LNDN+L+G +P SLT+L  L++LD+SNNNLS  LP FP  V++   GN L
Sbjct  385   ANLTSLRNLLLNDNDLSGTLPASLTSLKELRILDISNNNLSGSLPHFPSTVSVKAQGNNL  444

Query  1381  L  1379
             L
Sbjct  445   L  445


 Score =   235 bits (600),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  985  KGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDP  806
            +G++EFQAEI  L+KVRH++LVAL+G+CIN ++ LLVYEYM  GTLG HLFE+ + GF P
Sbjct  576  QGLSEFQAEIGVLTKVRHRHLVALLGFCINGNERLLVYEYMPQGTLGQHLFEYNETGFSP  635

Query  805  LTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDD  626
            LTWKQR+TIA DVA+G+EYLHSL  QSFIHRD+K SNILL  D+RAKV+DFGLVK APD 
Sbjct  636  LTWKQRITIALDVAKGMEYLHSLAQQSFIHRDLKPSNILLGTDMRAKVSDFGLVKNAPDG  695

Query  625  KSFVETRVAGTFGYLAPEYATTGRVTKK  542
            K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  696  KYSVETRLAGTFGYLAPEYAATGRVTIK  723


 Score =   141 bits (355),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV+AFGVVLME+ITG+K++DE LP+E  HLV+W
Sbjct  698  SVETRLAGTFGYLAPEYAATGRVTIKVDVFAFGVVLMEMITGRKSLDEALPEEKSHLVSW  757

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N++ A+DP+L PDE+TF SI +VAELA HCT  + ++RP+M H VNVL   
Sbjct  758  FRRVLPNPDNIRDALDPSLHPDEETFRSICEVAELAGHCTAREPHQRPDMSHAVNVLSHL  817

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  + FG  D N+SLP
Sbjct  818  LDEWKPSADDEENDNFGIDDFNLSLP  843



>ref|XP_002268601.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=926

 Score =   481 bits (1237),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 264/421 (63%), Positives = 322/421 (76%), Gaps = 2/421 (0%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSEL  2462
              D+AA M+KL AALSP PSGWS +   C W+ V CD   G V+SIN+ S+S+SG LPS++
Sbjct  27    ADEAAFMTKLAAALSPTPSGWSGTNH-CKWSGVKCDA-IGQVISINLASRSLSGMLPSDI  84

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
              QL  L++LS+QKN LSGPLPS +N++SL+ ++LD+N FSS+PP+FLLGL +L+ FSIS+
Sbjct  85    NQLPQLQALSLQKNQLSGPLPSLSNLTSLQSVFLDNNNFSSVPPEFLLGLNSLQTFSISE  144

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGS  2102
             N  L PW+I  +L+ESTSL S  ASNA+I G IP  F SFPNLQ++RLSYNNLTG LP S
Sbjct  145   NPSLQPWRIPEHLSESTSLASLLASNANIFGTIPEIFGSFPNLQSVRLSYNNLTGPLPPS  204

Query  2101  FGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
             FG S IQNLWLNNQ+ GLSG +DV+ +M +LSQ WL ANAF+GPIPDLS    +FDLQL 
Sbjct  205   FGGSGIQNLWLNNQKVGLSGRLDVLGAMVQLSQAWLHANAFSGPIPDLSNSSAIFDLQLR  264

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQLTGV+  SL   P L NI LQNNKL GP P F   V+V LG TN+FC   PGPCDPQ
Sbjct  265   DNQLTGVLLPSLFSHPRLVNISLQNNKLQGPYPNFSKTVEVTLGSTNNFCNPQPGPCDPQ  324

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             VTALL  A  LGYP+ LAQSW+GNDAC+ W+FI+CD QGKNVT VN G Q +SG+ISPAF
Sbjct  325   VTALLEVAKALGYPMILAQSWEGNDACKGWSFISCDAQGKNVTIVNFGKQEWSGSISPAF  384

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LTSLRNL LNDN+L+G +P SLT+L  L++LD+SNNNLS  LP FP  V++   GN L
Sbjct  385   ANLTSLRNLLLNDNDLSGTLPASLTSLKELRILDISNNNLSGSLPHFPSTVSVKAQGNNL  444

Query  1381  L  1379
             L
Sbjct  445   L  445


 Score =   141 bits (355),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDV+AFGVVLME+ITG+K++DE LP+E  HLV+W
Sbjct  741  SVETRLAGTFGYLAPEYAATGRVTIKVDVFAFGVVLMEMITGRKSLDEALPEEKSHLVSW  800

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N++ A+DP+L PDE+TF SI +VAELA HCT  + ++RP+M H VNVL   
Sbjct  801  FRRVLPNPDNIRDALDPSLHPDEETFRSICEVAELAGHCTAREPHQRPDMSHAVNVLSHL  860

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  + FG  D N+SLP
Sbjct  861  LDEWKPSADDEENDNFGIDDFNLSLP  886



>emb|CAH68356.1| H0723C07.6 [Oryza sativa Indica Group]
 gb|EAY96121.1| hypothetical protein OsI_17999 [Oryza sativa Indica Group]
Length=939

 Score =   481 bits (1237),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 317/762 (42%), Positives = 447/762 (59%), Gaps = 70/762 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS--GWSA--SKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             D +V+  L  +L+ A +  GW    + DPC  W +++CD+  G V +I++ +  +SG LP
Sbjct  22    DLSVLHDLRRSLTNADAVLGWGDPNAADPCAAWPHISCDR-AGRVNNIDLKNAGLSGTLP  80

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
             S    L +L+ LS+Q N+LSG LPSF  M+SL   +L++N F SIP DF  GL +L + S
Sbjct  81    STFAALDALQDLSLQNNNLSGDLPSFRGMASLRHAFLNNNSFRSIPADFFSGLTSLLVIS  140

Query  2290  ISDNG---ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             +  N        W I + +A +  L S   +  ++TG IP+F  +  +LQ L+L+YN L+
Sbjct  141   LDQNPLNVSSGGWTIPADVAAAQQLQSLSLNGCNLTGAIPDFLGAMNSLQELKLAYNALS  200

Query  2119  GSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPD-LSKC  1949
             G +P +F +S +Q   L   +    LSGT+D+I++M  L Q WL  N F+GPIPD ++ C
Sbjct  201   GPIPSTFNASGLQTLWLNNQHGVPKLSGTLDLIATMPNLEQAWLHGNDFSGPIPDSIADC  260

Query  1948  VNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK  1769
               L DL L  NQL G+VP +L  +  L++++L NN LLGP+P    K        N FC 
Sbjct  261   KRLSDLCLNSNQLVGLVPPALESMAGLKSVQLDNNNLLGPVPAI--KAPKYTYSQNGFCA  318

Query  1768  DTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQ  1592
             D PG  C PQV ALL F   + YP  L  SW GN++C +W  I+C     NVT +NL   
Sbjct  319   DKPGVACSPQVMALLHFLAEVDYPKRLVASWSGNNSCVDWLGISC--VAGNVTMLNLPEY  376

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               +GTIS +   L+ L ++ L  NNLTG +P SLT+L  LQ LD+S N+L+ PLP+F P+
Sbjct  377   GLNGTISDSLGNLSELSDINLIGNNLTGHVPDSLTSLRLLQKLDLSGNDLTGPLPTFSPS  436

Query  1411  VNISFGGNLLLEKTV---ATGRGSPGSGQT------------ENGSSMSARMfvvvvivv  1277
             V ++  GNL    T    A  + +PGS  +            EN    SA +    + V 
Sbjct  437   VKVNVTGNLNFNGTAPGSAPSKDTPGSSSSRAPTLPGQGVLPENKKKRSAVVLATTIPVA  496

Query  1276  vivvlvvlfvFYKCYMKRE------------HKRFGRAKSPEKIKSTQML---------K  1160
             V VV +        + K+             H R      P+ +    M+         +
Sbjct  497   VSVVALASVCAVLIFRKKRGSVPPNAASVVVHPR--ENSDPDNLVKIVMVDNDGNSSSTQ  554

Query  1159  TNEIMGTA---------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
              N + G++               I +QVL  AT  F++++VLG GG+GVVY G+L +GT 
Sbjct  555   GNTLSGSSSRASDVHMIDTGNFVIAVQVLRGATKNFTQDNVLGRGGFGVVYKGELHDGTM  614

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+      K ++EFQAEIA L+KVRH+NLV+++GY I  ++ LLVYEYMS+G L 
Sbjct  615   IAVKRMEAAVISNKALDEFQAEIAILTKVRHRNLVSILGYSIEGNERLLVYEYMSNGALS  674

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLF+WK+   +PL+WK+R+ IA DVARG+EYLH+L HQ +IHRD+KS+NILL DD RAK
Sbjct  675   KHLFQWKQFELEPLSWKKRLNIALDVARGMEYLHNLAHQCYIHRDLKSANILLGDDFRAK  734

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             V+DFGLVK APD    V TR+AGTFGYLAPEYA TG++T K+
Sbjct  735   VSDFGLVKHAPDGNFSVATRLAGTFGYLAPEYAVTGKITTKA  776


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDET-LPDETCHL  448
            N S+   L G    L       G+   K DV++FGVVLME+ITG  A+DE+ L +ET +L
Sbjct  748  NFSVATRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELITGMTAIDESRLEEETRYL  807

Query  447  VTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVL  268
             +WF +I +    L+ AIDPTLD  ++TFESIS +AELA HCT+ +  +RP+M H VNVL
Sbjct  808  ASWFCQIRKDEDRLRAAIDPTLDQSDETFESISVIAELAGHCTSREPTQRPDMGHAVNVL  867

Query  267  GPFAHNWRSLRPEEIVEKFGGFDLNMSL  184
             P    W+ +  E   E + G DL+  L
Sbjct  868  VPMVEKWKPVNDE--TEDYMGIDLHQPL  893



>gb|KCW52194.1| hypothetical protein EUGRSUZ_J01624 [Eucalyptus grandis]
Length=825

 Score =   476 bits (1225),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 304/661 (46%), Positives = 403/661 (61%), Gaps = 58/661 (9%)
 Frame = -2

Query  2362  LDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVI  2183
             L +N+F S+P DF  GL +L+   + DN   + W+I   L  +++L +F A++A++TG +
Sbjct  2     LGNNQFDSVPADFFDGLSSLQSVEV-DNNPFAAWEIPRSLQNASALQNFSANSANVTGTV  60

Query  2182  PNFFDS--FPNLQNLRLSYNNLTGSLPGSFGSSEIqnl--wlnnqqqgLSGTIDVISSMT  2015
             P+FF +  FP L  L L+ N+L G LP SF  S+I++L          LSG IDVI++MT
Sbjct  61    PDFFGAGDFPGLTLLHLAMNDLGGGLPASFSGSQIESLWLNGKAGSGKLSGRIDVIANMT  120

Query  2014  RLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLL  1835
              L +VWL +N+F+GP+PD S   +L  L L DN   G VP SLTGL +L+++ L NN L 
Sbjct  121   SLREVWLHSNSFSGPLPDFSGLQDLQTLSLRDNLFAGPVPSSLTGLQSLQSVNLTNNLLQ  180

Query  1834  GPMPLFGNKVKVILG-DTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQ  1658
             GP+P FG+ V+V +  D+NSFC   PG CDP+V  LL  A  +GYP  LA++WKGND C 
Sbjct  181   GPVPKFGSSVQVDMADDSNSFCLPGPGDCDPRVNTLLLIAKSIGYPQKLAENWKGNDPCS  240

Query  1657  NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLP  1478
              W  ITC+    N+T VN     F+GTISP F+ LTSL+ L L  NNLTG IP  L TLP
Sbjct  241   GWIGITCN--DGNITVVNFEKMGFNGTISPDFASLTSLQRLILASNNLTGSIPAELATLP  298

Query  1477  HLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMf  1298
              L +LDVS+N L   +P+F   V I   GN  + K    G  +PGS +   G S SA   
Sbjct  299   ALALLDVSSNQLYGKVPTFKSNVIIKTDGNPDIGKD-RNGISTPGSPRDAAGPSGSAHRI  357

Query  1297  vvvvivvvivvlvvlfvFYK-------------CYMKREHKRFGRAKSP-----------  1190
                      ++ V++                  C  K++ KRF R +SP           
Sbjct  358   ASRSRNKSGLIGVIVVSTIGGLFLIVLLGLLGFCLYKKQQKRFTRVQSPNAMVIHPRHSG  417

Query  1189  ---EKIKST---------QMLKTNEIMGT-------------AIKIQVLEKATNFFsees  1085
                E +K T          + +T+ I G+              I IQVL   TN FSEE+
Sbjct  418   SDNESVKITVAGSSVSVGAISETHTIPGSEAGDIQMVEAGNMVISIQVLRNVTNNFSEEN  477

Query  1084  vlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGY  905
             +LG GG+G VY G+L +GTK+AVK+M+      KG+ EF++EIA L+KVRH++LV L+GY
Sbjct  478   ILGQGGFGTVYKGELHDGTKIAVKRMECAVITGKGITEFKSEIAVLTKVRHRHLVGLLGY  537

Query  904   CINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQS  725
             C++ ++ LLVYEYM  GTL  HLF W + G  PL W +R+TIA DVARG+EYLH L HQS
Sbjct  538   CLDGNEKLLVYEYMPQGTLSRHLFNWPEEGRAPLEWTRRLTIALDVARGVEYLHGLAHQS  597

Query  724   FIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTK  545
             FIHRD+K SNILL DD+RAKV+DFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TGRVT 
Sbjct  598   FIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTT  657

Query  544   K  542
             K
Sbjct  658   K  658


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+++ HLVTW
Sbjct  633  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEDSMHLVTW  692

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT+D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  693  FRRMHINKDTFKKAIDPTIDLNEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  752

Query  258  AHNWRSL--RPEEIVEKFGGFDLNMSLP  181
               W+     P++I     G DL MSLP
Sbjct  753  VDVWKPTDQNPDDIF----GIDLEMSLP  776



>ref|XP_006415826.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
 gb|ESQ34179.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
Length=891

 Score =   478 bits (1230),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 315/742 (42%), Positives = 423/742 (57%), Gaps = 53/742 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGN-VVSINIDSQSISGNLPSELT  2459
             D  +M  L  +L  +   WS   DPC WT + C+   GN V SI I +   SG LP +L 
Sbjct  24    DMEIMITLRNSLKSSKLDWSGP-DPCHWTGLQCE---GNRVTSIQIRNTGTSGTLPPDLK  79

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
             +L+SL    V  NSL+G +PS A + SL    +  N+F+SI  DF  GL +LR   I DN
Sbjct  80    KLSSLEVFEVMGNSLTGKIPSLAGLESLRTFNVHDNDFTSIDADFFTGLSSLRDV-ILDN  138

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNF--FDSFPNLQNLRLSYNNLTGSLPG  2105
               L  W+I S L  +TSL  F A+   ++G IP+F     F +LQ L LS N+L G LP 
Sbjct  139   NPLVSWEIPSSLQNATSLTKFSAARCGLSGKIPDFNWTHDFSSLQTLVLSGNSLEGELPM  198

Query  2104  SFGSS--EIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDL  1931
             SF  S  ++  +      + L+G+I V+  MT L+ V LQ N F+GP+PD +  V+L   
Sbjct  199   SFAGSIIQVLLINGQKGNEKLNGSISVLQKMTSLTSVSLQGNGFSGPLPDFTGLVSLKSF  258

Query  1930  QLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNK-VKVILGDTNSFCKDTPGP  1754
                +NQLTG VP SLTGL +L N+ L NN L GP P F +K  KV +   NSFC +TPG 
Sbjct  259   NCRENQLTGPVPSSLTGLESLSNVALGNNLLQGPTPKFKSKYTKVDMTGLNSFCLNTPGS  318

Query  1753  -CDPQVTALLAFAGGLGYPITLAQSWKGNDACQN---WAFITCDPQGKNVTTVNLGNQRF  1586
              CDP+V  LL+     GYP+ LAQSWKGND C     W  ITC   G  +T +N  N   
Sbjct  319   TCDPRVNTLLSIVEAFGYPVRLAQSWKGNDPCDGKSMWVGITC--AGGEITVINFKNMGL  376

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             +GTISP F+ LTS+R + L+ NNLTG IP  LT L HL  LDVSN              N
Sbjct  377   TGTISPRFANLTSVRVIDLSQNNLTGTIPQELTNLTHLTTLDVSN--------------N  422

Query  1405  ISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
               +G     +  V    G+P  G+   GSS        +V  ++ +VL +L + +     
Sbjct  423   HLYGQVPDFKPNVVNTSGNPDIGKDSPGSSSGNSKAAKIVGAIIGIVLCLLLIGFAVLYL  482

Query  1225  REHKRFGRAKSPEKIKSTQMLKTN----------------------EIMGTAIKIQVLEK  1112
              + K+  R   P+K    ++  T                       E   T I IQ L+ 
Sbjct  483   VKKKKQDRKMHPQKYDQDEVKITIGNLGVGGSESGLSGSDAHHMILEDGNTVISIQDLQD  542

Query  1111  ATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRH  932
             AT+ F  +++LG GG+G+VY G+L +GTK+AVK+M       KG++EF++EI+ L+KVRH
Sbjct  543   ATDNFKGKNILGRGGFGIVYKGELHDGTKIAVKRMDPSILSGKGLDEFKSEISVLTKVRH  602

Query  931   KNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIE  752
             +NLV L G+C+   + LLVY+YM  GTL  H+F W++ G  PL W +R+ IA DVARG+E
Sbjct  603   RNLVKLHGFCLEGDERLLVYQYMPQGTLSRHIFHWQEEGLKPLEWSRRLIIASDVARGVE  662

Query  751   YLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPE  572
             YLH+L H+SFIHRD+K SNILL DD+ AKVADFGLV+ AP+    +ET++AGTFGYLAPE
Sbjct  663   YLHTLAHKSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGTQSIETKIAGTFGYLAPE  722

Query  571   YATTGRVTKKSRCLCIRSCFNG  506
             YA T +V   S  + +     G
Sbjct  723   YAVTTKVDVYSFGIILMELITG  744


 Score =   109 bits (273),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 72/106 (68%), Gaps = 3/106 (3%)
 Frame = -3

Query  543  KVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAIDPTLDPDEQT  364
            KVDVY+FG++LME+ITG+KA+D    +E  HL TWF ++     +  KAID T++ +E+T
Sbjct  728  KVDVYSFGIILMELITGRKALDAKRSEEDVHLATWFRRMFINKDSFPKAIDETIEINEET  787

Query  363  FESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEE  226
              SI+KVA+LA HC+  +  +RP+M HVVNVL      W   +PEE
Sbjct  788  LRSINKVAQLACHCSAREPQQRPDMSHVVNVLVSLLDQW---KPEE  830



>ref|NP_001054323.1| Os04g0685900 [Oryza sativa Japonica Group]
 emb|CAD41925.1| OSJNBa0070M12.3 [Oryza sativa Japonica Group]
 emb|CAE03463.1| OSJNBa0088H09.21 [Oryza sativa Japonica Group]
 dbj|BAF16237.1| Os04g0685900 [Oryza sativa Japonica Group]
 gb|EAZ32481.1| hypothetical protein OsJ_16698 [Oryza sativa Japonica Group]
 dbj|BAH00734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=938

 Score =   478 bits (1230),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 315/762 (41%), Positives = 446/762 (59%), Gaps = 70/762 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS--GWSA--SKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             D +V+  L  +L+ A +  GW    + DPC  W +++CD+  G V +I++ +  ++G LP
Sbjct  21    DLSVLHDLRRSLTNADAVLGWGDPNAADPCAAWPHISCDR-AGRVNNIDLKNAGLAGTLP  79

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
             S    L +L+ LS+Q N+LSG LPSF  M+SL   +L++N F SIP DF  GL +L + S
Sbjct  80    STFAALDALQDLSLQNNNLSGDLPSFRGMASLRHAFLNNNSFRSIPADFFSGLTSLLVIS  139

Query  2290  ISDNG---ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             +  N        W I + +A +  L S   +  ++TG IP+F  +  +LQ L+L+YN L+
Sbjct  140   LDQNPLNVSSGGWTIPADVAAAQQLQSLSLNGCNLTGAIPDFLGAMNSLQELKLAYNALS  199

Query  2119  GSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPD-LSKC  1949
             G +P +F +S +Q   L   +    LSGT+D+I++M  L Q WL  N F+GPIPD ++ C
Sbjct  200   GPIPSTFNASGLQTLWLNNQHGVPKLSGTLDLIATMPNLEQAWLHGNDFSGPIPDSIADC  259

Query  1948  VNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK  1769
               L DL L  NQL G+VP +L  +  L++++L NN LLGP+P    K        N FC 
Sbjct  260   KRLSDLCLNSNQLVGLVPPALESMAGLKSVQLDNNNLLGPVPAI--KAPKYTYSQNGFCA  317

Query  1768  DTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQ  1592
             D PG  C PQV ALL F   + YP  L  SW GN++C +W  I+C     NVT +NL   
Sbjct  318   DKPGVACSPQVMALLHFLAEVDYPKRLVASWSGNNSCVDWLGISC--VAGNVTMLNLPEY  375

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               +GTIS +   L+ L ++ L  NNLTG +P SLT+L  LQ LD+S N+L+ PLP+F P+
Sbjct  376   GLNGTISDSLGNLSELSDINLIGNNLTGHVPDSLTSLRLLQKLDLSGNDLTGPLPTFSPS  435

Query  1411  VNISFGGNLLLEKTV---ATGRGSPGSGQT------------ENGSSMSARMfvvvvivv  1277
             V ++  GNL    T    A  + +PGS  +            EN    SA +    + V 
Sbjct  436   VKVNVTGNLNFNGTAPGSAPSKDTPGSSSSRAPTLPGQGVLPENKKKRSAVVLATTIPVA  495

Query  1276  vivvlvvlfvFYKCYMKRE------------HKRFGRAKSPEKIKSTQML---------K  1160
             V VV +        + K+             H R      P+ +    M+         +
Sbjct  496   VSVVALASVCAVLIFRKKRGSVPPNAASVVVHPR--ENSDPDNLVKIVMVNNDGNSSSTQ  553

Query  1159  TNEIMGTA---------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
              N + G++               I +QVL  AT  F++++VLG GG+GVVY G+L +GT 
Sbjct  554   GNTLSGSSSRASDVHMIDTGNFVIAVQVLRGATKNFTQDNVLGRGGFGVVYKGELHDGTM  613

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+      K ++EFQAEI  L+KVRH+NLV+++GY I  ++ LLVYEYMS+G L 
Sbjct  614   IAVKRMEAAVISNKALDEFQAEITILTKVRHRNLVSILGYSIEGNERLLVYEYMSNGALS  673

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLF+WK+   +PL+WK+R+ IA DVARG+EYLH+L HQ +IHRD+KS+NILL DD RAK
Sbjct  674   KHLFQWKQFELEPLSWKKRLNIALDVARGMEYLHNLAHQCYIHRDLKSANILLGDDFRAK  733

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             V+DFGLVK APD    V TR+AGTFGYLAPEYA TG++T K+
Sbjct  734   VSDFGLVKHAPDGNFSVATRLAGTFGYLAPEYAVTGKITTKA  775


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDET-LPDETCHL  448
            N S+   L G    L       G+   K DV++FGVVLME+ITG  A+DE+ L +ET +L
Sbjct  747  NFSVATRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELITGMTAIDESRLEEETRYL  806

Query  447  VTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVL  268
             +WF +I +    L+ AIDPTLD  ++TFESIS +AELA HCT+ +  +RP+M H VNVL
Sbjct  807  ASWFCQIRKDEDRLRAAIDPTLDQSDETFESISVIAELAGHCTSREPTQRPDMGHAVNVL  866

Query  267  GPFAHNWRSLRPEEIVEKFGGFDLNMSL  184
             P    W+ +  E   E + G DL+  L
Sbjct  867  VPMVEKWKPVNDE--TEDYMGIDLHQPL  892



>ref|XP_006421082.1| hypothetical protein CICLE_v10004322mg [Citrus clementina]
 gb|ESR34322.1| hypothetical protein CICLE_v10004322mg [Citrus clementina]
Length=828

 Score =   473 bits (1218),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 300/665 (45%), Positives = 404/665 (61%), Gaps = 64/665 (10%)
 Frame = -2

Query  2362  LDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVI  2183
             L +N+F+S+P DF  GL +L+   I DN   S W+I   L  ++ L +F A++A+ITG I
Sbjct  2     LSNNQFTSVPSDFFTGLSSLQSIEI-DNNPFSSWEIPQSLRNASGLQNFSANSANITGQI  60

Query  2182  PNFF--DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMT  2015
             P+FF  D FP L  L L++N L G LP SF  S+IQ+  +   N    L G IDVI +MT
Sbjct  61    PSFFGPDEFPGLTILHLAFNQLIGGLPASFSGSQIQSLWVNGQNGNAKLGGGIDVIQNMT  120

Query  2014  RLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLL  1835
              L ++WL +NAF+GP+PD S    L  L L DN  TG VP SL  L +L+ + L NN L 
Sbjct  121   SLKEIWLHSNAFSGPLPDFSGVKQLESLSLRDNFFTGPVPDSLVKLESLKIVNLTNNLLQ  180

Query  1834  GPMPLFGNKVKVILGD-TNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQ  1658
             GP+P F   V + +   +N+FC  +PG CDP++ ALL+    +GYP   A++WKGND C 
Sbjct  181   GPVPEFDRSVSLDMAKGSNNFCLPSPGACDPRLNALLSVVKLMGYPQRFAENWKGNDPCS  240

Query  1657  NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLP  1478
             +W  +TC     N+T +N      +GTISP F    SL+ L L+DNNL+G IP  L+ L 
Sbjct  241   DWIGVTCTK--GNITVINFQKMNLTGTISPEFDSFKSLQRLILDDNNLSGTIPEGLSVLG  298

Query  1477  HLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATG-RGSP-------GSGQ---T  1331
              L+ LDVSNN L   +PSF     ++  GN  + K  ++  +GSP       GSG    T
Sbjct  299   ALKELDVSNNQLYGKIPSFKSNAIVNTDGNPDIGKEKSSSFQGSPSGSPTSTGSGNASST  358

Query  1330  ENGSSMSARMfvvvv--ivvvivvlvvlfvFYKCYMKREHKRFGRAKSP-----------  1190
             ENG   S+ +  V++  ++    V+ +  V   C  K++ KRF R +SP           
Sbjct  359   ENGVKNSSALITVILFCVIGGAFVISLTGVLVFCLCKKKQKRFSRVQSPNAMVIHPRHSG  418

Query  1189  ----EKIKST-------------------------QMLKTNEIMGTAIKIQVLEKATNFF  1097
                 E +K T                         QML+   ++   I IQVL   TN F
Sbjct  419   SENSESVKITVAGSNVSVGAISETHTVPSSEPGDIQMLEAGNMV---ISIQVLRNVTNNF  475

Query  1096  seesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVA  917
             SEE++LG GG+G VY G+L +GTK+AVK+M+ G    KG+ EF++EIA L+KVRH++LVA
Sbjct  476   SEENILGRGGFGTVYKGELHDGTKIAVKRMEAGVISGKGLTEFKSEIAVLTKVRHRHLVA  535

Query  916   LVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSL  737
             L+G+C++ ++ LLV+EYM  GTL  H+F W + G  PL W +R+TIA DVARG+EYLH L
Sbjct  536   LLGHCLDGNEKLLVFEYMPQGTLSRHIFNWAEEGLKPLEWNRRLTIALDVARGVEYLHGL  595

Query  736   THQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTG  557
              HQSFIHRD+K SNILL DD+RAKVADFGLV+ AP+ K  +ETR+AGTFGYLAPEYA TG
Sbjct  596   AHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTG  655

Query  556   RVTKK  542
             RVT K
Sbjct  656   RVTTK  660


 Score =   131 bits (329),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 88/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DE+ P+E+ HLVTW
Sbjct  635  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDESQPEESMHLVTW  694

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +I     +  KAIDPT+D +E T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  695  FRRIHLSKDSFHKAIDPTIDLNEGTLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  754

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL MSLP
Sbjct  755  VELWKPT--DQNSEDIYGIDLEMSLP  778



>ref|XP_003579497.1| PREDICTED: probable receptor protein kinase TMK1 [Brachypodium 
distachyon]
Length=949

 Score =   476 bits (1226),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 312/756 (41%), Positives = 442/756 (58%), Gaps = 62/756 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSG---WSAS-KDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             D +++  L  +L+ A      W+A+  DPC  W +V+CD+  G V ++++ +  ++G LP
Sbjct  36    DLSILHDLRRSLTNAADALPTWTATGTDPCVGWAHVSCDR-DGRVNNLDLKNLGLTGTLP  94

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
             +  + LA L+ LS+Q N+LSGPLPSF  M++L++ YL+ N F+S+P DF  GL +L   S
Sbjct  95    ATFSGLAGLQGLSLQSNALSGPLPSFRGMAALQKAYLNGNAFASVPNDFFRGLADLVEIS  154

Query  2290  ISD---NGELSPWQISSYLAE-STSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNL  2123
             + D   N     W + + L + S  L S    N S+ G +P F  +   LQ LRLSYN L
Sbjct  155   LDDNPLNASQGGWALPADLGDTSQQLRSLRLINCSLVGSVPGFLGNMSGLQELRLSYNKL  214

Query  2122  TGSLPGSFGSS---EIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPD-LS  1955
             +G +P SFG+    +   L      + LSGT++V+++M  L + WL  N F+GPIPD + 
Sbjct  215   SGPIPASFGAGSGIQTLWLNNQVGVKKLSGTLEVVAAMGSLQEAWLHGNEFSGPIPDGIG  274

Query  1954  KCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSF  1775
              C  L      +N L G+VP SL  LP L+++RL NN LLGP P+   K        N F
Sbjct  275   NCKQLKTFWANNNMLVGLVPASLATLPLLKDVRLDNNNLLGPAPVL--KAGNFTFSGNEF  332

Query  1774  CKDTPGP-CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLG  1598
             C + PG  C  +V ALL F   +GYP  L  SW GND C++W  +TC   GK V+ +NL 
Sbjct  333   CAEKPGGVCSSEVMALLQFLAQVGYPQKLVGSWSGNDPCKDWLGVTCS-DGK-VSVINLP  390

Query  1597  NQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfp  1418
                 +GTIS +   LT++ ++ L+ NNLTG +P SLT L  L+ LD+S N+LS PLP+F 
Sbjct  391   GYGLNGTISDSLGNLTTVSDIRLDSNNLTGHVPDSLTNLKSLKKLDLSMNDLSGPLPAFR  450

Query  1417  PAVNISFGGNLLLEKTV--ATGRGSPGSGQTE------------NGSSMSARMfvvvviv  1280
               VN+   GNL    T   A  + SP                  NG+  SA M  + + V
Sbjct  451   RDVNVVVTGNLNFNGTAPGAPPKDSPRPATPSVPGPQDHTVSPGNGTKSSATMLAIPIAV  510

Query  1279  vvivvlvvlfvFYKCYMKREHKRFGRAKS----------PEKIKSTQMLKTN--------  1154
              V+V++ +  V + C  +   ++   A S          P+ +    M   +        
Sbjct  511   SVVVLVSLGAVVFYCKKRGSIRQPQAAASVVVHPRDNSDPDNLVKIVMANNDSFSAASSG  570

Query  1153  -----------EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKM  1007
                        E     I +QVL  AT  FS+++VLG GG+GVVY G+L +GT +AVK+M
Sbjct  571   NSSQAGDIHMIEARNFVIAVQVLRGATKNFSQDNVLGRGGFGVVYKGELHDGTMIAVKRM  630

Query  1006  KDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEW  827
             +      K ++EFQAEIA L+KVRH+NLV+++GY I  ++ LLVYE+MS+G L  HLF+W
Sbjct  631   ESAVISNKALDEFQAEIAILTKVRHRNLVSILGYSIEGNERLLVYEHMSNGALSKHLFQW  690

Query  826   KKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGL  647
             K+   +PL+WK+R+ IA DVARG+EYLH+L  Q +IHRD+KS+NILL DD RAKV+DFGL
Sbjct  691   KQLELEPLSWKKRLNIALDVARGMEYLHTLAQQCYIHRDLKSANILLGDDFRAKVSDFGL  750

Query  646   VKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             +K APD    V TR+AGTFGYLAPEYA TG++T K+
Sbjct  751   LKPAPDGNFSVATRLAGTFGYLAPEYAVTGKITTKA  786


 Score =   110 bits (274),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDET-LPDETCHL  448
            N S+   L G    L       G+   K DV++FGVVLME+ITG  A+DE  + +ET +L
Sbjct  758  NFSVATRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELITGMTAIDERRIDEETRYL  817

Query  447  VTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVL  268
             +WF +I +     + AIDP+L   ++ FESIS +AELA HCT+ +  +RP+M H V VL
Sbjct  818  ASWFCQIRKDEEKFRAAIDPSLVLTDEIFESISVIAELAGHCTSREPSQRPDMGHAVTVL  877

Query  267  GPFAHNWRSLRPEEIVEKFGGFDLNMSL  184
             P    W+    E   E + G DL++ L
Sbjct  878  VPMVEKWKPSNNE--AEDYMGIDLHLPL  903



>gb|KHN12355.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=693

 Score =   468 bits (1204),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 290/530 (55%), Positives = 348/530 (66%), Gaps = 39/530 (7%)
 Frame = -2

Query  2020  MTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNK  1841
             M+ L+Q WL  N FTG IPDLS+C  L DLQL DNQLTGVVP SLT LP+L+ + L NN+
Sbjct  1     MSALNQSWLNKNQFTGSIPDLSQCTALSDLQLRDNQLTGVVPASLTSLPSLKKVSLDNNE  60

Query  1840  LLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDAC  1661
             L GP+P+FG  V V L   NSFC DTPG CDP+V  LL  A   GYPI LA+SWKGND C
Sbjct  61    LQGPVPVFGKGVNVTLDGINSFCLDTPGNCDPRVMVLLQIAEAFGYPIRLAESWKGNDPC  120

Query  1660  QNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTL  1481
               W ++ C   GK + TVN   Q   GTISPAF+ LT LR L+LN NNL G IP SL TL
Sbjct  121   DGWNYVVC-AAGK-IITVNFEKQGLQGTISPAFANLTDLRTLFLNGNNLIGSIPDSLITL  178

Query  1480  PHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV------------ATGRGSPGSG  1337
             P LQ LDVS+NNLS  +P FPP V +   GN LL K +             +  G  G  
Sbjct  179   PQLQTLDVSDNNLSGLVPKFPPKVKLVTAGNALLGKPLSPGGGPSGTTPSGSSTGGSGGE  238

Query  1336  QTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPEKIKSTQMLKT  1157
              ++  SS+S      +V++V+  + VVLFV +KC++ +   +F R K  E  K    L  
Sbjct  239   SSKGNSSVSPGWIAGIVVIVLFFIAVVLFVSWKCFVNKLQGKFSRVKGHENGKGGFKLDA  298

Query  1156  -------------------------NEIMGTAIKIQVLEKATNFFseesvlgsggygvvy  1052
                                      + + G    IQVL + TN FSEE++LG GG+GVVY
Sbjct  299   VHVSNGYGGVPVELQSQSSGDRSDLHALDGPTFSIQVLRQVTNNFSEENILGRGGFGVVY  358

Query  1051  lGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVY  872
              G+L +GTK+AVK+M+  A   KG  EF+AEIA LSKVRH++LVAL+GYCIN ++ LLVY
Sbjct  359   KGELHDGTKIAVKRMESVAMGNKGQKEFEAEIALLSKVRHRHLVALLGYCINGNERLLVY  418

Query  871   EYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNI  692
             EYM  GTL  HLFEW++HG+ PLTWKQRV IA DVARG+EYLHSL  QSFIHRD+K SNI
Sbjct  419   EYMPQGTLTQHLFEWQEHGYAPLTWKQRVVIALDVARGVEYLHSLAQQSFIHRDLKPSNI  478

Query  691   LLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             LL DD+RAKVADFGLVK APD K  VETR+AGTFGYLAPEYA TGRVT K
Sbjct  479   LLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTK  528


 Score =   147 bits (372),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    KVDVYAFGVVLME+ITG+KA+D+T+PDE  HLVTW
Sbjct  503  SVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDTVPDERSHLVTW  562

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F +++    N+ KAID  L+PDE+T  SI  VAELA HCT  + Y+RP+M H VNVL P 
Sbjct  563  FRRVLINKENIPKAIDQILNPDEETMGSIYTVAELAGHCTAREPYQRPDMGHAVNVLVPL  622

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    +E  E   G DL+MSLP
Sbjct  623  VEQWKPTSHDEEEEDGSGGDLHMSLP  648



>gb|EMS63078.1| putative receptor protein kinase TMK1 [Triticum urartu]
Length=746

 Score =   469 bits (1208),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 321/725 (44%), Positives = 430/725 (59%), Gaps = 39/725 (5%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKP-TGNVVSINIDSQSISGNLPSELT  2459
             D  V+  L   LS  PS W A  D C +  + C++  +G V SI++    ++G LP+ L+
Sbjct  26    DEDVIFGLAKLLSNPPSSWGAGGDVCVFDGITCERGGSGRVTSIDLGDMGLTGTLPTSLS  85

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L+ L +Q N+L G  PS A  + L  L LD N F+S+P DFL  LP+L+  S+ D 
Sbjct  86    SLTALKELHLQGNALHGDFPSLAGCTDLTRLVLDGNWFTSLPSDFLKDLPSLQYLSLEDL  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L PW +   +  S+ L +F ASNASI G  P    +  +L++LRLSYNNLTG LP   
Sbjct  146   -PLKPWSVPDAIVGSSLLETFSASNASIAGAFPAGLANLSSLRSLRLSYNNLTGGLPAGL  204

Query  2098  G---SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
                 + E   L        LSG+IDV+++M  L  +W+Q+N FTGPIPD S    L  L 
Sbjct  205   AELIALESLQLNNQMSDGKLSGSIDVVAAMKNLRLLWIQSNKFTGPIPDFSNS-QLEALN  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDTPGPC  1751
             + DN+LTGVVP SL  +  L N+ L NN   GPMP F G  V +     + FC+  PGPC
Sbjct  264   VRDNRLTGVVPASLYEIKTLRNVSLTNNLFQGPMPDFRGVNVDLAADTVSRFCQSRPGPC  323

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP VT LLA A G GYP  LA++W GN  C NW  I C     +V+  +L N+  SGTIS
Sbjct  324   DPLVTTLLAVAAGFGYPAELAETWNGNTPCGNWIGIVC--SNGDVSIFDLHNRGLSGTIS  381

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PA + LTS+  L L++N+LTG IP +LTT+ +L++  VSNN+L   LP F P+V +   G
Sbjct  382   PAIANLTSVGKLDLSNNHLTGVIPDTLTTMSNLKIFIVSNNSLDGELPKFKPSVKVLADG  441

Query  1390  NLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK-REHK  1214
             N   +    +   S G+ + ++ + M   + V VV++V+IV L+V     K   K R   
Sbjct  442   NQFGKSDSGSQSVSAGALKWKSDAGMIIGILVAVVLLVIIVGLLVHHRRKKNAEKFRPVS  501

Query  1213  RFGRAKSPEKIKSTQMLKTN---------------------------EIMGTAIKIQVLE  1115
               G A   E +K  Q+++TN                           E  G  + I+VL 
Sbjct  502   SKGSADESEMMK-IQVVETNWSANGNTAVPADYSQVSAGSANITHLFESHGMQLPIEVLL  560

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
             KAT+ F+E+ +LG GG+GVV+ G L N   VAVK+   G   TKG  EF AEI  L+KVR
Sbjct  561   KATDNFNEDCILGKGGFGVVFKGNL-NERLVAVKRCDSGTMGTKGQQEFMAEIDVLTKVR  619

Query  934   HKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGI  755
             H++LV L+GYC + ++ LLVYEYMS GTL  HL + ++ G+ PLTW QR+TIA DVARGI
Sbjct  620   HRHLVGLLGYCTHGYERLLVYEYMSGGTLREHLCDLQRSGYTPLTWTQRMTIALDVARGI  679

Query  754   EYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAP  575
             EYLH L  ++FIHRD+K SNILL+ D+RAKV+DFGLVK A D    + TRVAGTFGYLAP
Sbjct  680   EYLHGLAQETFIHRDLKPSNILLDQDLRAKVSDFGLVKLANDTDKSMMTRVAGTFGYLAP  739

Query  574   EYATT  560
             EYA +
Sbjct  740   EYAIS  744



>gb|AAO72615.1| receptor-like protein kinase-like protein [Oryza sativa Japonica 
Group]
Length=938

 Score =   474 bits (1220),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 313/762 (41%), Positives = 445/762 (58%), Gaps = 70/762 (9%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPS--GWSA--SKDPCT-WTNVNCDKPTGNVVSINIDSQSISGNLP  2471
             D +V+  L  +L+ A +  GW    + DPC  W +++CD+  G V +I++ +  ++G LP
Sbjct  21    DLSVLHDLRRSLTXAEAVLGWGDPNAADPCAAWPHISCDR-AGRVNNIDLKNAGLAGTLP  79

Query  2470  SELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFS  2291
                  L +L+ LS+Q ++LSG LPSF  M+SL   +L++N F SIP DF  GL +L + S
Sbjct  80    FTFAALDALQDLSLQNHNLSGDLPSFRGMASLRHAFLNNNSFRSIPADFFSGLTSLLVIS  139

Query  2290  ISDNG---ELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLT  2120
             +  N        W I + +A +  L S   +  ++TG IP+F  +  +LQ L+L+YN L+
Sbjct  140   LDQNPLNVSSGGWTIPADVAAAQQLQSLSLNGCNLTGAIPDFLGAMNSLQELKLAYNALS  199

Query  2119  GSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPD-LSKC  1949
             G +P +F +S +Q   L   +    LSGT+D+I++M  L Q WL  N F+GPIPD ++ C
Sbjct  200   GPIPSTFNASGLQTLWLNNQHGVPKLSGTLDLIATMPNLEQAWLHGNDFSGPIPDSIADC  259

Query  1948  VNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCK  1769
               L DL L  NQL G+VP +L  +  L++++L NN LLGP+P    K        N FC 
Sbjct  260   KRLSDLCLNSNQLVGLVPPALESMAGLKSVQLDNNNLLGPVPAI--KAPKYTYSQNGFCA  317

Query  1768  DTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQ  1592
             D PG  C PQV ALL F   + YP  L  SW GN++C +W  I+C     NVT +NL   
Sbjct  318   DKPGVACSPQVMALLHFLAEVDYPKRLVASWSGNNSCVDWLGISC--VAGNVTMLNLPEY  375

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               +GTIS +   L+ L ++ L  NNLTG +P SLT+L  LQ LD+S N+L+ PLP+F P+
Sbjct  376   GLNGTISDSLGNLSELSDINLIGNNLTGHVPDSLTSLRLLQKLDLSGNDLTGPLPTFSPS  435

Query  1411  VNISFGGNLLLEKTV---ATGRGSPGSGQT------------ENGSSMSARMfvvvvivv  1277
             V ++  GNL    T    A  + +PGS  +            EN    SA +    + V 
Sbjct  436   VKVNVTGNLNFNGTAPGSAPSKDTPGSSSSRAPTLPGQGVLPENKKKRSAVVLATTIPVA  495

Query  1276  vivvlvvlfvFYKCYMKRE------------HKRFGRAKSPEKIKSTQML---------K  1160
             V VV +        + K+             H R      P+ +    M+         +
Sbjct  496   VSVVALASVCAVLIFRKKRGSVPPNAASVVVHPR--ENSDPDNLVKIVMVNNDGNSSSTQ  553

Query  1159  TNEIMGTA---------------IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTK  1025
              N + G++               I +QVL  AT  F++++VLG GG+GVVY G+L +GT 
Sbjct  554   GNTLSGSSSRASDVHMIDTGNFVIAVQVLRGATKNFTQDNVLGRGGFGVVYKGELHDGTM  613

Query  1024  VAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLG  845
             +AVK+M+      K ++EFQAEI  L+KVRH+NLV+++GY I  ++ LLVYEYMS+G L 
Sbjct  614   IAVKRMEAAVISNKALDEFQAEITILTKVRHRNLVSILGYSIEGNERLLVYEYMSNGALS  673

Query  844   HHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAK  665
              HLF+WK+   +PL+WK+R+ IA DVARG+EYLH+L HQ +IHRD+KS+NILL DD RAK
Sbjct  674   KHLFQWKQFELEPLSWKKRLNIALDVARGMEYLHNLAHQCYIHRDLKSANILLGDDFRAK  733

Query  664   VADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKKS  539
             V+DFGLVK APD    V TR+AGTFGYLAPEYA TG++T K+
Sbjct  734   VSDFGLVKHAPDGNFSVATRLAGTFGYLAPEYAVTGKITTKA  775


 Score =   124 bits (310),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 3/148 (2%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDET-LPDETCHL  448
            N S+   L G    L       G+   K DV++FGVVLME+ITG  A+DE+ L +ET +L
Sbjct  747  NFSVATRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELITGMTAIDESRLEEETRYL  806

Query  447  VTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVL  268
             +WF +I +    L+ AIDPTLD  ++TFESIS +AELA HCT+ +  +RP+M H VNVL
Sbjct  807  ASWFCQIRKDEDRLRAAIDPTLDQSDETFESISVIAELAGHCTSREPTQRPDMGHAVNVL  866

Query  267  GPFAHNWRSLRPEEIVEKFGGFDLNMSL  184
             P    W+ +  E   E + G DL+  L
Sbjct  867  VPMVEKWKPVNDE--TEDYMGIDLHQPL  892



>ref|XP_010462912.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=871

 Score =   470 bits (1209),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 303/726 (42%), Positives = 413/726 (57%), Gaps = 61/726 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALS-PAPSGWSASKDPCTWTN-VNCDKPTGNVVSINIDSQSISGNLPSEL  2462
             DAA M+ L  +L  P    WS   DPC W++ + CD     +  I I ++ ISG LP +L
Sbjct  25    DAAAMTALRRSLKLPGSLNWS-DPDPCKWSSSIQCDG-NNRITKIQIGNKGISGTLPPDL  82

Query  2461  TQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISD  2282
               L+SL    V  N ++G +PSFA + SL  +Y + N F SI  DF   L +L+  S+ D
Sbjct  83    KNLSSLMIFEVMHNKITGKIPSFAGLKSLNRVYFNDNSFDSIDSDFFANLTSLQQVSL-D  141

Query  2281  NGELSPWQISSYLAESTSLGSFFASNASITGVIPN--FFDSFPNLQNLRLSYNNLTGSLP  2108
             N    PW+I   L ++T+L  F A+N S+ G IP+  +  +FP+L  L L+   L     
Sbjct  142   NNPFGPWEIPLSLKDATTLSEFSAANCSLNGKIPDLEWAKTFPSLNTLSLNGQKL-----  196

Query  2107  GSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
                                 SG+I V+ +MT L++V L  N F+GPIP+ S  V+L  + 
Sbjct  197   --------------------SGSISVLRNMTALTEVRLNRNEFSGPIPNFSGHVSLKIVN  236

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDTPG-P  1754
             + DNQLTG+VP SLT L +L  + L NN L GP P F  N + + L   NSFC DTPG P
Sbjct  237   IRDNQLTGIVPSSLTELTSLSEVGLGNNLLQGPTPSFKANNLTLDLTGLNSFCLDTPGTP  296

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQ---NWAFITCDPQGKNVTTVNLGNQRFS  1583
             CDP+V  LL+      YP   A+SWKGND C    +W  ITC   G N+T ++  N   +
Sbjct  297   CDPRVNTLLSIVKAFDYPEKFARSWKGNDPCSKSPSWLGITC--MGGNITVIDFENMGLN  354

Query  1582  GTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplp-sfpPAVN  1406
             GTISP+F  L SL+ + L+ NNL G IP  LT L +L+ LDVSNN L       F   V 
Sbjct  355   GTISPSFRNLMSLQVINLSRNNLNGTIPQELTELTNLKTLDVSNNYLCGSKVPGFNTTVI  414

Query  1405  ISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMK  1226
             ++  GN  + K  ++G      G+  N   M   +   ++ +++I   +   V  K   +
Sbjct  415   VNTSGNPNIGKGCSSG---GDGGKKANAWKMIGFVIGSLLGLLLIGFAIFFLVKKKKQYR  471

Query  1225  REHKRFGRAKSPEKIKST------------------QMLKTNEIMGTAIKIQVLEKATNF  1100
             R H +  R      +K T                        E     I IQVL  AT+ 
Sbjct  472   RMHPKQQRGDDQGALKITIGNLCAGGGGSESGFSGSDAHHVGESGNIVISIQVLRDATDN  531

Query  1099  FseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLV  920
             F E+++LG GG+G+VY G+L +GTK+AVK+M+      KG++EF++EI  L++VRH+NLV
Sbjct  532   FDEKNILGRGGFGIVYKGELHDGTKIAVKRMEPSIISGKGLDEFKSEIVVLTRVRHRNLV  591

Query  919   ALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHS  740
              L GYC+  ++ LLVY+YM  GTL  H+F W+  G  PL W +R+ IA DVARG+EYLH+
Sbjct  592   ILHGYCLEGNERLLVYQYMPQGTLSRHIFHWQVEGLKPLEWTRRLIIALDVARGVEYLHT  651

Query  739   LTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATT  560
             L HQSFIHRD+K SNILL DD+ AKVADFGLV+ AP+    +ET++AGTFGYLAPEYA T
Sbjct  652   LAHQSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGAQSIETKIAGTFGYLAPEYAVT  711

Query  559   GRVTKK  542
             GRVT K
Sbjct  712   GRVTTK  717


 Score =   100 bits (250),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+  ++ G    L       G    KVDVY+FGV+LME++TG+KA+D+   +E  HL TW
Sbjct  692  SIETKIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELLTGRKALDDKRSEEEVHLATW  751

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++     +  KAID T++ +E+T  SI+ VAELA  C+  +  +RP+M HVVNVL   
Sbjct  752  FRRMYINKDSFPKAIDETIEFNEETLRSINTVAELANQCSAREPQQRPDMSHVVNVLVSL  811

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPLVFDDSS  160
               W+        E   G D +  LPL   DS+
Sbjct  812  VLQWKPAEQSGDSEDIYGIDYDTPLPLHSFDST  844



>gb|ACM89521.1| receptor-like protein kinase-like protein [Glycine max]
Length=897

 Score =   469 bits (1208),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 311/721 (43%), Positives = 424/721 (59%), Gaps = 27/721 (4%)
 Frame = -2

Query  2638  DDAAVMSKLLAAL-SPAPSGW-SASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             +DA ++ +L   L +P    W     DPC W  + CD     V  I     ++SG LP  
Sbjct  23    NDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDS-NKRVNQIQPKGLNLSGPLPQN  81

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L QL  L +L +Q N L+GPLPSF  +S L+  YLD+N F SIP DF  GL +L + ++ 
Sbjct  82    LNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLEVLALD  141

Query  2284  D---NGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
                 N     WQ+   L EST L +F     ++TG IP F  S  +L  L+LS N LTG 
Sbjct  142   HNNLNASTGGWQLPETLQESTQLTNFSCMGCNLTGPIPQFLGSMNSLSFLKLSNNYLTGD  201

Query  2113  LPGSFGSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPD-LSKCVNL  1940
             +P S   S +Q L   N Q + LSG IDV++SM  L+ +WL  NAFTG IP+ +    +L
Sbjct  202   IPRSLNDSALQVLWLNNQQGERLSGGIDVVASMVSLTSLWLHGNAFTGTIPENIGALSSL  261

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP  1760
              +L L  N L G+VP  L  +  L  + L NN  +GP+P F  K   +  D N+FC   P
Sbjct  262   KELNLNGNNLVGLVPRGLGDM-KLGKLDLNNNHFMGPIPDF--KAATVSYDVNNFCVSKP  318

Query  1759  G-PCDPQVTALLAFAGGLGYPITLAQSWKGNDAC-QNWAFITCDPQGKNVTTVNLGNQRF  1586
             G PC  +V ALL F GGL YP+ L  SW GND C  NW  I C+  GK V  +NL N   
Sbjct  319   GVPCAFEVMALLGFLGGLNYPLNLVDSWTGNDPCGGNWLGIKCNADGK-VIMINLPNLNL  377

Query  1585  SGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVN  1406
             SG++SP+ + L SL  + L  N+++G +P + T+L  L+ LD+S NN+ PPLP F   + 
Sbjct  378   SGSLSPSVANLGSLVEIRLGGNDISGVVPGNWTSLASLKSLDLSGNNIYPPLPDFKTGLK  437

Query  1405  ISFGGNLLLE---KTVATGRGSP--GSGQTENGSSMSARMfvvvvivvvivvlvvlfvFY  1241
                 GN LL    KT  +G  +P  GSG  +   + ++                 L   +
Sbjct  438   PVVVGNPLLNGGAKTTPSGNNNPSTGSGNVDPSGNTNSNSSSSDSHETKKSKRKQLLRLF  497

Query  1240  KCYMKREHKRFGRAKSPEKIK---STQMLKTNEIMGTA---IKIQVLEKATNFFseesvl  1079
              C  +  H   G      +++   ++  +  + I+      I +QVL K T  F+ E+ L
Sbjct  498   -CSFRSMHTVSGGGTVASRLQLHWNSSGIGDSHIIEAGNLRISVQVLRKVTENFAPENEL  556

Query  1078  gsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCI  899
             G GG+GVVY G+LD+GTK+AVK+M+ G   +K ++EFQ+EIA LSKVRH++LV+L+GY  
Sbjct  557   GRGGFGVVYKGELDDGTKIAVKRMEAGVISSKALDEFQSEIAVLSKVRHRHLVSLLGYST  616

Query  898   NDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFI  719
               ++ +LVYEYM  G L  HLF WK H  +PL+WK+R+ IA DVARG+EYLH+L HQSFI
Sbjct  617   EGNERILVYEYMPQGALSKHLFHWKSHDLEPLSWKRRLNIALDVARGMEYLHTLAHQSFI  676

Query  718   HRDIKSSNILLNDDIRAKVADFGLVKKAPD-DKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             HRD+K SNILL DD +AKV+DFGLVK AP+ +K+ V TR+AGTFGYLAPEYA TG++T K
Sbjct  677   HRDLKPSNILLADDFKAKVSDFGLVKLAPEGEKASVVTRLAGTFGYLAPEYAVTGKITTK  736

Query  541   S  539
             +
Sbjct  737   A  737


 Score =   117 bits (294),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   K DV++FGVVLME++TG  A+DE  P+E+ +L  W
Sbjct  711  SVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAW  770

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F  I      L  AIDP LD  E+TFES+S +AELA HCT  +  +RP+M H VNVL P 
Sbjct  771  FWHIKSDKKKLMAAIDPALDVKEETFESVSIIAELAGHCTAREPSQRPDMGHAVNVLAPL  830

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLPL  178
               W+    ++  E++ G D   SLPL
Sbjct  831  VEKWKPF--DDDTEEYSGID--YSLPL  853



>ref|XP_006653057.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006653058.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X2 [Oryza brachyantha]
Length=911

 Score =   469 bits (1208),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 308/736 (42%), Positives = 433/736 (59%), Gaps = 65/736 (9%)
 Frame = -2

Query  2572  SKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPLPSF  2393
             + D C W +++CD+  G V +I++ +  +SG LP     L +L+ LS+Q N+LSGPLPSF
Sbjct  20    AADACAWPHISCDR-AGRVNNIDLKNAGLSGALPPTFRSLDALQDLSLQNNNLSGPLPSF  78

Query  2392  ANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDNG-ELSP--WQISSYLAESTSLG  2222
               M+SL   +L++N F SIP DF  GL  L + S+  N   LS   W + + +A +  L 
Sbjct  79    RGMASLRNAFLNNNSFDSIPADFFDGLTALLVISLDQNPLNLSSGGWTLPADVANAQQLQ  138

Query  2221  SFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqn--lwlnnqqqgL  2048
             +   ++ ++TG IP+F  +  +LQ+L+L+YN L+G +P +F  S +Q   L   +    L
Sbjct  139   TLSLNSCNLTGAIPDFLGTMNSLQDLKLAYNALSGPIPPTFNGSGLQTLWLNNQHGVSKL  198

Query  2047  SGTIDVISSMTRLSQVWLQANAFTGPIPD-LSKCVNLFDLQLGDNQLTGVVPVSLTGLPN  1871
             SGT+D+I++M  L Q WL  N F+GPIPD +  C  L DL L  NQL G+VP +L  +  
Sbjct  199   SGTLDIIATMPNLQQAWLHGNEFSGPIPDSIGNCKRLNDLCLNGNQLVGLVPPALENMAG  258

Query  1870  LENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGYPIT  1694
             L++++L NN  LGP+P    K        N FC D PG PC P+V ALL F   + YP  
Sbjct  259   LKSLQLDNNDFLGPVPAV--KAGNYTYSENGFCADKPGVPCSPEVMALLQFLAEVDYPKR  316

Query  1693  LAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNL  1514
             L  +W GN+ C  W  +TC   GK VT +NL     +GTIS +   L++L ++ L  N+L
Sbjct  317   LLGTWSGNNPCTGWLGVTC-VAGK-VTVLNLPEYGLNGTISDSLGNLSTLSDINLVGNHL  374

Query  1513  TGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTV-------ATGR  1355
             TG +P SL  L  LQ LD+S N+L+ PLP+F  +V ++  GNL    T        A+G 
Sbjct  375   TGHVPDSLANLKSLQKLDLSMNDLTGPLPTFSSSVRVNVTGNLNFNGTAPGEPPKDASGS  434

Query  1354  GS------PGSGQT-ENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKRE--------  1220
              S      PG G   EN    SA +    + V V VV +V       + K+         
Sbjct  435   PSSSTPNLPGRGALPENKKKGSAVLLATTIPVAVSVVALVSVCGVLIFRKKRGSIPPNAA  494

Query  1219  ----HKRFGRAKSPEKIKSTQMLKTNEIMGTA-------------------------IKI  1127
                 H R   +  P+ +    M+  ++  GT+                         I +
Sbjct  495   SVVVHPR--ESSDPDNLVKIVMVDNHDGNGTSSQGNTLSGSSSRASDVHMIDTGNFVIAV  552

Query  1126  QVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFL  947
             QVL  AT  F++++VLG GG+GVVY G+L +GT +AVK+M+      K ++EFQAEIA L
Sbjct  553   QVLRGATKNFTQDNVLGRGGFGVVYKGELHDGTMIAVKRMEAAVISNKALDEFQAEIAIL  612

Query  946   SKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDV  767
             +KVRH+NLV+++GY I  ++ LLVYEYMS+G L  HLF+WK+   +PL+WK+R+ IA DV
Sbjct  613   TKVRHRNLVSILGYSIEGNERLLVYEYMSNGALSKHLFQWKQFELEPLSWKKRLNIALDV  672

Query  766   ARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFG  587
             ARG+EYLH+L HQ +IHRD+KS+NILL DD RAKV+DFGLVK APD    V TR+AGTFG
Sbjct  673   ARGMEYLHNLAHQCYIHRDLKSANILLGDDFRAKVSDFGLVKHAPDGNFSVATRLAGTFG  732

Query  586   YLAPEYATTGRVTKKS  539
             YLAPEYA TG++T K+
Sbjct  733   YLAPEYAVTGKITTKA  748


 Score =   122 bits (305),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = -3

Query  624  NLSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDE-TCHL  448
            N S+   L G    L       G+   K DV++FGVVLME+ITG  A+DE+  DE T +L
Sbjct  720  NFSVATRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELITGMTAIDESRLDEDTRYL  779

Query  447  VTWFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVL  268
             +WF +I +    L+ AIDPTLD  ++TFESIS +AELA HCT+ +  +RP+M H VNVL
Sbjct  780  ASWFCQIRKDEERLRSAIDPTLDLTDETFESISVIAELAGHCTSREPTQRPDMGHAVNVL  839

Query  267  GPFAHNWRSLRPEEIVEKFGGFDLNMSL  184
             P    W+ +  E   E + G DL+  L
Sbjct  840  VPMVEKWKPVNDE--TEDYMGIDLHQPL  865



>gb|KEH29536.1| receptor-like kinase, putative [Medicago truncatula]
Length=831

 Score =   467 bits (1202),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 321/718 (45%), Positives = 427/718 (59%), Gaps = 44/718 (6%)
 Frame = -2

Query  2638  DDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSELT  2459
             DD   MSKL  +LSP PSGWS++   C WT V CD+   +V SI + S S+ G +PS+L 
Sbjct  28    DDGTFMSKLAKSLSPTPSGWSSNTSFCLWTGVRCDE-FNSVTSIKLASMSLIGTIPSDLN  86

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L+SL SL +  NSLSG LPS AN+S LE + LDSN FSS+P     GL NL+  S+ +N
Sbjct  87    SLSSLTSLVLFSNSLSGALPSLANLSYLETVLLDSNNFSSVPDGCFQGLDNLQKLSMRNN  146

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L+PW I   L  ST L     +N ++ G +P  F    +L+NLRLSYNNLTG LP SF
Sbjct  147   INLAPWTIPIELIHSTRLDLIDLANTNLVGPLPEIFHRLFSLKNLRLSYNNLTGDLPMSF  206

Query  2098  GSSEIqnl-wlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQLG  1922
               S IQNL   N +  G +G+I+V++SMT+L+QVWL  N FTG IPD S C +LFDLQL 
Sbjct  207   SGSGIQNLWLNNQKPNGFTGSINVLASMTQLTQVWLMNNKFTGQIPDFSNCTDLFDLQLR  266

Query  1921  DNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGPCDPQ  1742
             DNQLTGVVP SL  L +L+N+ L NN L GP P FG  V   L + +SFC++ PGPCDP+
Sbjct  267   DNQLTGVVPSSLMALSSLKNVSLDNNHLQGPFPSFGKGVSFTLDEIHSFCQNAPGPCDPR  326

Query  1741  VTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAF  1562
             VT LL  AG  GYP+ L  SWKGN+ CQNW+F+ C  +GK + T+NL NQ+  GTISP+F
Sbjct  327   VTTLLGVAGEFGYPLQLVNSWKGNNPCQNWSFVVCS-EGK-IITLNLANQKLKGTISPSF  384

Query  1561  SQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLL  1382
             + LT LRNLYL DNNLTG IP SLT+L HLQVLDVSNNNLS  +P F   +  +  GN+L
Sbjct  385   ASLTYLRNLYLGDNNLTGSIPSSLTSLAHLQVLDVSNNNLSGDVPKFSSTLRFNSTGNVL  444

Query  1381  LEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGR  1202
             L        GSP S +      M A +    +  VV ++ +V+    K Y+     R   
Sbjct  445   LR------LGSP-SEKANTSYVMLAWLLGGALCAVVDMLFIVMVCKRKGYLSLLKTRI--  495

Query  1201  AKSPEKIKSTQMLKTNEIMGTAIKIQV----------LEKATNFFseesvlgsggygvvy  1052
                    K+T+++  ++I     +  +          +++ TN F     LG GGYGVVY
Sbjct  496   ------FKNTRIVIDHDIEDFIKRYNLSVPKRFSYADVKRFTNSF--RDKLGQGGYGVVY  547

Query  1051  lGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVY  872
                L +G  VAVK + +   + +   EF  E+A ++K  H N+V+L+G+C   +K  L+Y
Sbjct  548   KASLPDGRHVAVKVISECKGNGE---EFINEVASITKTSHMNVVSLLGFCYEKNKRALIY  604

Query  871   EYMSHGTLGHHLFEWKKHGFD----PLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIK  704
             E+MS+G+L   ++   K GF      L W     I   +ARG+EYLH       +H DIK
Sbjct  605   EFMSNGSLDKFIY---KSGFPNAICDLDWNTLFQIVIGIARGLEYLHQGCISRILHLDIK  661

Query  703   SSNILLNDDIRAKVADFGLVKKAPDDKSFVETR-VAGTFGYLAPEYATT--GRVTKKS  539
               NILL++D   K++DFGL K     +S V      GT GY++PE  +   G V+ KS
Sbjct  662   PQNILLDEDFCPKISDFGLAKICQKKESVVSMLGTRGTIGYISPEVFSRAFGAVSSKS  719



>ref|XP_010246966.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=496

 Score =   455 bits (1171),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 318/441 (72%), Gaps = 2/441 (0%)
 Frame = -2

Query  2653  SVSFCDDAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNL  2474
             SV   DDA VM+KL A+L P PSGWS S DPC WT VNCD     + +IN+ S+S+SG L
Sbjct  23    SVVISDDAFVMNKLAASLKPTPSGWSGS-DPCKWTGVNCDS-NHRITAINLASRSLSGTL  80

Query  2473  PSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIF  2294
             PS+L QL+ L+ LS+Q N +SGPLPS AN+++LEE +LD N F+S+P  F +GL +L++ 
Sbjct  81    PSDLNQLSQLQILSLQNNIISGPLPSLANLTNLEEAFLDRNNFTSVPLSFFVGLESLQVL  140

Query  2293  SISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
             S+ +N  L+PW I   L +S+SL +F+AS A++ G+IP+ F SFPNLQ+LRLSYN LTG 
Sbjct  141   SLGENYNLAPWSIPLDLVQSSSLVTFYASKANVVGMIPDIFRSFPNLQSLRLSYNRLTGP  200

Query  2113  LPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFD  1934
             LP SF  S IQNLWLNNQ  GLSGTI+V+ +M +L+QVWLQ N  +G IPDLS C +LFD
Sbjct  201   LPPSFNGSNIQNLWLNNQDYGLSGTIEVLGTMAQLTQVWLQGNKLSGLIPDLSACTSLFD  260

Query  1933  LQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP  1754
             LQL DNQ TGVVP +L  LP+L N+ L NNKL+G  P F + V+ I+G  N+FC   PG 
Sbjct  261   LQLRDNQFTGVVPTTLMSLPSLLNVSLSNNKLMGSFPEFNSNVQAIIGGINNFCNLKPGS  320

Query  1753  CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTI  1574
             CD QVTAL+A AGG GYP+TLA +W GND C  W FITCD + KNVT +NL  Q  SG I
Sbjct  321   CDSQVTALIAVAGGFGYPMTLADAWDGNDPCHGWRFITCDTKNKNVTVINLAKQHLSGKI  380

Query  1573  SPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFG  1394
             SPA + LTSLR+L+LNDNNLTGPIP +LTTLP L+VLD+SNNNL+  +P+FP  V +S  
Sbjct  381   SPAIANLTSLRDLFLNDNNLTGPIPDALTTLPQLRVLDLSNNNLTGKIPAFPERVTVSIS  440

Query  1393  GNLLLEKTVATGRGSPGSGQT  1331
             GN LL     +     GS  T
Sbjct  441   GNALLGHNSISSEEGGGSTDT  461



>gb|KHN41049.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=812

 Score =   465 bits (1197),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 294/640 (46%), Positives = 395/640 (62%), Gaps = 65/640 (10%)
 Frame = -2

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFF--DSFPNLQNLRLSYNNLTGSL  2111
             DN    PW+I   L  ++ L +F A++A++ G +P+FF  D FP L  L L+ N+L G+ 
Sbjct  10    DNNPFEPWEIPQSLRNASGLQNFSANSANVRGTMPDFFSSDVFPGLTLLHLAMNSLEGTF  69

Query  2110  PGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLF  1937
             P SF  S+IQ+  +        L G+++V+ +MT L+QVWLQ+NAFTGP+PDLS   +L 
Sbjct  70    PLSFSGSQIQSLWVNGQKSVNKLGGSVEVLQNMTFLTQVWLQSNAFTGPLPDLSALKSLR  129

Query  1936  DLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVI-LGDTNSFCKDTP  1760
             DL L DN+ TG V   L GL  L+ + L NN   GPMP+F + V V  + D+NSFC  +P
Sbjct  130   DLNLRDNRFTGPVSTLLVGLKTLKVVNLTNNLFQGPMPVFADGVVVDNIKDSNSFCLPSP  189

Query  1759  GPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSG  1580
             G CDP+V  LL+ AG +GYP   A+SWKGND C +W  ITC     N+T VN      SG
Sbjct  190   GDCDPRVDVLLSVAGVVGYPQRFAESWKGNDPCGDWIGITC--SNGNITVVNFQKMGLSG  247

Query  1579  TISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNIS  1400
              ISP F++L SL+ + L DNNLTG IP  L TLP L  L+V+NN L   +PSF   V +S
Sbjct  248   VISPDFAKLKSLQRIMLADNNLTGSIPEELATLPALTQLNVANNQLYGKVPSFRKNVVVS  307

Query  1399  FGGNLLL--EKTVATGRGSPGSGQTENGSSM------------SARMfvvvvivvvivvl  1262
               GN+ +  +K+  + +G P S    N                S+R+ V+V  V+  V +
Sbjct  308   TSGNIDIGKDKSSLSPQG-PVSPMAPNAKGESGGGPGNGGKKSSSRVGVIVFSVIGAVFV  366

Query  1261  vvlfvFYK-CYMKREHKRFGRAKSP--------------EKIKST---------------  1172
             V +  F   C  + + K+  R +SP              E +K T               
Sbjct  367   VSMIGFLVFCLFRMKQKKLSRVQSPNALVIHPRHSGSDNESVKITVAGSSVNVGAASETR  426

Query  1171  ----------QMLKTNEIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKV  1022
                       QM++   ++   I IQVL+  T+ FSE++VLG GG+G VY G+L +GT++
Sbjct  427   TMPGSEASDIQMVEAGNMV---ISIQVLKNVTDNFSEKNVLGQGGFGTVYRGELHDGTRI  483

Query  1021  AVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGH  842
             AVK+M+ GA   KG  EF++EIA L+KVRH++LVAL+GYC++ ++ LLVYEYM  GTL  
Sbjct  484   AVKRMECGAIAGKGATEFKSEIAVLTKVRHRHLVALLGYCLDGNEKLLVYEYMPQGTLSS  543

Query  841   HLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKV  662
             HLF W + G +PL W +R+TIA DVARG+EYLHSL HQSFIHRD+K SNILL DD+RAKV
Sbjct  544   HLFNWPEEGLEPLEWNRRLTIALDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDMRAKV  603

Query  661   ADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             ADFGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  604   ADFGLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  643


 Score =   121 bits (303),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 87/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME++TG+KA+DET P+++ HLVTW
Sbjct  618  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELMTGRKALDETQPEDSMHLVTW  677

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F K+     + + AID  ++ +E+T  SI  VAELA HC   + Y+RP+M H VNVL   
Sbjct  678  FRKMSINKDSFRMAIDSAMELNEETLASIHTVAELAGHCCAREPYQRPDMGHAVNVLSSL  737

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    ++  E   G DL+MSLP
Sbjct  738  VELWKP--SDQNSEDIYGIDLDMSLP  761


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 21/246 (9%)
 Frame = -2

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  +  L  + +Q N+ +GPLP  + + SL +L L  N F+      L+GL  L++ +++
Sbjct  99    LQNMTFLTQVWLQSNAFTGPLPDLSALKSLRDLNLRDNRFTGPVSTLLVGLKTLKVVNLT  158

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPG  2105
             +N    P  +    A+   + +   SN+     +P+  D  P +  L LS   + G  P 
Sbjct  159   NNLFQGPMPV---FADGVVVDNIKDSNSF---CLPSPGDCDPRVDVL-LSVAGVVG-YPQ  210

Query  2104  SFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPI-PDLSKCVNLFDLQ  1928
              F  S                 I +  S   ++ V  Q    +G I PD +K  +L  + 
Sbjct  211   RFAES-------WKGNDPCGDWIGITCSNGNITVVNFQKMGLSGVISPDFAKLKSLQRIM  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTP----  1760
             L DN LTG +P  L  LP L  + + NN+L G +P F   V V         KD      
Sbjct  264   LADNNLTGSIPEELATLPALTQLNVANNQLYGKVPSFRKNVVVSTSGNIDIGKDKSSLSP  323

Query  1759  -GPCDP  1745
              GP  P
Sbjct  324   QGPVSP  329



>gb|EMT17636.1| Putative receptor protein kinase TMK1 [Aegilops tauschii]
Length=996

 Score =   468 bits (1205),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 314/730 (43%), Positives = 424/730 (58%), Gaps = 53/730 (7%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAPSGWSASKDPCTWTNVNCDKP-TGNVVSINIDSQSISGNLPSELT  2459
             D  V+  L   LS  PS W A  D C +  + C++  +G V SI++    ++G LP+ L+
Sbjct  26    DEDVIFGLAKLLSSPPSSWGAGGDVCVFEGITCERGGSGRVTSIDLGDMGLTGTLPTSLS  85

Query  2458  QLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN  2279
              L +L+ L +Q N+L G  PS A  + L  L LD N F+S+P DFL  LP+L+  S+ D 
Sbjct  86    SLTALKELHLQGNALHGDFPSLAGCTDLTRLVLDGNGFTSLPSDFLKDLPSLQYLSLEDL  145

Query  2278  GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSF  2099
               L PW +   +  S+ L +F ASNASI G  P    +  +L++LRLSYNNLTG LP   
Sbjct  146   -PLKPWSVPDAIVGSSLLETFSASNASIAGAFPAVLANLSSLRSLRLSYNNLTGGLPAGL  204

Query  2098  G---SSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNLFDLQ  1928
                 + E   L        LSG+I V+++M  L  +W+Q+N FTGPIPD S    L    
Sbjct  205   AELIALESLQLNNQISDGKLSGSIAVVAAMKNLRLLWIQSNKFTGPIPDFSNS-QLEAFN  263

Query  1927  LGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLF-GNKVKVILGDTNSFCKDTPGPC  1751
             + DN+LTGVVP SL  +  L N+ L NN   GPMP F G  V +     + FC+  PGPC
Sbjct  264   VRDNRLTGVVPASLYEIKTLRNVSLTNNLFQGPMPDFRGVNVDLAADTVSRFCQSRPGPC  323

Query  1750  DPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTIS  1571
             DP VT LL+ A G GYP  LA++W GN  C NW  I C     +V+  +L N+  SGTIS
Sbjct  324   DPLVTTLLSVAAGFGYPAELAETWNGNTPCGNWIGIVC--SNGDVSIFDLHNRGLSGTIS  381

Query  1570  PAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGG  1391
             PA + LTS+  L L++N+LTG IP +LTT+ +L++  VSNN+L   LP F P+V +   G
Sbjct  382   PAIANLTSVGKLDLSNNHLTGVIPDTLTTMSNLKIFIVSNNSLDGELPKFKPSVKVLANG  441

Query  1390  NLLLEKTVATGRGSPGSGQTENGS---SMSARMfvvvvivvvivvlvvlfvFYKCYMKRE  1220
             N         G+   GS     G+      A M + +++ VV++V++V    +    K+ 
Sbjct  442   NQF-------GKSDSGSQSVSAGALKWKSDAGMIIGILVAVVLLVIIVGLFVHH-LRKKN  493

Query  1219  HKRFGRAKSPEKIKSTQMLKTN--------------------------------EIMGTA  1136
              ++F    S E    ++M+K                                  E  G  
Sbjct  494   AEKFRPVSSKESADESEMMKIQVVETNWSVNGNTAVPADYSQVSAGSANITHLFESHGMQ  553

Query  1135  IKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEI  956
             + I+VL KAT+ F+E+ +LG GG+GVV+ G L NG  VAVK+   G   TKG  EF AEI
Sbjct  554   LPIEVLLKATDNFNEDFILGKGGFGVVFKGNL-NGRLVAVKRCDSGTMGTKGQQEFMAEI  612

Query  955   AFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIA  776
               L+KVRH++LV L+GYC + ++ LLVYEYMS GTL  HL + ++ G+ PLTW QR+TIA
Sbjct  613   DVLTKVRHRHLVGLLGYCTHGYERLLVYEYMSDGTLREHLCDLQRSGYTPLTWTQRMTIA  672

Query  775   WDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAG  596
              DVARGIEYLH L  ++FIHRD+K SNILL+ D+RAKV+DFGLVK A D    + TRVAG
Sbjct  673   LDVARGIEYLHGLAQETFIHRDLKPSNILLDQDLRAKVSDFGLVKLANDTDKSMMTRVAG  732

Query  595   TFGYLAPEYA  566
             TFGYLAPEYA
Sbjct  733   TFGYLAPEYA  742


 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  570  MLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTWFHKIIRKSHNLQKAID  391
            +   G+   KVDVYA+GV+LME+ITG+K +D++LPD+  HLVT F + +      +K +D
Sbjct  846  LTSTGKVTTKVDVYAYGVILMEMITGRKVLDDSLPDDETHLVTIFRRNMLDKEKFRKFVD  905

Query  390  PTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPFAHNWRSLRPEEI  223
            PTL+   + ++S+ +VA+LA HCT  +  +RP+M H VN L      W   +P E+
Sbjct  906  PTLELGAEAWKSLLEVADLARHCTAREQNQRPDMCHCVNRLSSLLDEW---KPTEV  958



>ref|XP_002980850.1| hypothetical protein SELMODRAFT_233622 [Selaginella moellendorffii]
 gb|EFJ18035.1| hypothetical protein SELMODRAFT_233622 [Selaginella moellendorffii]
Length=925

 Score =   466 bits (1198),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 317/747 (42%), Positives = 435/747 (58%), Gaps = 58/747 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAP--SGWSASKDPC--TWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             D AV+   L  +      + W  S DPC   W ++ C      V ++ +++  + G +  
Sbjct  33    DLAVLQSFLQGIDQKSVLTNWKNS-DPCGDRWIHIKCTGAA--VTALEMNNLQLGGTVTP  89

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             ++ +L+SL SL +Q+N  +G LPS + ++SL   Y   N F +IP DF  GL N+    +
Sbjct  90    DINKLSSLDSLQLQQNGFTGSLPSLSGLTSLSRAYFGGNSFDTIPGDFFTGLTNVMEIFL  149

Query  2287  SDNGELSP--WQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
              DN   S   W + + +   ++L +   +N ++ G IP+F  +  +L+NL L+YN L G 
Sbjct  150   EDNHVNSTPGWSLPADIQHCSNLQTLSITNTTLGGTIPDFLGTMSSLKNLYLAYNTLRGG  209

Query  2113  LPGSFGSSEIqnlwlnnqqqgL--SGTIDVISSMTRLSQVWLQANAFTGPI-PDLSKCVN  1943
             +P +F  S +     NNQQ     +G+ID ++SM  L+ +WL  N F+G I P L    +
Sbjct  210   IPATFAGSNLIKFQANNQQGNEPLTGSIDPVASMQSLTTLWLHVNQFSGVIPPGLGNLSS  269

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDT  1763
             L DL+L DN+  GVVP SLT LP L+N  ++ N L+GPMP  G       G TN FC+ T
Sbjct  270   LQDLKLNDNEFVGVVPQSLTQLPALKNFTIKGNMLVGPMPELGFSYD---GSTNGFCQAT  326

Query  1762  PG-PCDPQVTALLAFAGGL-GYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQR  1589
             PG PCDP+VTALL FAG    +      +WKGND C +W  I C      VTT+ L N +
Sbjct  327   PGLPCDPRVTALLDFAGAADAFTSPCMTTWKGNDPC-SWTGINC--VRGTVTTIQLPNCQ  383

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              +G+IS A + LT L  L L +N+++G +P ++  +P L+ L++  N LS PLP FP  +
Sbjct  384   LNGSISTALANLTGLTALDLRNNHISGLLPAAIVQIPTLRNLNLFRNRLSGPLPPFPSGL  443

Query  1408  NISFGGNLL----------LEKTVATGRGSPGSGQTENGSSMSARMfvv----vvivvvi  1271
              ++   N L             + ++G  +PGS    +G+  S R  V      V VV  
Sbjct  444   QVNVDENPLTPVSPASGSGASPSGSSGTQAPGSPNAPSGAEQSTRRKVSPAAIAVPVVGA  503

Query  1270  vvlvvlfvFYKCYMKREHKRFGRAKSPEKI----------KSTQMLKTN-----------  1154
             V  V   V      +R+  RF R +S   I          + T  L T+           
Sbjct  504   VAAVAAAVSVFVMCRRKRPRFMRVQSSSAIVVHPRDSSFERETVKLPTSVAKEGHSGPSE  563

Query  1153  ---EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                E     I I VL KATN FSE S+LG GG+GVVY G+LD+GTK+AVK+M+    + K
Sbjct  564   VRVETGNLVISIHVLRKATNGFSENSILGRGGFGVVYKGELDDGTKIAVKRMESAVVNNK  623

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             G++EFQAEI  L+KVRH++LVAL+GYCI+ ++ LLVYEYM  GTL  HLFE+ KHG+  L
Sbjct  624   GLSEFQAEIQVLTKVRHRHLVALLGYCIHGNEKLLVYEYMPQGTLSQHLFEFAKHGYHHL  683

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TWK R++IA DVARGIEYLH L H+SFIHRD+K SNILL+D + AKVADFGLVK AP+ K
Sbjct  684   TWKHRLSIALDVARGIEYLHGLAHKSFIHRDLKPSNILLDDTLHAKVADFGLVKLAPEGK  743

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
               VETR+AGTFGYLAPEYA TGRVT K
Sbjct  744   VSVETRLAGTFGYLAPEYAVTGRVTTK  770


 Score =   119 bits (297),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 2/146 (1%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
            +S+   L G    L       G    KVDVY+FGV+LME+ITG++A+D +  +ET HL T
Sbjct  744  VSVETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRQALDTSRSEETMHLPT  803

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       + ++DP L+  ++ FESI  VAELA +CT  + Y+RP+M H VNVL P
Sbjct  804  WFKRMRVNRETFRSSLDPVLEVTDEEFESICSVAELAGYCTMREPYQRPDMSHAVNVLAP  863

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSL  184
                W+     +  E  GG DL +SL
Sbjct  864  MVERWKPSMDFDAEE--GGIDLGLSL  887



>ref|XP_007160467.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
 gb|ESW32461.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
Length=918

 Score =   465 bits (1197),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 319/740 (43%), Positives = 433/740 (59%), Gaps = 51/740 (7%)
 Frame = -2

Query  2641  CDDAAVMSKLLAALS-PAPSGWSASKDPCTWTNVNCDKPTGNVVSINIDSQSISGNLPSE  2465
             C DA ++  L   ++ P    W+  +D C W ++ CD  +  V +I I +Q++ G LP E
Sbjct  30    CQDAEIIGILKNTINVPVSFEWTG-QDICKWKHIVCDV-SKRVKAIQIGNQNLQGTLPKE  87

Query  2464  LTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSIS  2285
             L  L +L     Q NSL+G  P  +   SL++  +  N F+  P DF  G+ +L+   I 
Sbjct  88    LVMLTALTRFECQGNSLTGSFPYLS--KSLQKFIIHDNNFNLFPQDFFKGMSSLQEVRID  145

Query  2284  DNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDS---FPNLQNLRLSYNNLTGS  2114
             DN   S W I S L +  +L  F A +A I+G IP+FF     F  L  L LS N L G 
Sbjct  146   DN-PFSQWNIPSSLKDCVALQIFSAQSAGISGTIPDFFGRDGPFAGLVFLALSDNFLEGP  204

Query  2113  LPGSFGSSEIqnlwl--nnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCVNL  1940
             LP S   S I+NL +   N    L+GT+ V+  M  L Q+W   NAFTGPIP+L +   L
Sbjct  205   LPASLSDSSIENLLVNGQNSNSKLNGTLWVLRRMRSLKQIWANGNAFTGPIPNLQQHDQL  264

Query  1939  FDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKV---ILGDTNSFCK  1769
             +D+ L DNQLTGVVP SL  LPNL+ + L NN L G  P F   V V   +    N +C 
Sbjct  265   YDVNLRDNQLTGVVPPSLVALPNLKFVNLTNNLLQGSPPRFKIGVGVDNNMDKGRNQYCT  324

Query  1768  DTPG-PCDPQVTALLAFAGGLGYPITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGN  1595
             +  G PC P V  LL+    LGYP+ LAQSW+GND C N W  I C   G NV+ +N  N
Sbjct  325   NVAGQPCSPLVNLLLSIVEPLGYPLKLAQSWQGNDPCANRWTGIVC--SGGNVSVINFQN  382

Query  1594  QRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpP  1415
                SGTI P F+ LTS+  ++L +N++TG +P  L +LP+LQ LDVSNN+L   +PSFP 
Sbjct  383   MGLSGTICPCFASLTSVTKIFLANNDITGTVPNELASLPNLQELDVSNNHLYGKVPSFPK  442

Query  1414  AVNISFGGNLLLEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKC  1235
              V   + GN  + K V   + S       NG++ S  + + V+++V I+++VV+ V    
Sbjct  443   DVVFRYEGNPDIGKKVQQTQTS----SKGNGNNSSIAVIIGVIVIVAILLVVVVGVLLLV  498

Query  1234  YMKREHKRFGRAK--------------SPEKIKS--------------TQMLKTNEIMGT  1139
               +R+ K  G+ +              +  KI                T  +   E    
Sbjct  499   KFRRKGKYAGKLQNLTTALVPPHYGDGNAAKISGGGHGEGNVSSLLSPTHSVYQGEASNM  558

Query  1138  AIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKD-GATHTKGMNEFQA  962
              I IQ+L + TN FSEE++LG GG+G VY G+L +GTK+AVK+M+  G    KG++EF A
Sbjct  559   LISIQILREVTNNFSEENILGKGGFGTVYKGELHDGTKIAVKRMQSAGLVDQKGLSEFTA  618

Query  961   EIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVT  782
             EIA L+KVRHKNLVAL+G+C++ ++ LLVYE M  G L  HL +WK+ G  PL WK R++
Sbjct  619   EIAVLTKVRHKNLVALLGFCLDGNERLLVYECMPQGALSKHLVDWKEAGLKPLEWKTRLS  678

Query  781   IAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRV  602
             IA DVARG+EYLH L  Q FIHRD+K SNILL DD+ AKV+DFGLV+ AP+ K+  +TR+
Sbjct  679   IALDVARGVEYLHGLAQQIFIHRDLKPSNILLGDDMHAKVSDFGLVRLAPEGKTSFQTRL  738

Query  601   AGTFGYLAPEYATTGRVTKK  542
             AGTFGY+APEYA TGR+T K
Sbjct  739   AGTFGYMAPEYAATGRLTTK  758


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S +  L G    +       G    KVDVY+FGV+LME++TG+KA+D++LP+E  HLVTW
Sbjct  733  SFQTRLAGTFGYMAPEYAATGRLTTKVDVYSFGVILMEMVTGRKALDDSLPEENIHLVTW  792

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F K++    +    IDPT+  DE+T  S++ VA LA HC     Y+RP+M HVVNVL P 
Sbjct  793  FRKMLTNKDSFPTIIDPTIKLDEETLVSVNTVAGLAGHCCARDPYQRPDMSHVVNVLSPL  852

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+ L P   V++  G D +MSLP
Sbjct  853  VQVWKPLEP--TVDEIYGIDFDMSLP  876



>ref|XP_002989354.1| hypothetical protein SELMODRAFT_129592 [Selaginella moellendorffii]
 gb|EFJ09628.1| hypothetical protein SELMODRAFT_129592 [Selaginella moellendorffii]
Length=935

 Score =   465 bits (1196),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 316/747 (42%), Positives = 433/747 (58%), Gaps = 58/747 (8%)
 Frame = -2

Query  2635  DAAVMSKLLAALSPAP--SGWSASKDPC--TWTNVNCDKPTGNVVSINIDSQSISGNLPS  2468
             D AV+   L  +      + W  S DPC   W ++ C      V ++ +++  + G +  
Sbjct  43    DLAVLQSFLQGIDQKSVLTNWKNS-DPCGDRWIHIKCTGAA--VTALEMNNLQLGGTVTP  99

Query  2467  ELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSI  2288
             ++ +L+SL SL +Q+N  +G LPS + ++SL   Y   N F +IP DF  GL N+    +
Sbjct  100   DINKLSSLDSLQLQQNGFTGSLPSLSGLTSLSRAYFGGNSFDTIPGDFFTGLTNVMEIFL  159

Query  2287  SDN--GELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGS  2114
              DN       W + + +   ++L +   +N ++ G IP F  +  +L+NL L+YN L G 
Sbjct  160   EDNHVNSTQGWSLPADIQHCSNLQTLSITNTTLGGTIPGFLGTMSSLKNLYLAYNTLRGG  219

Query  2113  LPGSFGSSEIqnlwlnnqqqgL--SGTIDVISSMTRLSQVWLQANAFTGPI-PDLSKCVN  1943
             +P +F  S +     NNQQ     +G+ID ++SM  L+ +WL  N F+G I P L    +
Sbjct  220   IPATFAGSNLIKFQANNQQGNEPLTGSIDPVASMQSLTTLWLHVNQFSGVIPPGLGNLSS  279

Query  1942  LFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDT  1763
             L DL+L DN+  GVVP SLT LP L+N  ++ N L+GPMP  G       G TN FC+ T
Sbjct  280   LQDLKLNDNEFVGVVPQSLTQLPALKNFTIKGNMLVGPMPELGFSYD---GSTNGFCQAT  336

Query  1762  PG-PCDPQVTALLAFAGGL-GYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQR  1589
             PG PCDP+VTALL FAG    +      +WKGND C +W  I C      VTT+ L N +
Sbjct  337   PGLPCDPRVTALLDFAGAADAFTSPCMTTWKGNDPC-SWTGINC--VRGTVTTIQLPNCQ  393

Query  1588  FSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAV  1409
              +G+IS A + LT L  L L +N+++G +P ++  +P L+ L++  N LS PLP FP  +
Sbjct  394   LNGSISTALANLTGLTALDLRNNHISGLLPAAIVQIPTLRNLNLFRNRLSGPLPPFPSGL  453

Query  1408  NISFGGNLL----------LEKTVATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlv  1259
              ++   N L             + ++G  +PGS    +G+  S R  V    V V VV  
Sbjct  454   QVNVDENPLTPVSPASGSGASPSGSSGTQAPGSPNAPSGAEQSTRRKVSPAAVAVPVVGA  513

Query  1258  vlfvFYK----CYMKREHKRFGRAKSPEKI----------KSTQMLKTN-----------  1154
             V  V          +R+  RF R +S   I          + T  L T+           
Sbjct  514   VAAVAAAVSVFVMCRRKRPRFMRVQSSSAIVVHPRDSSFERETVKLPTSVAKEGHSGPSE  573

Query  1153  ---EIMGTAIKIQVLEKATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTK  983
                E     I I VL KATN FSE S+LG GG+GVVY G+LD+GTK+AVK+M+    + K
Sbjct  574   VRVETGNLVISIHVLRKATNGFSENSILGRGGFGVVYKGELDDGTKIAVKRMESAVVNNK  633

Query  982   GMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPL  803
             G++EFQAEI  L+KVRH++LVAL+GYCI+ ++ LLVYEYM  GTL  HLFE+ KHG+  L
Sbjct  634   GLSEFQAEIQVLTKVRHRHLVALLGYCIDGNEKLLVYEYMPQGTLSQHLFEFAKHGYHHL  693

Query  802   TWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDK  623
             TWK R++IA DVARGIEYLH L H+SFIHRD+K SNILL+D + AKVADFGLVK AP+ K
Sbjct  694   TWKHRLSIALDVARGIEYLHGLAHKSFIHRDLKPSNILLDDTLHAKVADFGLVKLAPEGK  753

Query  622   SFVETRVAGTFGYLAPEYATTGRVTKK  542
               VETR+AGTFGYLAPEYA TGRVT K
Sbjct  754   VSVETRLAGTFGYLAPEYAVTGRVTTK  780


 Score =   119 bits (297),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 85/146 (58%), Gaps = 2/146 (1%)
 Frame = -3

Query  621  LSLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVT  442
            +S+   L G    L       G    KVDVY+FGV+LME+ITG++A+D +  +ET HL T
Sbjct  754  VSVETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRQALDTSRSEETMHLPT  813

Query  441  WFHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGP  262
            WF ++       + ++DP L+  ++ FESI  VAELA +CT  + Y+RP+M H VNVL P
Sbjct  814  WFKRMRVNRETFRSSLDPVLEVTDEEFESICSVAELAGYCTMREPYQRPDMSHAVNVLAP  873

Query  261  FAHNWRSLRPEEIVEKFGGFDLNMSL  184
                W+     +  E  GG DL +SL
Sbjct  874  MVERWKPSMDFDAEE--GGIDLGLSL  897



>ref|XP_009412894.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=888

 Score =   461 bits (1187),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 308/711 (43%), Positives = 415/711 (58%), Gaps = 74/711 (10%)
 Frame = -2

Query  2566  DPC---TWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPLPS  2396
             DPC    W +V C      V  I + S  +SG LP    +L+ L ++  Q+N  +G LPS
Sbjct  54    DPCGNPRWPHVGCSG--SRVTQIQLQSMGLSGPLPQNFNKLSMLTNIGFQRNKFTGKLPS  111

Query  2395  FANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN--GELSPWQISSYLAESTSLG  2222
             F  +SSL+  YLD N+F +IP DF +GL NL++ ++  N   + + W + S LA S  L 
Sbjct  112   FNGLSSLQRAYLDLNQFDTIPSDFFVGLDNLQVLTLDHNPLNQSTGWTLPSDLANSAQLM  171

Query  2221  SFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl-wlnnqqqgLS  2045
             +      ++ G +P F  S  +L  LR++ N  TG +P S+    +Q L   + +  GL+
Sbjct  172   NLSLVECNLVGPLPEFLGSMKSLTALRIAQNKFTGGIPTSYSGMPLQVLWLNDQEGAGLT  231

Query  2044  GTIDVISSMTRLSQVWLQANAFTGPIP-DLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNL  1868
             G+ID+I+SMT LS   +  N F+GPIP  +    +L  L L  NQ  G+VP +L  LP L
Sbjct  232   GSIDIIASMTMLSDAVVYGNQFSGPIPSSIGSLTSLKRLLLNSNQFVGLVPETLMSLPML  291

Query  1867  ENIRLQNNKLLGPMPLFGNKVKVILGD----TNSFCKDTPG-PCDPQVTALLAFAGGLGY  1703
             +++RL  N L+GP+P      K    D     NSFC+ TPG PC PQV ALL F   + Y
Sbjct  292   QSLRLDKNMLMGPIP------KASFSDFNYAHNSFCQSTPGVPCSPQVDALLEFLEEVNY  345

Query  1702  PITLAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLN  1526
             P  L +SW GND C   W  I+C   GK V+ +NL N + SGTIS +  +L SL NL L 
Sbjct  346   PSKLTRSWSGNDPCAGPWFGISCS-DGK-VSIINLQNSQLSGTISESLGKLDSLMNLILK  403

Query  1525  DNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSP  1346
              NNLTGPIP S+T+L  L+ LD+S NNLSPP+P FP  V +   GN   +  +AT  G+ 
Sbjct  404   GNNLTGPIPPSMTSLKSLKTLDLSYNNLSPPVPQFPSTVTVLLEGNKFAKIIIATVVGA-  462

Query  1345  GSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHK---------RFGRAKS  1193
                                         V+LF     Y +R+ K            R  +
Sbjct  463   ---------------------------SVILFAILFWYCRRKGKTNVTAVPNSSILRLTN  495

Query  1192  PEKIKSTQMLKTNEIMGTA--------------IKIQVLEKATNFFseesvlgsggygvv  1055
             P+  +S+  L     +G                I IQVL  AT  F+ E+VLG GG+GVV
Sbjct  496   PDDPESSADLTPKITIGIGDHSGTPAINSGNLTITIQVLRVATKNFAPENVLGRGGFGVV  555

Query  1054  ylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHKMLLV  875
             Y G+L +GT +AVK+M+ G  + K  +EF +EIA LSKVRH+NLV+++GY   D++ LLV
Sbjct  556   YKGELHDGTLIAVKRMESGVPNNKAFDEFHSEIAVLSKVRHRNLVSILGYSAEDNERLLV  615

Query  874   YEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDIKSSN  695
             YEYM HG L  HLF+WK+ G +PL WK+R+TIA DVARG+EYLH L +QSFIHRD+KSSN
Sbjct  616   YEYMHHGALSKHLFQWKEQGLEPLCWKKRLTIALDVARGMEYLHCLANQSFIHRDLKSSN  675

Query  694   ILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             ILL DD RAK++DFGLVK A ++K+ + TR+AGTFGYLAPEYA TG+VT K
Sbjct  676   ILLRDDYRAKISDFGLVKFATNNKASIATRLAGTFGYLAPEYAVTGKVTTK  726


 Score =   116 bits (291),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 77/124 (62%), Gaps = 0/124 (0%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G+   KVDV++FG+VLME++TG  A+DE  PDE+C+L +W
Sbjct  701  SIATRLAGTFGYLAPEYAVTGKVTTKVDVFSFGIVLMELLTGMMALDEKRPDESCYLASW  760

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++   S +L+  +DP++D  ++TFE +S +AELA HC   + ++RP+M H V VL P 
Sbjct  761  FCRMKASSEDLRSIVDPSIDITDETFEGVSIIAELAGHCAAREPHQRPDMGHAVGVLAPL  820

Query  258  AHNW  247
               W
Sbjct  821  VEKW  824



>ref|XP_010110337.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXC25986.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=826

 Score =   458 bits (1179),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 296/660 (45%), Positives = 393/660 (60%), Gaps = 56/660 (8%)
 Frame = -2

Query  2362  LDSNEFSSIPPDFLLGLPNLRIFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVI  2183
             L +N FSSIP DF  G+ +L+   I DN   + W+I   L  ++++ +F +++A++TG I
Sbjct  2     LSNNMFSSIPSDFFAGMTSLQSVEI-DNNPFAAWEIPEALKNASAIQNFSSNSANVTGRI  60

Query  2182  PNFF--DSFPNLQNLRLSYNNLTGSLPGSFGSSEIqn--lwlnnqqqgLSGTIDVISSMT  2015
             P FF  D+FP L  L L++N L G LP SF  S+IQ+  +        LSG IDV+ +M+
Sbjct  61    PEFFGADNFPGLSILHLAFNRLEGGLPSSFSGSQIQSLWVNGQESSGKLSGRIDVVQNMS  120

Query  2014  RLSQVWLQANAFTGPIPDLSKCVNLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLL  1835
              L +VWL +NAF+G +PD S   +L  L L DN  TG VP+SL GL +L+ + L NN   
Sbjct  121   LLKEVWLHSNAFSGSLPDFSGLKDLESLSLRDNLFTGPVPLSLLGLKSLKVVNLTNNLFQ  180

Query  1834  GPMPLFGNKVKV-ILGDTNSFCKDTPGPCDPQVTALLAFAGGLGYPITLAQSWKGNDACQ  1658
             GP+P FG  V V +  D+NSFC   PGPCD Q   LL+ A  + YP   A++WKGND C 
Sbjct  181   GPVPEFGTGVSVDMTKDSNSFCLPAPGPCDWQGNVLLSIAKSMDYPRRFAENWKGNDVCA  240

Query  1657  NWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLP  1478
             +W  ++C     NVT +N      +GTISP F    SL+ + L +NNLTG IP  ++TLP
Sbjct  241   DWIGVSC--SNGNVTVINFEKMGLTGTISPDFGLFKSLKRVVLANNNLTGTIPEEISTLP  298

Query  1477  HLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEK-----TVATGRGSPGSGQTENGSSM  1313
              L  LDVSNN L   +PSF   V ++  GN  + K     +V     SP S    N  S 
Sbjct  299   SLTELDVSNNLLYGKVPSFKSNVIVNTNGNPDIGKEKSSSSVGEAGTSPTSTNPTNAGSE  358

Query  1312  SARMfvvvvivvvivvlvvlfvFYK-------------CYMKREHKRFGRAKSP------  1190
             +             ++ V++F                 C  K + KR  R +SP      
Sbjct  359   NGGGSGRSGKKSSSLIGVIVFSVIGGVFVIFLIALLVFCVYKTKQKRLSRVQSPNAMGSD  418

Query  1189  -EKIKST--------------QMLKTNEIMG---------TAIKIQVLEKATNFFseesv  1082
              E +K T              Q L  +E+ G           I IQVL+  T+ FS E++
Sbjct  419   NESVKITVAGSSVSVGAVSDAQTLPGSEVGGDIQMVEAGNMVISIQVLKNVTSNFSHENI  478

Query  1081  lgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYC  902
             LG GG+G VY G+L +GTK+AVK+M+ G    KG+ EF++EIA L+KVRH++LVAL+GYC
Sbjct  479   LGQGGFGTVYKGELHDGTKIAVKRMESGVIAGKGLGEFKSEIAVLTKVRHRHLVALLGYC  538

Query  901   INDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSF  722
             ++  + LLVYEYM  GTL  HLF W + G  PL WK+R+TIA DVARG+EYLH L HQSF
Sbjct  539   LDGLERLLVYEYMPQGTLSRHLFNWPEEGLKPLKWKKRLTIALDVARGVEYLHGLAHQSF  598

Query  721   IHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTGRVTKK  542
             IHRD+K SNILL DD+RAKVADFGLV+ AP+ K+ +ETR+AGTFGYLAPEYA TGRVT K
Sbjct  599   IHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKASIETRIAGTFGYLAPEYAVTGRVTTK  658


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 88/146 (60%), Gaps = 2/146 (1%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   + G    L       G    KVDV++FGV+LME+ITG+KA+DET P+E+ HLVTW
Sbjct  633  SIETRIAGTFGYLAPEYAVTGRVTTKVDVFSFGVILMELITGRKALDETQPEESMHLVTW  692

Query  438  FHKIIRKSHNLQKAIDPTLDPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVNVLGPF  259
            F ++       +KAIDPT D +E+T  SIS VAELA HC   + Y+RP+M H VNVL   
Sbjct  693  FRRMHINKDTFRKAIDPTTDLNEETLASISTVAELAGHCCAREPYQRPDMGHAVNVLSSL  752

Query  258  AHNWRSLRPEEIVEKFGGFDLNMSLP  181
               W+    E+  E   G DL MSLP
Sbjct  753  VELWKP--SEQSSEDIYGIDLEMSLP  776



>ref|XP_002980529.1| hypothetical protein SELMODRAFT_233539 [Selaginella moellendorffii]
 gb|EFJ18180.1| hypothetical protein SELMODRAFT_233539 [Selaginella moellendorffii]
Length=935

 Score =   459 bits (1181),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 310/726 (43%), Positives = 423/726 (58%), Gaps = 52/726 (7%)
 Frame = -2

Query  2581  WSASKDPC--TWTNVNCDKPTGNVVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSG  2408
             WS + DPC   W +V C   +  V  I++    + G +   L +L++L  L +Q N+LSG
Sbjct  46    WSGT-DPCGAAWKHVQCRGKS--VTGIDVAFLGLQGIVSPSLNRLSNLEYLGMQGNALSG  102

Query  2407  PLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN--GELSPWQISSYLAES  2234
              +PS A M++L+  Y D+N+FSSIP DF  GL +L    + +N     + W++   ++  
Sbjct  103   SMPSLAGMANLKIAYFDNNDFSSIPGDFFAGLESLEAIYLDNNPLNGTAGWELPVDISHL  162

Query  2233  TSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSE-Iqnlwlnnqq  2057
              +L +   +N+S+ G IP F  + P+L+ L L+YN LTG +P SF SS  +Q    N Q 
Sbjct  163   GALANLSLTNSSVVGSIPAFLGAMPHLKVLNLAYNRLTGGIPPSFVSSNLVQLQANNMQG  222

Query  2056  qgLSGTIDVISSMTRLSQVWLQANAFTGPI-PDLSKCVNLFDLQLGDNQLTGVVPVSLTG  1880
               L+G ID +  M  L Q+WLQ N   G I P L   + L DL+L DN+LTG +P SL  
Sbjct  223   PVLTGPIDAVGGMGSLVQLWLQVNEIAGTIPPGLGNALALQDLKLNDNRLTGPIPASLAE  282

Query  1879  LPNLENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPG-PCDPQVTALLAFAGGLGY  1703
             LP L  + + NN+L+G +P F    KV L   N+FC+  PG  C   V  LL F G  GY
Sbjct  283   LP-LAILSVDNNELIGVLPAFKPATKV-LATGNNFCQAVPGLRCSHDVETLLEFIGEFGY  340

Query  1702  PITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLND  1523
             P ++  SWKG+D C  W  I CD  GK V+ ++L   +  G +SPA   LT+L  L LN 
Sbjct  341   PASIVSSWKGDDPCL-WTGIVCD-SGKRVSVIDLAGSQLVGRLSPALVNLTALTVLRLNG  398

Query  1522  NNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLLEKTVATGRGSP-  1346
             NN++G IP  LT++  LQ +D+ NNNLS  LP FP +V  +F GN LL +++      P 
Sbjct  399   NNISGGIPPVLTSMKSLQQVDLHNNNLSGDLPQFPESVKTNFQGNPLLLQSLPPVTSPPV  458

Query  1345  GSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSP--------  1190
                Q    S       +   +V  + +L +       + KR  KRF R + P        
Sbjct  459   APAQPSGSSGGGGAGLIAGPVVGAVSLLAIGLALSFLFYKRSEKRFVRVQGPTMVVHPRD  518

Query  1189  ----------------EKIKSTQMLKTN------------EIMGTAIKIQVLEKATNFFs  1094
                               + S  +++T             E     I I VL  AT  FS
Sbjct  519   SSSEDIVKIIVPGGAGNNVNSRSLVETASVNSNGTDVQVVEAGNLVISIHVLRNATRNFS  578

Query  1093  eesvlgsggygvvylGKLDNGTKVAVKKMK-DGATHTKGMNEFQAEIAFLSKVRHKNLVA  917
             EE+VLG GG+G VY G+LD+GT +AVK+M+      +KG++EF AEIA LSKVRH++LVA
Sbjct  579   EETVLGRGGFGAVYRGQLDDGTNIAVKRMEASSVVSSKGVSEFHAEIAVLSKVRHRHLVA  638

Query  916   LVGYCINDHKMLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSL  737
             L+GYCI+ ++ LLVYEY+  G L HHLFE+++    PL WK+R+ IA DVARG+EYLH L
Sbjct  639   LLGYCIDGNEKLLVYEYLPQGALSHHLFEYRRMRLKPLEWKRRLAIALDVARGMEYLHGL  698

Query  736   THQSFIHRDIKSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYATTG  557
              ++SFIHRD+K SNILL+DD+RAKVADFGLVK AP+ K  VETR+AGTFGYLAPEYA TG
Sbjct  699   AYKSFIHRDLKPSNILLDDDLRAKVADFGLVKLAPEGKYSVETRLAGTFGYLAPEYAVTG  758

Query  556   RVTKKS  539
             RVT K+
Sbjct  759   RVTTKA  764


 Score =   111 bits (278),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 87/151 (58%), Gaps = 7/151 (5%)
 Frame = -3

Query  618  SLRHELLGHLVILHQSMLQQGE*QKKVDVYAFGVVLMEIITGKKAVDETLPDETCHLVTW  439
            S+   L G    L       G    K DV++FGVVL+E+I+G++A+DE+ P+E  HLVTW
Sbjct  738  SVETRLAGTFGYLAPEYAVTGRVTTKADVFSFGVVLLELISGRRALDESQPEENMHLVTW  797

Query  438  FHKIIRKS--HNLQKAIDPTL---DPDEQTFESISKVAELAAHCTTNKYYRRPNMEHVVN  274
            + +I   S   +L + IDP L   D     F S+  V+ELA HCT  + Y+RP+M H V+
Sbjct  798  YRRITSSSSKESLLRIIDPVLGVGDVTGDVFHSVYTVSELARHCTAREPYQRPDMGHAVS  857

Query  273  VLGPFAHNWRSLRPEEIVEKFGGFDLNMSLP  181
            VL P    W+    ++  E+  G DL+++LP
Sbjct  858  VLSPLVDQWKP--ADQDGEESAGIDLSLTLP  886



>ref|XP_002530240.1| protein binding protein, putative [Ricinus communis]
 gb|EEF32146.1| protein binding protein, putative [Ricinus communis]
Length=607

 Score =   442 bits (1137),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 310/707 (44%), Positives = 393/707 (56%), Gaps = 144/707 (20%)
 Frame = -2

Query  2644  FC----DDAAVMSKLL-AALSPAPSGWSA--SKDPCTWTNVNCDKPTGNVVSINIDSQSI  2486
             FC    DD+A M KL   AL P P GWS+  + + C+W  VNCD  + +V+SI +  +++
Sbjct  27    FCYSSADDSAAMLKLAKEALHPTPPGWSSRNANNYCSWDGVNCD--SNHVISIYLSKKNL  84

Query  2485  SGNLPSELTQLASLRSLSVQKNSLSGPLPSFANMSSLEELYLDSNEFSSIPPDFLLGLPN  2306
             SG LPSEL+ L+ L+ LS+  N LSGP PS  N++ L ELY+ S +FS+           
Sbjct  85    SGFLPSELSTLSKLQYLSLDHNRLSGPFPSLGNLTYLRELYIGSKDFST-----------  133

Query  2305  LRIFSISDNGELSPWQISSYLAESTSLGSFFASNASITGVIPNFFDSFPNLQNLRLSYNN  2126
                                                +I G +P+ FDS P+LQ L +S NN
Sbjct  134   -----------------------------------NIIGTLPDIFDSLPSLQQLIISENN  158

Query  2125  LTGSLPGSFGSSEIqnlwlnnqqqgLSGTIDVISSMTRLSQVWLQANAFTGPIPDLSKCV  1946
             LTG LP S  +S IQ L L NQ  GLSGTI+V+SSMTRL++VWLQ N FT PIPDLS C 
Sbjct  159   LTGPLPASLANSAIQFLNLGNQLIGLSGTINVLSSMTRLTKVWLQRNQFTSPIPDLSACR  218

Query  1945  NLFDLQLGDNQLTGVVPVSLTGLPNLENIRLQNNKLLGPMPLFGNKVKVIL-GDTNSFCK  1769
             NL D    +NQL G+VP SL   PNL+N+ L +NKL GP P F   V V L   +N+FC+
Sbjct  219   NLSDFLPSENQLRGMVPASLVLHPNLQNVSLSHNKLQGPAPNFSRNVNVDLYSSSNNFCE  278

Query  1768  DTPGP-CDPQVTALLAFAGGLGYPITLAQSWKGNDACQNWAFITCDPQGKNVTTVNLGNQ  1592
             +  G  CDPQVTA L  AG LGYP  ++ SWKGNDAC+NW FITC+ Q   +  VN G  
Sbjct  279   NKIGALCDPQVTATLEIAGALGYPDIMSDSWKGNDACKNWLFITCNDQNI-IIIVNFGKL  337

Query  1591  RFSGTISPAFSQLTSLRNLYLNDNNLTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPA  1412
               +GTIS AF++LT LR+L+LNDNNLTGPIP SLT L  LQVLDVSNNNL+  +PSF  +
Sbjct  338   HLTGTISTAFAKLTGLRDLFLNDNNLTGPIPDSLTKLTQLQVLDVSNNNLTGKIPSFRFS  397

Query  1411  VNISFGGNLLLEKTVATGRGSPG--SGQTENGS---SMSARMfvvvvivvvivvlvvlfv  1247
             VN++            T  G+PG     T NG    ++  R+                  
Sbjct  398   VNLT------------TKPGNPGLLEMDTPNGGKKFNVKGRL--------------GKSR  431

Query  1246  FYKCYMKREHKRFGRAKSPEKIKSTQMLKTNEIMGTAIKIQVLEKATNFFseesvlgsgg  1067
               K  +     R G  +          ++   +M   I I VL++AT+ FSE  +LG+GG
Sbjct  432   KVKLLVNNAATRNGSGRDDR--SDCHFIQGGNVM---IPINVLQQATDNFSESRILGTGG  486

Query  1066  ygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVRHKNLVALVGYCINDHK  887
             +GVVY G++ +GTK+AVKKM+  A  T+G N FQAE+A L+K                  
Sbjct  487   FGVVYEGEIHDGTKIAVKKMEARAMVTQGGNGFQAEVAVLTK------------------  528

Query  886   MLLVYEYMSHGTLGHHLFEWKKHGFDPLTWKQRVTIAWDVARGIEYLHSLTHQSFIHRDI  707
                                             R  IA DVA G+EYLH L  Q FIHRD+
Sbjct  529   --------------------------------RANIALDVAHGVEYLHKLVQQRFIHRDL  556

Query  706   KSSNILLNDDIRAKVADFGLVKKAPDDKSFVETRVAGTFGYLAPEYA  566
             KSS ILL DD+ AK+ DFGLVK  PDDKS +ETRVAGTFGYL PEYA
Sbjct  557   KSSYILLGDDMTAKLGDFGLVKNVPDDKSSLETRVAGTFGYLVPEYA  603



>ref|XP_009629429.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=932

 Score =   447 bits (1151),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 302/732 (41%), Positives = 425/732 (58%), Gaps = 66/732 (9%)
 Frame = -2

Query  2566  DPC---TWTNVNCDKPTGN-VVSINIDSQSISGNLPSELTQLASLRSLSVQKNSLSGPLP  2399
             DPC    W ++ C   +GN +  I +    + G+LP +  QL+ L +L +Q+N  SG LP
Sbjct  54    DPCGPQAWPHIIC---SGNRIQQIQVMGLGLKGSLPQKFNQLSKLTNLGLQRNQFSGKLP  110

Query  2398  SFANMSSLEELYLDSNEFSSIPPDFLLGLPNLRIFSISDN--GELSPWQISSYLAESTSL  2225
             SF+ +S L   +LD N+F SIP DF  GL +L + ++ DN     + W + S L  S  L
Sbjct  111   SFSGLSELRYAFLDFNQFDSIPSDFFNGLVSLEVLALDDNPLNATTGWSLPSELQGSAQL  170

Query  2224  GSFFASNASITGVIPNFFDSFPNLQNLRLSYNNLTGSLPGSFGSSEIqnl-wlnnqqqgL  2048
              +    N ++ G +P F  +  +L  L LS N L+G +PG+F  SE++ L   +    G+
Sbjct  171   TNLTLVNCNLAGFLPEFLGNMSSLDVLLLSKNRLSGPIPGTFKDSELKMLWLNDQFGDGM  230

Query  2047  SGTIDVISSMTRLSQVWLQANAFTGPIP-DLSKCVNLFDLQLGDNQLTGVVPVSLTGLPN  1871
             SG+IDVIS+M  ++ +WL  N F+G IP  +   + L DL +  N L G++P SL  +P 
Sbjct  231   SGSIDVISTMGLMTSLWLHGNHFSGKIPKKIGSLIYLQDLNVNSNDLVGLIPESLANMP-  289

Query  1870  LENIRLQNNKLLGPMPLFGNKVKVILGDTNSFCKDTPGP-CDPQVTALLAFAGGLGYPIT  1694
             + ++ L NN  +GP+P F  K   +   +NSFC+   G  C+ +V ALL F   L YP  
Sbjct  290   ISHLDLNNNHFMGPIPNF--KATNVSYQSNSFCQTKIGALCNTEVMALLEFLDELNYPSK  347

Query  1693  LAQSWKGNDACQN-WAFITCDPQGKNVTTVNLGNQRFSGTISPAFSQLTSLRNLYLNDNN  1517
             L +SW GN+ C   W  ++CD   K V  +NL     SGT+SP+ ++L SL ++YL  NN
Sbjct  348   LVESWSGNNPCDGPWWGLSCDNNQK-VIVINLPKSNLSGTLSPSIAKLDSLTHIYLGSNN  406

Query  1516  LTGPIPVSLTTLPHLQVLDVsnnnlspplpsfpPAVNISFGGNLLL----------EKTV  1367
             ++G IP S T+L HL VLD+SNNN+S PLP F   V +   GN LL          +K  
Sbjct  407   ISGSIPSSWTSLKHLVVLDLSNNNISLPLPKFTGPVKLFVSGNSLLNSSPLVASPSQKNN  466

Query  1366  ATGRGSPGSGQTENGSSMSARMfvvvvivvvivvlvvlfvFYKCYMKREHKRFGRAKSPE  1187
              T  G+     T   SS  +++ + VV +    +LV L +    Y+++  +   R K P 
Sbjct  467   NTSPGASPYSSTNKPSSSKSKLVIFVVPIASFAILVFLAISLYVYVRK--RSVDRRKGPT  524

Query  1186  KI--------KSTQMLK---TNEIMGT-------------------------AIKIQVLE  1115
              +         S  M+K    +E  G+                          I +QVL 
Sbjct  525   SLVIHPRDPSDSDDMVKIAVADETKGSLSILTESGSASIHSGKYPMVEAGNLVISVQVLR  584

Query  1114  KATNFFseesvlgsggygvvylGKLDNGTKVAVKKMKDGATHTKGMNEFQAEIAFLSKVR  935
               T  F+ E+ LG GG+GVVY G+LD+GTK+AVK+M+ G   +K  +EFQAEI+ LSKVR
Sbjct  585   NVTKNFAPENELGRGGFGVVYKGELDDGTKIAVKRMEAGVISSKASDEFQAE