BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24825_g8_i1 len=1302 path=[5302:0-1301]

Length=1302
                                                                      Score     E

ref|XP_009789874.1|  PREDICTED: pectinesterase 1-like                   432   5e-146   
ref|XP_009626579.1|  PREDICTED: pectinesterase 1-like                   431   3e-145   
emb|CDP13860.1|  unnamed protein product                                425   4e-143   
ref|XP_004239982.1|  PREDICTED: pectinesterase 1-like                   423   3e-142   
ref|XP_006365351.1|  PREDICTED: pectinesterase 2-like                   419   1e-140   
ref|XP_004513231.1|  PREDICTED: pectinesterase 1-like                   414   8e-139   
ref|XP_006365350.1|  PREDICTED: pectinesterase 2-like                   413   3e-138   
ref|XP_007038213.1|  Pectinesterase, putative isoform 1                 410   5e-137   
gb|AHL24653.1|  Fra e 11.01 allergen                                    409   1e-136   
ref|XP_004239981.2|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    406   1e-135   
gb|KHN29928.1|  Pectinesterase PPME1-like protein                       402   4e-134   
ref|XP_007218171.1|  hypothetical protein PRUPE_ppa007533mg             401   1e-133   
ref|XP_004516439.1|  PREDICTED: pectinesterase PPME1-like               401   1e-133   
gb|KEH38558.1|  pectinesterase-like protein                             400   3e-133   
ref|XP_003518804.1|  PREDICTED: pectinesterase PPME1                    400   3e-133   
gb|KEH17536.1|  pectinesterase-like protein                             399   1e-132   
ref|XP_009362793.1|  PREDICTED: putative pectinesterase 63              398   2e-132   
ref|XP_009363888.1|  PREDICTED: putative pectinesterase 63              397   3e-132   
ref|XP_010038407.1|  PREDICTED: putative pectinesterase 63              397   4e-132   
ref|XP_011076543.1|  PREDICTED: pectinesterase 1-like                   396   1e-131   
ref|XP_007222175.1|  hypothetical protein PRUPE_ppa007766mg             395   1e-131   
ref|XP_008234142.1|  PREDICTED: putative pectinesterase 63              396   1e-131   
ref|XP_003516497.1|  PREDICTED: pectinesterase PPME1                    395   2e-131   
gb|KEH30561.1|  pectinesterase-like protein                             395   3e-131   
ref|XP_006572809.1|  PREDICTED: uncharacterized protein LOC100306...    395   3e-131   
ref|XP_003517875.1|  PREDICTED: pectinesterase PPME1                    395   4e-131   
ref|XP_008338559.1|  PREDICTED: putative pectinesterase 63              394   1e-130   
ref|XP_008219199.1|  PREDICTED: pectinesterase PPME1-like               393   2e-130   
ref|XP_003517889.1|  PREDICTED: pectinesterase PPME1-like               392   4e-130   
ref|XP_008234143.1|  PREDICTED: putative pectinesterase 63              392   4e-130   
ref|XP_011076542.1|  PREDICTED: pectinesterase 1-like                   391   1e-129   
sp|D8VPP5.1|AL11A_OLEEU  RecName: Full=Pectinesterase 1; AltName:...    390   3e-129   
ref|XP_006289810.1|  hypothetical protein CARUB_v10003415mg             389   5e-129   
ref|XP_007207766.1|  hypothetical protein PRUPE_ppa026550mg             389   9e-129   
ref|XP_007206641.1|  hypothetical protein PRUPE_ppa021246mg             389   9e-129   
sp|B2VPR8.1|AL11B_OLEEU  RecName: Full=Pectinesterase 2; AltName:...    388   2e-128   Olea europaea
ref|XP_007207707.1|  hypothetical protein PRUPE_ppa025119mg             387   4e-128   
ref|XP_002511045.1|  Pectinesterase-1 precursor, putative               387   5e-128   Ricinus communis
ref|XP_007215602.1|  hypothetical protein PRUPE_ppa007761mg             385   9e-128   
ref|XP_008234141.1|  PREDICTED: putative pectinesterase 63              386   1e-127   
ref|XP_008244214.1|  PREDICTED: putative pectinesterase 63              385   2e-127   
ref|XP_002871269.1|  ATPPME1                                            384   6e-127   
ref|NP_177152.2|  pectinesterase PPME1                                  383   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010087095.1|  Pectinesterase PPME1                               383   1e-126   
ref|XP_009136508.1|  PREDICTED: putative pectinesterase 63 isofor...    383   1e-126   
ref|XP_009122341.1|  PREDICTED: pectinesterase PPME1                    382   2e-126   
ref|XP_009363892.1|  PREDICTED: probable pectinesterase 48              382   2e-126   
emb|CDX70037.1|  BnaA10g23860D                                          382   3e-126   
ref|NP_568181.1|  putative pectinesterase 48                            382   3e-126   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98975.1|  BnaC09g48600D                                          382   5e-126   
ref|XP_004287800.1|  PREDICTED: probable pectinesterase 48-like         381   8e-126   
ref|XP_010452707.1|  PREDICTED: pectinesterase PPME1                    380   1e-125   
gb|KDP39968.1|  hypothetical protein JCGZ_03499                         380   2e-125   
ref|XP_010546425.1|  PREDICTED: pectinesterase PPME1-like               379   3e-125   
ref|XP_010423212.1|  PREDICTED: pectinesterase PPME1-like               379   6e-125   
emb|CDY14046.1|  BnaC02g01630D                                          379   7e-125   
gb|ADH82125.1|  pectinesterase                                          378   9e-125   
ref|XP_002511043.1|  Pectinesterase-1 precursor, putative               378   9e-125   Ricinus communis
ref|XP_006394480.1|  hypothetical protein EUTSA_v10004453mg             378   1e-124   
ref|XP_010491358.1|  PREDICTED: pectinesterase PPME1-like               378   2e-124   
ref|XP_011014352.1|  PREDICTED: pectinesterase PPME1-like               378   2e-124   
ref|XP_009125688.1|  PREDICTED: pectinesterase PPME1-like               377   2e-124   
ref|XP_002530224.1|  Pectinesterase U1 precursor, putative              377   2e-124   Ricinus communis
ref|XP_011076539.1|  PREDICTED: pectinesterase 1-like                   385   6e-124   
gb|KHG24685.1|  Pectinesterase PPME1 -like protein                      376   8e-124   
ref|XP_002318197.1|  hypothetical protein POPTR_0012s12720g             375   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_006399225.1|  hypothetical protein EUTSA_v10013901mg             375   1e-123   
ref|XP_010457627.1|  PREDICTED: putative pectinesterase 63              375   2e-123   
ref|XP_002318199.2|  hypothetical protein POPTR_0012s11460g             375   2e-123   Populus trichocarpa [western balsam poplar]
gb|KFK25126.1|  hypothetical protein AALP_AA8G069500                    375   2e-123   
ref|XP_002277388.2|  PREDICTED: putative pectinesterase 63              375   5e-123   Vitis vinifera
ref|XP_010523318.1|  PREDICTED: pectinesterase PPME1-like               373   1e-122   
emb|CAB87930.1|  pectin methyl-esterase-like protein                    372   2e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23044.1|  BnaC07g31430D                                          375   2e-122   
ref|XP_003634032.1|  PREDICTED: putative pectinesterase 63              371   6e-122   
ref|XP_007216116.1|  hypothetical protein PRUPE_ppa018812mg             371   6e-122   
gb|KDP22496.1|  hypothetical protein JCGZ_26327                         380   9e-122   
gb|AAG52566.1|AC010675_14  putative pectin methylesterase; 8433-9798    370   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511044.1|  Pectinesterase-3 precursor, putative               370   1e-121   Ricinus communis
dbj|BAB09012.1|  pectin methylesterase-like protein                     370   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109161.1|  Pectinesterase PPME1                               370   2e-121   
emb|CDP19851.1|  unnamed protein product                                368   2e-121   
gb|AAM65347.1|  pectin methyl-esterase-like protein                     367   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381893.1|  hypothetical protein POPTR_0006s20010g             368   1e-120   
emb|CAN78808.1|  hypothetical protein VITISV_030725                     368   1e-120   Vitis vinifera
ref|XP_002309337.2|  hypothetical protein POPTR_0006s20000g             367   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011040323.1|  PREDICTED: pectinesterase PPME1-like               367   2e-120   
gb|KFK27921.1|  hypothetical protein AALP_AA8G447400                    367   2e-120   
ref|XP_008229317.1|  PREDICTED: putative pectinesterase 63              366   7e-120   
ref|XP_010546117.1|  PREDICTED: pectinesterase PPME1-like isoform X2    364   2e-119   
ref|XP_010546116.1|  PREDICTED: pectinesterase PPME1-like isoform X1    364   3e-119   
ref|XP_002511042.1|  Pectinesterase-1 precursor, putative               364   3e-119   Ricinus communis
ref|XP_011033438.1|  PREDICTED: pectinesterase PPME1-like               364   5e-119   
ref|XP_006485036.1|  PREDICTED: pectinesterase PPME1-like               364   5e-119   
gb|KDO57708.1|  hypothetical protein CISIN_1g039631mg                   363   6e-119   
ref|XP_006437032.1|  hypothetical protein CICLE_v10031872mg             363   7e-119   
ref|XP_009362807.1|  PREDICTED: putative pectinesterase 63              362   2e-118   
ref|XP_002321778.1|  hypothetical protein POPTR_0015s12220g             362   2e-118   Populus trichocarpa [western balsam poplar]
ref|XP_008449624.1|  PREDICTED: pectinesterase PPME1-like               362   3e-118   
ref|XP_010523329.1|  PREDICTED: pectinesterase PPME1-like               361   6e-118   
ref|XP_002277202.1|  PREDICTED: putative pectinesterase 63              360   1e-117   Vitis vinifera
emb|CBI38549.3|  unnamed protein product                                361   1e-117   
ref|XP_010662219.1|  PREDICTED: putative pectinesterase 63              360   2e-117   
ref|XP_007153340.1|  hypothetical protein PHAVU_003G027000g             357   2e-116   
emb|CAN66682.1|  hypothetical protein VITISV_005088                     357   3e-116   Vitis vinifera
gb|KHN28380.1|  Putative pectinesterase 48                              354   5e-116   
ref|XP_007204487.1|  hypothetical protein PRUPE_ppa019696mg             355   1e-115   
gb|KFK25128.1|  hypothetical protein AALP_AA8G069700                    353   4e-115   
gb|AAX11262.1|  pectin methylesterase allergenic protein                353   4e-115   Kali turgidum [common saltwort]
gb|EYU20154.1|  hypothetical protein MIMGU_mgv1a008641mg                353   7e-115   
ref|XP_006286828.1|  hypothetical protein CARUB_v10003776mg             353   8e-115   
ref|XP_009130989.1|  PREDICTED: probable pectinesterase 50              353   9e-115   
ref|XP_004156059.1|  PREDICTED: pectinesterase PPME1-like               353   9e-115   
ref|XP_010491359.1|  PREDICTED: probable pectinesterase 50              352   1e-114   
ref|XP_009122340.1|  PREDICTED: probable pectinesterase 49              351   3e-114   
ref|XP_007038214.1|  Pectinesterase isoform 2                           349   4e-114   
ref|XP_006289803.1|  hypothetical protein CARUB_v10003407mg             350   7e-114   
ref|XP_007204920.1|  hypothetical protein PRUPE_ppa026195mg             349   8e-114   
gb|KGN48072.1|  hypothetical protein Csa_6G428290                       350   9e-114   
ref|XP_010491360.1|  PREDICTED: probable pectinesterase 49              350   1e-113   
ref|XP_009136509.1|  PREDICTED: putative pectinesterase 63 isofor...    349   1e-113   
ref|XP_010452708.1|  PREDICTED: probable pectinesterase 50              350   1e-113   
ref|XP_004140272.1|  PREDICTED: pectinesterase PPME1-like               350   1e-113   
gb|ACO34813.1|  Sal k 1 pollen allergen                                 349   1e-113   Kali turgidum [common saltwort]
ref|XP_006399226.1|  hypothetical protein EUTSA_v10013913mg             350   1e-113   
ref|XP_010423211.1|  PREDICTED: probable pectinesterase 49              349   2e-113   
ref|XP_010452709.1|  PREDICTED: probable pectinesterase 49              349   3e-113   
ref|NP_196359.1|  putative pectinesterase 49                            349   3e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81050.1|  BnaC03g03040D                                          349   3e-113   
ref|XP_010666416.1|  PREDICTED: pectinesterase 2-like                   349   3e-113   
ref|XP_002871270.1|  pectinesterase family protein                      348   4e-113   
ref|XP_010423208.1|  PREDICTED: probable pectinesterase 50 isofor...    348   6e-113   
gb|AAX11261.1|  pectin methylesterase allergenic protein                347   6e-113   Kali turgidum [common saltwort]
ref|XP_008228727.1|  PREDICTED: pectinesterase PPME1-like               347   1e-112   
ref|XP_004140273.1|  PREDICTED: pectinesterase PPME1-like               347   1e-112   
ref|XP_006280767.1|  hypothetical protein CARUB_v10026738mg             345   3e-112   
ref|NP_196360.1|  putative pectinesterase 50                            345   7e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KGN48071.1|  hypothetical protein Csa_6G428040                       344   1e-111   
ref|XP_002871271.1|  pectinesterase family protein                      345   1e-111   
ref|XP_009125689.1|  PREDICTED: probable pectinesterase 50              345   1e-111   
emb|CDY14045.1|  BnaC02g01620D                                          344   2e-111   
ref|XP_008449623.1|  PREDICTED: putative pectinesterase 63              344   3e-111   
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              343   4e-111   
ref|XP_011039979.1|  PREDICTED: putative pectinesterase 63              343   9e-111   
ref|XP_007204919.1|  hypothetical protein PRUPE_ppa020130mg             342   1e-110   
gb|AAT99258.1|  pectin-methyltransferase precursor                      341   3e-110   
ref|XP_006381567.1|  hypothetical protein POPTR_0006s13930g             341   5e-110   
ref|XP_002866448.1|  pectinesterase family protein                      339   6e-110   
ref|XP_011016271.1|  PREDICTED: putative pectinesterase 63              340   1e-109   
ref|NP_200976.1|  putative pectinesterase 63                            338   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666417.1|  PREDICTED: putative pectinesterase 63              339   1e-109   
gb|KFK25127.1|  hypothetical protein AALP_AA8G069600                    339   2e-109   
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              338   3e-109   
ref|XP_010667524.1|  PREDICTED: pectinesterase 2-like                   338   4e-109   
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              338   4e-109   
gb|KHN47850.1|  Putative pectinesterase 63                              335   1e-108   
gb|KHN15646.1|  Putative pectinesterase 63                              335   1e-108   
ref|XP_002277518.1|  PREDICTED: putative pectinesterase 63 isofor...    337   1e-108   Vitis vinifera
ref|XP_004289004.1|  PREDICTED: pectinesterase PPME1-like               337   1e-108   
gb|KDP39969.1|  hypothetical protein JCGZ_03500                         338   2e-108   
emb|CBI27759.3|  unnamed protein product                                337   2e-108   
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             338   4e-108   
ref|XP_010666418.1|  PREDICTED: pectinesterase 1-like                   335   7e-108   
ref|XP_008376964.1|  PREDICTED: probable pectinesterase 48              333   9e-108   
ref|XP_006572810.1|  PREDICTED: uncharacterized protein LOC100306...    333   1e-107   
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    332   9e-107   
gb|KHG22980.1|  Pectinesterase PPME1 -like protein                      332   1e-106   
ref|XP_010656088.1|  PREDICTED: putative pectinesterase 63 isofor...    332   2e-106   
ref|XP_006474682.1|  PREDICTED: putative pectinesterase 63-like         331   2e-106   
ref|XP_006452876.1|  hypothetical protein CICLE_v10010655mg             331   4e-106   
gb|KDO73799.1|  hypothetical protein CISIN_1g047018mg                   330   5e-106   
ref|XP_004169214.1|  PREDICTED: probable pectinesterase 48-like         330   8e-106   
ref|XP_004140274.1|  PREDICTED: probable pectinesterase 48-like         330   1e-105   
emb|CDP21978.1|  unnamed protein product                                325   3e-105   
gb|KDP33954.1|  hypothetical protein JCGZ_07525                         328   4e-105   
gb|KDP39971.1|  hypothetical protein JCGZ_03502                         334   4e-105   
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              325   2e-104   
ref|XP_008450966.1|  PREDICTED: putative pectinesterase 63              325   2e-103   
ref|XP_010252431.1|  PREDICTED: putative pectinesterase 63              323   4e-103   
ref|XP_002516214.1|  Pectinesterase-3 precursor, putative               323   4e-103   Ricinus communis
ref|XP_010483849.1|  PREDICTED: putative pectinesterase 63              320   1e-102   
ref|XP_009402033.1|  PREDICTED: putative pectinesterase 63              322   2e-102   
ref|XP_010109162.1|  putative pectinesterase 50                         319   1e-101   
ref|XP_004140271.1|  PREDICTED: pectinesterase PPME1-like               318   3e-101   
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         319   3e-101   
ref|XP_010259713.1|  PREDICTED: pectinesterase PPME1-like               316   6e-101   
ref|XP_007154546.1|  hypothetical protein PHAVU_003G127700g             315   2e-100   
ref|XP_010243601.1|  PREDICTED: pectinesterase PPME1-like               309   4e-98    
emb|CDY02121.1|  BnaA03g40460D                                          306   1e-97    
gb|EPS69429.1|  hypothetical protein M569_05334                         303   3e-96    
ref|XP_010259712.1|  PREDICTED: pectinesterase PPME1-like               300   9e-95    
ref|XP_003541318.1|  PREDICTED: putative pectinesterase 63-like         300   2e-94    
ref|XP_003609956.1|  Pectinesterase                                     298   1e-93    
ref|XP_009123158.1|  PREDICTED: probable pectinesterase 49              295   3e-93    
ref|XP_004174112.1|  PREDICTED: pectinesterase PPME1-like               295   7e-93    
gb|KHN07870.1|  Putative pectinesterase 63                              289   3e-90    
ref|XP_007219703.1|  hypothetical protein PRUPE_ppa024066mg             287   1e-89    
ref|XP_004174171.1|  PREDICTED: probable pectinesterase 49-like         280   2e-87    
ref|XP_007038215.1|  Pectin lyase-like superfamily protein, putat...    280   2e-87    
ref|XP_006843862.1|  hypothetical protein AMTR_s00007p00264370          282   3e-87    
ref|XP_009348902.1|  PREDICTED: putative pectinesterase 63 isofor...    277   7e-86    
ref|XP_007038216.1|  Pectin lyase-like superfamily protein, putat...    273   4e-85    
ref|NP_001234964.1|  uncharacterized protein LOC100306177 precursor     272   6e-85    
ref|XP_007219211.1|  hypothetical protein PRUPE_ppa017319mg             270   4e-84    
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             270   1e-82    
gb|KHG12918.1|  putative pectinesterase 53 -like protein                269   5e-82    
ref|XP_010262227.1|  PREDICTED: putative pectinesterase 63              262   1e-79    
ref|XP_010094410.1|  putative pectinesterase 53                         263   2e-79    
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         260   1e-78    
ref|XP_006349162.1|  PREDICTED: probable pectinesterase 53-like         260   2e-78    
ref|XP_001769271.1|  predicted protein                                  259   2e-78    
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    260   2e-78    
ref|XP_007051206.1|  Pectinesterase                                     259   5e-78    
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              259   6e-78    
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    258   9e-78    
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              255   1e-76    
ref|XP_009787978.1|  PREDICTED: probable pectinesterase 53 isofor...    255   1e-76    
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             251   5e-76    
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             251   6e-76    
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              253   8e-76    
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             252   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_004229371.1|  PREDICTED: probable pectinesterase 53              251   5e-75    
ref|XP_004495886.1|  PREDICTED: probable pectinesterase 53-like         250   6e-75    
ref|XP_008801747.1|  PREDICTED: probable pectinesterase 53              250   9e-75    
gb|ACU13228.1|  unknown                                                 244   1e-74    Glycine max [soybeans]
ref|NP_001067039.1|  Os12g0563700                                       251   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964049.1|  PREDICTED: probable pectinesterase 53-like         251   1e-74    
gb|EEC69509.1|  hypothetical protein OsI_38743                          251   1e-74    Oryza sativa Indica Group [Indian rice]
gb|KEH25488.1|  pectinesterase                                          247   3e-74    
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         249   4e-74    
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              248   4e-74    
gb|ACU18534.1|  unknown                                                 242   6e-74    Glycine max [soybeans]
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               247   9e-74    Ricinus communis
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              247   1e-73    
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               247   1e-73    
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    247   2e-73    
ref|XP_008338574.1|  PREDICTED: pectinesterase PPME1-like               241   2e-73    
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          246   2e-73    
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    246   4e-73    
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    244   2e-72    
ref|XP_004136146.1|  PREDICTED: probable pectinesterase 53-like         244   2e-72    
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         244   2e-72    
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    244   2e-72    
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         243   2e-72    
ref|XP_008461405.1|  PREDICTED: probable pectinesterase 53              244   3e-72    
ref|XP_003579301.1|  PREDICTED: putative pectinesterase 63              244   3e-72    
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    244   3e-72    
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              243   3e-72    
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    243   4e-72    
gb|EMT04970.1|  Putative pectinesterase 53                              244   5e-72    
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              243   5e-72    
emb|CBI27989.3|  unnamed protein product                                240   7e-72    
ref|NP_001044216.1|  Os01g0743200                                       243   8e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             239   8e-72    
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    241   1e-71    
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    242   1e-71    
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             240   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              241   2e-71    
emb|CAD41229.2|  OSJNBa0010H02.16                                       240   2e-71    Oryza sativa Japonica Group [Japonica rice]
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     242   2e-71    
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             240   2e-71    
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    242   2e-71    
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         241   2e-71    
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                240   3e-71    
emb|CAN63186.1|  hypothetical protein VITISV_037092                     241   3e-71    Vitis vinifera
ref|XP_001769817.1|  predicted protein                                  240   3e-71    
ref|XP_001756557.1|  predicted protein                                  238   4e-71    
emb|CDY48409.1|  BnaAnng09780D                                          238   5e-71    
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              240   5e-71    
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              241   5e-71    
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             240   5e-71    
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             240   6e-71    
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             240   6e-71    
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              239   8e-71    
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              240   9e-71    
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              239   9e-71    
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             239   1e-70    
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    239   1e-70    
ref|XP_006653657.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    238   1e-70    
emb|CDY68784.1|  BnaCnng60500D                                          236   1e-70    
ref|NP_001167796.1|  pectinesterase precursor                           240   1e-70    
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              238   1e-70    
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         239   2e-70    
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         239   2e-70    
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              239   2e-70    
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              239   2e-70    
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    239   2e-70    
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              239   2e-70    
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    239   2e-70    
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              239   2e-70    
gb|EYU46841.1|  hypothetical protein MIMGU_mgv1a019910mg                238   2e-70    
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              238   3e-70    
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          239   3e-70    
gb|KHG28421.1|  putative pectinesterase 53 -like protein                238   3e-70    
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              237   4e-70    
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              238   4e-70    
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              238   4e-70    
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       238   4e-70    
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         238   4e-70    
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             239   5e-70    
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         238   6e-70    
emb|CDY42290.1|  BnaC02g08960D                                          238   6e-70    
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              237   6e-70    
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              237   8e-70    
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              237   8e-70    
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              237   8e-70    
ref|XP_002443368.1|  hypothetical protein SORBIDRAFT_08g018360          239   9e-70    
ref|XP_011100946.1|  PREDICTED: probable pectinesterase 53              236   1e-69    
dbj|BAK03607.1|  predicted protein                                      239   1e-69    
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              236   1e-69    
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         236   1e-69    
ref|XP_006492456.1|  PREDICTED: probable pectinesterase 53-like         236   2e-69    
gb|KEH27219.1|  pectinesterase                                          236   2e-69    
ref|XP_011079515.1|  PREDICTED: probable pectinesterase 53              236   2e-69    
ref|XP_010069753.1|  PREDICTED: probable pectinesterase 53 isofor...    237   2e-69    
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              236   2e-69    
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              237   2e-69    
ref|NP_197474.1|  probable pectinesterase 53                            236   3e-69    
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             235   3e-69    
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              236   3e-69    
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              236   3e-69    
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              234   3e-69    
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          234   3e-69    
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    235   4e-69    
ref|XP_003630703.1|  Pectinesterase                                     235   4e-69    
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         235   4e-69    
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              235   4e-69    
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    234   5e-69    
emb|CDY44939.1|  BnaA02g04440D                                          238   6e-69    
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             234   7e-69    
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             234   7e-69    
ref|XP_009411137.1|  PREDICTED: pectinesterase QRT1                     233   7e-69    
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           234   8e-69    
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    234   9e-69    
ref|XP_002871903.1|  pectinesterase family protein                      234   9e-69    
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             234   1e-68    
gb|EYU24077.1|  hypothetical protein MIMGU_mgv1a008262mg                234   1e-68    
emb|CBI31927.3|  unnamed protein product                                233   2e-68    
emb|CDP03246.1|  unnamed protein product                                232   2e-68    
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              233   2e-68    
ref|XP_004169876.1|  PREDICTED: probable pectinesterase 53-like         233   2e-68    
ref|XP_002266321.3|  PREDICTED: probable pectinesterase 68              234   3e-68    
ref|XP_008244291.1|  PREDICTED: putative pectinesterase 63              228   3e-68    
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    233   3e-68    
ref|XP_010110876.1|  putative pectinesterase 53                         233   4e-68    
ref|XP_009787979.1|  PREDICTED: probable pectinesterase 53 isofor...    233   4e-68    
gb|KHN40374.1|  Putative pectinesterase 53                              231   4e-68    
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              231   5e-68    
ref|XP_001775877.1|  predicted protein                                  229   5e-68    
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              231   7e-68    
gb|EMT14071.1|  Putative pectinesterase 68                              231   7e-68    
gb|AFK39158.1|  unknown                                                 232   7e-68    
gb|EPS63895.1|  pectinesterase                                          229   8e-68    
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         232   9e-68    
ref|XP_008660472.1|  PREDICTED: putative pectinesterase 63              233   9e-68    
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              231   1e-67    
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    232   1e-67    
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    232   1e-67    
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    231   2e-67    
gb|KHG26932.1|  putative pectinesterase 53 -like protein                231   2e-67    
ref|XP_004976450.1|  PREDICTED: probable pectinesterase 68-like         229   3e-67    
emb|CDP09966.1|  unnamed protein product                                230   3e-67    
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              228   4e-67    
gb|EEC79546.1|  hypothetical protein OsI_20666                          230   5e-67    
ref|NP_001056077.1|  Os05g0521600                                       230   5e-67    
ref|XP_003591360.1|  Pectinesterase                                     229   5e-67    
gb|KHN14256.1|  Putative pectinesterase 53                              229   6e-67    
gb|KHG28220.1|  putative pectinesterase 53 -like protein                229   6e-67    
gb|EYU33537.1|  hypothetical protein MIMGU_mgv1a008469mg                229   6e-67    
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         229   7e-67    
gb|AFK35509.1|  unknown                                                 229   1e-66    
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             228   1e-66    
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              229   1e-66    
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 228   1e-66    
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              227   2e-66    
emb|CDP01931.1|  unnamed protein product                                228   2e-66    
emb|CDX77772.1|  BnaC07g20260D                                          227   2e-66    
ref|XP_001769270.1|  predicted protein                                  228   2e-66    
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    228   2e-66    
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          229   2e-66    
ref|XP_002976448.1|  hypothetical protein SELMODRAFT_104861             228   2e-66    
gb|ABD64977.1|  pectinesterase family protein                           228   2e-66    
ref|XP_006444558.1|  hypothetical protein CICLE_v10024027mg             228   3e-66    
ref|XP_010683975.1|  PREDICTED: probable pectinesterase 15 isofor...    229   3e-66    
ref|XP_002979836.1|  hypothetical protein SELMODRAFT_55472              225   3e-66    
ref|XP_003611307.1|  Pectinesterase                                     227   4e-66    
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                225   4e-66    
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              228   4e-66    
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              228   4e-66    
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         227   4e-66    
ref|XP_010113388.1|  putative pectinesterase 53                         227   5e-66    
ref|XP_010264302.1|  PREDICTED: probable pectinesterase 68              226   6e-66    
ref|XP_001752210.1|  predicted protein                                  227   6e-66    
ref|XP_009101416.1|  PREDICTED: probable pectinesterase 68              226   7e-66    
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         226   8e-66    
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    227   8e-66    
gb|ABG46325.1|  putative pectin methylesterase                          226   1e-65    
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    225   1e-65    
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              225   1e-65    
emb|CDX78291.1|  BnaA03g02030D                                          224   1e-65    
emb|CDY59290.1|  BnaA06g39970D                                          226   1e-65    
emb|CDY33185.1|  BnaC04g08540D                                          224   2e-65    
ref|XP_006838145.1|  hypothetical protein AMTR_s00106p00092510          225   2e-65    
ref|XP_001764345.1|  predicted protein                                  224   2e-65    
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              224   2e-65    
ref|XP_010315307.1|  PREDICTED: putative pectinesterase 11              224   2e-65    
ref|XP_006848989.1|  hypothetical protein AMTR_s00028p00077900          225   2e-65    
ref|XP_010258939.1|  PREDICTED: probable pectinesterase 68 isofor...    224   2e-65    
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              224   3e-65    
ref|XP_011076540.1|  PREDICTED: pectinesterase 2-like                   220   3e-65    
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         226   3e-65    
ref|XP_002863340.1|  pectinesterase family protein                      224   3e-65    
ref|NP_199561.1|  pectin methylesterase 5                               224   4e-65    
gb|EYU27262.1|  hypothetical protein MIMGU_mgv1a011822mg                221   5e-65    
gb|KHN26987.1|  Putative pectinesterase 53                              223   8e-65    
ref|XP_010093131.1|  putative pectinesterase 8                          225   8e-65    
ref|XP_010481313.1|  PREDICTED: probable pectinesterase 68              223   1e-64    
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             223   1e-64    
ref|XP_009605554.1|  PREDICTED: probable pectinesterase 68              223   1e-64    
ref|XP_003538735.1|  PREDICTED: probable pectinesterase 68-like         223   1e-64    
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              221   1e-64    
gb|EMT30081.1|  Putative pectinesterase 53                              225   1e-64    
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    224   1e-64    
ref|XP_002988891.1|  hypothetical protein SELMODRAFT_128677             221   2e-64    
ref|XP_003575671.1|  PREDICTED: probable pectinesterase 53              225   2e-64    
gb|ACF22736.1|  pectinesterase family protein                           225   2e-64    
ref|XP_001777108.1|  predicted protein                                  220   2e-64    
ref|XP_004980888.1|  PREDICTED: pectinesterase QRT1-like                226   2e-64    
gb|KFK42874.1|  hypothetical protein AALP_AA1G050100                    223   2e-64    
ref|XP_010530051.1|  PREDICTED: probable pectinesterase 68              222   3e-64    
ref|XP_009764658.1|  PREDICTED: pectinesterase QRT1                     222   3e-64    
gb|KHN42698.1|  Putative pectinesterase 68                              222   4e-64    
ref|XP_009144121.1|  PREDICTED: probable pectinesterase 15              221   4e-64    
ref|XP_001774315.1|  predicted protein                                  219   4e-64    
gb|ABR18283.1|  unknown                                                 221   4e-64    
ref|XP_007039841.1|  Pectin lyase-like superfamily protein              221   4e-64    
gb|ABK27127.1|  unknown                                                 221   5e-64    
ref|XP_009602719.1|  PREDICTED: pectinesterase QRT1                     221   5e-64    
gb|ABD65006.1|  pectinesterase family protein                           221   5e-64    
ref|XP_010936490.1|  PREDICTED: pectinesterase QRT1-like                222   5e-64    
ref|XP_010543016.1|  PREDICTED: probable pectinesterase 8               223   5e-64    
ref|XP_006398447.1|  hypothetical protein EUTSA_v10000935mg             221   6e-64    
ref|XP_010936491.1|  PREDICTED: pectinesterase QRT1-like                221   6e-64    
ref|XP_003517421.1|  PREDICTED: probable pectinesterase 68              221   6e-64    
ref|XP_010324275.1|  PREDICTED: pectinesterase QRT1                     221   7e-64    
ref|XP_006418040.1|  hypothetical protein EUTSA_v10009800mg             222   7e-64    
ref|XP_002451275.1|  hypothetical protein SORBIDRAFT_05g026816          222   7e-64    
emb|CDY69057.1|  BnaCnng61650D                                          221   9e-64    
ref|XP_009803587.1|  PREDICTED: putative pectinesterase 11              220   1e-63    
ref|XP_004511684.1|  PREDICTED: probable pectinesterase 68-like         221   1e-63    
ref|XP_009128974.1|  PREDICTED: probable pectinesterase 68 isofor...    220   1e-63    
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              221   2e-63    
ref|XP_006346251.1|  PREDICTED: pectinesterase QRT1-like                220   2e-63    
ref|XP_001758990.1|  predicted protein                                  218   2e-63    
gb|ACF82787.1|  unknown                                                 220   3e-63    
ref|XP_008451885.1|  PREDICTED: probable pectinesterase 8               220   3e-63    
ref|NP_001144148.1|  uncharacterized protein LOC100277001 precursor     220   3e-63    
ref|XP_010516895.1|  PREDICTED: probable pectinesterase 15              221   3e-63    
ref|XP_002964173.1|  hypothetical protein SELMODRAFT_81583              218   3e-63    
gb|KCW71970.1|  hypothetical protein EUGRSUZ_E00425                     219   3e-63    
ref|XP_002303355.2|  hypothetical protein POPTR_0003s07460g             219   3e-63    
gb|KDP39870.1|  hypothetical protein JCGZ_03401                         219   4e-63    
ref|XP_007226857.1|  hypothetical protein PRUPE_ppa017141mg             219   4e-63    
ref|XP_009621417.1|  PREDICTED: putative pectinesterase 11              219   4e-63    
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         220   4e-63    
ref|XP_010695152.1|  PREDICTED: probable pectinesterase 68              219   5e-63    
ref|XP_011031878.1|  PREDICTED: probable pectinesterase 68              219   5e-63    
ref|XP_010686768.1|  PREDICTED: probable pectinesterase 8               220   6e-63    
ref|XP_009768018.1|  PREDICTED: probable pectinesterase 68              218   6e-63    
ref|XP_008390573.1|  PREDICTED: probable pectinesterase 67              218   6e-63    
ref|XP_001764301.1|  predicted protein                                  216   7e-63    
ref|XP_010066169.1|  PREDICTED: putative pectinesterase 11              217   7e-63    
ref|XP_009349568.1|  PREDICTED: probable pectinesterase 8               219   8e-63    
ref|XP_006477195.1|  PREDICTED: probable pectinesterase 68-like         218   8e-63    
emb|CDY31785.1|  BnaC01g27410D                                          215   8e-63    
ref|XP_009336347.1|  PREDICTED: probable pectinesterase 67              218   8e-63    
gb|KDO61446.1|  hypothetical protein CISIN_1g018249mg                   218   9e-63    
ref|XP_006440314.1|  hypothetical protein CICLE_v10020787mg             218   9e-63    
ref|XP_010055495.1|  PREDICTED: probable pectinesterase 68              220   9e-63    
ref|XP_001762576.1|  predicted protein                                  217   1e-62    
ref|XP_004164282.1|  PREDICTED: probable pectinesterase 68-like         217   1e-62    
ref|XP_004152402.1|  PREDICTED: probable pectinesterase 68-like         217   1e-62    
ref|XP_010088935.1|  Putative pectinesterase 11                         216   1e-62    
ref|XP_008378333.1|  PREDICTED: probable pectinesterase 8               219   1e-62    
ref|XP_008437714.1|  PREDICTED: probable pectinesterase 68              218   1e-62    
ref|XP_009372133.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    217   1e-62    
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          218   2e-62    
ref|XP_004494095.1|  PREDICTED: probable pectinesterase 15-like         218   2e-62    
ref|XP_008223370.1|  PREDICTED: probable pectinesterase 67              217   2e-62    
gb|KFK31368.1|  hypothetical protein AALP_AA6G103300                    217   2e-62    
ref|XP_004494018.1|  PREDICTED: probable pectinesterase 15-like         218   3e-62    
ref|XP_002879623.1|  pectinesterase family protein                      218   3e-62    
ref|NP_181208.1|  putative pectinesterase 14                            216   3e-62    
ref|XP_010270248.1|  PREDICTED: pectinesterase QRT1                     216   3e-62    
gb|EMT17971.1|  Putative pectinesterase 53                              214   4e-62    
ref|XP_008367992.1|  PREDICTED: putative pectinesterase 63              215   4e-62    
ref|XP_009407032.1|  PREDICTED: putative pectinesterase 11              217   4e-62    
ref|XP_010505218.1|  PREDICTED: probable pectinesterase 15              217   7e-62    
ref|XP_003550907.1|  PREDICTED: probable pectinesterase 68              216   7e-62    
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    218   8e-62    



>ref|XP_009789874.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=367

 Score =   432 bits (1112),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 207/356 (58%), Positives = 265/356 (74%), Gaps = 6/356 (2%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHIR  1078
             +++ +    P V SDDS+PIPA+K+++KSWF +NV+P+  RK+ LDP L  AE+N   I+
Sbjct  13    IVITILLFIPRVFSDDSVPIPADKSQIKSWFETNVKPLDARKDTLDPALVAAEANKTIIK  72

Query  1077  VSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPF  898
             V  DG G+F+T+TDA+ S+P+ N +RVIISIGGGNYTE+V I++ KPFITLYGDP   P 
Sbjct  73    VRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIDRYKPFITLYGDPKNVPN  132

Query  897   INFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAY  718
             I F+ T+   GTV SATV+VE++YF+A+NIN +NSAPR +G  + +QA AL   GD A+ 
Sbjct  133   IIFNGTAKDYGTVDSATVVVESEYFSAVNINFVNSAPRPDGKRELAQAAALRTGGDKASL  192

Query  717   YNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQ  550
             YNCK+YGFQDTFCDD G+HFFKDCYIEGTVDFIFGNGK+LYL+TE+HVI G    +I A 
Sbjct  193   YNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGDPMAMITAH  252

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
             AR     D+GYSFVHC ITG  +   LGR W  F++V+Y+YT+M++ V P GW    GK 
Sbjct  253   ARGAGNVDSGYSFVHCMITGTGKTALLGRAWKPFAKVVYSYTDMSDVVHPEGWSD-NGKS  311

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
              Y  + ++GEY   G GA MDGR  +AKKLTD E KP ITLG+IEGSKWLLPP+ L
Sbjct  312   DYDRSVFYGEYNCKGAGATMDGRVGYAKKLTDAEAKPLITLGYIEGSKWLLPPVTL  367



>ref|XP_009626579.1| PREDICTED: pectinesterase 1-like [Nicotiana tomentosiformis]
Length=367

 Score =   431 bits (1108),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 210/362 (58%), Positives = 266/362 (73%), Gaps = 9/362 (2%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAES  1096
             V  +++ IVL     P V SDDS+PIPA+K+++ SWF +NV+P+  RK+ LDP L  AE+
Sbjct  10    VEAIVITIVL---FIPRVFSDDSVPIPADKSQINSWFETNVKPLDARKDTLDPALVAAEA  66

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
             N   I+V  DG G+F+T+TDA+ S+P+ N +RVIISIGGGNYTE+V IE+ KPFITLYGD
Sbjct  67    NKTTIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIERYKPFITLYGD  126

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P I F+ T+   GTV SATV+VE++YFTA+NIN +NSAPR +G  + +QA AL   
Sbjct  127   PKNVPNIIFNGTAKDYGTVDSATVVVESEYFTAVNINFVNSAPRPDGKRELAQAAALRTG  186

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             GD A+ YNCK+YGFQDTFCDD G+HFFKDCYIEGTVDFIFGNGK+LYL+TE+HVI G   
Sbjct  187   GDKASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGDPM  246

Query  564   -VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
              +I A AR     D+GYSFVHC ITG     FLGR W  F++V+Y+YT+M++ V P GW 
Sbjct  247   AMITAHARGAGNVDSGYSFVHCMITGTGNTAFLGRAWKPFAKVVYSYTDMSDVVHPEGWS  306

Query  387   GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPI  208
                GK  Y  + ++GEY   G GA M+ R  + +KLTD E KPFITLG+IEGSKWLLPP+
Sbjct  307   D-NGKSDYDRSVFYGEYNCKGAGATMERRVGYVRKLTDAEAKPFITLGYIEGSKWLLPPV  365

Query  207   KL  202
              L
Sbjct  366   AL  367



>emb|CDP13860.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   425 bits (1093),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 206/368 (56%), Positives = 269/368 (73%), Gaps = 9/368 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPEL  1111
             M  M +N+ I+   L+    P V+SD+++P PA+KA++ SWF  NV+P+A+RK+ LDP L
Sbjct  1     MGDMALNKAILFSTLLFI--PLVLSDNTVPAPADKAQLNSWFEQNVQPLASRKDTLDPAL  58

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE+NP+ I++  DG G+F+TI DA+ S+P DNT RVIIS+G GNYTE++ IE+ KPFI
Sbjct  59    VAAEANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFI  118

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             T+ GDP+  P + F  T+ K GTV SAT+IVE+DYF A N+ + NSAPR  G  KG+QA+
Sbjct  119   TIIGDPNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQAL  178

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             A+   GD A++YNCK  GFQDT CDD+G+H FKDCYIEGTVDFIFGNGK++YL+ ELHVI
Sbjct  179   AVRIGGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVI  238

Query  570   DG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
              G     I AQARHT+ EDTGYSFVHCK+TG  +  +LGR WM + +V++AYT+M++AV 
Sbjct  239   PGDRQAWITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVI  298

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKM-DGRPYFAKKLTDEEVKPFITLGFIEGSK  226
             P GW      P    T  FGE+ +TGPG+     R  F KKLT+ EVKPF+TLGFIE SK
Sbjct  299   PAGWSN-NFHPETEKTVLFGEFSSTGPGSDTSSSRAAFTKKLTEAEVKPFLTLGFIEASK  357

Query  225   WLLPPIKL  202
             WLLPP ++
Sbjct  358   WLLPPTQV  365



>ref|XP_004239982.1| PREDICTED: pectinesterase 1-like [Solanum lycopersicum]
Length=368

 Score =   423 bits (1087),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/362 (56%), Positives = 265/362 (73%), Gaps = 8/362 (2%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAES  1096
             V  +I+  +L++ +   V SDD +PIPA+K+++ SWF +NV+P+  RK+ LDP L  AE+
Sbjct  10    VETIIITFLLLNIIE--VFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAEA  67

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
             N   I+V   G GDF+TIT+A+ S+PE N +RVII IG GNYTE++ IE+ KPF+TLYGD
Sbjct  68    NKTIIKVRTYGSGDFKTITEAVKSIPEGNKKRVIIWIGSGNYTEKIKIERTKPFVTLYGD  127

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P I FH T+ +  TV SATVIVE++YF+A+NIN +N+APR +G +  +QA AL   
Sbjct  128   PKNVPNIIFHGTAQEYTTVDSATVIVESEYFSAVNINFVNTAPRPDGKSDKAQAAALRTG  187

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             GD A+ YNCK++GFQDTFCDD G+HFFKDCYIEGTVDFIFGNGK+LYL+TE HVI G   
Sbjct  188   GDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGDPM  247

Query  564   -VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
              ++ AQAR     D+G+SFVHC ITG     +LGR W  +S+V+++YT+MT+ + P GW 
Sbjct  248   AMVTAQARAVENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEGWS  307

Query  387   GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPI  208
                GK  +G T Y+GEYK  G GA +D R  F KKLTDEE KPFI+L +IEGSKWLLPP+
Sbjct  308   DF-GKKEFGSTVYYGEYKCKGAGATLDKRVPFTKKLTDEEAKPFISLAYIEGSKWLLPPV  366

Query  207   KL  202
              L
Sbjct  367   TL  368



>ref|XP_006365351.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=368

 Score =   419 bits (1076),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 259/357 (73%), Gaps = 6/357 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHI  1081
             ++I  + +   GV SDD +PIPA+K+++ SWF +NV+P+  RK+ LDP L  AE+N   I
Sbjct  13    IIITFLFFNIIGVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAEANKTII  72

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V  DG GDF+TIT+A+ S+PE N +RVII IGGGNYTE++ IE+ KPF+T YGD    P
Sbjct  73    KVRTDGSGDFKTITEAVKSIPEGNKRRVIIWIGGGNYTEKIKIERTKPFVTFYGDSKNVP  132

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              I FH T+ +  TV SATVIVE++YF A+NIN +N+APR +G +  +QA AL   GD A+
Sbjct  133   NIIFHGTAKEYTTVDSATVIVESEYFNAVNINFVNTAPRPDGKSDKAQAAALRTGGDKAS  192

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
              YNCK++GFQDTFCDD G+HFFKDCYIEGTVDFIFGNGK+LYL+TE HVI G    ++ A
Sbjct  193   LYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGDPMAMVTA  252

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
              AR     D+G+SFVHC ITG     +LGR W  +S+V+++YT+MT+ + P GW    GK
Sbjct  253   HARAAENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEGWSNF-GK  311

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               +  T Y+GEYK  G GA +D R  F KKL+DEE KPFI+L +IEGSKWLLPP+ L
Sbjct  312   KEFDSTVYYGEYKCKGAGATLDKRVPFTKKLSDEEAKPFISLAYIEGSKWLLPPVTL  368



>ref|XP_004513231.1| PREDICTED: pectinesterase 1-like [Cicer arietinum]
Length=370

 Score =   414 bits (1065),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 202/369 (55%), Positives = 262/369 (71%), Gaps = 8/369 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M++  V   I V +++ +L+  +V SDD++PIP++KA++ +WF++NV+P++ RKN LDP 
Sbjct  1     MDSKTVRSYIHVALVISFLTANIVLSDDNVPIPSDKAQLNTWFNNNVKPLSQRKNTLDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V KDG GDF+TITDA+ S+PE NT+RVI+ IGGGN+ E++ I + KPF
Sbjct  61    LVTAEEGAKVVKVMKDGSGDFKTITDAIKSIPEGNTKRVIVYIGGGNFNEKITIGRTKPF  120

Query  933   ITLYGDPDAT-PFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQ  757
             +TLYG      P + +  T+ + GTV SAT+IVE DYF A NI I N+APR +G  +G+Q
Sbjct  121   VTLYGALGGNMPNLTYGGTAQQYGTVDSATLIVEGDYFVAANIMISNTAPRPDGKRQGAQ  180

Query  756   AVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELH  577
             AVAL  SGD A++YNCKL GFQDT CDD  RH FK+C I+GTVDFIFG+GK+LYL+TEL 
Sbjct  181   AVALRISGDKASFYNCKLLGFQDTVCDDRNRHLFKNCLIQGTVDFIFGSGKSLYLNTELR  240

Query  576   VIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEA  409
             V+      VI AQAR ++ ED GYSFVHC ITG   G FLGR WM+ S+ ++AYT MT  
Sbjct  241   VLGDTGMTVIVAQARKSDSEDNGYSFVHCDITGTGNGTFLGRAWMSHSKAVFAYTHMTSV  300

Query  408   VRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGS  229
             V   GW        Y  T YFGEY+NTGPGA + GR    K+L+D EVKP+ITL  IEGS
Sbjct  301   VNQEGWSD-NRHSQYASTVYFGEYRNTGPGADLKGRSKITKQLSDAEVKPYITLAMIEGS  359

Query  228   KWLLPPIKL  202
             KWLLPP  L
Sbjct  360   KWLLPPPNL  368



>ref|XP_006365350.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=367

 Score =   413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             L  +++ +    P V SDD+IPIPA+K+++ SWF +NV+P+  RK+ LDP L  AE+N  
Sbjct  10    LETIVLTILLFIPRVFSDDTIPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAEANKT  69

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I+V  DG GDF+T+T+A+ S+PE N +RVII IGGGNYTE+V IE+ KPF+TLYGDP  
Sbjct  70    IIKVRTDGSGDFKTLTEAVKSIPEGNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPKN  129

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P I FH T+ +   V SATVIVE++YF+A+NIN +N+APR +G  + +QA AL   GD 
Sbjct  130   VPNIIFHGTAKQYTIVESATVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTGGDK  189

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             A+ YNCK++GFQDTFCDD G+HFFKDCYIEGTVDFIFGNGK++YL+TE HVI G    ++
Sbjct  190   ASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAMV  249

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A AR     D+GYSFVHC ITG     +LGR W  F +V++ Y++MT+ V P GW    
Sbjct  250   TAHARDAENVDSGYSFVHCTITGTGNTAYLGRAWKPFGKVVFLYSDMTDVVHPEGWSD-N  308

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             GKP    + ++GEY   G GA ++ R  F KKL+D E KPFI+L +IEGSKWLLPP+ L
Sbjct  309   GKPENDKSVFYGEYNCKGAGAALEKRVGFTKKLSDAEAKPFISLAYIEGSKWLLPPVTL  367



>ref|XP_007038213.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
 gb|EOY22714.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
Length=368

 Score =   410 bits (1053),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 262/373 (70%), Gaps = 11/373 (3%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  K    + V   I  I++   L+P V+S +S PIP +K+++K+WF++N++P + R   
Sbjct  1     MTGKRSRNIEVGAAICTILV---LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGST  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             +DP LAKAE     I+V KDG GDF+TIT A+ASVP  NT+RVIISIGGG+Y E++ I++
Sbjct  58    IDPALAKAEVAAHIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDR  117

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPFIT YGDP   P +++  T+ + GTV SAT+IVE+DYF A NI I N+APR +G   
Sbjct  118   SKPFITFYGDPRNMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMV  177

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAV+L  SGD AA+YNCK+ GFQDT CDD G HFFKDCYI GTVDFIFG+GK+LYL+T
Sbjct  178   GAQAVSLRISGDKAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNT  237

Query  585   ELHVIDG-----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTE  421
              L+V DG     VI AQAR ++ E+TGYSFVHC +TG   G +LGR W    RV++AYT 
Sbjct  238   VLYV-DGQKGVTVITAQARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTN  296

Query  420   MTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGF  241
             M+  + PLGW      P    T +FGEYK  G GA   GR  +AK+LTD E KPF+ LGF
Sbjct  297   MSSVIHPLGWSDNL-HPERAKTVFFGEYKCKGKGASFSGREKYAKRLTDGEAKPFLVLGF  355

Query  240   IEGSKWLLPPIKL  202
             I+G+KWLLPP ++
Sbjct  356   IDGAKWLLPPPRV  368



>gb|AHL24653.1| Fra e 11.01 allergen [Fraxinus excelsior]
Length=368

 Score =   409 bits (1050),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/372 (54%), Positives = 262/372 (70%), Gaps = 11/372 (3%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             M  K + ++ +  +I+ I+L     P V SDD +PIPA+ A++ SWF   V P++ RK  
Sbjct  1     MAGKIVSSIALETVIVSIILCM---PIVFSDDRVPIPADSAQINSWFDGIVRPLSARKAT  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDP L  AES PK I++  DG GDF+TI DA+ ++P+ NT+RVI+S+  GNY E+V I  
Sbjct  58    LDPALVTAESEPKVIKLKSDGSGDFKTINDAIKTIPDGNTKRVILSLAPGNYKEKVKIGM  117

Query  945   EKPFITLYG-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTT  769
              KPFIT YG DP+  P + F  T+ +  TV SAT+IVE+DYF A+N+ I+NSAPR +G  
Sbjct  118   YKPFITFYGEDPNNMPVLVFGGTAKEYDTVESATLIVESDYFNAVNLKIVNSAPRPDGKR  177

Query  768   KGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLD  589
             +G+QA AL   GD +++YN KLYG+QDT CDD G+HF+KDCYIEGTVDFIFG+GK+LYL+
Sbjct  178   EGAQAAALRIGGDKSSFYNVKLYGYQDTLCDDRGKHFYKDCYIEGTVDFIFGSGKSLYLN  237

Query  588   TELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTE  421
             TELHVI G    +I AQAR T+ EDTGYSFVHCK+TG     +LGR WM  ++V++AYTE
Sbjct  238   TELHVIPGDQLAMITAQARKTDSEDTGYSFVHCKVTGTGGVAYLGRSWMPAAKVVFAYTE  297

Query  420   MTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGF  241
             M++A+ P GW  V  KP +  T  F EY N GPGA +D R  F  KLT  + KPF++L +
Sbjct  298   MSDAINPKGWSIV--KPEHESTVRFAEYDNKGPGANVDKRAKFVNKLTKADAKPFVSLSY  355

Query  240   IEGSKWLLPPIK  205
             IE SKWLLPP K
Sbjct  356   IEASKWLLPPAK  367



>ref|XP_004239981.2| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 1-like, partial 
[Solanum lycopersicum]
Length=358

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 260/360 (72%), Gaps = 8/360 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNP  1090
             + I +I+L+    P V SDD +PIPA+K+++ S F +NV+P+  RK+ LDP L  AE+N 
Sbjct  2     ETIFLIILL--FIPRVFSDDLVPIPADKSQLNSGFEANVKPLDARKDTLDPALVAAEANK  59

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
               I+V  DG GDF+T+T+A+ S+PEDN +RVII IGGGNYTE+V IE+ KPF+TLYGDP 
Sbjct  60    TIIKVRTDGSGDFKTLTEAVKSIPEDNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPK  119

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
               P I F  T+ +   V S TVIVE++YF+A+NIN +N+APR +G  + +QA AL  +GD
Sbjct  120   NVPNIIFSGTAKQYTIVESGTVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTAGD  179

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----V  562
              A+ YNCK++GFQDTFCDD+G+HFFKDCYIEGTVDFIFGNGK++YL+TE HVI G    +
Sbjct  180   KASLYNCKMFGFQDTFCDDKGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAM  239

Query  561   IAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGV  382
             + A AR     D+GYSFVHC ITG     +LGR W  FS+V+++YT+MT+ V P GW   
Sbjct  240   VTAHARDGENVDSGYSFVHCTITGTGNTAYLGRAWKPFSKVVFSYTDMTDVVHPEGWSD-  298

Query  381   PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
              GKP    + ++GEY   G GA    R  + KKL+DEE KPFI+L +IEGSKWLLPP+ L
Sbjct  299   NGKPENDKSVFYGEYNCKGAGAASGKRVPYTKKLSDEEAKPFISLAYIEGSKWLLPPVTL  358



>gb|KHN29928.1| Pectinesterase PPME1-like protein [Glycine soja]
Length=369

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 253/365 (69%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++ +WFS+NV P+  RK+ +DP 
Sbjct  1     MASKTICTTIQVTLIVAFLTTQVVFSDDTVPIPANKAQLGTWFSTNVGPLDQRKSTMDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVI+ IG GNY E++ IEK KPF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             ITLYG P+  P + F  T+ K GTV SAT+IVE+DYF A NI I NSAPR +G  +G QA
Sbjct  121   ITLYGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK +GFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LYL TEL  
Sbjct  181   VALRISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM   RV++AY+ M+  V
Sbjct  241   LGDTGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
             +  GW      P +     FGEY+NTGPGA   GR     +L + +VKP+ITLG IEGSK
Sbjct  301   KKEGWSN-NNHPEHDKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>ref|XP_007218171.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
 gb|EMJ19370.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
Length=364

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 252/354 (71%), Gaps = 6/354 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEP-VANRKNLDPELAKAESNPKHI  1081
             + + L+ + +   ++DD  P+PA++++V +WF++NV+P  A R  LDP LAKAE++ K I
Sbjct  7     LTMTLILFTATIAMADDHTPVPADQSQVNTWFNNNVKPYTARRGTLDPTLAKAEASQKVI  66

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V K+G G F+TITDA+ S+P  NT+RVI+ IGGG Y E++ I + KPF+T YG P   P
Sbjct  67    KVMKNGSGQFKTITDAVNSIPAGNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  126

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  TS K GTV+SATVI E+DYF A N+ I NS+PR +G   G+QAVAL  SG+ +A
Sbjct  127   TLTFAGTSQKYGTVNSATVIAESDYFVAANVIIKNSSPRPDGKRVGAQAVALRVSGNKSA  186

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
              YNCKL GFQDT CDD G H FKDC+IEGTVDFI+G+GK+LYL+TELHV+      VI A
Sbjct  187   LYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGLTVITA  246

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
             QAR +  EDTGYSFVHCKITG   G +LGR W     V+YAYT MT+ + P GW      
Sbjct  247   QARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAGWSD-NNH  305

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             P    T ++GEYK +GPG+   GR  + K LTDE++KPF++LG+I+GSKWLLPP
Sbjct  306   PERDSTVFYGEYKCSGPGSSAVGREKYTKHLTDEQIKPFLSLGYIQGSKWLLPP  359



>ref|XP_004516439.1| PREDICTED: pectinesterase PPME1-like [Cicer arietinum]
Length=367

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 253/358 (71%), Gaps = 7/358 (2%)
 Frame = -1

Query  1260  IMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             I V ++V   S  VV SDD+  +PA +AEV SWF+SN+ P+  RK+ LDP L  AE+N  
Sbjct  10    INVAIIVALFSANVVLSDDNAAVPAERAEVDSWFNSNIGPLEQRKSTLDPALVTAEANAT  69

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              ++V++DG GDF++ITDA+ S+P  NTQRVI++IGGGNY E++ IEK KPFIT  G P  
Sbjct  70    IVKVNQDGSGDFKSITDAINSIPSGNTQRVILNIGGGNYQEKIKIEKTKPFITFIGTPSN  129

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + +  T+ + GTV SAT+IVE+DYF A NI I NSAPR +G   G+QAVA+  +GD 
Sbjct  130   MPNLTYGGTAQEYGTVDSATLIVESDYFVASNIMISNSAPRPDGKKSGAQAVAMRITGDK  189

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             AA+YNCK  GFQDT CDD+  HFFKDC I+GTVDFIFGNG++LYL  EL V+      VI
Sbjct  190   AAFYNCKFLGFQDTICDDKNIHFFKDCLIQGTVDFIFGNGRSLYLKNELRVLGNAEMTVI  249

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR +  E + Y+FVHC +TG   G +LGR WMA+S+VI+AY+ ++  + PLGW    
Sbjct  250   VAQARKSESEKSLYTFVHCDVTGTGTGTYLGRAWMAYSKVIFAYSTLSSVLNPLGWSN-N  308

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
               P Y  T+YFGEY NTGPGA   GR    ++LTD EVKPF+TLG IE SKWLLPP K
Sbjct  309   RHPEYDKTSYFGEYMNTGPGADTKGRAPITRQLTDAEVKPFLTLGSIEASKWLLPPPK  366



>gb|KEH38558.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   400 bits (1028),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 252/364 (69%), Gaps = 8/364 (2%)
 Frame = -1

Query  1275  RVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAE  1099
             R + + + I++  + +  V+SDD  PIPAN+A++ +WF++NV P+A RK  LDP L  AE
Sbjct  6     RTSTINVAIIVALFTANVVLSDDLTPIPANRAQLDAWFNTNVGPLAQRKATLDPSLVAAE  65

Query  1098  SNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG  919
             + PK I V +DGKGDF+TITDA+ S+P  N +RVI+ IGGGNY E++ IE+ KPF+TLY 
Sbjct  66    AAPKVITVMQDGKGDFKTITDAINSIPTGNNKRVIVKIGGGNYNEKIKIERTKPFVTLYA  125

Query  918   DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
              P   P I F  T+ K GTV SAT+IVE+DYF A NI + NSAPR +G   G QAVAL  
Sbjct  126   APGTMPNITFGGTAAKYGTVDSATLIVESDYFVAANIMLSNSAPRPDGRKAGEQAVALRI  185

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG--  565
             SGD AA+YNCK+ GFQDT CDD   HFFKDC I+GTVDFIFG+G +LYL  EL  +    
Sbjct  186   SGDRAAFYNCKILGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYLKNELRALGDAG  245

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQAR +  +   YSFVHC ITG     FL R WM + ++IYAY+ MT  V P GW
Sbjct  246   PTVIVAQARKSASDADLYSFVHCDITGTGTTTFLARAWMTYPKIIYAYSTMTNVVHPKGW  305

Query  390   -HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              +G+   P +  T+YFGEY+NTGP +   GR    K+L++ EVKPFITLG I+GSKWLLP
Sbjct  306   DNGM--HPEFDKTSYFGEYQNTGPKSDPKGRVSITKQLSEAEVKPFITLGMIQGSKWLLP  363

Query  213   PIKL  202
             P K+
Sbjct  364   PPKV  367



>ref|XP_003518804.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   400 bits (1028),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 253/365 (69%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPA+KA++ +WFS+NV P+  RK+ +DP 
Sbjct  1     MASKTICTTIQVTLIVAFLTTQVVFSDDTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVI+ IG GNY E++ IEK KPF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             ITLYG P+  P + F  T+ K GTV SAT+IVE+DYF A NI I NSAPR +G  +G QA
Sbjct  121   ITLYGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK +GFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LYL TEL  
Sbjct  181   VALRISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM   RV++AY+ M+  V
Sbjct  241   LGDTGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
             +  GW      P +     FGEY+NTGPGA   GR     +L + +VKP+ITLG IEGSK
Sbjct  301   KKEGWSN-NNHPEHDKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>gb|KEH17536.1| pectinesterase-like protein [Medicago truncatula]
 gb|KEH17537.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 251/363 (69%), Gaps = 6/363 (2%)
 Frame = -1

Query  1275  RVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAE  1099
             R   + + I++  ++    +SDD+IP+PAN+A+V SWF++NV P+  RK+ LDP L  AE
Sbjct  6     RTYMINVAIIVALFMVNVALSDDTIPVPANRAQVDSWFNTNVGPLEQRKSTLDPALVTAE  65

Query  1098  SNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG  919
             +  K I+V +DG GDF+TITDA+ S+P  NT RVI++IGGG+Y E++ I++ KPF+TLYG
Sbjct  66    AGAKVIKVMQDGSGDFKTITDAINSIPTGNTVRVIVNIGGGSYNEKIKIDRTKPFVTLYG  125

Query  918   DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
              P   P + +  T+ + GTV SAT+I E+DYF A NI + NSAPR +G T G QAVAL  
Sbjct  126   APGNMPNLTYGGTAKQYGTVDSATLIAESDYFVAANILVSNSAPRPDGKTAGGQAVALRI  185

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG--  565
             SGD AA+YNCK +GFQDT CDD   H FKDC I+GTVDFIFG+G +LYL +EL  +D   
Sbjct  186   SGDKAAFYNCKFFGFQDTICDDRHNHIFKDCVIQGTVDFIFGSGTSLYLKSELRALDDTG  245

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQAR T  +   YSFVHC ITG     FL R WM + ++IYAY+ MT  V P GW
Sbjct  246   PTVIVAQARKTASDADLYSFVHCDITGTGSSTFLARAWMTYPKIIYAYSTMTNVVNPKGW  305

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                   P +  T+YFGEY+NTGP +   GR   AK+LT+ EVKPFITLG I+ SKWLLPP
Sbjct  306   DNA-MHPEFDKTSYFGEYQNTGPKSDPKGRASVAKQLTEAEVKPFITLGMIQASKWLLPP  364

Query  210   IKL  202
              K+
Sbjct  365   PKV  367



>ref|XP_009362793.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 254/359 (71%), Gaps = 9/359 (3%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KNLDPELAKAESNPK  1087
             LIM I+L   ++   ++DD+ P+PA  ++V +WF++NV+P   R K LDP +  AE+  K
Sbjct  7     LIMTILLSATIA---MADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAVVTAEAGQK  63

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I+V +DGKG+F+T+TDA+ S+P  NT+RVI+ IG G Y E++ I + KPF+TLYG P  
Sbjct  64    VIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGTGEYKEKITIPRNKPFVTLYGSPTN  123

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ K GTV+SAT+I E+DYF A N+NI NS+PR +G   G+QAVAL  SG+ 
Sbjct  124   MPILTFDGTAQKYGTVNSATIIAESDYFVAANLNIKNSSPRPDGKRVGAQAVALRVSGNK  183

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             AA YNCKL+GFQDT CDD G H FKDCYIEGTVDFI+G+GK+LYL+TELHV+      VI
Sbjct  184   AALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDNGITVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR ++ EDTGYSFVHCKITG   G +LGR W A  +V+YAYT MT+ V P GW    
Sbjct  244   TAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNMTKVVNPAGWSN-D  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
                    T  +GEYK  GPG+  + +   +K+LTDE+ K FI+LG+I+GSKWLLPP  L
Sbjct  303   NHSERDKTVSYGEYKCMGPGSSKNNKRNLSKELTDEQAKRFISLGYIQGSKWLLPPPNL  361



>ref|XP_009363888.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 252/356 (71%), Gaps = 9/356 (3%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             LIM I+L   ++    +DD+ PIP++ +++ +WF++NV+P   R++ LDP +  AE+   
Sbjct  7     LIMTILLTATVA---TADDNAPIPSDHSQINTWFNNNVKPYTERQSTLDPAIVTAEAGQT  63

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I+V +DGKGDF+TITDA+ S+P  NT+RVI+ IGGG Y E++ I + KPF+TLYG P  
Sbjct  64    VIKVMQDGKGDFKTITDAINSIPAGNTKRVIVHIGGGEYNEKITIPRNKPFVTLYGSPTN  123

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ K GTV+SATVI E+DYF AIN+ I NS+PR +G   G+QAVAL  SG+ 
Sbjct  124   MPNLTFDGTAQKYGTVNSATVIAESDYFIAINLLIKNSSPRPDGKRVGAQAVALRVSGNN  183

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             +A YNCKL GFQDT CDD G H FKDCYIEGTVDFI+G+GK+LYL+TELHV+      VI
Sbjct  184   SALYNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR +  EDTGYSFVHC +TG   G +LGR W    +V+YAYT MTE V P GW    
Sbjct  244   TAQARDSASEDTGYSFVHCNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWSN-D  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               P    T  +GEYK  GPG+    +   +K+LTDE+VKPFI+LG+I+GSKWLLPP
Sbjct  303   NHPERDNTVSYGEYKCMGPGSSTYNKRNLSKELTDEQVKPFISLGYIQGSKWLLPP  358



>ref|XP_010038407.1| PREDICTED: putative pectinesterase 63 [Eucalyptus grandis]
 gb|KCW46225.1| hypothetical protein EUGRSUZ_K00113 [Eucalyptus grandis]
Length=372

 Score =   397 bits (1021),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 251/359 (70%), Gaps = 7/359 (2%)
 Frame = -1

Query  1260  IMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES-NPK  1087
             I ++ L+  L+   VSDD IPIPA+K++V +WF  NV+    RK  LDP L  AE+  PK
Sbjct  15    IAILSLLIALAQIAVSDDKIPIPADKSQVNAWFQQNVQAFEARKGTLDPNLEAAEAIPPK  74

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              IRVS+DG GDF+T+T+A+ S+P  N+QRVI+SI GG Y E++ IE+ KPF+TLYG P+ 
Sbjct  75    VIRVSQDGSGDFKTVTEAINSIPAGNSQRVIVSIAGGVYKEKITIERTKPFVTLYGSPND  134

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + +  T+ + GTV SA++IVE+DYF   N+ I NSAPR +G   G QAVAL  SGD 
Sbjct  135   MPKLTYSGTAQQYGTVDSASIIVESDYFVGANLIIENSAPRPDGKAAGGQAVALRTSGDK  194

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----GVI  559
             AA+YNC++ GFQDT CDD G HFFKDCYIEGTVDFIFG+G ++YL+TEL V+      VI
Sbjct  195   AAFYNCRMLGFQDTLCDDRGFHFFKDCYIEGTVDFIFGSGTSIYLNTELRVLGDSGLSVI  254

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR +N EDTGYS VHC ITG   G FLGR WM   RVI++YT+M+  + PLGW    
Sbjct  255   TAQARQSNTEDTGYSLVHCSITGTGNGTFLGRAWMPSPRVIFSYTDMSSVINPLGWSD-N  313

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P    T  F EYK +G G+   GR  FAK+L+D +V+ FI+L +I GSKWLLPP ++
Sbjct  314   FHPERQRTVTFAEYKCSGEGSTPAGRAKFAKQLSDADVQTFISLSYIVGSKWLLPPPRV  372



>ref|XP_011076543.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 260/366 (71%), Gaps = 8/366 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLS--PGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDP  1117
             M   +V+ + + +V +  L   P  +S +  PIPANKA++ SWF  NV P+A+R+ +LDP
Sbjct  1     MSMQKVSYIAVEVVFLTALLVLPIALSTNDEPIPANKAQLNSWFDRNVGPLASREGSLDP  60

Query  1116  ELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKP  937
              + +AE N   +RV  DG GDF+T+TDA+ SVP+ N  RVIISIG GNYTE+V I++   
Sbjct  61    AVVEAEKNVTVVRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTH  120

Query  936   FITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQ  757
             FITLYGDP+  P + F  T+ + GT+ SAT+ VE+DYF+A+N+ I+NSAPR +G   G+Q
Sbjct  121   FITLYGDPNNMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQ  180

Query  756   AVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELH  577
             AVA+  +G+ A++YNC++YGFQDT CDD G+H FKDCY+EGTVDFIFG+G++LYL++E+H
Sbjct  181   AVAMKIAGEYASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIH  240

Query  576   VIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEA  409
             VI G     IAA +R  + E  GY FVHC++TG     +L R W  + RVI+AY+++++A
Sbjct  241   VIPGDPVSFIAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDA  300

Query  408   VRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGS  229
             V P GW    G+ H   T YFGEY N GPG+ +  R  + K+L+D EVK FI++ +IEGS
Sbjct  301   VNPQGWSN-NGQNHTDSTVYFGEYHNEGPGSDLSKRAAYGKQLSDAEVKSFISIAYIEGS  359

Query  228   KWLLPP  211
             KWLLPP
Sbjct  360   KWLLPP  365



>ref|XP_007222175.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 ref|XP_007224100.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
 gb|EMJ23374.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 gb|EMJ25299.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
Length=356

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 250/352 (71%), Gaps = 6/352 (2%)
 Frame = -1

Query  1251  IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRV  1075
             + L+   +   ++DD  PIPAN+ +V +WF++NV+P   R+  LDP LA AE+    I+V
Sbjct  1     MTLILLTATIAMADDDTPIPANQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKV  60

Query  1074  SKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFI  895
              KDG G F+TITDA+ S+P DNT+RVI+ IG G Y E++ I + KPF+T +G P   P +
Sbjct  61    MKDGSGQFKTITDAINSIPADNTKRVIVYIGEGKYEEKITIPRNKPFVTFFGSPTNMPTL  120

Query  894   NFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYY  715
              F  T+ K GTV+SATVIVE+DYF A N+ I NS+PR +G   G+QAVAL  SG+ +A Y
Sbjct  121   TFAGTAQKYGTVNSATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALY  180

Query  714   NCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQA  547
             NCKL GFQDTFCDD+G HF KDC+IEGTVDFI+G+GK+LYL+ ELHV+      VI AQA
Sbjct  181   NCKLIGFQDTFCDDKGNHFLKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQA  240

Query  546   RHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPH  367
             R ++ +DTGYSFVHCKITG   G +LGR W     V++AYT M+E + P GW      P 
Sbjct  241   RDSSSDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSD-DNHPE  299

Query  366   YGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                T ++GEYK +GPG+   GR  + K+LTDE++KPF++LG+I+GSKWLLPP
Sbjct  300   RDNTVFYGEYKCSGPGSSAAGRVKYTKQLTDEQIKPFLSLGYIQGSKWLLPP  351



>ref|XP_008234142.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 253/361 (70%), Gaps = 7/361 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             M VN   + + L+   +   ++DD  P+PA + +V +WF++NV+P   +K  LDP LA A
Sbjct  8     MGVNAA-LTMTLILLTATIAMADDDTPVPAEQTQVNTWFNNNVKPYTEQKGTLDPALATA  66

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E+    I+V KDG G F+TITDA+ S+P  NT+RVI+ IGGG Y E++ I + KPF+T Y
Sbjct  67    EAGQTIIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFY  126

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P   P + F  T+ K GTV+SATVI E+DYF A N+   NS+PR +G   G+QAVAL 
Sbjct  127   GSPTNMPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALR  186

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-  565
              SG+ +A YNCKL GFQDT CDD+G HFFKDC+IEGTVDFI+G+GK+LYL+TELHV+   
Sbjct  187   VSGNKSALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTELHVVGDN  246

Query  564   ---VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
                VI AQAR +  +DTGYSFVHCKITG   G +LGR W     V++AYT M+E + P+G
Sbjct  247   GLTVITAQARDSASDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPVG  306

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W     +P    T ++GEYK++GPG+ + GR  + K LTDE+VKPF+ LG+I+GSKWLLP
Sbjct  307   WSN-DNRPERDSTVFYGEYKSSGPGSSVAGRVKYTKHLTDEQVKPFLNLGYIQGSKWLLP  365

Query  213   P  211
             P
Sbjct  366   P  366



>ref|XP_003516497.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   395 bits (1016),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 256/365 (70%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP 
Sbjct  1     MASRTICFTIQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF
Sbjct  61    LVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY+ TEL  
Sbjct  181   VALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M++ V
Sbjct  241   LGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
               LGW      P +  T  FGEY+N+GPGA   GR    K+L++ EVKP+ITL  IEGSK
Sbjct  301   NKLGWSN-NNHPEHDKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>gb|KEH30561.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 251/363 (69%), Gaps = 6/363 (2%)
 Frame = -1

Query  1275  RVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAE  1099
             R   + + I+++ +   GV+SDD+IPIPA K ++ SWF+SNV P+  RK+ LDP L  AE
Sbjct  6     RTYAINIAIIVLLFTVKGVLSDDTIPIPAEKTQLDSWFNSNVGPLEQRKSALDPALVTAE  65

Query  1098  SNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG  919
             +  K I+V +DG GDF+TITDA+ S+P  NT+RVI+SIGGGNY E++ IE+ KPF+TLYG
Sbjct  66    AGAKVIKVMQDGSGDFKTITDAINSIPTGNTKRVIVSIGGGNYNEKIKIERTKPFVTLYG  125

Query  918   DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
              P   P + +  T+ + GTV SAT+IVE+DYF A N+ I NSAPR +G + G+QAVAL  
Sbjct  126   TPANMPNLTYGGTAKQYGTVDSATLIVESDYFVAANMLISNSAPRPDGKSAGAQAVALRI  185

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG--  565
             SGD AA+YNCK  GFQDT CDD   HFFKDC I+GTVDFIFG+G +LY  +EL  +    
Sbjct  186   SGDKAAFYNCKFLGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYFKSELRALGDAG  245

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQAR +  +   YSFVHC +TG     FL R WM + ++I+AY+ M+  V P GW
Sbjct  246   PTVIVAQARKSVSDADLYSFVHCDVTGTGSTTFLARAWMTYPKIIFAYSTMSNVVDPKGW  305

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                   P +  T+YFGEY+NTGP +   GR    K+L+  EVKPFITLG I+GSKWLLPP
Sbjct  306   DNT-MHPEFDKTSYFGEYQNTGPKSDPKGRATVGKQLSAAEVKPFITLGMIQGSKWLLPP  364

Query  210   IKL  202
              K+
Sbjct  365   PKV  367



>ref|XP_006572809.1| PREDICTED: uncharacterized protein LOC100306177 isoform X1 [Glycine 
max]
Length=369

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 256/365 (70%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP 
Sbjct  1     MASRTICFTIQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF
Sbjct  61    LVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY+ TEL  
Sbjct  181   VALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M++ V
Sbjct  241   LGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
               LGW      P +  T  FGEY+N+GPGA   GR    K+L++ EVKP+ITL  IEGSK
Sbjct  301   NKLGWSN-NNHPEHDKTVRFGEYQNSGPGADPKGRATITKQLSEREVKPYITLAMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>ref|XP_003517875.1| PREDICTED: pectinesterase PPME1 [Glycine max]
 gb|KHN04070.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN32883.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN44801.1| Pectinesterase PPME1 [Glycine soja]
Length=369

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 197/365 (54%), Positives = 256/365 (70%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP 
Sbjct  1     MASRTICFTIQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF
Sbjct  61    LVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY+ TEL  
Sbjct  181   VALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M++ V
Sbjct  241   LGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
               LGW      P +  T  FGEY+N+GPGA   GR    K+L++ EVKP+ITL  IEGSK
Sbjct  301   NKLGWSN-NNHPEHDKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>ref|XP_008338559.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=370

 Score =   394 bits (1011),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 255/369 (69%), Gaps = 9/369 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  KN   +    LIM I+L   ++   ++DD+ P+PA  ++V +WF++NV+P   R K 
Sbjct  1     MAGKNKCMVVHAALIMTILLSATIA---MADDNTPVPAALSQVNTWFNNNVKPYTQRQKT  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDP +  AE+  K I+V +DGKG+F+T+TDA+ S+P  NT+RVI+ IG G Y E++ I +
Sbjct  58    LDPAVVTAEAGQKVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGSGEYKEKITIPR  117

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPF+TLYG P   P + F  T+ K GTV+SATVI E+DYF A N+ I NS+PR +G   
Sbjct  118   NKPFVTLYGSPTNMPILTFDGTAQKYGTVNSATVIAESDYFVAANLIIKNSSPRPDGKRV  177

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAVAL  SG+ AA YNCKL+GFQDT CDD G H FKDCYIEGTVDFI+G+GK+LYL+ 
Sbjct  178   GAQAVALRVSGNKAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNX  237

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
             ELHV+      VI AQAR ++ EDTGYSFVHCKITG   G +LGR W A  +V+YAYT M
Sbjct  238   ELHVLGDNGITVITAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNM  297

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
             T+ V P GW           T  +GEYK  GPG+  + +   +K+LTDE+ K FI+LG+I
Sbjct  298   TKVVNPAGWSN-DNHSERDKTVSYGEYKCMGPGSSKNNKRNLSKELTDEQAKRFISLGYI  356

Query  237   EGSKWLLPP  211
             +GSKWLLPP
Sbjct  357   QGSKWLLPP  365



>ref|XP_008219199.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=374

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 249/354 (70%), Gaps = 6/354 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHI  1081
             + + L+   +   ++DD  P+PA++ +V +WF++NV+P   R+  LDP LA AE+    I
Sbjct  17    LTMTLILLTATIAMADDDTPVPADQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVI  76

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V KDG G F+TITDA+ S+P DNT+RVI+ IG G Y E++ I + KPF+T +G P   P
Sbjct  77    KVMKDGSGQFKTITDAINSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFFGSPTNMP  136

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  T+ K GTV+SATVI E+DYF A N+ I NS+PR +G   G+QAVAL  SG+ +A
Sbjct  137   TLTFAGTAQKYGTVNSATVIAESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSA  196

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
              YNCKL GFQDT CDD+G HFFKDC+IEGTVDFI+G+GK+LYL+ ELHV+      VI A
Sbjct  197   LYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITA  256

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
             QAR +  +DTGYSFVHCKITG   G +LGR W     V++AYT M+E + P GW     +
Sbjct  257   QARDSASDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSN-DNR  315

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             P    T ++GEYK +GPG+   GR  + K LTDE++KPF++LG+I+GSKWLLPP
Sbjct  316   PERDNTVFYGEYKCSGPGSSAAGRVKYTKHLTDEQIKPFLSLGYIQGSKWLLPP  369



>ref|XP_003517889.1| PREDICTED: pectinesterase PPME1-like [Glycine max]
Length=369

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 255/365 (70%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANK ++ +WFS+NV P+  RK+ +DP 
Sbjct  1     MASKTICTTIQVTLIVAFLTTQVVFSDDNVPIPANKEQLGTWFSTNVGPLDQRKSTIDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ SVP  NT+RVI+ IG GNY E++ IE+ KPF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK++GFQDT CDD  +HFFKDC I+GT+D+IFG+GK+LY+ TEL  
Sbjct  181   VALRISGDKAAFYNCKMFGFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M+  V
Sbjct  241   LGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIV  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
               LGW      P +  T  FGEY+NTGPGA   GR    K+L++ EVKP+ITL  IEGSK
Sbjct  301   NKLGWSN-NNHPEHDKTVRFGEYQNTGPGADPKGRAPITKQLSETEVKPYITLAMIEGSK  359

Query  225   WLLPP  211
             WLLPP
Sbjct  360   WLLPP  364



>ref|XP_008234143.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 254/362 (70%), Gaps = 9/362 (2%)
 Frame = -1

Query  1278  MRVNQ-LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAK  1105
             M VN  L M ++L+   +   ++DD  P+PA++++V +WF++NV+P   ++  LDP LA 
Sbjct  8     MGVNAALTMTLILL--TATIAMADDDTPVPADQSQVNTWFNNNVKPYTEQQGTLDPALAT  65

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE+    I+V KDG G F+TITDA+ S+P  NT+RVI+ IGGG Y E++ I + KPF+T 
Sbjct  66    AEAGQTVIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTF  125

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             YG P   P + F  T+ K GTV+SATVI E+DYF A N+   NS+PR +G   G+QAVAL
Sbjct  126   YGSPTNMPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVAL  185

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG  565
               SG+ +A YNCKL GFQDT CDD+G HFFKDC+IEGTVDFI+G+GK+LYL+T LHV+  
Sbjct  186   RVSGNKSALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTRLHVVGD  245

Query  564   ----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                 VI AQAR +  +DTGYSFVHC ITG   G +LGR W     V++AYT M+E + P 
Sbjct  246   NGLTVITAQARDSASDDTGYSFVHCSITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPA  305

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             GW     +P    T ++GEYK++GPG+ + GR  + K LTDE+VKPF+ LG+I+GSKWLL
Sbjct  306   GWSN-DNRPERDSTVFYGEYKSSGPGSSVAGRVKYTKHLTDEQVKPFLNLGYIQGSKWLL  364

Query  216   PP  211
             PP
Sbjct  365   PP  366



>ref|XP_011076542.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/366 (51%), Positives = 258/366 (70%), Gaps = 8/366 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLS--PGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDP  1117
             M   +V+ + + +V +  L   P  +S +  PIPANKA++ SWF  NV P+A+R+ +LDP
Sbjct  1     MSMQKVSYIAVEVVFLTALLVLPIALSTNDEPIPANKAQLNSWFDRNVGPLASREGSLDP  60

Query  1116  ELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKP  937
              + +AE N   +RV  D  GDF+T+TDA+ SVP+ N  RVIISIG GNY E+V I++   
Sbjct  61    AVVEAEKNVTVVRVRTDRSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYIEKVKIDRYTH  120

Query  936   FITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQ  757
             FITLYGDP+  P + F  T+ + GT+ SAT+ VE+DYF+A+N+ I+NSAPR +G   G+Q
Sbjct  121   FITLYGDPNNMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQ  180

Query  756   AVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELH  577
             AVA+  +G+ A++YNC++YGFQDT CDD G+H FKDCY+EGTVDFIFG+G++LYL++E+H
Sbjct  181   AVAMKIAGEYASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIH  240

Query  576   VIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEA  409
             VI G     IAA +R  + E  GY FVHC++TG     +L R W  + RVI+AY+++++A
Sbjct  241   VIPGDPVSFIAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDA  300

Query  408   VRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGS  229
             V P GW    G+ H   T YFGEY N GPG+ +  R  + K+L+D EVK FI++ +IEGS
Sbjct  301   VNPQGWSN-NGQNHTDSTVYFGEYHNEGPGSDLSKRAAYGKQLSDAEVKSFISIAYIEGS  359

Query  228   KWLLPP  211
             KWLLPP
Sbjct  360   KWLLPP  365



>sp|D8VPP5.1|AL11A_OLEEU RecName: Full=Pectinesterase 1; AltName: Full=Pollen allergen 
Ole e 11.0101; Short=Ole e 11-1; AltName: Allergen=Ole e 11.0101; 
Flags: Precursor [Olea europaea]
 gb|ACZ57582.1| Ole e 11.0101 allergen precursor [Olea europaea]
Length=364

 Score =   390 bits (1001),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 261/365 (72%), Gaps = 13/365 (4%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M  + V  +++ I+L  Y+ P V+SDD  PIP+N A++ SWF   ++PVA RK  +DP L
Sbjct  1     MSCIAVEAVLLGILL--YI-PIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPAL  57

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE   K I++  DG GDF++I +A+ S+P+DNT+RVI+S+  GNY+E+V I   K +I
Sbjct  58    VTAEGQTKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYI  117

Query  930   TLYG-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             T YG DP+  P + F  T+ + GTV SAT+IVE++YF+A+N+ I+NSAPR +G   G+QA
Sbjct  118   TFYGEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQA  177

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
              AL  SGD A++YN K+YGFQDT CDD+G+HF+KDCYIEGTVDFIFG+GK+++L+TELH 
Sbjct  178   AALRISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHA  237

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             + G    +I AQAR T+ EDTGY FV+C++TG   G FLGR WM  ++V++AYTEM +A+
Sbjct  238   VPGDQPAIITAQARKTDSEDTGYYFVNCRVTG--GGAFLGRSWMPAAKVVFAYTEMVDAI  295

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW  V  KP +  T  F EY N GPGA M+ R  F K+L+D E K  I+LG IE SK
Sbjct  296   HPEGWILV--KPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASK  353

Query  225   WLLPP  211
             WLLPP
Sbjct  354   WLLPP  358



>ref|XP_006289810.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
 gb|EOA22708.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
Length=361

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 253/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V+ WF +NV P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPETKPQVEQWFKTNVAPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F+T+TDAL SVP  NT+RVII +  G Y E+V I+K KPFITL G P+
Sbjct  65    RTITVNPKG-GEFKTLTDALKSVPAGNTKRVIIKMAPGEYREKVTIDKNKPFITLMGQPN  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I+F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVISFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
             MAA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   MAAFYNCKFYGFQDTVCDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
             AA A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F + +   E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDATEANRFLSLGYIQGSKWLLPPPAL  361



>ref|XP_007207766.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
 gb|EMJ08965.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
Length=371

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 257/369 (70%), Gaps = 8/369 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             M RKN   + V+  ++V +++   +  V +DD+ P+PA+ ++V +WF++NV+    R+  
Sbjct  1     MARKNT-CLDVHAALIVTLILLTAAIAVANDDT-PVPADYSQVNTWFNNNVKSYKERQGT  58

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDP L  AE     ++V KDG G+F+TITDA+ S+P DNT+RVI+ IGGG Y E++ I +
Sbjct  59    LDPALVTAEVGQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPR  118

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPF+T YG P   P + F   + K GT+ SATVI E+DYF A+N+ I NS+P+    + 
Sbjct  119   NKPFVTFYGSPTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSV  178

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G QA+AL  SG  +A +NC+L GFQDT CDD+G HFFKDC+IEGTVDFIFG+GK+LYL+T
Sbjct  179   GQQALALRVSGTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNT  238

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
             ELHV+      VI AQAR +  EDTGYSFVHC ITG   G +LGR W    RV++AYT M
Sbjct  239   ELHVLGDNEMTVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGM  298

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
             +E + P GW+    +P    T ++GEYK +GPG+ M GR  +AK+L +E++KPF+ LG+I
Sbjct  299   SEVITPAGWNN-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYI  357

Query  237   EGSKWLLPP  211
             +GSKWLLPP
Sbjct  358   QGSKWLLPP  366



>ref|XP_007206641.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 ref|XP_007206849.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
 gb|EMJ07840.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 gb|EMJ08048.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
Length=371

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 257/369 (70%), Gaps = 8/369 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             M RKN   + V+  ++V +++   +  V +DD+ P+PA+ ++V +WF++NV+    R+  
Sbjct  1     MARKNT-CLDVHAALIVTLILLTATIAVANDDT-PVPADYSQVNTWFNNNVKSYKERQGT  58

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDP L  AE     ++V KDG G+F+TITDA+ S+P DNT+RVI+ IGGG Y E++ I +
Sbjct  59    LDPALVTAEVGQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPR  118

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPF+T YG P   P + F   + K GT+ SATVI E+DYF A+N+ I NS+P+    + 
Sbjct  119   NKPFVTFYGSPTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSV  178

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G QA+AL  SG  +A +NC+L GFQDT CDD+G HFFKDC+IEGTVDFIFG+GK+LYL+T
Sbjct  179   GQQALALRVSGTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNT  238

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
             ELHV+      VI AQAR +  EDTGYSFVHC ITG   G +LGR W    RV++AYT M
Sbjct  239   ELHVLGDNEMTVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGM  298

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
             +E + P GW+    +P    T ++GEYK +GPG+ M GR  +AK+L +E++KPF+ LG+I
Sbjct  299   SEVITPAGWNN-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYI  357

Query  237   EGSKWLLPP  211
             +GSKWLLPP
Sbjct  358   QGSKWLLPP  366



>sp|B2VPR8.1|AL11B_OLEEU RecName: Full=Pectinesterase 2; AltName: Full=Pollen allergen 
Ole e 11.0102; Short=Ole e 11-2; AltName: Allergen=Ole e 11.0102; 
Flags: Precursor [Olea europaea]
 gb|AAY88919.1| Ole e 11.0102 allergen precursor [Olea europaea]
Length=364

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 259/365 (71%), Gaps = 13/365 (4%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M  + V  +++ I+L  Y+ P V+SDD  PIPAN A++ SWF   ++PVA RK  +DP L
Sbjct  1     MSCIAVEAVLLGILL--YI-PIVLSDDRAPIPANSAQLNSWFDGIIQPVAVRKATMDPAL  57

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE   K I++  DG GDF++I +A+ S+P+DNT+RVI+S   GNY+E+V I   K +I
Sbjct  58    VTAEGQAKVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSFSPGNYSEKVKIGMYKHYI  117

Query  930   TLYG-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             T YG DP+  P + F  T+ + GTV SAT+IVE++YF+A+N+ I+NSAPR +G   G+QA
Sbjct  118   TFYGEDPNNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQA  177

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
              AL  SGD A++YN K+YGFQDT CDD+G+HF+KDCYIEGTVDFIFG+GK+++L+TELH 
Sbjct  178   AALRISGDKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHA  237

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             + G    +I AQAR T  EDTGY FV+C++TG   G FLGR WM  ++V++AYTEM +A+
Sbjct  238   VPGDQPAIITAQARKTESEDTGYYFVNCRVTG--GGAFLGRSWMPAAKVVFAYTEMGDAI  295

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW  V  KP +  T  F EY N GPGA M+ R  F K+L+D E K  I+LG IE SK
Sbjct  296   HPEGWILV--KPEHESTVRFPEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASK  353

Query  225   WLLPP  211
             WLLPP
Sbjct  354   WLLPP  358



>ref|XP_007207707.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
 gb|EMJ08906.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
Length=371

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 254/369 (69%), Gaps = 8/369 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             M RKN        LI+ ++L+  +    V++D  P+PA+ ++V +WF++NV+    R+  
Sbjct  1     MARKNTCLDVHAALIVTLILLTAII--AVANDDTPVPADYSQVNTWFNNNVKSYKERQGT  58

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDP L  AE     ++V KDG G+F+TITDA+ S+P DNT+RVI+ IGGG Y E++ I +
Sbjct  59    LDPALVTAEVGQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPR  118

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPF+T YG P   P + F   + K GT+ SATVI E+DYF A+N+ I NS+P+    + 
Sbjct  119   NKPFVTFYGSPTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSV  178

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G QA+AL  SG  +A +NC+L GFQDT CDD+G HFFKDC+IEGTVDFIFG+GK+LYL+T
Sbjct  179   GQQALALRVSGTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNT  238

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
             ELHV+      VI AQAR +  EDTGYSFVHC ITG   G +LGR W    RV+++YT M
Sbjct  239   ELHVLGDNEMTVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFSYTGM  298

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
             +E + P GW+    +P    T ++GEYK +GPG+ M GR  +AK+L +E++KPF+ LG+I
Sbjct  299   SEVITPAGWNN-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYI  357

Query  237   EGSKWLLPP  211
             +GSKWLLPP
Sbjct  358   QGSKWLLPP  366



>ref|XP_002511045.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51647.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=366

 Score =   387 bits (993),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 244/353 (69%), Gaps = 7/353 (2%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIR  1078
             VI      +  V+SDD+ PIPA + ++ SWF +NV+P ++RK  LDP L  AE+ PK I+
Sbjct  14    VIAATLLAATTVISDDATPIPAAEDQINSWFQANVKPFSSRKGTLDPALEAAETAPKRIK  73

Query  1077  VSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPF  898
             V  DG GDF+++TDAL S+P  N  RVI+ IG G YTE+VII++ KPF+TL G  +  P 
Sbjct  74    VRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGAGVYTEKVIIDRIKPFVTLLGSSNPMPT  133

Query  897   INFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAY  718
             + F  T+ K GTV+SAT+ VEADYF A NI I N+APR +G   G+QAVAL  +GD  A+
Sbjct  134   LQFDGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRA-GAQAVALRVAGDKTAF  192

Query  717   YNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----GVIAAQ  550
             YNC++ GFQDT CDD+GRHFFKDCYIEGTVDFIFG+GK+LYL T L+VI      VI AQ
Sbjct  193   YNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTNLNVIKEKFMTVITAQ  252

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
             A+HT+ ED+G+SFVH  I G     +LGR WM    V+++Y++M+  V P GW      P
Sbjct  253   AKHTSSEDSGFSFVHSNIAGDATDAYLGRAWMEMPEVVFSYSKMSNVVIPAGWSNY-NHP  311

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                   +F EYK +GPGA   GR  F+K+L+D E K FI+LG+I+G KWLLPP
Sbjct  312   EREKNIFFAEYKCSGPGANPSGRAKFSKQLSDSEAKSFISLGYIQGCKWLLPP  364



>ref|XP_007215602.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
 gb|EMJ16801.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
Length=356

 Score =   385 bits (990),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 247/352 (70%), Gaps = 6/352 (2%)
 Frame = -1

Query  1251  IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRV  1075
             + L+   +   ++DD  P+PA++++V +WF++NV+P   R+  LDP LA AE+    I+V
Sbjct  1     MTLILLTATIAMADDDTPVPADQSQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKV  60

Query  1074  SKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFI  895
              KDG G F+TITDA+ S+P DNT+RVI+ IG G Y E++ I + KPF+T YG P   P +
Sbjct  61    MKDGSGQFKTITDAINSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFYGSPTNMPTL  120

Query  894   NFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYY  715
              F  T+ K GTV+SATVIVE+DYF A N+ I NS+PR +G   G+QAVAL  SG+ +A Y
Sbjct  121   TFTGTAQKYGTVNSATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALY  180

Query  714   NCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQA  547
             NCKL GFQDT CDD+G HFFKDC+IEGTVDFI+G+GK+LYL+ ELHV+      VI AQA
Sbjct  181   NCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQA  240

Query  546   RHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPH  367
             R +  +DTGYSF HC ITG   G +LGR W     V++AYT M++ + P GW      P 
Sbjct  241   RDSASDDTGYSFAHCNITGTGNGTYLGRAWRISPMVVFAYTSMSKVINPAGWSN-DNHPE  299

Query  366   YGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                T ++GEYK +GPG+ + GR  + K +TDE++KPF++L +I+GSKWLLPP
Sbjct  300   RDNTVFYGEYKCSGPGSSVAGRVKYIKHMTDEQIKPFLSLDYIQGSKWLLPP  351



>ref|XP_008234141.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=367

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 248/361 (69%), Gaps = 11/361 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEP-VANRKNLDPELAKA  1102
             M VN   + + L+ + +   ++DD  P+ A++++V +WF++NV+P  A R  LDP LA A
Sbjct  8     MGVNA-ALTMTLILFTATITMADDHTPVLADQSQVNTWFNNNVKPYTARRGTLDPALATA  66

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E+  K I+V KDG G F+TITDA       NT+RVI+ IGGG Y E++ I + KPF+T Y
Sbjct  67    EAGQKVIKVMKDGSGQFKTITDAXXX----NTKRVIVYIGGGEYNEKITIPRNKPFVTFY  122

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P   P + F  TS K GTV+SATVI E+DYF A N+ I NS+PR +G   G+QAVAL 
Sbjct  123   GSPANMPTLTFAGTSQKYGTVNSATVIAESDYFVASNVIIKNSSPRPDGKRVGAQAVALR  182

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-  565
              SG+ +A YNCKL GFQDT CDD G H FKDC+IEGTVDFI+G+GK+LYL+TELHV+   
Sbjct  183   VSGNKSALYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDN  242

Query  564   ---VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
                VI AQAR +  EDTGYSFVHCKITG   G +LGR W     V+YAYT MT+ + P G
Sbjct  243   GLTVITAQARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAG  302

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W      P    T ++GEYK +GPG+   GR  + K LTDE++KPF++LG+I+GSKWLLP
Sbjct  303   WSD-DNHPERDSTVFYGEYKCSGPGSSAAGRVKYTKHLTDEQIKPFLSLGYIQGSKWLLP  361

Query  213   P  211
             P
Sbjct  362   P  362



>ref|XP_008244214.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 251/356 (71%), Gaps = 8/356 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L + ++L++ +   VV+DD  P+PA++++V +WF++NV P   R+  LDP L  AE    
Sbjct  14    LTVTLILLNAII--VVADDDAPVPADQSQVNTWFNNNVNPNKERQGKLDPALVTAELGQT  71

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              ++V KDG G+F+TITDA+ S+P +NT+RVI+ IGGG Y E++ I +  PF+T YG P  
Sbjct  72    IVKVMKDGSGEFKTITDAVNSIPAENTKRVIVYIGGGEYNEKITIPRNIPFVTFYGSPTN  131

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F   + K GTV SATVI E+DYF A N+ I NS+P+ +G   G QA+AL  SG+ 
Sbjct  132   MPTLIFGGNAQKYGTVDSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNK  191

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             +A +NC++ GFQDT CDD+G HFFKDC+IEGTVDFIFG+GK+LYL+TELHV+      VI
Sbjct  192   SALFNCRVIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEMTVI  251

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR +  EDTGYSFVHC ITG   G +LGR W    RV++AYT M+E + P GW+   
Sbjct  252   TAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTSMSEVITPAGWNN-K  310

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +P    T ++GE+K +GPG+ M GR  + K+L +E+VKPF+ LG+I+GSKWLLPP
Sbjct  311   NRPERDSTVFYGEHKCSGPGSSMVGRVKYTKQLNEEQVKPFLNLGYIQGSKWLLPP  366



>ref|XP_002871269.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47528.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   384 bits (985),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 251/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V  WF +NV P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPEAKPQVAQWFKANVAPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F+T+TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P 
Sbjct  65    RIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPG  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I +  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
             AA A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPAL  361



>ref|NP_177152.2| pectinesterase PPME1 [Arabidopsis thaliana]
 sp|Q84WM7.1|PPME1_ARATH RecName: Full=Pectinesterase PPME1; Short=AtPPME1; Short=PE PPME1; 
AltName: Full=Pectin methylesterase 9; Short=AtPME9; AltName: 
Full=Pectin methylesterase PPME1; AltName: Full=Protein 
POLLEN SPECIFIC PME 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22801.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE35001.1| pectinesterase PPME1 [Arabidopsis thaliana]
Length=361

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 253/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +L+ +++P V +DD  PIP  K +V  WF++NV P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F+T+TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P+
Sbjct  65    RIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPN  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I +  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
             AA A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPAL  361



>ref|XP_010087095.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXB26150.1| Pectinesterase PPME1 [Morus notabilis]
Length=368

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 247/357 (69%), Gaps = 8/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP-K  1087
             L++++V +   +  V +DD++ IP  K ++ SWF+ NV P++  K LDP L  AE+ P K
Sbjct  9     LVLLVVALIATNNIVNADDNVQIPYQKGQLNSWFNGNVRPLSASKGLDPALVAAETGPAK  68

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              ++V+KDG GDF+T+ +A+ SVP  N++RVII +GGG Y E+V I++ KPFITLYG P  
Sbjct  69    VVKVAKDGSGDFKTVQEAINSVPSGNSKRVIIYVGGGEYHEKVTIDRSKPFITLYGSPTN  128

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P I++  T+ + GTV SAT+IV +DYF  +N+ I NSAPR +G  KG+QAVAL  SG+ 
Sbjct  129   MPTISYAGTAAQYGTVDSATLIVGSDYFVGVNLIIKNSAPRPDGIRKGAQAVALRASGNK  188

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-----DGV  562
             A +Y CKL GFQDT CDD G H FKDCYIEGTVDFIFG+G +LYL+TELHVI     + V
Sbjct  189   ATFYKCKLLGFQDTLCDDRGFHLFKDCYIEGTVDFIFGSGTSLYLNTELHVISDPTMESV  248

Query  561   IAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGV  382
             I AQAR +  + TG+SFVHC ITG  +   LGR WM  ++VI+AYT +   + P GW   
Sbjct  249   ITAQARQS-ADGTGFSFVHCTITGNAKDAVLGRAWMPNAKVIFAYTNLGGVISPQGWSD-  306

Query  381   PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                P    T +FGEY+NTG  A  DGR  F K L D + KP++TLGFI+GSKWLLPP
Sbjct  307   NMHPERDNTVFFGEYQNTGASANDDGRVDFVKTLNDAQAKPYLTLGFIQGSKWLLPP  363



>ref|XP_009136508.1| PREDICTED: putative pectinesterase 63 isoform X1 [Brassica rapa]
Length=364

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 256/359 (71%), Gaps = 5/359 (1%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNP  1090
              LI+ I+LV    P V  +D+ PIP NK  ++ WF++NV  +A+RK+ LDP L  AE+ P
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVPSLASRKDTLDPALLTAEATP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I+V ++G+GDF+T+T+A+ SVP  N +RVII +G G Y E+V I++ KPFITLYGDP+
Sbjct  67    RVIKVRQNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPN  126

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + F  T+ + GTV SAT+IV +DYF AINI + NSAP  +G  KG+QA+++  SG+
Sbjct  127   AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVVGDGLRVI  246

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GWH   
Sbjct  247   TAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-N  305

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
              +     T ++GEYK +GPG++ + R  + + + + E   FI+LG+I+GS WLLPP  L
Sbjct  306   TQTERDKTVFYGEYKCSGPGSRKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPPHSL  364



>ref|XP_009122341.1| PREDICTED: pectinesterase PPME1 [Brassica rapa]
 gb|AGX13882.1| pectin methylesterase [Brassica rapa subsp. chinensis]
Length=365

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 247/356 (69%), Gaps = 5/356 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ ++V +++P V++DD+ PIP  K +V+ WF +NV P+  RK LDP L  AE+ P
Sbjct  5     NVSILLALVVVFVTPTVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V   G G+F+T+ DA+ SVP  NT+RVII I  G Y E+V I++ KPFITL GDP 
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G  KG+QA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
             MAA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G +LYL T+LHV+ DG  VI
Sbjct  184   MAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  +  E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                H   T ++GEYK  G G++ + R  F +K+       F+TLG+IEGSKWLLPP
Sbjct  304   IAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPP  358



>ref|XP_009363892.1| PREDICTED: probable pectinesterase 48 [Pyrus x bretschneideri]
Length=355

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 245/354 (69%), Gaps = 9/354 (3%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHI  1081
             M I+L    +    +DD+ PIP++ +++ +WF++NV+P   R++ LDP +A AE+    I
Sbjct  1     MTILLT---ATAATADDNTPIPSDHSQINTWFNNNVKPYTERQSTLDPAVATAEAGQTVI  57

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V +DGKGDF+T+TDA+ S+P  NT+RVI+ IG G Y E++ I + KPF+TLYG P    
Sbjct  58    KVMQDGKGDFKTVTDAINSIPAGNTKRVIVHIGRGEYNEKITIPQNKPFVTLYGSPTKMS  117

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  T+ K GTV+SATVI E DYF A N+ I NS+PR +G   G+QAVAL  SG+ +A
Sbjct  118   NLTFAGTAQKYGTVNSATVIAEFDYFIATNLLIKNSSPRPDGKRVGAQAVALRVSGNNSA  177

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
              YNCKL GFQDT CDD G H FKDCYIEGTVDFI+G+GK+LYL+TELHV+      VI A
Sbjct  178   LYNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITA  237

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
             QAR +  EDTGYSFVHC +TG   G +LGR W    +V+YAYT MTE V P GW      
Sbjct  238   QARDSASEDTGYSFVHCNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWSN-DNH  296

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             P    T  +GEYK   PG+    +   +K+LTD++VKPFI+LG+I+GSKWLLPP
Sbjct  297   PERDNTVSYGEYKCMDPGSSTYNKRNLSKELTDQQVKPFISLGYIQGSKWLLPP  350



>emb|CDX70037.1| BnaA10g23860D [Brassica napus]
Length=365

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 247/356 (69%), Gaps = 5/356 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ ++V +++P V++DD+ PIP  K +V+ WF +NV P+  RK LDP L  AE+ P
Sbjct  5     NVSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V   G G+F+T+ DA+ SVP  NT+RVII I  G Y E+V I++ KPFITL GDP 
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G  KG+QA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
             MAA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G +LYL T+LHV+ DG  VI
Sbjct  184   MAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  +  E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                H   T ++GEYK  G G++ + R  F +K+       F+TLG+IEGSKWLLPP
Sbjct  304   IAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPP  358



>ref|NP_568181.1| putative pectinesterase 48 [Arabidopsis thaliana]
 sp|Q9LY19.2|PME48_ARATH RecName: Full=Probable pectinesterase 48; Short=PE 48; AltName: 
Full=Pectin methylesterase 48; Short=AtPME48; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED91154.1| putative pectinesterase 48 [Arabidopsis thaliana]
Length=361

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 253/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V  WF+++V P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGMLVIFVSPMVFADDLTPIPEGKPQVVQWFNTHVGPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F+T+TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P+
Sbjct  65    RIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMGQPN  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I +  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
             AA A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANCFLSLGYIQGSKWLLPPPAL  361



>emb|CDX98975.1| BnaC09g48600D [Brassica napus]
Length=365

 Score =   382 bits (980),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 248/356 (70%), Gaps = 5/356 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ ++V +++P V++DD+ PIP  K +V+ WF +NV P+  RK LDP L  AE+ P
Sbjct  5     NVSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V   G G+F+T+ DA+ SVP +NT+RVII I  G Y E+V I++ KPFITL GDP 
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAENTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G  KG+QA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIIVKNTAPAPDGKAKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G +LYL T+LHV+ DG  VI
Sbjct  184   KAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSKEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                H   T ++GEYK  G G++ + R  F +K+       F+TLG+IEGSKWLLPP
Sbjct  304   IAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPP  358



>ref|XP_004287800.1| PREDICTED: probable pectinesterase 48-like [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   381 bits (979),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 256/362 (71%), Gaps = 10/362 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M ++  +M+I  V   +   ++DD + IP++K+ V  WF  NV+P+A+RK+ LDP+L KA
Sbjct  8     MSIHAALMMITTVLLAATVSMADDPV-IPSDKSAVDKWFQDNVKPLADRKSSLDPDLVKA  66

Query  1101  ES-NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             E  +PK ++V  +G GDF+ I++A+ S+P  NT+RVII +GGG Y E++ I K KPF+TL
Sbjct  67    EDGDPKIVKVMANG-GDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNKPFVTL  125

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
              GD    P + F+  S K GT++SAT+ VE+DYF  +N+NI+NS+PR +G  +G+QA+AL
Sbjct  126   MGDSKNMPNLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDGKKEGAQALAL  185

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG  565
               SG+ AA YNC+++GFQDT CDD+G HF KD Y+EGTVDFIFG+GK+LYL+T ++V+  
Sbjct  186   KLSGNKAALYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHINVLGD  245

Query  564   ----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                 VI A AR  + ED GYSFVHC ITG   G FLGR W A  +V +AYTEM E V+P 
Sbjct  246   SGMTVITANAREGD-EDKGYSFVHCSITGTGSGTFLGRAWRAAPKVTFAYTEMGEVVKPE  304

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             GW      P Y  +  FGEYKNTGPG+ M  R  F K+L+D + KPFI+LGFI+GSKWLL
Sbjct  305   GWTD-NNHPEYDKSVSFGEYKNTGPGSSMSKRVSFTKELSDADAKPFISLGFIDGSKWLL  363

Query  216   PP  211
             PP
Sbjct  364   PP  365



>ref|XP_010452707.1| PREDICTED: pectinesterase PPME1 [Camelina sativa]
Length=361

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 250/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V+ WF +NV P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F T+T A+ SVP  NT+RVII I  G+Y E+V IE+ +PFITL G P 
Sbjct  65    RIINVNPKG-GEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F +++   E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSLSAKRVPFIQEIDPTEANRFLSLGYIQGSKWLLPPPAL  361



>gb|KDP39968.1| hypothetical protein JCGZ_03499 [Jatropha curcas]
Length=358

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 252/355 (71%), Gaps = 16/355 (5%)
 Frame = -1

Query  1251  IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRV  1075
             I+ + + +  V SDD++PIP  +AEV +WF +NV+P+A+RK  LD  L  AE+ PK I+V
Sbjct  15    IIAIVFTAITVSSDDAVPIPEAEAEVNAWFEANVKPLADRKGTLDGNLEAAEATPKTIKV  74

Query  1074  SKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFI  895
             S DG G+F+TITDA+ S+P  NTQRVI+ IG G YTE++ +EKEK F++  G P+ T  I
Sbjct  75    SADGSGEFKTITDAVKSIPAKNTQRVIVDIGPGTYTEKITVEKEKGFVSFIGVPEKT-II  133

Query  894   NFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYY  715
              F  T+ + GTV+SAT+ VE+D+F        N+AP  +G   G+QAVA    G+MA++Y
Sbjct  134   EFAGTAHEYGTVYSATLQVESDFF--------NTAPPPDGVRPGAQAVAFRIGGNMASFY  185

Query  714   NCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQA  547
             NC+  GFQDT CDD+G HFFKDCYIEGTVDFIFG+GK++YL+T+L VI      VI AQA
Sbjct  186   NCRFIGFQDTICDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLEVIQDKDMTVIVAQA  245

Query  546   RHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPH  367
             R  N E+TG+SFVHC ITG  +G FLGR WM   + I+AY+ +++ + P GW      P 
Sbjct  246   RG-NAEETGFSFVHCSITGKAKGAFLGRAWMPAPKAIFAYSTISDVICPEGWSN-NQHPE  303

Query  366   YGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
                  +FGEYKNTGPGA ++GR  FAK+LT+ EVKPFI+L +IEGSKWLLPP KL
Sbjct  304   REPEIFFGEYKNTGPGAAIEGRVKFAKQLTEAEVKPFISLSYIEGSKWLLPPPKL  358



>ref|XP_010546425.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   379 bits (974),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 245/347 (71%), Gaps = 5/347 (1%)
 Frame = -1

Query  1230  SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGD  1054
             SP V++ DS PIP ++AEV+ WF +NV P+A+R   LDP L  AE+ P+ I VSK+G GD
Sbjct  17    SPAVLAGDSTPIPEDRAEVEEWFKANVAPLAHRNATLDPALVAAEAAPRVITVSKNGDGD  76

Query  1053  FETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTST  874
             F+T+  A+ S+P+ N +RVII +G G Y E+V I++ KPFITLYG PDA P + +H T+ 
Sbjct  77    FKTLKAAIKSIPKGNQERVIIKMGPGEYREKVTIDRNKPFITLYGRPDAMPVLTYHGTAA  136

Query  873   KDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGF  694
             K GTV SA++IV +DYF A+NI + NSAP  +G  KG+QA+A+  SG+ AA+YNC+ +GF
Sbjct  137   KYGTVDSASLIVLSDYFMAVNIILKNSAPMPDGKMKGAQALAMRISGNKAAFYNCEFHGF  196

Query  693   QDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---VIAAQARHTNKEDT  523
             QDT CDD G HFFKDCYIEGT DFIFG+G ++YL+T+L+V+     VI AQA  T  + +
Sbjct  197   QDTLCDDIGYHFFKDCYIEGTFDFIFGSGTSIYLNTQLNVVGNGMRVITAQAGKTIADPS  256

Query  522   GYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFG  343
             GYSFVHC++TG     +LGR WM+  +V+YAYTEMT A+ P GW  +  +P    + Y+G
Sbjct  257   GYSFVHCRVTGTGSEIYLGRAWMSHPKVVYAYTEMTSALNPTGWQ-LNSEPDRDSSVYYG  315

Query  342   EYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             EYK  GPG+  + R    + L   E   F+TLG+I+GSKWLLPP  L
Sbjct  316   EYKCYGPGSNTEERVASTRSLDSNEAARFLTLGYIQGSKWLLPPPAL  362



>ref|XP_010423212.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 250/359 (70%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V+ WF +NV P+A RK LDP L  AE+ P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPEAKPQVEQWFKANVGPLAQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F T+T A+ SVP  NT+RVII I  G+Y E+V IE+ +PFITL G P 
Sbjct  65    RIINVNPKG-GEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVIIFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F +++   E   F++LG+I+GSKWLLPP  L
Sbjct  303   KTPAHDKTVFYGEYKCSGPGSISAKRVPFIQEIDPTEANRFLSLGYIQGSKWLLPPPAL  361



>emb|CDY14046.1| BnaC02g01630D [Brassica napus]
Length=363

 Score =   379 bits (972),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/355 (51%), Positives = 254/355 (72%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              +++ +V+V +++P V++DD+ PIP  K +V+ WF +NV P+ +RK LDP L  AE++P+
Sbjct  7     SMLLAMVMV-FVTPMVLADDNTPIPEAKPQVEQWFKTNVAPLPSRKGLDPALVAAEASPR  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+  G G+F+T+TDAL SVPE NT+RVII +  G Y E+V ++K+KPFITL GDP A
Sbjct  66    TINVNPKG-GEFKTLTDALKSVPEKNTKRVIIKMAPGEYKEKVTLDKKKPFITLMGDPKA  124

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV+SA++I+ +DYF A+NI + NSAP+ +G  KG+QA+A+  SG+ 
Sbjct  125   MPVLTFDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK +GFQDT CDD G HFFKDCYIEGT DFIFG+G ++YL+T+LH + DG  VI+
Sbjct  185   AAFYNCKFHGFQDTVCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLETQLHAVGDGIKVIS  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  + +E +GYSFVHCK+TG   G +LGR W +  +V+YAYTEM+  V P GW     
Sbjct  245   AHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWQANKV  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               H   T ++GEYK TGPG+    R  F + + + E   F++LG+I+GS WLLPP
Sbjct  305   AAH-DKTVFYGEYKCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIQGSSWLLPP  358



>gb|ADH82125.1| pectinesterase [Brassica rapa subsp. pekinensis]
Length=363

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 254/355 (72%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              +++ +V+V +++P V++DD+ PIP  K + + WF +NV P+ +RK LDP L  AE++P+
Sbjct  7     SMLLAMVMV-FVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPSRKGLDPALVAAEASPR  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+  G G+F+T+TDAL S+PE NT+RVII +G G Y E+V I+K+KPFITL GDP A
Sbjct  66    TINVNPKG-GEFKTLTDALKSIPEKNTKRVIIKMGPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + +  T+ + GTV+SA++I+ +DYF A+NI + NSAP+ +G  KG+QA+A+  SG+ 
Sbjct  125   MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK +GFQDT CDD G HFFKDCYIEGT DFIFG+G ++YLDT+LH + DG  VI+
Sbjct  185   AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAVGDGIKVIS  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  + +E +GYSFVHCK+TG   G +LGR W +  +V+YAYTEM+  V P GW     
Sbjct  245   AHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANKV  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               H   T ++GEY+ TGPG+    R  F + + + E   F++LG+I+GS WLLPP
Sbjct  305   AAH-DKTVFYGEYRCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIKGSSWLLPP  358



>ref|XP_002511043.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51645.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 246/359 (69%), Gaps = 11/359 (3%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             V   I+ IVL    +  V SDD+ PIP   + +  WFS+NV+P+A+RK  LDP L  AE+
Sbjct  11    VQFAILAIVLA---ANTVSSDDTTPIPEAASGIAGWFSANVKPLADRKGTLDPALEAAEA  67

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
             NPK I+V  DG G+F+TI DA+ S+P  NTQRVI+ IG G Y E++ IE++KPF+T  G 
Sbjct  68    NPKTIKVRLDGSGEFKTIADAVKSIPSGNTQRVIVDIGPGTYNEKITIERDKPFVTFLG-  126

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P     I F  T+ + GTV+SAT+ VE++YF A N+ I N+APR +G T G+QA+A+   
Sbjct  127   PSNMATIAFGGTAHEYGTVYSATLQVESEYFIAANLIIQNTAPRPDGKTPGAQALAVRTG  186

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             G  AA+Y  K+ GFQDT CDD+G HFFKDCYIEGTVDFIFG+GK++YL+TE++V+     
Sbjct  187   GSKAAFYKVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEP  246

Query  564   -VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
              VI AQAR    EDTG+SFVHC + G   G  LGR WM   RV++AYT MT  V P GW 
Sbjct  247   TVITAQARQ-GSEDTGFSFVHCSVGGTGTGAHLGRAWMEAPRVVFAYTAMTGVVNPEGWS  305

Query  387   GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  P       FGEYKNTGPGA  DGR  ++K+LTD E+ PF++LGFIEGSKWLLPP
Sbjct  306   S-NNHPEREAKVVFGEYKNTGPGAAPDGRVKYSKQLTDAEIAPFLSLGFIEGSKWLLPP  363



>ref|XP_006394480.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
 gb|ESQ31766.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
Length=364

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 254/359 (71%), Gaps = 5/359 (1%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNP  1090
              LI+ I+LV   SP V  +D+ PIP NK  ++ WF++NV  +A+RK  LDP L  AE++P
Sbjct  7     SLIVTILLVVITSPIVSGNDASPIPQNKRRIEQWFNTNVPSLASRKGTLDPALLTAEASP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I+V ++G+G F+T+T+A+ SVP  NT+RVII +G G Y E++ I++ KPFITLYG P+
Sbjct  67    RVIKVKQNGRGHFKTLTEAIKSVPAGNTRRVIIKLGPGVYKEKITIDRNKPFITLYGHPN  126

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + F  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+
Sbjct  127   AMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLRTQLNVVGDGLRVI  246

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  +  E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW    
Sbjct  247   TAHAGKSAAEKSGYSFVHCKVTGTGTGVYLGRAWMSHPKVVYAYTDMSSVVNPSGWQD-N  305

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             G+     T ++GEYK +GPG+  + R  + + + + E   FI+LG+I+GS WLLPP  L
Sbjct  306   GQTERDKTVFYGEYKCSGPGSNKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPPPTL  364



>ref|XP_010491358.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 249/359 (69%), Gaps = 5/359 (1%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV ++SP V +DD  PIP  K +V+ WF +NV P+  RK LDP L  AE+ P
Sbjct  5     NVSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLPQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V+  G G+F TIT A+ SVP  NT+RVII I  G+Y E+V IE+ +PFITL G P 
Sbjct  65    RIINVNPKG-GEFTTITAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P I F  T+ K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI
Sbjct  184   YAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG  +G +LGR WM+  +V+YAYTEMT  V P GW    
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               P +  T ++GEYK +GPG+    R  F +++   E   F++LG+I+GSKWLLPP  L
Sbjct  303   KVPAHDKTVFYGEYKCSGPGSLSAKRVPFIQEIDLTEANRFLSLGYIQGSKWLLPPPAL  361



>ref|XP_011014352.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=364

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 248/365 (68%), Gaps = 9/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M ++   Q  M  +L+  +S  V SDD  PIPA+ + + +WF  NV+P+A+RK  +DP L
Sbjct  1     MGSIAAIQCAMTAILL--VSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPAL  58

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE+ P+ I+V +DG G+F+T+ DA+ S+P  NT+RVI+ IG G Y E++ IE+ KPF+
Sbjct  59    EAAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERGKPFV  118

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             T  G P   P ++F  T+ + GTV+SAT+  EADYF A NI I NSAPR  G  KG QAV
Sbjct  119   TFLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIIKNSAPRPNGELKGEQAV  178

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             AL  SGD +A+YNC+L GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TELHVI
Sbjct  179   ALRISGDKSAFYNCRLLGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVI  238

Query  570   ----DGVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAV  406
                    I A AR++  EDTG+SFVHCK+ G   +G +LGR W A  RV+++YT M++ V
Sbjct  239   GEENGNFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSDVV  298

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW      P    T  FGEYK  G GA   GR   +K+LT ++  PFI+LGFIEGSK
Sbjct  299   NPEGWSN-NFHPERDQTALFGEYKCEGEGANPAGRAKASKQLTPDQAAPFISLGFIEGSK  357

Query  225   WLLPP  211
             W+L P
Sbjct  358   WVLHP  362



>ref|XP_009125688.1| PREDICTED: pectinesterase PPME1-like [Brassica rapa]
 gb|AGX13881.1| pectin methylesterase [Brassica rapa subsp. chinensis]
 emb|CDY55179.1| BnaAnng13700D [Brassica napus]
Length=363

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 253/355 (71%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              +++ +V+V +++P V++DD+ PIP  K + + WF +NV P+ +RK LDP L  AE++P+
Sbjct  7     SMLLAMVMV-FVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPSRKGLDPALVAAEASPR  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+  G G+F+T+TDAL S+PE NT+RVII +  G Y E+V I+K+KPFITL GDP A
Sbjct  66    TINVNPKG-GEFKTLTDALKSIPEKNTKRVIIKMAPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + +  T+ + GTV+SA++I+ +DYF A+NI + NSAP+ +G  KG+QA+A+  SG+ 
Sbjct  125   MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK +GFQDT CDD G HFFKDCYIEGT DFIFG+G ++YLDT+LH + DG  VI+
Sbjct  185   AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAVGDGIKVIS  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  + +E +GYSFVHCK+TG   G +LGR W +  +V+YAYTEM+  V P GW     
Sbjct  245   AHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANKV  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               H   T ++GEYK TGPG+    R  F + + + E   F++LG+I+GS WLLPP
Sbjct  305   AAH-DKTVFYGEYKCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIKGSSWLLPP  358



>ref|XP_002530224.1| Pectinesterase U1 precursor, putative [Ricinus communis]
 gb|EEF32171.1| Pectinesterase U1 precursor, putative [Ricinus communis]
Length=368

 Score =   377 bits (969),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/372 (52%), Positives = 253/372 (68%), Gaps = 9/372 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             MVR  M ++   +  +++VL   +S    SDD+  IP +++ + SWF +NV+P A+RK  
Sbjct  1     MVR-GMTSLDAIKCAIILVLAVLISTAT-SDDTEQIPESQSALNSWFEANVKPYASRKGT  58

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             L+P L  AE+NPK I+V  DG GDF+T+TDAL S+P  NTQRVI+ IG G YTE++ ++ 
Sbjct  59    LNPALEAAEANPKTIKVRTDGSGDFKTVTDALKSIPVKNTQRVIVDIGPGVYTEKITVDI  118

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
             +KPF+TLYG P+A P + F  T+ + GT  SAT+IV +DYF A NI I N+APR  G  +
Sbjct  119   QKPFVTLYGSPNAMPTLAFGGTAKEYGTDDSATLIVMSDYFVAANIIIKNTAPRPNGKPQ  178

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G QAVAL   G  AA YNC++ GFQDT CDD G HFFKDCYIEGT+DFIFG GK++YL++
Sbjct  179   G-QAVALRLWGSKAAIYNCRILGFQDTLCDDHGMHFFKDCYIEGTIDFIFGLGKSIYLNS  237

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
              +HV+D     VI AQA    KEDTG+ FVHC ITG   G FLGR WM   RV++AYT M
Sbjct  238   IIHVVDDKLLTVITAQAGSDPKEDTGFVFVHCSITGDGTGAFLGRAWMPMPRVVFAYTRM  297

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
              + + P GW      P    T  F EYK+TGPG K + R  ++K+LTD E K +I+LG+I
Sbjct  298   GKVIHPGGWFN-NFHPERERTVSFAEYKSTGPGYKPNERVKYSKQLTDTEAKKYISLGYI  356

Query  237   EGSKWLLPPIKL  202
             EGS WLLPP KL
Sbjct  357   EGSTWLLPPPKL  368



>ref|XP_011076539.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=623

 Score =   385 bits (989),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 244/335 (73%), Gaps = 6/335 (2%)
 Frame = -1

Query  1200  PIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDALAS  1024
             PIPANKA++ SWF  NV P+A+R+ +LDP + +AE N   +RV  DG GDF+T+TDA+ S
Sbjct  285   PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNVTVVRVRTDGSGDFKTVTDAIKS  344

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATV  844
             VP+ N  RVIISIG GNYTE+V I++   FITLYGDP+  P + F  T+ + GT+ SAT+
Sbjct  345   VPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPNNMPVMLFDGTAAQFGTLESATL  404

Query  843   IVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGR  664
              VE+DYF+A+N+ I+NSAP+ +G   G+QAVA+  +G+ A++YNC++YGFQDT CDD G+
Sbjct  405   TVESDYFSAVNLKIVNSAPKPDGKRVGAQAVAIKIAGEYASFYNCRMYGFQDTLCDDRGK  464

Query  663   HFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKI  496
             H FKDCY+EGTVDFIFG+G++LYL++E+HVI G     IAA +R  + E  GY FVHC++
Sbjct  465   HLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSFIAAHSRSKHNEANGYVFVHCRV  524

Query  495   TGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGA  316
             TG     +L R W  + RVI+AY+++++AV P GW    G+ H   T YFGEY N GPG+
Sbjct  525   TGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSN-NGQNHTDSTVYFGEYHNEGPGS  583

Query  315   KMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +  R  + K  +D EVK FI++ +IEGSKWLLPP
Sbjct  584   DLSKRAAYGKVSSDAEVKSFISIAYIEGSKWLLPP  618



>gb|KHG24685.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=369

 Score =   376 bits (965),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 187/355 (53%), Positives = 246/355 (69%), Gaps = 13/355 (4%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHIR  1078
             + V +   +P +VS    PIPA+K+++ +WF+  ++ V  R N LDPEL +AE+ P+ I+
Sbjct  16    ICVSILLFAPIIVSQ---PIPADKSQINAWFNGIIKSVKERGNTLDPELVEAETKPRIIK  72

Query  1077  VSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPF  898
             V + G G+F+TIT A+ SVP  NT+RVI+SIG G+Y E++ IE+ KPFITL GDP   P 
Sbjct  73    VMQGGGGEFDTITKAIESVPSGNTKRVIVSIGPGSYKEKIRIERNKPFITLLGDPKKMPN  132

Query  897   INFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAY  718
             + F  T+ + GTV SAT+I E  YF   N+NILN+APR +G   G+QAVAL  SGD +A+
Sbjct  133   LTFDGTAKQFGTVDSATLITECSYFVGANLNILNTAPRPDGKMVGAQAVALRVSGDRSAF  192

Query  717   YNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-----VIAA  553
             YNCK+ GFQDT CDD G HFFKDC+I GTVDFIFG+GK+LYL+TE+ V +G     VI A
Sbjct  193   YNCKIIGFQDTLCDDRGNHFFKDCHIRGTVDFIFGSGKSLYLNTEIFV-EGDPGLTVITA  251

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW-HGVPG  376
             QAR ++ EDTGYSFVH  I+G  +  FLGR W +  RV+YAYTEM   + P+GW H V  
Sbjct  252   QARESSSEDTGYSFVHGSISGTAKNAFLGRAWKSSPRVVYAYTEMGNVINPVGWSHNV--  309

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +P    T Y+GEYK TG GA    R  F K+L D E +PF+ L ++E +KWLLPP
Sbjct  310   QPERAKTVYYGEYKCTGQGANPKTREPFVKQLPDAEAQPFLVLDYVEATKWLLPP  364



>ref|XP_002318197.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
 gb|EEE96417.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
Length=364

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 245/365 (67%), Gaps = 9/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M ++   Q  +  +L+  +S  V SDD  PIPA+ + + +WF  NV+P+A+RK  +DP L
Sbjct  1     MGSIAAIQCALTAILL--VSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPAL  58

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE+ P+ I+V +DG G+F+T+ DA+ S+P  NT+RVI+ IG G Y E++ IE+ KPF+
Sbjct  59    EAAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFV  118

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             T  G P   P ++F  T+ + GTV+SAT+  EADYF A NI   NSAPR  G  KG QAV
Sbjct  119   TFLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAV  178

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             AL  SGD +A+YNC+L GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TELHVI
Sbjct  179   ALRISGDKSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVI  238

Query  570   ----DGVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAV  406
                    I A AR++  EDTG+SFVHCK+ G   +G +LGR W A  RV+++YT M+  V
Sbjct  239   GDENGNFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVV  298

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW      P    T  FGEYK  G GA   GR    K+LT ++  PFI+LGFIEGSK
Sbjct  299   NPEGWSN-NFHPERDQTALFGEYKCEGEGANPAGRAKATKQLTPDQAAPFISLGFIEGSK  357

Query  225   WLLPP  211
             WLL P
Sbjct  358   WLLHP  362



>ref|XP_006399225.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
 gb|ESQ40678.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
Length=364

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 245/347 (71%), Gaps = 6/347 (2%)
 Frame = -1

Query  1230  SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGD  1054
             SP V++DD+ PIP  K +V+ WF +NV P+A+RK  LDP L  AE+ P+ I V+K G G+
Sbjct  20    SPMVLADDTTPIPEAKPQVEQWFKTNVGPLASRKGTLDPALVAAEAEPRIINVNKKG-GE  78

Query  1053  FETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTST  874
             F T+TDAL SVP  NT+RVII +G G Y E+V I++ KPFITL G P+A P I+F  T+ 
Sbjct  79    FTTLTDALKSVPAGNTKRVIIKMGPGEYREKVTIDRNKPFITLMGQPNAMPIISFDGTAA  138

Query  873   KDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGF  694
             K GTV SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+ AA+YNCK YGF
Sbjct  139   KYGTVDSASLIILSDYFMAVNIVVKNTAPMPDGKTKGAQALSMRISGNKAAFYNCKFYGF  198

Query  693   QDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDT  523
             QDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VI A A  + +E +
Sbjct  199   QDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVITAHAGKSAEEKS  258

Query  522   GYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFG  343
             GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW      P +  T ++G
Sbjct  259   GYSFVHCKVTGDGNGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQ-ENKMPAHDKTVFYG  317

Query  342   EYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             EYK +GPG+    R  F + +   E   F++LG+I+GS WLLPP  L
Sbjct  318   EYKCSGPGSHKAKRVPFTQDIDATEANRFLSLGYIQGSAWLLPPPAL  364



>ref|XP_010457627.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=365

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 254/361 (70%), Gaps = 9/361 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNP  1090
              LI+  +LV   SP V ++D+ PIP NK  ++ WF++NV  +A+RK+ LDP L  AE+ P
Sbjct  7     SLIVTSLLVVITSPVVFANDAAPIPQNKGGIEQWFNTNVPSLASRKSTLDPALLAAEAKP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I+V ++G+G F+TIT+A+ SV   NT RVII +G G Y E+V I++ KPFITLYG P+
Sbjct  67    RIIKVEQNGRGQFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPN  126

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + +  T+ + GTV SAT+IV +DYF AINI + NSAP  +G  KG+QA+++  SG+
Sbjct  127   AMPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKMKGAQALSMRISGN  186

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI
Sbjct  187   KAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVI  246

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  T +E TGY+FVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW    
Sbjct  247   TAHAGKTAQEKTGYTFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVDPSGWQANR  306

Query  378   --GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
               G+     T ++GEYK TGPG+    R  F + + D + K FI+LG+I+GS WLLPP K
Sbjct  307   DIGRDK---TVFYGEYKCTGPGSLKAKRVKFTQYIDDIKAKYFISLGYIQGSSWLLPPPK  363

Query  204   L  202
             L
Sbjct  364   L  364



>ref|XP_002318199.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
 gb|EEE96419.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
Length=364

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/360 (52%), Positives = 241/360 (67%), Gaps = 7/360 (2%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             +  +   I  +  +S  V SDD  PIPA+ + + +WF  NV+P+A+RK  +DP L  AE+
Sbjct  4     IAAIQCAITAILLVSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEA  63

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
              P+ I+V +DG G+F+T+ DA+ S+P  NT+RVI+ IG G Y E++ IE+ KPF+T  G 
Sbjct  64    KPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVTFLGS  123

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P ++F  T+ + GTV+SAT+  EADYF A NI   NSAPR  G  KG QAVAL  S
Sbjct  124   PSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVALRIS  183

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI----D  568
             GD +A+YNC+L GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TELHVI     
Sbjct  184   GDKSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDENG  243

Query  567   GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               I A AR++  EDTG+SFVHCK+ G   +G +LGR W A  RV+++YT M+  V P GW
Sbjct  244   NFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVVNPEGW  303

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                   P    T  FGEYK  G GA   GR    K+LT ++  PFI+LGFIEGSKWLL P
Sbjct  304   SN-NFHPERDQTALFGEYKCEGEGANPAGRAKATKQLTPDQAAPFISLGFIEGSKWLLHP  362



>gb|KFK25126.1| hypothetical protein AALP_AA8G069500 [Arabis alpina]
Length=362

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 251/360 (70%), Gaps = 6/360 (2%)
 Frame = -1

Query  1269  NQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP  1090
             N  I++ +LV +++P V +DD+ PIPA+K  V+ WF ++V P+  RK LDP L  AE+ P
Sbjct  5     NVPILLALLVVFVTPMVFADDNAPIPASKPGVEQWFKTHVAPLPQRKGLDPALVAAEAAP  64

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             K I V+  G G+F+T+TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P 
Sbjct  65    KTITVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLLGQPG  123

Query  909   AT-PFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
             A  P I +  T+ K GTV SA++I+ +DYF A+NI + NSAP  +G TKG+QA+++  SG
Sbjct  124   ANMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIIVKNSAPAPDGKTKGAQALSMRISG  183

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--V  562
             + AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  V
Sbjct  184   NYAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRV  243

Query  561   IAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGV  382
             I A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW   
Sbjct  244   ITAHAGKSAEEKSGYSFVHCKVTGTGSGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQE-  302

Query  381   PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               +P    T ++GEYK +G G++   R  F +++   E   F+TLG+I+GSKWLLPP  L
Sbjct  303   NKQPANDKTVFYGEYKCSGAGSQTAKRVPFTQEIDANEANRFLTLGYIQGSKWLLPPPAL  362



>ref|XP_002277388.2| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38548.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 234/361 (65%), Gaps = 7/361 (2%)
 Frame = -1

Query  1251  IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEP-VANRKNLDPELAKAESNPKHIRV  1075
             +V    + P  V  D   IP +  ++ SWF+  ++     R  LDP L KAE   K I+V
Sbjct  16    MVFFFLVLPSTVLADDPQIPDDAIQLASWFNDVIQSHNLRRTTLDPVLVKAEERVKIIKV  75

Query  1074  SKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFI  895
             SK G G+F  +  A+ SVP  NTQRVII IGGG Y E++ I++ KPFIT YG PD  P +
Sbjct  76    SKGGGGNFNKVMAAVDSVPAGNTQRVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPML  135

Query  894   NFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYY  715
             +F  T+ K GTV SAT+IVE+DYF A+NI ++NS+PR EG   G QAVA+  SGD AA+Y
Sbjct  136   SFDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFY  195

Query  714   NCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-----VIAAQ  550
             NCKL GFQDT CDD GRHFF  CYIEGTVDFIFG+GK+LYL TELH         VI AQ
Sbjct  196   NCKLVGFQDTLCDDRGRHFFHGCYIEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQ  255

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
             AR    ED GYSFVHC+++G     +LGR WM+  RV+++YT M+  V PLGW      P
Sbjct  256   ARKLESEDNGYSFVHCRVSGSGSNTYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFHP  314

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKLDPHA  190
                   ++GEYK  GPGA    R  FAK L D+ V+PF+TL +IE SKWLLPP +L P  
Sbjct  315   ERDSLVFYGEYKCMGPGANTSKRAKFAKMLDDDGVRPFVTLNYIEASKWLLPPPRLVPRG  374

Query  189   Q  187
             +
Sbjct  375   K  375



>ref|XP_010523318.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=364

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 245/358 (68%), Gaps = 5/358 (1%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L+ +++++    P V+++D  PIP NK +V  WF++ V+P + RK  LDP LA AES+P+
Sbjct  8     LVALLMVLASPPPAVLANDVTPIPENKGQVNPWFNAQVQPFSRRKATLDPALAAAESSPR  67

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              IRV+K+G GDF T+T A+ S+P  N +RVII +G G Y E+V I + KPF+TLYG P+A
Sbjct  68    VIRVNKNGGGDFNTLTAAINSIPSGNARRVIIKLGPGEYREKVTIGRTKPFVTLYGQPNA  127

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F+  +T+ GT +SAT+IV +DYFTA+NI + N+AP+ +      QA+A+  SG+ 
Sbjct  128   MPVLTFNGKATQYGTFNSATLIVLSDYFTAVNIIVKNTAPKPDPRRDDGQALAMRISGNK  187

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---VIA  556
             AA+YNCK YGFQDT CDD G HFFKDCY+EGT DFIFGNG +LY+ T +H +     VI+
Sbjct  188   AAFYNCKFYGFQDTLCDDTGNHFFKDCYVEGTFDFIFGNGTSLYIGTLIHAVGNGIRVIS  247

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQ   + K+ +GYSFVHCK+TG  +G +LGR W    +VIYAYTEMT  V P GW     
Sbjct  248   AQGAQSAKDPSGYSFVHCKVTGEGEGIYLGRAWRTHPKVIYAYTEMTSVVNPAGWQNNTE  307

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             K     T ++GEYK  GPG+  + R  F + +  +E   F++LG+I+GSKWLLPP  L
Sbjct  308   KARQ-KTVFYGEYKCFGPGSHQEKRVPFTQDIDAQEAAHFLSLGYIQGSKWLLPPPAL  364



>emb|CAB87930.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 242/343 (71%), Gaps = 5/343 (1%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETI  1042
             V +DD  PIP  K +V  WF+++V P+A RK LDP L  AE+ P+ I V+  G G+F+T+
Sbjct  2     VFADDLTPIPEGKPQVVQWFNTHVGPLAQRKGLDPALVAAEAAPRIINVNPKG-GEFKTL  60

Query  1041  TDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGT  862
             TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P+A P I +  T+ K GT
Sbjct  61    TDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  120

Query  861   VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTF  682
             V SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+ AA+YNCK YGFQDT 
Sbjct  121   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  180

Query  681   CDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDTGYSF  511
             CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VIAA A  + +E +GYSF
Sbjct  181   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVIAAHAGKSAEEKSGYSF  240

Query  510   VHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKN  331
             VHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW      P +  T ++GEYK 
Sbjct  241   VHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQ-ENKTPAHDKTVFYGEYKC  299

Query  330   TGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  300   SGPGSHKAKRVPFTQDIDDKEANCFLSLGYIQGSKWLLPPPAL  342



>emb|CDY23044.1| BnaC07g31430D [Brassica napus]
Length=451

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 251/356 (71%), Gaps = 8/356 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNP  1090
              LI+ I+LV    P V  +D+ PIP NK  ++ WF++NV  +A+RK+ LDP L  AE+ P
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNTNVPSLASRKDKLDPALLTAEATP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
                RV ++G+GDF T+T+A+ SVP  N +RVII +G G Y E+V I++ KPFITLYG+P+
Sbjct  67    ---RVRQNGRGDFNTLTEAINSVPVGNNERVIIKLGHGEYKEKVTIDRNKPFITLYGNPN  123

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + F  T+ + GTV SAT+IV +DYF AINI + NSAP  +G  KG+QA+++  SG+
Sbjct  124   AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  183

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI
Sbjct  184   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVVGDGLRVI  243

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GWH   
Sbjct  244   TAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-N  302

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +     T ++GEYK +GPG++   R  + + + + E   FI+LG+I+GS WLLPP
Sbjct  303   TQTERDKTVFYGEYKCSGPGSRKKKRVKYTQDIDNIEANSFISLGYIQGSSWLLPP  358



>ref|XP_003634032.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38547.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 244/356 (69%), Gaps = 7/356 (2%)
 Frame = -1

Query  1260  IMVIVLVHYLSPGVVSD-DSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             I   +LV   S  V++D D+  IP++K+++  WF ++++    R+  LDP L +AE + K
Sbjct  8     IAFFLLVPLSSSAVLADNDNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVK  67

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I+VSK G G+F T+  A+ SVP  NTQRVII IGGG Y E++ I++ KPFIT YG P+ 
Sbjct  68    IIKVSKSGGGNFNTVMAAVNSVPAGNTQRVIIWIGGGVYEEKIKIDRNKPFITFYGSPED  127

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P ++F  T+ K GTV SAT+IVE+DYF A+NI ++NS+PR +G  KG+QAVAL  SGD 
Sbjct  128   MPKLSFDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDK  187

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG---VI  559
             AA+YNC+L GFQDT CDD GRHFF +CY+EGTVD+IFG+GK+LYL TELH   DG   VI
Sbjct  188   AAFYNCRLIGFQDTLCDDRGRHFFHECYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVI  247

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              AQAR+   ED GYSFVHC ++G     FLGR WM+  RV+++YT M+  V PLGW    
Sbjct  248   TAQARNLEWEDNGYSFVHCTLSGTGGNTFLGRAWMSRPRVVFSYTFMSSVVSPLGWSD-N  306

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +P      ++GEYK  GP A    RP F+K+L D    PFITL +I+ S WLLPP
Sbjct  307   DQPERDSLVFYGEYKCMGPAADTSKRPKFSKELDDNGATPFITLNYIDASTWLLPP  362



>ref|XP_007216116.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
 gb|EMJ17315.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
Length=375

 Score =   371 bits (953),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 245/354 (69%), Gaps = 8/354 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHI  1081
              VI+ +   +    +DDS PIP++ ++V SWF +NV+P+A RK  LD  L  AE  PK I
Sbjct  15    FVIITILLAASTTAADDSTPIPSDGSQVGSWFDNNVKPLAERKGALDAALVTAEDGPKLI  74

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V KDG G+F+T+TDA+ S+PE NT+RV++ IGGG Y E++ I + KPF+TLYG P   P
Sbjct  75    KVMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMP  134

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  T+ K GTV+S T+IVE+DYF A NI + NSAP  +G   G+QAVAL  SGD AA
Sbjct  135   TLMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAA  194

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQ  550
             +YNCK  GFQDT  D +G HFFKDCYIEGTVDFIFG GK+LYL+TE+HV++    VI AQ
Sbjct  195   FYNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVLERNITVITAQ  254

Query  549   ARHTNKEDTGYSFVHCKITGPR--QGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
              R    ED G+SFVHCKITG    +  +LGR W +   V++AYT+M   V P  W+   G
Sbjct  255   QRDA-LEDNGFSFVHCKITGTTYVRSTYLGRAWGSSPTVVFAYTDMANVVHPERWNDF-G  312

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              P      ++GE++N+GPG+ + G+  + KKL+D E K F++LG+I+GSKWLLP
Sbjct  313   HPERSNNMFYGEFQNSGPGSNISGQARYTKKLSDVEAKSFLSLGYIQGSKWLLP  366



>gb|KDP22496.1| hypothetical protein JCGZ_26327 [Jatropha curcas]
Length=651

 Score =   380 bits (977),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 243/342 (71%), Gaps = 7/342 (2%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFET  1045
             V S+D+ PIP +K++V+SWF+++V+P+A+RK  L+  L  AE+ PK I+V +DG G+F+T
Sbjct  311   VCSNDATPIPPDKSQVQSWFAAHVKPLASRKGTLNSTLEAAEAKPKTIKVRQDGSGNFKT  370

Query  1044  ITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG  865
             ITDA+ SVP  N QRVII IG G YTE+V I +EKPFIT  G P     + F  T+ K G
Sbjct  371   ITDAVNSVPAKNAQRVIIDIGPGVYTEKVTIPREKPFITFRGPPKMAT-LQFGGTAAKYG  429

Query  864   TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDT  685
             TV+SAT+ VE+++F A N+ I N+AP+ +G  KG+QAVAL     M A+YN +L GFQDT
Sbjct  430   TVYSATLQVESEFFVAANLIIKNTAPQPDGKRKGAQAVALRTGASMQAFYNVRLLGFQDT  489

Query  684   FCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----GVIAAQARHTNKEDTGY  517
              CDD+G HFFKDCYIEGTVDFIFG+GK++YL+T+L+V++     +I AQAR    ED GY
Sbjct  490   LCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLYVLEEKDAQIITAQAREKEGEDIGY  549

Query  516   SFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEY  337
             SFVHC I G     FLGR WMA  RV++AY+ M+  V P GW      P      YFGE+
Sbjct  550   SFVHCDIKGVGNRAFLGRAWMAMPRVVFAYSSMSSVVHPEGWSN-NNHPEREKNLYFGEF  608

Query  336   KNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             KNTGPG+   GR  F+K+L+ EE KPF+TLGFI+GS WLLPP
Sbjct  609   KNTGPGSNPKGRAKFSKQLSFEEAKPFLTLGFIKGSSWLLPP  650



>gb|AAG52566.1|AC010675_14 putative pectin methylesterase; 8433-9798 [Arabidopsis thaliana]
Length=338

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 239/343 (70%), Gaps = 9/343 (3%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETI  1042
             V +DD  PIP  K +V  WF++NV P+A RK LDP L  AE+ P+ I       G+F+T+
Sbjct  2     VFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAAEAAPRIIN-----GGEFKTL  56

Query  1041  TDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGT  862
             TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P+A P I +  T+ K GT
Sbjct  57    TDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  116

Query  861   VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTF  682
             V SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+ AA+YNCK YGFQDT 
Sbjct  117   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  176

Query  681   CDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDTGYSF  511
             CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VIAA A  + +E +GYSF
Sbjct  177   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVIAAHAGKSAEEKSGYSF  236

Query  510   VHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKN  331
             VHCK+TG   G +LGR WM+  +V+YAYTEMT  V P GW      P +  T ++GEYK 
Sbjct  237   VHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQ-ENKTPAHDKTVFYGEYKC  295

Query  330   TGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  296   SGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPAL  338



>ref|XP_002511044.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF51646.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=366

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 248/362 (69%), Gaps = 14/362 (4%)
 Frame = -1

Query  1260  IMVIVLVHYL-------SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAK  1105
             I  I ++HY+       +  V+SDD+ PIPA + +V SWF +NV+  ++RK  LDP L  
Sbjct  5     ITYIAIIHYVIAAILLAATTVISDDATPIPAAENQVNSWFQANVKHFSSRKGTLDPALLA  64

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE+ PK I+V  DG GDF+++TDAL S+P  N  RVI+ IG G YTE+V I++ KPF+TL
Sbjct  65    AEAAPKRIKVRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGCGVYTEKVTIDRIKPFVTL  124

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
              G     P + F  T+ K GTV+SAT+ VEADYF A NI I N+APR +G   G+QAVAL
Sbjct  125   LGSSKHMPTLQFAGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRA-GAQAVAL  183

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               +GD AA+YNC++ GFQDT CDD+GRHFFKDCYIEGTVDFIFG+GK+LYL T L+VI  
Sbjct  184   RVAGDKAAFYNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTHLNVIKE  243

Query  567   ---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                 VI AQA+HT+ ED+G+SFVH  ITG     +LGR WM    V+++Y++M++ V P 
Sbjct  244   KFMTVITAQAKHTSSEDSGFSFVHSSITGDATDAYLGRAWMEMPEVVFSYSKMSKVVIPA  303

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             GW      P       F EYK +GPGA   GR  F+K+L+D   K FI+LG+I+GSKWLL
Sbjct  304   GWSNY-NHPEREKNILFAEYKCSGPGANPSGRVKFSKQLSDSAAKRFISLGYIQGSKWLL  362

Query  216   PP  211
             PP
Sbjct  363   PP  364



>dbj|BAB09012.1| pectin methylesterase-like protein [Arabidopsis thaliana]
Length=364

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 250/356 (70%), Gaps = 5/356 (1%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNL-DPELAKAESNP  1090
              LI+ I+LV   SP V  +D+ PIP NK  ++ WF++NV  +A+RK+  DP L  AE+ P
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVPSLASRKSTSDPALLTAEAKP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I+V ++G+G F+TIT+A+ SV   NT+RVII IG G Y E+V I++ KPFITLYG P+
Sbjct  67    RIIKVKQNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFITLYGHPN  126

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + F  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+
Sbjct  127   AMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQALSMRISGN  186

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVI  246

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A  +  E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW    
Sbjct  247   TAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVVNPSGWQE-N  305

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +     T ++GEYK TG G+  + R  + + + D E K FI+LG+I+GS WLLPP
Sbjct  306   REAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDIEAKYFISLGYIQGSSWLLPP  361



>ref|XP_010109161.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXC21090.1| Pectinesterase PPME1 [Morus notabilis]
Length=359

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 245/361 (68%), Gaps = 10/361 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M V   ++ I+L       V+  D   +P NKA++ SWF+ NV PV  RK+ LDP L  A
Sbjct  1     MAVGAALLTILLS---VAAVLGSDYSAVPPNKAQLHSWFNQNVRPVNERKSTLDPALVAA  57

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E   + I V KDG G+F+ ITDA+ SVP +N +RVII IG G Y E++ I++ K F+TLY
Sbjct  58    EQGRRVITVRKDGTGNFKRITDAINSVPSNNNKRVIIKIGPGEYREKITIDRTKRFVTLY  117

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G+P+A P +++  T+ + GTV S T+I  ADYF A N+ I N+AP+ +G  KG+QA AL 
Sbjct  118   GNPNAKPTLSYGGTAEQYGTVDSGTLIALADYFVAANLIIKNTAPKPDGKRKGAQASALR  177

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-  565
              SGD +A YNC++ GFQDT CDD G HFFKDCYIEGTVDFIFG+G ++YL+TELHV+   
Sbjct  178   ISGDKSAVYNCRILGFQDTICDDRGYHFFKDCYIEGTVDFIFGSGTSIYLNTELHVVQDS  237

Query  564   ---VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
                VI AQAR +N ++TGYSF+HC +TG     FLGR WM+  +V+Y YT M  A+ P G
Sbjct  238   GIEVITAQARQSN-DNTGYSFLHCAVTGTGSNTFLGRAWMSRPKVVYIYTNMGNAINPQG  296

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W      P    T ++GEYKN+G GA M  R  ++K+LT ++ KP++TLGFI+GS WLLP
Sbjct  297   WSD-NFHPERDSTVFYGEYKNSGSGANMVKRVKYSKELTYDQAKPYMTLGFIKGSSWLLP  355

Query  213   P  211
             P
Sbjct  356   P  356



>emb|CDP19851.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 228/301 (76%), Gaps = 7/301 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M +N+ I+   L+    P V+SDD++P PA+KA++ SWF  NV+P+A+RK+ LDP L  A
Sbjct  1     MALNKAILFSTLL--FIPLVLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAA  58

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E+NP+ I++  DG G+F+TI DA+ S+P DNT RVIIS+G GNYTE++ IE+ KPFIT+ 
Sbjct  59    EANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITII  118

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             GDP+  P + F  T+ K GTV SAT+IVE+DYF A N+ + NSAPR  G  KG+QA+A+ 
Sbjct  119   GDPNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVR  178

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-  565
               GD A++YNCK  GFQDT CDD+G+H FKDCYIEGTVDFIFGNGK++YL+ ELHVI G 
Sbjct  179   IGGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGD  238

Query  564   ---VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
                 I AQARHT+ EDTGYSFVHCK+TG  +  +LGR WM + +V++AYT+M++AV P G
Sbjct  239   RQAWITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVIPDG  298

Query  393   W  391
             W
Sbjct  299   W  299



>gb|AAM65347.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 241/343 (70%), Gaps = 5/343 (1%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETI  1042
             V +DD  PIP  K +V  WF+++V P+  RK LDP L  AE+ P+ I V+  G G+F+T+
Sbjct  2     VFADDLTPIPEGKPQVVQWFNTHVGPLVQRKGLDPALVAAEAAPRIINVNPKG-GEFKTL  60

Query  1041  TDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGT  862
             TDA+ SVP  NT+RVII +  G Y E+V I++ KPFITL G P+A P I +  T+ K GT
Sbjct  61    TDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  120

Query  861   VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTF  682
             V SA++I+ +DYF A+NI + N+AP  +G TKG+QA+++  SG+ AA+YNCK YGFQDT 
Sbjct  121   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  180

Query  681   CDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDTGYSF  511
             CDD G HFFKDCY+EGT DFIFG+G ++YL T+LHV+ DG  VIAA A  + +E++GYSF
Sbjct  181   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGIRVIAAHAGKSAEENSGYSF  240

Query  510   VHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKN  331
             VHCK+TG     +LGR WM+  +V+YAYTEMT  V P GW      P +  T ++GEYK 
Sbjct  241   VHCKVTGTGGVIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQE-NKTPAHDKTVFYGEYKC  299

Query  330   TGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             +GPG+    R  F + + D+E   F++LG+I+GSKWLLPP  L
Sbjct  300   SGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPAL  342



>ref|XP_006381893.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
 gb|ERP59690.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
Length=365

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 238/362 (66%), Gaps = 11/362 (3%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             +  +   I  +  +S  V SDD  PIPA+ + +  WF  NV P+ANRK  +DP L  AE+
Sbjct  5     IAAIQCAITAILLVSTTVSSDDKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALMAAEA  64

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
              P+ I+V KDG G+F+T+ DA+ S+P  N +RVI+ IG G Y E++ IE+ KPF+T  G 
Sbjct  65    KPRTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGS  124

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P ++F  T+ K GTV+SAT+  EADYF A NI I NSAPR +G  KG QAVAL  S
Sbjct  125   PSNMPTLSFDGTARKYGTVYSATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRIS  184

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI----D  568
             GD +A+YNC+  GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TELHVI     
Sbjct  185   GDKSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKG  244

Query  567   GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               I A AR+   E+TG+SFVHCK+ G   +  +LGR W    RV+++YT M+  V P GW
Sbjct  245   NFITAHARNNEAENTGFSFVHCKVDGTGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGW  304

Query  390   HGV--PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
                  P + H   T  FGEYK  G GA    R   +K+LT  +V PFI+LGFIEGSKWLL
Sbjct  305   SNNFHPERDH---TALFGEYKCKGEGANPAARAKASKQLTPGQVAPFISLGFIEGSKWLL  361

Query  216   PP  211
              P
Sbjct  362   HP  363



>emb|CAN78808.1| hypothetical protein VITISV_030725 [Vitis vinifera]
Length=368

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/337 (54%), Positives = 225/337 (67%), Gaps = 7/337 (2%)
 Frame = -1

Query  1179  EVKSWFSSNVEP-VANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQ  1003
             ++ SWF+  ++     R  LDP L KAE   K I+VSK G G+F  +  A+ SVP  NTQ
Sbjct  11    QLASWFNDXIQSHNLRRTTLDPVLVKAEERVKIIKVSKGGGGNFNKVMAAVDSVPAGNTQ  70

Query  1002  RVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYF  823
             RVII IGGG Y E++ I++ KPFIT YG PD  P ++F  T+ K GTV SAT+IVE+DYF
Sbjct  71    RVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPMLSFDGTAAKFGTVDSATLIVESDYF  130

Query  822   TAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCY  643
              A+NI ++NS+PR EG   G QAVA+  SGD AA+YNCKL GFQDT CDD GRHFF  CY
Sbjct  131   MAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFYNCKLVGFQDTLCDDRGRHFFHGCY  190

Query  642   IEGTVDFIFGNGKTLYLDTELHVIDG-----VIAAQARHTNKEDTGYSFVHCKITGPRQG  478
             IEGTVDFIFG+GK+LYL TELH         VI AQAR    ED GYSFVHC+++G    
Sbjct  191   IEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQARKLESEDNGYSFVHCRVSGSGSN  250

Query  477   GFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRP  298
              +LGR WM+  RV+++YT M+  V PLGW      P      ++GEYK  GPGA    R 
Sbjct  251   TYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFHPERDSLVFYGEYKCMGPGANTSKRA  309

Query  297   YFAKKLTDEEVKPFITLGFIEGSKWLLPPIKLDPHAQ  187
              FAK L D+ V+PF+TL +IE SKWLLPP +L P  +
Sbjct  310   KFAKMLDDDGVRPFVTLNYIEASKWLLPPPRLVPRGK  346



>ref|XP_002309337.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
 gb|EEE92860.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
Length=365

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 238/362 (66%), Gaps = 11/362 (3%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             +  +   I  +  +S  V SDD  PIPA+ + +  WF  NV P+ANRK  +DP L  AE+
Sbjct  5     IAAIQCAITAILLVSTTVSSDDKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALKAAEA  64

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
              P+ I+V KDG G+F+T+ DA+ S+P  N +RVI+ IG G Y E++ IE+ KPF+T  G 
Sbjct  65    KPRTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGS  124

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P ++F  T+ K GTV+SAT+  EADYF A NI I NSAPR +G  KG QAVAL  S
Sbjct  125   PSNMPTLSFDGTARKYGTVYSATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRIS  184

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI----D  568
             GD +A+YNC+  GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TELHVI     
Sbjct  185   GDKSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKG  244

Query  567   GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               I A AR+   E+TG+SFVHCK+ G   +  +LGR W    RV+++YT M+  V P GW
Sbjct  245   NFITAHARNNEAENTGFSFVHCKVDGNGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGW  304

Query  390   HGV--PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
                  P + H   T  FGEYK  G GA    R   +K+LT  +V PFI+LGFIEGSKWLL
Sbjct  305   SNNFHPERDH---TALFGEYKCKGEGANPAARAKASKQLTPGQVAPFISLGFIEGSKWLL  361

Query  216   PP  211
              P
Sbjct  362   HP  363



>ref|XP_011040323.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=362

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 243/364 (67%), Gaps = 9/364 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M T +V  ++ +++L+  +SP   S D+ PIP   + + SWF +NV+P   R   LDP L
Sbjct  1     MSTGKVTGMVAIVILL-LVSPAAGSRDTGPIPGEPSSLNSWFQANVKPYTQRNGTLDPAL  59

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE+ PK I V KDG GDF+T+T A+ S+   NTQRVI+ IG G Y E++ I+K KPF+
Sbjct  60    ETAEAKPKTIMVRKDGSGDFKTLTSAVRSISSGNTQRVIVDIGSGVYNEKIQIDKGKPFV  119

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             T  G   + P + F  T+   GTV+SAT+ V++DYF A NI I NS+PR  G  K  QAV
Sbjct  120   TFKGSARSVPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLK-EQAV  178

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             AL   GD AA+YNC+L GFQDT CDD+GRHFFKDCYIEGTVDFIFG+GK+LYL T ++V+
Sbjct  179   ALRIGGDKAAFYNCRLVGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVL  238

Query  570   D----GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
                   VI AQAR+  ++DTG+SFVHCK+ G  +G FLGR W    RV++A+T M+  V 
Sbjct  239   ADQGLAVITAQARN-KEDDTGFSFVHCKVNGIGKGAFLGRAWTERPRVVFAFTAMSSVVD  297

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
             P GW      P       FGEYK  GPG+   GR  F+K+LT ++V PF++L +IEGSKW
Sbjct  298   PGGWSDNQ-HPERDRIVSFGEYKCKGPGSNPSGRVKFSKQLTPQQVNPFLSLAYIEGSKW  356

Query  222   LLPP  211
             LLPP
Sbjct  357   LLPP  360



>gb|KFK27921.1| hypothetical protein AALP_AA8G447400 [Arabis alpina]
Length=364

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 248/356 (70%), Gaps = 5/356 (1%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNP  1090
              LI++ +LV   SP V  +D+ PIP NK  ++ WF +NV  +A+RK  LD  L  AE+ P
Sbjct  7     SLIVIALLVVVTSPVVFGNDASPIPENKFGIEQWFKTNVPSLASRKGTLDQALLIAETAP  66

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I+V K+G+G F+TIT+A+ SV E NT+RVII IG G Y E++ I++ KPFITLYG P+
Sbjct  67    RVIKVKKNGRGHFKTITEAIKSVREGNTRRVIIKIGPGVYKEKITIDRNKPFITLYGHPN  126

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A P + +  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+
Sbjct  127   AMPVLTYDGTALQYGTVDSATLIVMSDYFMAVNIIVKNSAPMPDGKMKGAQALSMRISGN  186

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+LHV+ DG  VI
Sbjct  187   KAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLHVVGDGIRVI  246

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A A     E++GY+FVHC +TG   G +LGR WM++ +V+YAYT+M+  V P GW    
Sbjct  247   TAHAGKATVENSGYTFVHCTVTGTGTGIYLGRAWMSYPKVVYAYTDMSSVVNPSGWQE-N  305

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +     T ++GEYK TG G+  + R  F + + D E K F +LG+I+GS W+LPP
Sbjct  306   RETGQDKTVFYGEYKCTGTGSHKEKRVKFTQDIDDTEAKFFTSLGYIKGSSWVLPP  361



>ref|XP_008229317.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=375

 Score =   366 bits (940),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 243/354 (69%), Gaps = 8/354 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHI  1081
              +I+ +   +    +DDS PIPA+ ++V SWF +NV+P+A  K  LD  L  AE  PK I
Sbjct  15    FIIITILLAANTTAADDSTPIPADGSQVGSWFDNNVKPLAECKGELDAALVTAEDGPKLI  74

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V KDG G+F+T+TDA+ S+PE NT+RV++ IGGG Y E++ I + KPF+TLYG P   P
Sbjct  75    KVMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMP  134

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  T+ K GTV+S T+IVE+DYF A NI + NSAP  +G   G+QAVAL  SGD AA
Sbjct  135   TLMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAA  194

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQ  550
             +YNCK  GFQDT  D +G HFFKDCYIEGTVDFIFG GK+LYL+TE+HVI+    VI AQ
Sbjct  195   FYNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVIEHNITVITAQ  254

Query  549   ARHTNKEDTGYSFVHCKITGPR--QGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
              R    ED G+SFVHCKITG    +G +LGR W +   V++AYT+M   V P  W+   G
Sbjct  255   QRDA-LEDNGFSFVHCKITGTTYVRGTYLGRAWGSSPTVVFAYTDMANVVHPERWNDF-G  312

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              P      ++GE++N+ PG+ +  +  + KKL+D E K F++LG+I+GSKWLLP
Sbjct  313   HPERSNNMFYGEFQNSSPGSNISRQARYTKKLSDAEAKSFLSLGYIQGSKWLLP  366



>ref|XP_010546117.1| PREDICTED: pectinesterase PPME1-like isoform X2 [Tarenaya hassleriana]
Length=348

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 238/341 (70%), Gaps = 6/341 (2%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFET  1045
             V++ D+ PIP  + +V  WF++NV+ ++ RK  LDP L  AE+ P  I V+K G G F T
Sbjct  7     VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGG-GQFRT  65

Query  1044  ITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG  865
             +T+AL S+P  N++RVII +G G Y E+V I++ KPFITL G+P + P I F  T+ K G
Sbjct  66    LTEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYG  125

Query  864   TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDT  685
             TV SAT+IV +DYF AIN+ + N+AP  +G TKG+QA+A+  SG+ AA+YNCK YG+QDT
Sbjct  126   TVDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDT  185

Query  684   FCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDTGYS  514
              CDD G HFFKDCYIEGT DFIFG+G +LYL T+LHV+ DG  VI AQA  +  + +GYS
Sbjct  186   VCDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVVGDGIRVITAQAGKSTADQSGYS  245

Query  513   FVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYK  334
             FVHC++TG  +G +LGR WM   +V+YAYTEMT  V P GWH  P       T ++GEYK
Sbjct  246   FVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGWHHNPDISR-DKTVFYGEYK  304

Query  333   NTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               GPG+    R  + + L   E + F+TLG+I+GSKWLLPP
Sbjct  305   CYGPGSLKHKRVPYTQDLDATEARRFLTLGYIQGSKWLLPP  345



>ref|XP_010546116.1| PREDICTED: pectinesterase PPME1-like isoform X1 [Tarenaya hassleriana]
Length=363

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/341 (53%), Positives = 238/341 (70%), Gaps = 6/341 (2%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFET  1045
             V++ D+ PIP  + +V  WF++NV+ ++ RK  LDP L  AE+ P  I V+K G G F T
Sbjct  22    VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGG-GQFRT  80

Query  1044  ITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG  865
             +T+AL S+P  N++RVII +G G Y E+V I++ KPFITL G+P + P I F  T+ K G
Sbjct  81    LTEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYG  140

Query  864   TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDT  685
             TV SAT+IV +DYF AIN+ + N+AP  +G TKG+QA+A+  SG+ AA+YNCK YG+QDT
Sbjct  141   TVDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDT  200

Query  684   FCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQARHTNKEDTGYS  514
              CDD G HFFKDCYIEGT DFIFG+G +LYL T+LHV+ DG  VI AQA  +  + +GYS
Sbjct  201   VCDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVVGDGIRVITAQAGKSTADQSGYS  260

Query  513   FVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYK  334
             FVHC++TG  +G +LGR WM   +V+YAYTEMT  V P GWH  P       T ++GEYK
Sbjct  261   FVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGWHHNPDISR-DKTVFYGEYK  319

Query  333   NTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               GPG+    R  + + L   E + F+TLG+I+GSKWLLPP
Sbjct  320   CYGPGSLKHKRVPYTQDLDATEARRFLTLGYIQGSKWLLPP  360



>ref|XP_002511042.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51644.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 245/359 (68%), Gaps = 11/359 (3%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             V   I+ IVL   +   V S D+ P+P   + +  WFS+NV+P+A+RK  LDP L  AE+
Sbjct  11    VQYAIVAIVLTATI---VSSADTTPMPDAASGIAGWFSANVKPLADRKGTLDPALEAAEA  67

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
             NPK I+V  DG G+F+TITDA+ S+P  NTQRVI+ IG G Y E++ IE++KPF+T  G 
Sbjct  68    NPKTIKVRLDGSGEFKTITDAVKSIPSGNTQRVIVDIGPGTYKEKITIERDKPFVTFLGP  127

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P+    I F  T+ + GTV+SAT+ VE++YF A N+ I N+APR +G   G+QA+A+   
Sbjct  128   PNMAT-IAFGGTAQEFGTVYSATLQVESEYFIAANLIIQNTAPRPDGKRPGAQALAVRIG  186

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             G  AA+Y  K+ GFQDT CDD+G HFFKDCYIEGTVDFIFG+GK++YL+TE++V+     
Sbjct  187   GSKAAFYKVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEP  246

Query  564   -VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
              VI AQAR    EDTG+SFVHC + G   G  LGR WM   RV++AYT MT  V P GW 
Sbjct  247   TVITAQARQ-GSEDTGFSFVHCSVGGTGTGALLGRAWMEAPRVVFAYTAMTGVVNPEGWS  305

Query  387   GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  P       FGEYKNTGPGA   GR  F+K+LT+ EV PF++LGFIEGSKWLLPP
Sbjct  306   S-NNHPEREAKVVFGEYKNTGPGAAPAGRVKFSKQLTEAEVAPFLSLGFIEGSKWLLPP  363



>ref|XP_011033438.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=377

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 240/370 (65%), Gaps = 12/370 (3%)
 Frame = -1

Query  1296  RKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLD  1120
             +K M T  +  +   I  +  +S  V SDD  PIPA+ + +  WF  NV P+A+RK  +D
Sbjct  10    QKKMGTC-IAAIQCAITAILLVSATVSSDDKSPIPADPSSLNKWFQDNVRPLADRKGTID  68

Query  1119  PELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEK  940
             P L  AE+ P+ I+V KDG G+F+T+ DA+ S+P  N +RVI+ IG G Y E++ IE+ K
Sbjct  69    PALLAAEAKPRTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGK  128

Query  939   PFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGS  760
             PF+T  G P   P ++F  T+ + GTV+SAT+  EADYF A NI I NSAPR +G  KG 
Sbjct  129   PFVTFLGSPGNMPTLSFDGTARQYGTVYSATLEAEADYFVAANIIIKNSAPRPQGQLKGE  188

Query  759   QAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTEL  580
             QAVAL  SGD +A+YNC+  GFQDT CDD+GRH FKDCYIEGTVD+IFG+GK+LYL TEL
Sbjct  189   QAVALRISGDKSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTEL  248

Query  579   HVI----DGVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMT  415
              VI       I A AR+   EDTG+SFVHCK+ G   +  +LGR W    RV+++YT M+
Sbjct  249   RVIGDEKGNFITAHARNNEAEDTGFSFVHCKVDGTGTKRAYLGRAWQQRPRVVFSYTTMS  308

Query  414   EAVRPLGWHGV--PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGF  241
               V P GW     P + H   T  FGEYK  G GA    R   +K+L   +V PFITLGF
Sbjct  309   SVVNPEGWSNNFHPERDH---TALFGEYKCNGEGANPAARAQASKQLAPGQVAPFITLGF  365

Query  240   IEGSKWLLPP  211
             IEGSKWLL P
Sbjct  366   IEGSKWLLHP  375



>ref|XP_006485036.1| PREDICTED: pectinesterase PPME1-like [Citrus sinensis]
Length=370

 Score =   364 bits (934),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/334 (51%), Positives = 234/334 (70%), Gaps = 6/334 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHIRVSKDGKGDFETITDALASV  1021
             IP  K++++SWF++NV+P   RK  LDP L+ A++  + I+V++DG G+F+TI DA+ S+
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVI  841
             P+ NT+RVI+SIG G Y E++ I++ KPFIT YG PDA P + F  T+ + GTV SAT+I
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  840   VEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRH  661
             VE+DYF A+NI I NS+PR +G  +G+QAVAL  SG  AA+YNCK+ GFQDT CDD G H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  660   FFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKIT  493
             FFKDC+I+GTVDFIFG+GK+LYL TEL  +      VI A AR +  ED G++FVHC I 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  492   GPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAK  313
             G   G +LGR W    RV+YAYT M   V   GW     +P    T ++GEYK +GPGA 
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD-NFRPERRQTVFYGEYKCSGPGAS  332

Query  312   MDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                R  + K+L+D E +PF+ L +++G++W+LPP
Sbjct  333   PAERVEYTKQLSDAEARPFLVLDYVQGNQWILPP  366



>gb|KDO57708.1| hypothetical protein CISIN_1g039631mg [Citrus sinensis]
Length=369

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 243/358 (68%), Gaps = 8/358 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYL--SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESN  1093
               ++I ++++L  S      D   IP  K+++ SWF++NV+P   RK  LDP L+ A++ 
Sbjct  9     FTIIIFIINHLANSANGGGGDGAVIPPEKSQIGSWFTANVKPYTERKTTLDPALSTAQAG  68

Query  1092  PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP  913
              + I+V++DG G+F+TI DA+ S+P+ NT+RVI+SIG G Y E++ I++ KPFIT YG P
Sbjct  69    QRVIKVNQDGSGEFKTINDAINSIPQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSP  128

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
             DA P + F  T+ + GTV SAT+IVE+DYF A+NI I NS+PR +G  +G+QAVAL  SG
Sbjct  129   DAMPNVTFGGTAKEYGTVDSATLIVESDYFMAVNIIIANSSPRPDGKREGAQAVALRISG  188

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----  565
               AA+YNCK+ GFQDT CDD G HFFKDC+I+GTVDFIFG+GK+LYL TEL  +      
Sbjct  189   TKAAFYNCKIIGFQDTLCDDRGNHFFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLT  248

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
             VI A AR +  ED G++FVHC I G   G +LGR W    RV+YAYT M   V   GW  
Sbjct  249   VITAHARESESEDNGFAFVHCTIEGSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD  308

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                +P    T ++GEYK +GPGA    R  + K+L+D E +PF+ L +++G++W+LPP
Sbjct  309   -NFRPERRQTVFYGEYKCSGPGASPAERVEYTKQLSDAEARPFLVLDYVQGNQWILPP  365



>ref|XP_006437032.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
 gb|ESR50272.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
Length=370

 Score =   363 bits (933),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/334 (51%), Positives = 234/334 (70%), Gaps = 6/334 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHIRVSKDGKGDFETITDALASV  1021
             IP  K++++SWF++NV+P   RK  LDP L+ A++  + I+V++DG G+F+TI DA+ S+
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVI  841
             P+ NT+RVI+SIG G Y E++ I++ KPFIT YG PDA P + F  T+ + GTV SAT+I
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  840   VEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRH  661
             VE+DYF A+NI I NS+PR +G  +G+QAVAL  SG  AA+YNCK+ GFQDT CDD G H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  660   FFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKIT  493
             FFKDC+I+GTVDFIFG+GK+LYL TEL  +      VI A AR +  ED G++FVHC I 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  492   GPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAK  313
             G   G +LGR W    RV+YAYT M   V   GW     +P    T ++GEYK +GPGA 
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD-NFRPERRQTVFYGEYKCSGPGAS  332

Query  312   MDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                R  + K+L+D E +PF+ L +++G++W+LPP
Sbjct  333   PAERVEYTKQLSDAEARPFLVLDYVQGNQWILPP  366



>ref|XP_009362807.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=368

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 248/361 (69%), Gaps = 7/361 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M ++  +M+I ++   S   ++DD+IPIP++ ++V SWF +NV+    RK+ LDP L  A
Sbjct  8     MFIHASLMIITIILTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNVRKSTLDPALVAA  67

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E  P+ I V +DG G+F+TITDA+ S+P  NT+RV + I GG Y E++ I   KPF+TLY
Sbjct  68    EHAPQVINVMQDGGGNFKTITDAINSIPAGNTKRVFVYIKGGVYNEKITIPHNKPFVTLY  127

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P + P I F  T+ K GTV+S T+IVE+DYF A+N+ I+NSAP  +G  +G+QAVAL 
Sbjct  128   GSPKSMPNITFDGTAQKYGTVYSGTLIVESDYFKAVNLVIINSAPEPDGIREGAQAVALQ  187

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID--  568
              SG+ AA+YNCK+ G+QDT  D +G H FKDC+I+GTVDFIFG GK+LYL+TE+HV++  
Sbjct  188   ISGNKAAFYNCKMIGYQDTLYDYKGLHLFKDCFIQGTVDFIFGKGKSLYLNTEIHVVERN  247

Query  567   -GVIAAQARHTNKEDTGYSFVHCKITGPR--QGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
               VI AQ R +  ED+G+SFVHCKITG    +  +LGR W +   V+ AYT++ + V P 
Sbjct  248   LTVITAQQRDSASEDSGFSFVHCKITGTTYARRTYLGRAWGSSPNVVVAYTDIADIVHPE  307

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
              W    G P      ++GEY N G G+ + G+  + +KL+D E KPFI+LG I+GSKWLL
Sbjct  308   RWSDF-GHPERESNLFYGEYNNWGQGSNITGQARYTRKLSDAEAKPFISLGNIQGSKWLL  366

Query  216   P  214
             P
Sbjct  367   P  367



>ref|XP_002321778.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
 gb|EEF05905.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
Length=362

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 241/364 (66%), Gaps = 9/364 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPEL  1111
             M T +V  +   ++L+  +S    S D+ PIP   + + SWF +NV+    R   LDP L
Sbjct  1     MSTGKVTGIAAFVILL-LVSTTAGSKDTSPIPGEPSSLNSWFHANVKSYTQRNGTLDPAL  59

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE+ PK IRV KDG GDF+T+T A+ S+   NTQRVI+ IG G Y E++ IEKEKPF+
Sbjct  60    ETAEAKPKTIRVRKDGSGDFKTLTGAVRSISSGNTQRVIVDIGSGVYNEKIQIEKEKPFV  119

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             T  G   + P + F  T+   GTV+SAT+ V++DYF A NI I NS+PR  G  K  QAV
Sbjct  120   TFKGSASSMPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLK-EQAV  178

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             AL   GD AA+YNC+L GFQDT CDD+GRHFFKDCYIEGTVDFIFG+GK+LYL T ++V+
Sbjct  179   ALRIGGDKAAFYNCRLIGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVL  238

Query  570   D----GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
                   VI AQAR+  ++DTG+SFVHCK+ G  +  FLGR W    RV++A+T M+  V 
Sbjct  239   ADQGLAVITAQARN-KEDDTGFSFVHCKVNGIGKWAFLGRAWTERPRVVFAFTTMSSVVN  297

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
             P GW      P       FGEYK  GPG+   GR  F+++LT ++VKPF++L +IEGSKW
Sbjct  298   PGGWSDNQ-HPERDRIVSFGEYKCKGPGSNPSGRVKFSRQLTPQQVKPFLSLAYIEGSKW  356

Query  222   LLPP  211
             LLPP
Sbjct  357   LLPP  360



>ref|XP_008449624.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449625.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449626.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
Length=368

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 245/364 (67%), Gaps = 11/364 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             +R++ L +  ++    +   +   S PIP  K+++ +WFS NV+P+A+RK  LDP L  A
Sbjct  3     LRMDALAITRLVTFLATFTTILAVSTPIPVEKSQIDAWFSQNVKPLADRKAELDPALVAA  62

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E N   I+V  DG GDF+TIT+A+ASVP DN +RV+ISIG G Y E++ I++ KPF+TLY
Sbjct  63    EENATIIKVMSDGTGDFKTITEAIASVPADNKKRVMISIGDGIYKEKLKIDRNKPFVTLY  122

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P   P + F   + K GTV+SAT+IVEADYFTA N+ I NS+PR +G  KG+QA+A  
Sbjct  123   GSPKGMPKLTFDGDAAKFGTVYSATLIVEADYFTAANLVIENSSPRPDGVRKGAQALAAR  182

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG  565
               G  AA YNCK  GFQDT CDD+G HF+KDC+I+GTVDFIFG G +LY++T+L V  DG
Sbjct  183   FMGTKAAIYNCKFTGFQDTLCDDDGLHFYKDCFIQGTVDFIFGKGTSLYVNTQLDVAGDG  242

Query  564   ---VIAAQARHTNKEDTGYSFVHCKITGPRQGG---FLGRGWMAFSRVIYAYTEMTEAVR  403
                VI A +R    + +GYSFVHC ITG   GG   FLGR WM  SRV++AYT M + + 
Sbjct  243   GLAVITAHSREQESDGSGYSFVHCSITG--TGGKNTFLGRAWMPRSRVVFAYTTMADIIH  300

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
             P GW+ +     +  T  FGEYK +GPG+    R  + K+L+D EV PF++L +++  KW
Sbjct  301   PEGWNDMK-HAGFDKTVMFGEYKCSGPGSVSTERVPYGKQLSDAEVNPFLSLAYVQSEKW  359

Query  222   LLPP  211
             LLPP
Sbjct  360   LLPP  363



>ref|XP_010523329.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 237/344 (69%), Gaps = 9/344 (3%)
 Frame = -1

Query  1215  SDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETIT  1039
             + D+ PIP NKA+++ WF +NV P+A RK +LDP L  AE+ P+ IRV+K+G GDF+T+ 
Sbjct  22    TGDATPIPQNKAQLQQWFRANVAPLAQRKGSLDPALVAAEAAPRVIRVNKNGGGDFKTLN  81

Query  1038  DALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTV  859
              A+ S+P  NT+RVII +G G Y E+V I++ KPF+TLYG P+A P + +  T+ K GTV
Sbjct  82    AAINSIPAGNTKRVIIKLGPGEYREKVTIDRNKPFVTLYGQPNAMPVLTYDGTAAKYGTV  141

Query  858   HSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFC  679
              SAT IV +DYF A+N+   NSAP  +G  KG+QA+A   SG+ AA+YNCK YG+QDT C
Sbjct  142   DSATFIVLSDYFMAVNVIFKNSAPMPDGRMKGAQALAARVSGNKAAFYNCKFYGYQDTVC  201

Query  678   DDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---VIAAQARHTNKEDTGYSFV  508
             DD G HFFKDCYIEGT DFIFG+G +LYL+T+L+V+     VI A+A  +  + +GY F 
Sbjct  202   DDIGNHFFKDCYIEGTFDFIFGSGTSLYLNTQLNVVGNGIRVITAEAGKSVSDPSGYVFA  261

Query  507   HCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH--GVPGKPHYGGTTYFGEYK  334
             H ++TG   G +LGR WM+  +V+YAYTEMT  V P GW    +PG+     T ++ EYK
Sbjct  262   HSRVTGTGTGIYLGRAWMSHPKVVYAYTEMTSIVAPAGWQQNSIPGRDK---TVFYREYK  318

Query  333   NTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               GPG+ +  R  F + L   E   F++LG+I+GSKWLLPP  L
Sbjct  319   CYGPGSNIAKRVPFTRSLNPTEAGHFLSLGYIQGSKWLLPPPAL  362



>ref|XP_002277202.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38546.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 237/345 (69%), Gaps = 6/345 (2%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHIRVSKDGKGDFET  1045
             +  +D+  IP++K+++  WF ++++    R+  LDP L +AE + K I+VSK G G+F T
Sbjct  23    LADNDNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNT  82

Query  1044  ITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG  865
             +  A+ SVP  NT+RVII IGGG Y E++ I+++KPFIT YG P+  P ++F  T+ + G
Sbjct  83    VMAAVNSVPAGNTRRVIIWIGGGEYEEKIKIDRDKPFITFYGSPEDMPKLSFDGTAAEFG  142

Query  864   TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDT  685
             TV SAT+IVE+DYF A+NI ++NS+PR +G  KG+QAVAL  SGD AA+YNC+L GFQDT
Sbjct  143   TVDSATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDT  202

Query  684   FCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG---VIAAQARHTNKEDTGY  517
              CDD GRHFF  CY+EGTVD+IFG+GK+LYL TELH   DG   VI AQAR+   ED GY
Sbjct  203   LCDDRGRHFFHGCYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLESEDNGY  262

Query  516   SFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEY  337
             SFVHC ++G     FLGR WM+  +V+++YT M+  V PLGW      P      ++GEY
Sbjct  263   SFVHCTLSGTGGNTFLGRAWMSRPKVVFSYTFMSPVVSPLGWSNNI-HPERESLVFYGEY  321

Query  336   KNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             K  GPGA    R  F K+L D+   PFITL +I+ S WLLPP  L
Sbjct  322   KCMGPGADTSKRSKFTKELDDDGATPFITLNYIDASTWLLPPPGL  366



>emb|CBI38549.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 233/353 (66%), Gaps = 7/353 (2%)
 Frame = -1

Query  1209  DSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDA  1033
             D + IP +K ++ +WF   ++    R+  LDPEL KAE N K I+VSK G GDF+T+TDA
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  1032  LASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHS  853
             + SVPE N  RVII IGGG Y E++ I++ KPF+T YG PD  P ++F  T+ K GTV S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  852   ATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDD  673
             A++IVE+ YF  +NI ++NS+P+ +G  KG+QAVAL  SGD AA+YN KL GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  672   EGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG----VIAAQARHTNKEDTGYSFV  508
               RHFFK CYIEGTVDFIFG+GK+++L TE+H + DG    VI A AR+   EDTGYSFV
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  507   HCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNT  328
             HC I+G     FLGR WM   +V++++T M+  V PLGW      P      +FGEY   
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSN-NLHPDRDSMVFFGEYNCL  328

Query  327   GPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKLDPHAQLAKSEL  169
             GPGA M  R  F KKL     KP+I+L +I  S WLLPP  L  H  + + + 
Sbjct  329   GPGANMSRRAKFTKKLDFNGAKPYISLNYIRASSWLLPPPNLSAHLLIFRVDF  381



>ref|XP_010662219.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
Length=373

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 230/345 (67%), Gaps = 7/345 (2%)
 Frame = -1

Query  1209  DSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDA  1033
             D + IP +K ++ +WF   ++    R+  LDPEL KAE N K I+VSK G GDF+T+TDA
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  1032  LASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHS  853
             + SVPE N  RVII IGGG Y E++ I++ KPF+T YG PD  P ++F  T+ K GTV S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  852   ATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDD  673
             A++IVE+ YF  +NI ++NS+P+ +G  KG+QAVAL  SGD AA+YN KL GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  672   EGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG----VIAAQARHTNKEDTGYSFV  508
               RHFFK CYIEGTVDFIFG+GK+++L TE+H + DG    VI A AR+   EDTGYSFV
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  507   HCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNT  328
             HC I+G     FLGR WM   +V++++T M+  V PLGW      P      +FGEY   
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSNNL-HPDRDSMVFFGEYNCL  328

Query  327   GPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKLDPH  193
             GPGA M  R  F KKL     KP+I+L +I  S WLLPP  L  H
Sbjct  329   GPGANMSRRAKFTKKLDFNGAKPYISLNYIRASSWLLPPPNLALH  373



>ref|XP_007153340.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
 gb|ESW25334.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
Length=369

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/365 (49%), Positives = 240/365 (66%), Gaps = 7/365 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPE  1114
             M +  V   I V ++V +L+  VV  DD  P+P++K E+ SWF SNV  +  RK +LDP+
Sbjct  1     MASKYVYCSIKVTLMVVFLTTQVVLPDDDTPMPSDKTELGSWFQSNVGTLRKRKGSLDPK  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+++TI+DAL S+P  NT RVI+ IG GNY E++ +EK KPF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEYKTISDALRSIPSGNTMRVILYIGPGNYHEKITVEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +T YG P   P + +  T+ + GTV SAT+IV +DYF A NI I NSAPR +  + G QA
Sbjct  121   VTFYGKPGNMPNLTYDGTARQYGTVDSATLIVLSDYFVAANIIISNSAPRPDENSVGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD A +YNC+LYG+QDT  DD  RHFFKDC I+G VD+IFG+GK+LY++ E+  
Sbjct  181   VALRISGDKATFYNCELYGYQDTLLDDANRHFFKDCLIQGYVDYIFGSGKSLYVNCEIRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +       I AQAR   +ED G+SFVHC++TG     +LGR W  +S VI+AY  M    
Sbjct  241   LGDEGFTFITAQARKNKQEDNGFSFVHCELTGTGSDTYLGRAWFGYSTVIFAYCNMANIF  300

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
                 W      P +  T YFGEYKN GPG+ + GR   AK+L++ EVKP++ +G IEGSK
Sbjct  301   NKQAWSD-NNHPEFDKTLYFGEYKNRGPGSDVRGRSPLAKQLSESEVKPYLGIGMIEGSK  359

Query  225   WLLPP  211
             W+LPP
Sbjct  360   WILPP  364



>emb|CAN66682.1| hypothetical protein VITISV_005088 [Vitis vinifera]
Length=373

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 228/345 (66%), Gaps = 7/345 (2%)
 Frame = -1

Query  1209  DSIPIPANKAEVKSWFSSNVEP-VANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDA  1033
             D + IP +K ++ +WF   ++     R  LDPEL KAE N K I+VSK G GDF+T+TDA
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNHKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  1032  LASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHS  853
             + SVP  N  RVII  GGG Y E++ I++ KPF+T YG PD  P ++F  T+ K GTV S
Sbjct  90    VNSVPXGNXXRVIIWXGGGVYEEKIKIDRTKPFVTFYGSPDXMPMLSFDGTAAKYGTVDS  149

Query  852   ATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDD  673
             A++IVE+ YF  +NI ++NS+P+ +G  KG+QAVAL  SGD AA+YN KL GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  672   EGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG----VIAAQARHTNKEDTGYSFV  508
               RHFFK+CYIEGTVDFIFG+GK+L+L TE+H + DG    VI A AR+   EDTGYSFV
Sbjct  210   RNRHFFKECYIEGTVDFIFGSGKSLFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  507   HCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNT  328
             HC I+G     FLGR WM   +V++++T M+  V PLGW      P      +FGEY   
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSNNL-HPDRDSMVFFGEYNCL  328

Query  327   GPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKLDPH  193
             GPGA M  R  F KKL     KP+I+L +I  S WLLPP  L  H
Sbjct  329   GPGANMSRRAKFTKKLDFNGAKPYISLNYIGASSWLLPPPNLALH  373



>gb|KHN28380.1| Putative pectinesterase 48, partial [Glycine soja]
Length=313

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 218/309 (71%), Gaps = 5/309 (2%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             +DP L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK
Sbjct  1     VDPALVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEK  60

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPF+TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T 
Sbjct  61    TKPFVTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTP  120

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G QAVAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY+ T
Sbjct  121   GGQAVALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVST  180

Query  585   ELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEM  418
             EL  +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M
Sbjct  181   ELRTLGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNM  240

Query  417   TEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFI  238
             ++ V  LGW      P +  T  FGEY+N+GPGA   GR    K+L++ EVKP+ITL  I
Sbjct  241   SDIVNKLGWSN-NNHPEHDKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMI  299

Query  237   EGSKWLLPP  211
             EGSKWLLPP
Sbjct  300   EGSKWLLPP  308



>ref|XP_007204487.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
 gb|EMJ05686.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
Length=368

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 231/340 (68%), Gaps = 9/340 (3%)
 Frame = -1

Query  1215  SDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETIT  1039
             +DD   +  +  +V +WF++NV P   R+  LDP L  AE     ++V KD  G+F+TIT
Sbjct  28    ADDETLVVTDHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTIT  87

Query  1038  DALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTV  859
              A+ S+P DNT+RVI+ IGGG Y E++ I + K F+T YG P   P + F  T+ K GTV
Sbjct  88    GAVNSIPVDNTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTV  147

Query  858   HSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFC  679
              SATVI E+DYF A N+ I NS+P+ +G   G QA+AL  SG+ +A +NC+L GFQDT C
Sbjct  148   DSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLC  207

Query  678   DDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSF  511
             DD+G HFF+DC+IEGTVDFIFG+GK+LYL   LHV+      VI AQAR++  EDTGYSF
Sbjct  208   DDKGNHFFQDCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSF  264

Query  510   VHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKN  331
             VHC ITG   G +LGR W    RV++AYT M+E + P  W+    +P    T ++GEYK 
Sbjct  265   VHCNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITPADWNN-KNRPKRDRTVFYGEYKC  323

Query  330   TGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +GP + M GR  + K+L +E++KPF++L +I+GSKWLLPP
Sbjct  324   SGPASSMVGRVKYTKQLNEEQIKPFLSLSYIQGSKWLLPP  363



>gb|KFK25128.1| hypothetical protein AALP_AA8G069700 [Arabis alpina]
Length=361

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 243/363 (67%), Gaps = 16/363 (4%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V  LV + SP V++ D+ PIP +++++  WF +NV P + RK  LDP L  AE++  
Sbjct  6     LAIVAFLVVFASPVVLATDTDPIPEDRSKIPQWFHTNVAPYSKRKGTLDPALDAAEASRL  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G G+F+TI +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P A
Sbjct  66    IITVNQQGGGNFKTINEAVKSIPAGNKNRVIIKLAPGIYNEKVTIDIARPFVTLLGQPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ K GTV SAT+IV +DYF A N+ I N+AP  +  ++G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWSDYFMAANLVIKNTAPMPKPGSQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNC+ YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYNCRFYGFQDTLCDDKGTHFFKDCYIEGTYDFIFGRGASLYLNTKLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW-----  391
             AQ R ++ E  GY+FVHCK+TG   G +LGR WM+  +VIYA+TEMT  V P GW     
Sbjct  245   AQGRQSDNEQNGYTFVHCKVTGTGNGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWKENLL  304

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             HG      Y  T Y+GEYK  G G+ ++ R  F + +   EV+PF+TLG+I+GS WLLPP
Sbjct  305   HG------YDKTVYYGEYKCFGAGSHLEKRVPFTQDVDQNEVRPFLTLGYIKGSAWLLPP  358

Query  210   IKL  202
              K 
Sbjct  359   PKF  361



>gb|AAX11262.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 231/339 (68%), Gaps = 7/339 (2%)
 Frame = -1

Query  1200  PIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP-KHIRVSKDGKGDFETITDALAS  1024
             PIP N AE++SWF   V+PV+ +K L+P + +AES   + I V +DG G F+TI+DA+  
Sbjct  2     PIPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGTVHSAT  847
             V   NT+RVII+IG G Y E+V IE+  P+ITLYG DP   P I F  T+ + GTV SAT
Sbjct  62    VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  846   VIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEG  667
             +IVE+DYF   N+ + NSAPR +G  KG++A AL  SGD AA+YNCK  GFQDT CDD+G
Sbjct  122   LIVESDYFVGANLIVSNSAPRPDGKRKGARASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  666   RHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCK  499
              H FKDCYIEGTVDFIFG  ++LYL+TELHV+ G    +I A AR       GYSFVHCK
Sbjct  182   NHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  498   ITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPG  319
             +TG      LGR W   +RV+++Y  +++AV+P GW     KP    T +FGEYKNTGPG
Sbjct  242   VTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPG  300

Query  318   AKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             A  D R  + K+LT+ + K F +L +IE +KWLLPP K+
Sbjct  301   AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLLPPPKV  339



>gb|EYU20154.1| hypothetical protein MIMGU_mgv1a008641mg [Erythranthe guttata]
Length=367

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 248/370 (67%), Gaps = 10/370 (3%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-N  1126
             M  K+     +N +++ ++L   L        S PIPA+ +++ SWF+ NV   A+RK  
Sbjct  1     METKSSYIFTLNAVLVTVLLS--LPVARSGGGSEPIPADASQINSWFNKNVGDAASRKAT  58

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             L PELA AE+NPK I+V  DG GDF+TI DA+ S+P+ N  RVI+SIG G Y E+V +  
Sbjct  59    LAPELAAAEANPKVIKVRADGSGDFKTINDAVKSIPDGNKNRVIVSIGPGKYKEKVTVGA  118

Query  945   EKPFITLYGDPDATPFINFHKTSTKD-GTVHSATVIVEADYFTAININILNSAPRWEGTT  769
              KPF+TL GD    P I +  T+ K  G V+SAT+  E+DYF+A+N+ ++N+APR +G  
Sbjct  119   NKPFVTLRGDAGNMPTIVYDDTAKKSKGVVYSATLSAESDYFSAVNLKVVNTAPRPDGKM  178

Query  768   KGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLD  589
               +QAVAL   G  A+ YNCKLYGFQDT  DD+G+HF+KDCYIEGT DFI+G+  ++YL+
Sbjct  179   VDAQAVALKIIGKYASIYNCKLYGFQDTLFDDKGKHFYKDCYIEGTYDFIWGSAASIYLN  238

Query  588   TELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTE  421
             TELH+I G    VIAA AR  + E  GY F HCK+TG    G+LGR W  ++RV+YA+++
Sbjct  239   TELHIISGDPLAVIAANARSASAEPNGYVFAHCKVTGTGAMGYLGRSWYPYARVVYAFSD  298

Query  420   MTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGF  241
             + +AV P GW+   GK +   T YFGEY N G   K D R  FAKKL+D EVKPFI+L F
Sbjct  299   LGDAVNPDGWYTGTGKDN--KTVYFGEYNNKGSAGKFDKRASFAKKLSDAEVKPFISLDF  356

Query  240   IEGSKWLLPP  211
             I+GS WLLPP
Sbjct  357   IQGSTWLLPP  366



>ref|XP_006286828.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
 gb|EOA19726.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
Length=362

 Score =   353 bits (905),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 239/354 (68%), Gaps = 6/354 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L ++  LV + +P V++DD  PIPA KA+V+ WF +NV+P++ RK  LDP L  AE++P+
Sbjct  7     LSLIAFLVAFATPVVLADDITPIPAEKAQVEPWFKANVKPLSERKGTLDPLLEAAEASPR  66

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G GDF TI  A+ S+P +N +RVI+ +  G Y E+V I+  +PF+TL G P A
Sbjct  67    IITVNQKGGGDFTTINAAIKSIPLENKKRVIVKLAPGVYKEKVTIDIGRPFVTLLGKPGA  126

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + F  TS K GTV SAT+I+ A YF A N+N++N++P  +  T+G QA+A+  +GD 
Sbjct  127   ETNLTFDGTSAKYGTVESATLIIWAQYFMAANLNLINTSPMPKPGTQG-QALAMRINGDK  185

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNC+ YGFQDT CDD G HFFK+CYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  186   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  245

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R  + E  GYSFVHCKITG   G +LGR WM+  +V+YAYTEMT  V P GW     
Sbjct  246   AHNRQNDNEQNGYSFVHCKITGDGTGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQE-NR  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              P +  T ++GEY  TGPG+    R    + + ++E   F++LG+I+GS WLLP
Sbjct  305   TPAHDKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_009130989.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
Length=361

 Score =   353 bits (905),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 241/357 (68%), Gaps = 6/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V  LV + SP V++ D+ PIP +++++  WF +NV P + RK  LDP L  AE+  +
Sbjct  6     LTIVAFLVAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPSLEAAETARQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G  +F+TI +A+ S+P  N  RV+I +  G Y E+V I+  +PFITL G P +
Sbjct  66    VITVNQKGGANFKTINEAIKSIPTGNKNRVVIKLAPGVYNEKVTIDVARPFITLLGQPGS  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ + GTV SAT+IV +DYF A N+ I N+AP  +   +G QA+A+  +GD 
Sbjct  126   ETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y+CK YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQAR ++ E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEM+  V P GW     
Sbjct  245   AQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGWRENFN  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
             +  Y  T ++GEYK  GPG+  + R  + + +   EV+PF+TLG+I+GS WLLPP K
Sbjct  305   R-GYDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSTWLLPPPK  360



>ref|XP_004156059.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
 gb|KGN48070.1| hypothetical protein Csa_6G428030 [Cucumis sativus]
Length=370

 Score =   353 bits (905),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 243/365 (67%), Gaps = 13/365 (4%)
 Frame = -1

Query  1275  RVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKA  1102
             R+N L +  ++    +   +   S PIP  K+++  WF+ NV+P A  N+  LDP LA A
Sbjct  4     RINALAITRLVTFLATFTAILAVSPPIPVEKSQLAGWFTENVKPFAVRNKAELDPALATA  63

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E N   I+V  DG G+F+T+T+A+ASVP DN +RV+I IG G Y E++ I++ KPF+TLY
Sbjct  64    EENATVIKVMSDGTGNFKTVTEAIASVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLY  123

Query  921   G-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             G DP   P + F   + K GTV+SAT+IVEADYFTA N+ I NS+PR +G  KG+QA+A 
Sbjct  124   GSDPKNMPKLTFDGDAAKYGTVYSATLIVEADYFTAANLIIENSSPRPDGVRKGAQALAA  183

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-D  568
                G  AA YNCK  GFQDT CDD+G HF+KDC+I+GTVDFIFG G +LYL+T+L V  D
Sbjct  184   RFMGTKAAIYNCKFLGFQDTLCDDDGLHFYKDCFIQGTVDFIFGKGTSLYLNTQLDVAGD  243

Query  567   G---VIAAQARHTNKEDTGYSFVHCKITGPRQGG---FLGRGWMAFSRVIYAYTEMTEAV  406
             G   VI A +R    + +GYSFVHC ITG   GG   +LGR WM  SRV++AYT + + +
Sbjct  244   GGLAVITAHSREQEADTSGYSFVHCSITG--TGGKNTYLGRAWMPRSRVVFAYTTIADII  301

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW+ +     +  T  FGEYK +GPGA   GR  + K+LTD EVKPF+ L +++  K
Sbjct  302   HPEGWNDMK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTDVEVKPFLGLEYVQSEK  360

Query  225   WLLPP  211
             WLLPP
Sbjct  361   WLLPP  365



>ref|XP_010491359.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 243/362 (67%), Gaps = 6/362 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             M    + +V  LV + SP V++ D+ PIP N+A++  WF +NV+P + RK  LDP L  A
Sbjct  1     MGYMSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSMRKGKLDPALDAA  60

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E++   I V++ G G+F+TI +A+ S+P  N  RVII +  G Y E+V ++  +PFITL 
Sbjct  61    EASRLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFITLL  120

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P A   + +H T+ K GTV SAT+IV ADYF A N+ I N+AP  +  ++G QA+A+ 
Sbjct  121   GQPGAETVLTYHGTAAKYGTVESATLIVWADYFQAANLIIRNTAPMPKPGSQG-QALAMR  179

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG  565
              +GD AA+Y+CK YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG
Sbjct  180   INGDKAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDG  239

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQ+R +  E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEMT  V P GW
Sbjct  240   LRVITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW  299

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  +  Y  T ++GEYK  GPG+ +  R  + + +   EV+PFI+LG+I+GS WLLP 
Sbjct  300   RENFNR-GYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPA  358

Query  210   IK  205
              K
Sbjct  359   PK  360



>ref|XP_009122340.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
 emb|CDX70038.1| BnaA10g23870D [Brassica napus]
Length=361

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 240/355 (68%), Gaps = 6/355 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPV-ANRKNLDPELAKAESNPK  1087
             L M+  LV +  P VV+DD  PIP +KA+V++WF +NV+P  A R  LDP L  AE++P+
Sbjct  6     LTMIAFLVIFALPAVVADDITPIPEDKAQVEAWFKANVQPYSARRGTLDPVLDAAEASPQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+++G GDF+TI +A+ S+P  NT+RVII +  G Y E+V ++  +PF+TL G P A
Sbjct  66    IINVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + F  T++K GT+ SAT+I+ A YF A N+++ N+AP  +  T+G QA+A+  +GD 
Sbjct  126   ETNLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R +  +  GYSFVHCKITG   G +LGR WM+  +V+YAYTEM+  V P GW     
Sbjct  245   AHNRQSENQQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENRN  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             + +   T ++GEY  TGPG+  + R    + +   E   F+TLG+I+GS WLLPP
Sbjct  305   REN-DKTVFYGEYMCTGPGSHKEKRVAHTQDIDKNEANGFLTLGYIKGSLWLLPP  358



>ref|XP_007038214.1| Pectinesterase isoform 2, partial [Theobroma cacao]
 gb|EOY22715.1| Pectinesterase isoform 2, partial [Theobroma cacao]
Length=314

 Score =   349 bits (896),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 223/324 (69%), Gaps = 11/324 (3%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  K    + V   I  I++   L+P V+S +S PIP +K+++K+WF++N++P + R   
Sbjct  1     MTGKRSRNIEVGAAICTILV---LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGST  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             +DP LAKAE     I+V KDG GDF+TIT A+ASVP  NT+RVIISIGGG+Y E++ I++
Sbjct  58    IDPALAKAEVAAHIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDR  117

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPFIT YGDP   P +++  T+ + GTV SAT+IVE+DYF A NI I N+APR +G   
Sbjct  118   SKPFITFYGDPRNMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMV  177

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAV+L  SGD AA+YNCK+ GFQDT CDD G HFFKDCYI GTVDFIFG+GK+LYL  
Sbjct  178   GAQAVSLRISGDKAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLGV  237

Query  585   ELHVIDGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
                    VI AQAR ++ E+TGYSFVHC +TG   G +LGR W    RV++AYT M+  +
Sbjct  238   T------VITAQARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTNMSSVI  291

Query  405   RPLGWHGVPGKPHYGGTTYFGEYK  334
              PLGW      P    T +FGEYK
Sbjct  292   HPLGWSD-NLHPERAKTVFFGEYK  314



>ref|XP_006289803.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
 gb|EOA22701.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
Length=362

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/357 (48%), Positives = 240/357 (67%), Gaps = 6/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             + +V  LV + S  V++ D+ PIP N+A++  WF +NV+P + RK  LDP L  AE++ +
Sbjct  7     MFVVAFLVFFASSVVLATDTDPIPENRAQISQWFQTNVKPYSQRKGTLDPALDAAEASRR  66

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G G+F+T+ +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P A
Sbjct  67    VITVNQKGGGNFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGA  126

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ K GTV SAT+I+ ++YF A N+ I N+AP  +  T+G QA+A+  +GD 
Sbjct  127   ETVLTYHGTAAKYGTVESATLIIWSEYFQAANLIIRNTAPMPKPGTQG-QALAMRINGDK  185

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             A++YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  186   ASFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  245

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R    + +GY+F HCKITG   G +LGR WM+  +VIYA+TEMT  V P GW     
Sbjct  246   AHGRQNANDQSGYTFAHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENLN  305

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
             K  Y  T ++GEYK  GPG+ ++ R  + + +   EV+PF+TLG I+GSKWLLPP K
Sbjct  306   K-GYDKTVFYGEYKCFGPGSHVEKRVPYTQDIDQNEVRPFLTLGKIQGSKWLLPPPK  361



>ref|XP_007204920.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
 gb|EMJ06119.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
Length=332

 Score =   349 bits (896),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 225/328 (69%), Gaps = 9/328 (3%)
 Frame = -1

Query  1179  EVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQ  1003
             +V +WF++NV P   R+  LDP L  AE     ++V KD  G+F+TIT A+ S+P DNT+
Sbjct  4     QVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGAVNSIPVDNTK  63

Query  1002  RVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYF  823
             RVI+ IGGG Y E++ I + K F+T YG P   P + F  T+ K GTV SATVI E+DYF
Sbjct  64    RVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDSATVIAESDYF  123

Query  822   TAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCY  643
              A N+ I NS+P+ +G   G QA+AL  SG+ +A +NC+L GFQDT CDD+G HFF+DC+
Sbjct  124   VAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDDKGNHFFQDCF  183

Query  642   IEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGG  475
             IEGTVDFIFG+GK+LYL   LHV+      VI AQAR++  EDTGYSFVHC ITG   G 
Sbjct  184   IEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVHCNITGTGNGT  240

Query  474   FLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPY  295
             +LGR W    RV++AYT M+E + P  W+    +P    T ++GEYK +GP + M GR  
Sbjct  241   YLGRAWRTSPRVVFAYTSMSEVITPADWNN-KNRPKRDRTVFYGEYKCSGPASSMVGRVK  299

Query  294   FAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             + K+L +E++KPF++L +I+ SKWLLPP
Sbjct  300   YTKQLNEEQIKPFLSLSYIQSSKWLLPP  327



>gb|KGN48072.1| hypothetical protein Csa_6G428290 [Cucumis sativus]
Length=368

 Score =   350 bits (899),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 245/364 (67%), Gaps = 11/364 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSP--GVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPEL  1111
             +R++ L  +  LV +L+    +++  S  +P +KA++++WFS NV+P A  N+  LDP +
Sbjct  3     LRMDAL-AITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAV  61

Query  1110  AKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
               AE N   ++V  DG GDF+T+T+A+ASVP +N  RV+I IG G Y E++ IEK KPFI
Sbjct  62    VAAEGNVTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFI  121

Query  930   TLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
             TL G P   P + F   ++K GTV+SAT+IVEADYF A N+ I N++PR  G  K +QA+
Sbjct  122   TLCGTPKNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQAL  180

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             A    G  +A+YNCK  GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+TEL+V+
Sbjct  181   AARFRGTKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVV  240

Query  570   D----GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
                   VI A +R    + +GYSFVHC ITG  +  FLGR WM  SRVI+AYT M + + 
Sbjct  241   GEGQFAVITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIFAYTSMIDIIH  300

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
             P GW+ +     +  T  FGEYK +GPGA   GR  + K+LT+ EVKP+++L F++ +KW
Sbjct  301   PEGWNDMK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKW  359

Query  222   LLPP  211
             LLPP
Sbjct  360   LLPP  363



>ref|XP_010491360.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 237/355 (67%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPV-ANRKNLDPELAKAESNP  1090
              L ++ +LV +  P V++DD  PIPA KA+V+ WF +NV+P  A R  LDP+L  AE++P
Sbjct  6     SLSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASP  65

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V++ G GDF +I  A+ S+P  N  RVII +  G Y E+V ++  +PF+TL G P 
Sbjct  66    RIITVNQKGGGDFTSINAAIKSIPVGNKVRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPG  125

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A   + FH TS K GTV SAT+IV A YF A N++ILN+AP  +  T+G QA+A+  + D
Sbjct  126   AETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINAD  184

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI
Sbjct  185   KAAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVI  244

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A  R  + + +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEM+  V P GW    
Sbjct  245   TAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENR  304

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              + H   T ++GEY  TGPG+    R    + + ++E   F++LG+I+GS WLLP
Sbjct  305   VRAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_009136509.1| PREDICTED: putative pectinesterase 63 isoform X2 [Brassica rapa]
Length=338

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 238/358 (66%), Gaps = 29/358 (8%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              LI+ I+LV    P V  +D+ PIP NK  ++ WF++NV                     
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVR--------------------  46

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
                  ++G+GDF+T+T+A+ SVP  N +RVII +G G Y E+V I++ KPFITLYGDP+A
Sbjct  47    -----QNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNA  101

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV SAT+IV +DYF AINI + NSAP  +G  KG+QA+++  SG+ 
Sbjct  102   MPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI 
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVVGDGLRVIT  221

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GWH    
Sbjct  222   AHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-NT  280

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             +     T ++GEYK +GPG++ + R  + + + + E   FI+LG+I+GS WLLPP  L
Sbjct  281   QTERDKTVFYGEYKCSGPGSRKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPPHSL  338



>ref|XP_010452708.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/362 (49%), Positives = 241/362 (67%), Gaps = 6/362 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             M    + +V  LV + SP V++ D+ PIP N+A++  WF +NV+P + RK  LDP L  A
Sbjct  1     MGYMSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAA  60

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E++   I V   G G+F+TI +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL 
Sbjct  61    EASRLIITVRYTGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLL  120

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P A   + +H T+ K GTV SAT+IV +DYF A N+ I N+AP  +  ++G QA+A+ 
Sbjct  121   GQPGAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQG-QALAMR  179

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG  565
              +GD AA+Y+CK YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG
Sbjct  180   INGDKAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDG  239

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQ+R +  E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEMT  V P GW
Sbjct  240   LRVITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW  299

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  +  Y  T ++GEYK  GPG+ +  R  + + +   EV+PFI+LG+I+GS WLLP 
Sbjct  300   RKNFNR-GYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPA  358

Query  210   IK  205
              K
Sbjct  359   PK  360



>ref|XP_004140272.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 243/358 (68%), Gaps = 10/358 (3%)
 Frame = -1

Query  1260  IMVIVLVHYLSP--GVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKAESN  1093
             + +  LV +L+    +++  S  +P +KA++++WFS NV+P A  N+  LDP +  AE N
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  1092  PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP  913
                ++V  DG GDF+TIT+A+ASVP +N  RV+I IG G Y E++ IEK KPFITL G P
Sbjct  64    VTIVKVMGDGTGDFKTITEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
                P ++F   ++K GTV+SAT+IVEADYF A N+ I N++PR  G  K +QA+A    G
Sbjct  124   KNVPTLSFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----G  565
               +A+YNCK +GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+TEL+V+      
Sbjct  183   TKSAFYNCKFFGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
             VI A +R    + +GYSFVHC ITG  +  +LGR WM  SRVI+AYT M + + P GW+ 
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWND  302

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +     +  T  FGEYK +GPGA   GR  + K+LT+ EVKP+++L F++ +KWLLPP
Sbjct  303   MK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  359



>gb|ACO34813.1| Sal k 1 pollen allergen [Salsola kali]
Length=339

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 229/338 (68%), Gaps = 7/338 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP-KHIRVSKDGKGDFETITDALASV  1021
             IP N AE++SWF   V+PV+ +K L+P + +AES   + I V +DG G F+TI+DA+  V
Sbjct  3     IPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKHV  62

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGTVHSATV  844
                NT+RVII+IG G Y E+V IE+  P+ITLYG DP   P I F  T+ + GTV SAT+
Sbjct  63    KVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSATL  122

Query  843   IVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGR  664
             IVE+DYF   N+ + NSAPR +G  KG+QA AL  SGD AA+YNCK  GFQDT CDD+G 
Sbjct  123   IVESDYFVGANLIVSNSAPRPDGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKGN  182

Query  663   HFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKI  496
             H FKDCYIEGTVDFIFG  ++LYL+TELHV+ G    +I A AR       GYSFVHCK+
Sbjct  183   HLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCKV  242

Query  495   TGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGA  316
             TG      LGR W   +RV+++Y  +++AV+P GW     KP    T +FGEYKNTGPGA
Sbjct  243   TGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPGA  301

Query  315   KMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               D R  + K+LT+ + K F +L +IE +KWL PP K+
Sbjct  302   AADKRVPYTKQLTEADAKTFTSLEYIEAAKWLPPPPKV  339



>ref|XP_006399226.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
 gb|ESQ40679.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
Length=361

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 242/363 (67%), Gaps = 16/363 (4%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V   V + SP V++ D+ PIP +++++  WF +NV P + RK  LDP L  AE++ +
Sbjct  6     LAIVAFFVAFASPVVLATDTAPIPEDRSQIPEWFKTNVAPYSQRKGTLDPALDAAEASRQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V + G G+F+TI +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P +
Sbjct  66    VITVDQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGS  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ + GTV SAT+I+ +DYF A N+ I N++P  +  ++G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y+CK +GFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYSCKFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW-----  391
             A AR +  E  GY+FVHCK+TG   G +LGR WM+  +VIYA+TEMT  V P GW     
Sbjct  245   AHARESENEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWKENLQ  304

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             HG      Y  T ++GEYK  GPG+ ++ R  F + +   EV+PF+TLG+I+GS WLLPP
Sbjct  305   HG------YDKTVFYGEYKCFGPGSHLEKRVPFTQDVDQNEVRPFLTLGYIKGSTWLLPP  358

Query  210   IKL  202
              K 
Sbjct  359   PKF  361



>ref|XP_010423211.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 237/355 (67%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPV-ANRKNLDPELAKAESNP  1090
              L ++ +LV +  P V++DD  PIPA KA+V+ WF +NV+P  A R  LDP+L  AE++P
Sbjct  6     SLSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASP  65

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V++ G GDF ++  A+ S+P  N  RVII +  G Y E+V ++  +PF+TL G P 
Sbjct  66    RIITVNQKGGGDFTSVNAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPG  125

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A   + FH TS K GTV SAT+IV A YF A N++ILN+AP  +  T+G QA+A+  + D
Sbjct  126   AETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINAD  184

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI
Sbjct  185   KAAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVI  244

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A  R  + + +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEM+  V P GW    
Sbjct  245   TAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENR  304

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              + H   T ++GEY  TGPG+    R    + + ++E   F++LG+I+GS WLLP
Sbjct  305   VREH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_010452709.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 236/355 (66%), Gaps = 6/355 (2%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPV-ANRKNLDPELAKAESNP  1090
              L ++ +LV +  P V++DD  PIPA KA+V+ WF +NV+P  A R  LDP L  AE++P
Sbjct  6     SLSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPALEAAEASP  65

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             + I V++ G GDF +I  A+ S+P  N  RVII +  G Y E+V ++  +PF+TL G P 
Sbjct  66    RIITVNQKGGGDFTSINAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPG  125

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGD  730
             A   + FH TS K GTV SAT+IV A YF A N++ILN+AP  +  T+G QA+A+  + D
Sbjct  126   AETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINAD  184

Query  729   MAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VI  559
              AA+YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI
Sbjct  185   KAAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVI  244

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVP  379
              A  R  + + +GYSFVHCK+TG   G +LGR WM+  +V+YAYTEM+  V P GW    
Sbjct  245   TAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENR  304

Query  378   GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
              + H   T ++GEY  TGPG+    R    + + ++E   F++LG+I+GS WLLP
Sbjct  305   VREH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|NP_196359.1| putative pectinesterase 49 [Arabidopsis thaliana]
 sp|Q9LY18.1|PME49_ARATH RecName: Full=Probable pectinesterase 49; Short=PE 49; AltName: 
Full=Pectin methylesterase 49; Short=AtPME49; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87931.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAM63813.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAO22596.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO50592.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED91155.1| putative pectinesterase 49 [Arabidopsis thaliana]
Length=361

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 240/355 (68%), Gaps = 6/355 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V +LV + SP V++DD  PIPA++A++  WF +NV+P + R+  LDPEL  AE++ +
Sbjct  6     LALVALLVFFASPVVLADDITPIPADRAQIPQWFMANVKPFSQRRGTLDPELEAAEASRR  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+++G GDF+TI  A+ S+P  N  RVII +  G Y E+V ++  +P++TL G P A
Sbjct  66    VIIVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTVDVGRPYVTLLGKPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +  T+ K GTV SAT+IV A  F A N+NI+N++P  +  T+G QA+A+  +GD 
Sbjct  126   ETNLTYAGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNC+ YGFQDT CDD G HFFK+CYIEGT DFIFG G +LYL T+LH + DG  VIA
Sbjct  185   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAVGDGLRVIA  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R +  E  GYSFVHCK+TG   G +LGR WM+  +V+Y+YTEM+  V P GW     
Sbjct  245   AHNRQSTTEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQENRV  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             + H   T ++GEY  TGPG+    R    + + ++E   F+TLG+I+GSKWLLPP
Sbjct  305   RAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEASQFLTLGYIKGSKWLLPP  358



>emb|CDX81050.1| BnaC03g03040D [Brassica napus]
Length=361

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/357 (48%), Positives = 240/357 (67%), Gaps = 6/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V  L+ + SP V++ D+ PIP +++++  WF +NV P + RK  LDP L  AE+  +
Sbjct  6     LTIVAFLIAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPALEAAETARQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G  +F+TI +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P +
Sbjct  66    IITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDVARPFVTLLGQPGS  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ + GTV SAT+IV +DYF A N+ I N+AP  +   +G QA+A+  +GD 
Sbjct  126   ETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y+CK YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQAR ++ E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEM+  V P GW     
Sbjct  245   AQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGWRENFN  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
             +  Y  T ++GEYK  G G+  + R  + + +   EV+PF+TLG+I+GS WLLPP K
Sbjct  305   R-GYDKTVFYGEYKCFGAGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSTWLLPPPK  360



>ref|XP_010666416.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 246/367 (67%), Gaps = 13/367 (4%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             +++N ++   +LV+       +     IP ++AEV +WF S ++P++  K  L+P + +A
Sbjct  3     IKLNVILASFLLVNIT---FTASAQTLIPESEAEVDTWFQSVIKPISELKGTLEPSILEA  59

Query  1101  ESN-PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             E+   + + V +DG G F+TI+DA+  V   NT+RVII+IG G Y E++ +E+ + +IT 
Sbjct  60    ENGGVETLDVRQDGSGKFKTISDAVKHVKVGNTKRVIITIGPGEYREKIQLERMQSYITF  119

Query  924   YG-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVA  748
             YG DP   P I F  T+ + G V SAT+IVE+DYF A N+ I NSAPR +G  KG+QA A
Sbjct  120   YGTDPKNRPTITFAGTAAEFGAVDSATLIVESDYFVAANLIISNSAPRPDGKKKGAQAAA  179

Query  747   LTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID  568
             +  SGD AA+YNCK  GFQ+T CDD+G HFFKDCY+EGT DFIFG  K+LYL+TELHVI 
Sbjct  180   IRISGDRAAFYNCKFTGFQNTICDDQGNHFFKDCYVEGTADFIFGEAKSLYLNTELHVIP  239

Query  567   G----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
             G    +IAA AR    ++ GYSFVHCK+TG      LG  W   +RV+Y+Y  + + +RP
Sbjct  240   GDGEAIIAAHARKDLDDEGGYSFVHCKVTGTGGNAILGTAWFQAARVVYSYCAIGDVIRP  299

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGR-PYFAKKLTDEEVKPFITLGFIEGSKW  223
              GW     +P Y  TTYFGEYKNTGPGA +  R PYF KKLTD EVKPFI+L FI+ +KW
Sbjct  300   EGWSD-NKQPEYQKTTYFGEYKNTGPGADIKKRVPYF-KKLTDIEVKPFISLEFIDAAKW  357

Query  222   LLPPIKL  202
             L+P  K+
Sbjct  358   LIPLPKI  364



>ref|XP_002871270.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47529.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 239/355 (67%), Gaps = 6/355 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             L +V +LV + SP V++DD  PIPA++A +  WF +NV+P + R+  LDP+L  AE++ +
Sbjct  6     LSLVALLVFFASPVVLADDITPIPADRALISQWFKANVKPFSQRRGTLDPDLEAAEASRR  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+++G GDF+TI  A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P A
Sbjct  66    VITVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTIDIGRPFVTLLGKPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +  T+ K GTV SAT+IV A  F A N+NI+N++P  +  T+G QA+A+  +GD 
Sbjct  126   ETNLTYDGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQG-QALAMRINGDK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNC+ YGFQDT CDD G HFFK+CYIEGT DFIFG G +LYL T+LH + DG  VIA
Sbjct  185   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAVGDGLRVIA  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R +  E  GYSFVHCK+TG   G +LGR WM+  +V+Y+YTEM+  V P GW     
Sbjct  245   AHNRQSTNEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQENRV  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             + H   T ++GEY  TGPG+    R    + + ++E   F+TLG+I+GSKWLLPP
Sbjct  305   RAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANQFLTLGYIKGSKWLLPP  358



>ref|XP_010423208.1| PREDICTED: probable pectinesterase 50 isoform X1 [Camelina sativa]
 ref|XP_010423209.1| PREDICTED: probable pectinesterase 50 isoform X2 [Camelina sativa]
Length=361

 Score =   348 bits (893),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 242/362 (67%), Gaps = 6/362 (2%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             M    + +V  LV + SP V++ D+ PIP N+A++  WF +NV+P + RK  LDP L  A
Sbjct  1     MGYMSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAA  60

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E++   I V++ G G+F+TI +A+ S+P  N  RVII +  G Y E+V ++  +PF+TL 
Sbjct  61    EASRLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFVTLL  120

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G   A   + +H T+ K GTV SAT+IV +DYF A N+ I N+AP  +  ++G QA+A+ 
Sbjct  121   GQLGAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQG-QALAMR  179

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG  565
              +GD AA+Y+CK YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG
Sbjct  180   INGDKAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDG  239

Query  564   --VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
               VI AQ+R +  E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEMT  V P GW
Sbjct  240   LRVITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW  299

Query  390   HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  +  Y  T ++GEYK  GPG+ +  R  + + +   EV+PFI+LG+I+GS WLLP 
Sbjct  300   RENFNR-KYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPA  358

Query  210   IK  205
              K
Sbjct  359   PK  360



>gb|AAX11261.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   347 bits (890),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 178/339 (53%), Positives = 227/339 (67%), Gaps = 7/339 (2%)
 Frame = -1

Query  1200  PIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP-KHIRVSKDGKGDFETITDALAS  1024
             PIP N AE++SWF   V+PV+ +K L+P + +AES   + I V +DG G F+TI+DA+  
Sbjct  2     PIPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGTVHSAT  847
             V   NT+RVII+IG G Y E+V IE   P+ITLYG DP   P I F  T+ + GTV SAT
Sbjct  62    VKVGNTKRVIITIGPGEYREKVKIEGLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  846   VIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEG  667
             +IVE+DYF   N+ + NSAPR  G  KG+QA AL  SGD AA+YNCK  GFQDT CDD+G
Sbjct  122   LIVESDYFVGANLIVSNSAPRPAGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  666   RHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCK  499
              H FKDCYIEGTVD IFG  ++LYL+TELHV+ G    +I A AR       GYSFVHCK
Sbjct  182   NHLFKDCYIEGTVDLIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  498   ITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPG  319
             +TG      LGR W   +RV+++Y  +++AV+P GW     KP    T +FGEYKNTGPG
Sbjct  242   VTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPG  300

Query  318   AKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             A  D R  + K+LT+ + K F +L +IE +KWL PP K+
Sbjct  301   AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLPPPPKV  339



>ref|XP_008228727.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=353

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 224/334 (67%), Gaps = 6/334 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPKHI  1081
             + + L+   +   V+DD  P+PA+ ++V +WF++NV     ++  LD  L  AE     +
Sbjct  14    LTVTLILLTATIAVADDDTPVPADHSQVNTWFNNNVNSYKEQQGMLDHALVTAEVGQTIV  73

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
             +V KDG G+F+TITD + S+P DNT+RVI+ IGGG Y E++ I +  PF+T YG P   P
Sbjct  74    KVMKDGSGEFKTITDVINSIPADNTKRVIMYIGGGEYNEKITIPRNIPFVTFYGSPTNMP  133

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + F  T+ K GTV SATVI E+DYF A N+ I NS+PR +G   G QA+AL  SG+ +A
Sbjct  134   TLTFAGTTQKYGTVDSATVIAESDYFVAANLIIKNSSPRPDGKKVGEQALALRVSGNKSA  193

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
              +NCKL GFQDT CDD+G HFFKDC+IEGTVDFIFG+GK+LYL+TELHV+      VI A
Sbjct  194   LFNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEMTVITA  253

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
             QAR +  EDTGYSFVHC ITG   G +LGR W    RV++AYT M E + P GW+    +
Sbjct  254   QARDSALEDTGYSFVHCNITGTGNGTYLGRAWRTSPRVVFAYTSMFEVITPAGWNN-KNR  312

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDE  271
             P    T ++GEYK +GPG+ M GR  + K+L +E
Sbjct  313   PERDSTVFYGEYKCSGPGSSMVGRVKYTKQLNEE  346



>ref|XP_004140273.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 241/358 (67%), Gaps = 10/358 (3%)
 Frame = -1

Query  1260  IMVIVLVHYLSP--GVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKAESN  1093
             + +  LV +L+    +++  S  +P +KA++++WFS NV+P A  N+  LDP +  AE N
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  1092  PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP  913
                ++V  DG GDF+T+T+A+ASVP +N  RV+I IG G Y E++ IEK KPFITL G P
Sbjct  64    VTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
                P + F   ++K GTV+SAT+IVEADYF A N+ I N++PR  G  K +QA+A    G
Sbjct  124   KNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----G  565
               +A+YNCK  GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+TEL+V+      
Sbjct  183   TKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
             VI A +R    + +GYSFVHC ITG  +  +LGR WM  SRVI+AYT M + + P GW+ 
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWND  302

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +     +  T  FGEYK +GPG+   GR  + K+LT+ EVKP+++L F++ +KWLLPP
Sbjct  303   MK-HAGFDKTVMFGEYKCSGPGSVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  359



>ref|XP_006280767.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
 gb|EOA13665.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
Length=338

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 238/354 (67%), Gaps = 29/354 (8%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPKH  1084
             LI+ I+LV   SP V  +D+ PIP NK  ++ WF++NV+                     
Sbjct  8     LIVTILLVVITSPVVFGNDAAPIPQNKGRIEQWFNTNVK---------------------  46

Query  1083  IRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDAT  904
                 ++G+G F+TIT+A+ SV E NT+RVII +G G Y E+V I++ KPFITLYG P+A 
Sbjct  47    ----QNGRGHFKTITEAIKSVGEGNTRRVIIKVGPGVYKEKVTIDRSKPFITLYGHPNAM  102

Query  903   PFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMA  724
             P + +  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+ A
Sbjct  103   PVLTYDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKKKGAQALSMRISGNKA  162

Query  723   AYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAA  553
             A+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VIAA
Sbjct  163   AFYNCKFYGYQDTVCDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVIAA  222

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
             QA  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW     +
Sbjct  223   QAGKSAEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQE-NRE  281

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                  T ++GEYK +GPG+  + R  + + + D E   FI+LG+I+GS WLLPP
Sbjct  282   TERDKTVFYGEYKCSGPGSHKEKRVKYTQDIDDIEANYFISLGYIQGSSWLLPP  335



>ref|NP_196360.1| putative pectinesterase 50 [Arabidopsis thaliana]
 sp|Q9LY17.1|PME50_ARATH RecName: Full=Probable pectinesterase 50; Short=PE 50; AltName: 
Full=Pectin methylesterase 50; Short=AtPME50; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87932.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AED91156.1| putative pectinesterase 50 [Arabidopsis thaliana]
Length=361

 Score =   345 bits (885),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 240/357 (67%), Gaps = 6/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             + +V  LV + SP V++ D+ PIP N+A++  WF +NV+P + RK  LDP L  AE+  +
Sbjct  6     MSVVAFLVVFASPVVLATDTDPIPENRAQIPQWFKTNVKPYSQRKGTLDPALEAAEAARQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G  +F+T+ +A+ S+P  N  RVII +  G Y E+V I+  +PFITL G P A
Sbjct  66    IITVNQKGGANFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFITLLGQPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ + GTV SAT+IV A+YF A ++ I N+AP  +  ++G QA+A+  + D 
Sbjct  126   ETVLTYHGTAAQYGTVESATLIVWAEYFQAAHLTIKNTAPMPKPGSQG-QALAMRINADK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y+C+ +GFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQ R +  E  GY+FVHCK+TG   G +LGR WM+  +V+YA+TEMT  V P GW     
Sbjct  245   AQGRQSATEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENLN  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
             +  Y  T ++GEYK  GPG+ ++ R  + + +   EV PF+TLG+I+GS WLLPP K
Sbjct  305   R-GYDKTVFYGEYKCFGPGSHLEKRVPYTQDIDKNEVTPFLTLGYIKGSTWLLPPPK  360



>gb|KGN48071.1| hypothetical protein Csa_6G428040 [Cucumis sativus]
Length=339

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 230/335 (69%), Gaps = 8/335 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVA--NRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALAS  1024
             +P +K ++++WFS NV+P A  N+  LDP +  AE N   ++V  DG GDF+TIT+A+AS
Sbjct  2     VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  61

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATV  844
             VP +N  RV+I IG G Y E++ IEK KPFITL G P   P ++F   ++K GTV+SAT+
Sbjct  62    VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  121

Query  843   IVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGR  664
             IVEADYF A N+ I N++PR  G  K +QA+A    G  +A+YNCK  GFQDT CDD+G 
Sbjct  122   IVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGL  180

Query  663   HFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----GVIAAQARHTNKEDTGYSFVHCKI  496
             H +KDC+I+GTVDF+FG G +LYL+TEL+V+      VI A +R    + +GYSFVHC I
Sbjct  181   HLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSI  240

Query  495   TGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGA  316
             TG  +  +LGR WM  SRVI+AYT M + + P GW+ +     +  T  FGEYK +GPGA
Sbjct  241   TGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK-HAGFDKTVMFGEYKCSGPGA  299

Query  315   KMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                GR  + K+LT+ EVKP+++L F++ +KWLLPP
Sbjct  300   VSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  334



>ref|XP_002871271.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47530.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 240/357 (67%), Gaps = 6/357 (2%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPK  1087
             + +V  LV + SP V++ D+ PIP  +A++  WF +NV+P + RK  LDP L  AE+  +
Sbjct  6     MSVVAFLVVFASPLVLATDTDPIPETRAQIPQWFKANVKPYSQRKGTLDPALEAAEAARQ  65

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V++ G  +F+TI +A+ S+P  N  RVII +  G Y E+V I+  +PF+TL G P A
Sbjct  66    IITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGA  125

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +H T+ K GTV SAT+IV A+YF A ++ I N+AP  +  ++G QA+A+  + D 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWAEYFLAAHLTIKNTAPMPKPGSQG-QALAMRINADK  184

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y+C+ +GFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI 
Sbjct  185   AAFYSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVIT  244

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQ R +  E  GY+FVHCK+TG   G +LGR WM+  +V+YA+TEMT  V P GW     
Sbjct  245   AQGRQSANEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENLN  304

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
             +  Y  T ++GEYK  GPG+ ++ R  + + +   EV+PF++LG+I+GS WLLPP K
Sbjct  305   R-GYDKTVFYGEYKCFGPGSHLEKRVPYTQDIDQNEVRPFLSLGYIKGSTWLLPPPK  360



>ref|XP_009125689.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
 emb|CDY55180.1| BnaAnng13710D [Brassica napus]
Length=361

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 240/355 (68%), Gaps = 6/355 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHI  1081
             +V  +V ++ P V++ D+ PIP  +A++  WF +NV P + RK  LDP L  AE+    +
Sbjct  8     IVAFIVAFILPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
              V++ G  +F++I +A+ S+P  N +RVII +  G YTE+V ++  +PF+TL G P +  
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + +H T+ + GTV SAT+I+ +DYF A N+ I N++P  +  ++G QA+A+  +GD AA
Sbjct  128   VLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDYAA  186

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQ  550
             +Y C  YGFQDT CDD+G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI AQ
Sbjct  187   FYTCSFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAVGDGLRVITAQ  246

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
             +R +N E  GY+FVHCKITG   G +LGR WM+  +VIYA+TEMT  V P GW     + 
Sbjct  247   SRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENFNR-  305

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
              Y  T ++GEYK  GPG+  + R  + + +   EV+PF+TLG+I+GSKWLLPP K
Sbjct  306   AYDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSKWLLPPPK  360



>emb|CDY14045.1| BnaC02g01620D [Brassica napus]
Length=361

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 239/355 (67%), Gaps = 6/355 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHI  1081
             +V  +V ++ P V++ D+ PIP  +A++  WF +NV P + RK  LDP L  AE+    +
Sbjct  8     IVAFIVAFVLPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATP  901
              V++ G  +F++I +A+ S+P  N +RVII +  G YTE+V ++  +PF+TL G P +  
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              + +H T+ + GTV SAT+IV +DYF A N+ I N++P  +  ++G QA+A+  +GD AA
Sbjct  128   VLTYHGTAAQYGTVESATLIVWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDYAA  186

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAAQ  550
             +Y C  YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI AQ
Sbjct  187   FYTCSFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAVGDGLRVITAQ  246

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
             +R +N E  GY+FVHCKITG   G +LGR WM+  +V+YA+TEMT  V P GW     + 
Sbjct  247   SRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENFNR-  305

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
              Y  T ++GEYK  GPG+  + R  + + +   EV+PF+TLG+I+GSKWLLPP K
Sbjct  306   AYDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSKWLLPPPK  360



>ref|XP_008449623.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=369

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/340 (51%), Positives = 233/340 (69%), Gaps = 16/340 (5%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKN--LDPELAKAESNPKHIRVSKDGKGDFETITDALAS  1024
             IP  K+++  W+  NV+   NR    LDPEL  AE +   I+V  DG GDF+TI +A+ S
Sbjct  30    IPTEKSQLDEWYWENVKAFGNRNKAELDPELVAAEESATVIKVRGDGSGDFKTIAEAIES  89

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATV  844
             VP  NT+R++I IGGG Y E++ I++ KPF+TLYG P+  P + F   ++K GTV+SAT+
Sbjct  90    VPIGNTKRIVIWIGGGVYKEKLKIDRNKPFVTLYGSPNNMPNLTFDGDASKYGTVYSATL  149

Query  843   IVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGR  664
             IVEADYFTA N+ I NS+PR +G  KG+QA+A    G+ AA YNCK  GFQDT CDD+G 
Sbjct  150   IVEADYFTAANLVIENSSPRPDGVRKGAQALAARIRGNKAAIYNCKFIGFQDTLCDDDGL  209

Query  663   HFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----GVIAAQARHTNKEDTGYSFVHCKI  496
             H +KDC+I+GTVDFIFG G +LYL+T+L V+     GVIAA +R    + +GYSFVHC I
Sbjct  210   HLYKDCFIQGTVDFIFGKGTSLYLNTQLDVVGNGGLGVIAAHSRDQESDGSGYSFVHCSI  269

Query  495   TGPRQGG---FLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYG--GTTYFGEYKN  331
             TG   GG   +LGR W   SRV++AYT M + + P GW+ +    H+G   T  FGEYK 
Sbjct  270   TG--TGGRNTYLGRAWRPRSRVVFAYTTMADIIHPEGWNDM---NHFGYDKTVLFGEYKC  324

Query  330   TGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              GPG+K   R  ++K+L+ EEV+PF++LG+++  KWLLPP
Sbjct  325   WGPGSKSSERVKYSKQLSYEEVEPFVSLGYVQSEKWLLPP  364



>ref|XP_008242288.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=370

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 227/352 (64%), Gaps = 11/352 (3%)
 Frame = -1

Query  1230  SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK------NLDPELAKAESNPKHIRVSK  1069
             SP +V      IP + +++ +W   N+   ANRK        D +L  AE   K I V K
Sbjct  21    SPQLVLTHPNLIPPHLSQLDTWIVHNIRDYANRKATQATLRFDSKLLSAEYAVKIITVKK  80

Query  1068  DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINF  889
             DG GDF+T+TDA+ S+P  NT+RV++ I GG Y E+++++  +PF+T YGD +  P I F
Sbjct  81    DGTGDFKTVTDAVNSIPSWNTRRVVVFIRGGEYREKILVDASRPFVTFYGDKNDVPSITF  140

Query  888   HKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNC  709
               T+ K GT  SATV V+ADYF A+NI  +NSAP  +G   G+QAVA+  SGD AA++NC
Sbjct  141   DGTALKYGTWDSATVAVDADYFVAVNIAFVNSAPMPDGNRPGAQAVAMRISGDKAAFHNC  200

Query  708   KLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHT  538
             +  GFQDT CDD GRHFFKDCYI+GTVDFIFGNGK+LYL+  +H +    GVI A AR  
Sbjct  201   RFIGFQDTLCDDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSVANGMGVITAHARED  260

Query  537   NKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGG  358
               +D+G++FVHC ITG     FLGR W   +RV++AYT M   +   GW           
Sbjct  261   AADDSGFAFVHCNITGTGD-TFLGRAWRDRARVVFAYTNMGSLINSQGWSDAM-HSERDK  318

Query  357   TTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             T Y+GEYK  GPG+   GR  +AK L+DEE KPF+++ FI G+KW+LPP KL
Sbjct  319   TVYYGEYKCMGPGSSSTGRVKYAKMLSDEEAKPFLSMTFIRGTKWVLPPPKL  370



>ref|XP_011039979.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   343 bits (879),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 236/367 (64%), Gaps = 15/367 (4%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPE  1114
             L+++ +    + P  +S   + +PA+ ++VK+W + N+    +RK+          LD  
Sbjct  10    LLLITLQAIQIIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             LA AE   + IRV+KDG  DF TI+DAL ++ +DN +R+II IGGG Y E++ I+  KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPF  128

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +T YGDP   P I F+ T+++ GT++SATV VE+DYF A+N+  +NSAP       G QA
Sbjct  129   VTFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQA  188

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VA+  SGD AA++NCK  GFQDT CDD GRHFFKDCY+ GTVDFIFGNGK+LYL+T +  
Sbjct  189   VAMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIAS  248

Query  573   I---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
             +    GVI AQAR    ED+G++F+HC +TG     +LGR W    RV++AYT M   + 
Sbjct  249   VAEGTGVITAQAREHVTEDSGFTFIHCNLTGFGNDTYLGRAWKQRPRVVFAYTYMGHLIN  308

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
               GW      P   GT Y+GEYK  GPG+   GR  +AK L+  E KPF+++ +I G+KW
Sbjct  309   DEGW-STWKFPEREGTVYYGEYKCAGPGSSSFGRVSYAKSLSKAEAKPFLSMTYINGNKW  367

Query  222   LLPPIKL  202
             L+PP K 
Sbjct  368   LIPPPKF  374



>ref|XP_007204919.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
 gb|EMJ06118.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
Length=350

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 234/359 (65%), Gaps = 28/359 (8%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAES  1096
             V+  + + +L+   +   V+DD  P+PA+ ++V +WF++NV P   R+  LDP L   E 
Sbjct  10    VHAALTMTLLILPTAIIAVADDDTPVPADHSQVNTWFNNNVNPYKERQGTLDPTLVTDEV  69

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
                 I+V KDG G+F+TITDA+ S+P +NT+ VI+ IGGG Y E++ I + KPFIT YG 
Sbjct  70    GQTVIKVMKDGSGEFKTITDAVNSIPTNNTKHVIVYIGGGEYNEKITIPRNKPFITFYGS  129

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             P   P + F  T+ K GTV SATVIVE+DYF A N  I              +A+AL   
Sbjct  130   PTNMPTLTFAGTAQKYGTVDSATVIVESDYFVAANFII--------------KALALRVL  175

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             G+ +A +NC+L GFQDT CDD+G +FFKDC+IEGTVDFIFG+GK+LYL+TELHV+     
Sbjct  176   GNKSALFNCRLIGFQDTLCDDKGNYFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEM  235

Query  564   -VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
              VI  QAR +  EDTGYSF++C ITG   G +LGR W    RV++AYT M+E +   GW+
Sbjct  236   TVITTQARDSASEDTGYSFLYCNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITSAGWN  295

Query  387   GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                 +P         +YK +GPG+ M GR  + K+L +E++KPF++L +I+GSKWLLPP
Sbjct  296   D-KNRPE--------QYKCSGPGSSMVGRVKYTKQLNEEQIKPFLSLSYIQGSKWLLPP  345



>gb|AAT99258.1| pectin-methyltransferase precursor [Salsola kali]
Length=362

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/338 (52%), Positives = 225/338 (67%), Gaps = 7/338 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNP-KHIRVSKDGKGDFETITDALASV  1021
             IP N AE++SWF   V+PV+ +K L+P + + ES   + I V +DG G F+TI+DA+  V
Sbjct  26    IPPNPAELESWFQGAVKPVSEQKGLEPSVVQTESGGVETIEVRQDGSGKFKTISDAVKHV  85

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGTVHSATV  844
                NT+RVII+IG G Y E+V IE+  P+ITLYG DP   P I F  T+ + GTV SATV
Sbjct  86    KVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSATV  145

Query  843   IVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGR  664
             IVE+DY    ++ + NSAPR +G  KG+QA AL  SGD AA+YNCK  GFQDT CDD+G 
Sbjct  146   IVESDYSVGAHLIVTNSAPRPDGKRKGAQAGALRISGDRAAFYNCKFTGFQDTVCDDKGN  205

Query  663   HFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKI  496
             HFF DCY EGTVDFIFG  ++LYL+TELHV+ G    +I A AR       GYSFVHCK+
Sbjct  206   HFFTDCYTEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCKV  265

Query  495   TGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGA  316
             TG      LGR W   +RV+++Y  +++A +P GW     KP    T  FGEYKNTGPGA
Sbjct  266   TGTGGTALLGRAWFDAARVVFSYCNLSDAAKPEGWSD-NNKPEAQKTILFGEYKNTGPGA  324

Query  315   KMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               D R  + K+LT+ + K F +L +IE +KWLLPP K+
Sbjct  325   APDKRAPYTKQLTEADAKTFTSLEYIEAAKWLLPPPKV  362



>ref|XP_006381567.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
 gb|ERP59364.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
Length=375

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 171/367 (47%), Positives = 234/367 (64%), Gaps = 15/367 (4%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPE  1114
             L+++ +      P  +S   + +PA+ ++VK+W + N+    +RK+          LD  
Sbjct  10    LLLITLQAIQTIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             LA AE   + IRV+KDG  DF TI+DAL ++P+DN +R II IGGG Y E++ I+  KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIPKDNKRRTIIQIGGGEYWEKITIKCNKPF  128

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             IT YGDP   P I F+ T+++ GT++SATV VE+DYF A+N+  +NSAP       G QA
Sbjct  129   ITFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPLPNVNRTGGQA  188

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             V++  SGD AA++NCK  GFQDT CDD GRHFFKDCY+ GTVDFIFGNGK+LYL+T +  
Sbjct  189   VSMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIDS  248

Query  573   I---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
             +    GVI AQAR    ED+G++F+HC +TG     +LGR W    RV++AYT M   + 
Sbjct  249   VAEGTGVITAQAREHVTEDSGFTFIHCNLTGLGNNTYLGRAWKQRPRVVFAYTYMGHLIN  308

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
               GW      P   GT Y+GEYK  GPG+   GR  + K L+  E KPF+++ +I G+KW
Sbjct  309   DEGW-STWKFPEREGTVYYGEYKCAGPGSSSFGRVPYTKSLSKAEAKPFLSMTYINGNKW  367

Query  222   LLPPIKL  202
             L+PP K 
Sbjct  368   LIPPPKF  374



>ref|XP_002866448.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42707.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 234/355 (66%), Gaps = 29/355 (8%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              LI+ I+LV   SP V  +D+ PIP NK  ++ WF++NV+                    
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVK--------------------  46

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
                  ++G+G F+TIT+A+ SV   NT+RVII IG G Y E+V I++ KPFITLYG P+A
Sbjct  47    -----QNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRNKPFITLYGHPNA  101

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+ 
Sbjct  102   MPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI 
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVIT  221

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  +  E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW     
Sbjct  222   AHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQE-NR  280

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +     T ++GEYK TG G+  + R  + + + D E K FI+LG+I+GS WLLPP
Sbjct  281   EAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDVEAKYFISLGYIQGSSWLLPP  335



>ref|XP_011016271.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/367 (46%), Positives = 235/367 (64%), Gaps = 15/367 (4%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPE  1114
             L+++ +    + P  +S   + +PA+ ++VK+W + N+    +RK+          LD  
Sbjct  10    LLLITLQAIQIIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             LA AE   + IRV+KDG  DF TI+DAL ++ +DN +R+II IGGG Y E++ I+  KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPF  128

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +T YGDP   P I F+ T+++ GT++SATV VE+DYF A+N+  +NSAP       G QA
Sbjct  129   VTFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQA  188

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VA+  SGD AA++NCK  GFQDT CDD GRHFFKDCY+ GTVDFIFGNGK+LYL+T +  
Sbjct  189   VAMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIAS  248

Query  573   I---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
             +    GVI AQAR    ED+G++F+HC +TG     +LGR W     V++AYT M   + 
Sbjct  249   VAEGTGVITAQAREHVTEDSGFTFIHCNLTGFGNDTYLGRAWKQRPSVVFAYTYMGHLIN  308

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
               GW      P   GT Y+GEYK  GPG+   GR  +AK L+  E KPF+++ +I G+KW
Sbjct  309   DEGW-STWKFPEREGTVYYGEYKCAGPGSSSFGRVSYAKSLSKAEAKPFLSMTYINGNKW  367

Query  222   LLPPIKL  202
             L+PP K 
Sbjct  368   LIPPPKF  374



>ref|NP_200976.1| putative pectinesterase 63 [Arabidopsis thaliana]
 sp|Q9FKF3.2|PME63_ARATH RecName: Full=Putative pectinesterase 63; Short=PE 63; AltName: 
Full=Pectin methylesterase 63; Short=AtPME63; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97505.1| putative pectinesterase 63 [Arabidopsis thaliana]
Length=338

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 234/355 (66%), Gaps = 29/355 (8%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              LI+ I+LV   SP V  +D+ PIP NK  ++ WF++NV+                    
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVK--------------------  46

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
                  ++G+G F+TIT+A+ SV   NT+RVII IG G Y E+V I++ KPFITLYG P+A
Sbjct  47    -----QNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFITLYGHPNA  101

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV SAT+IV +DYF A+NI + NSAP  +G  KG+QA+++  SG+ 
Sbjct  102   MPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQALSMRISGNK  161

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI 
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVIT  221

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  +  E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW     
Sbjct  222   AHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVVNPSGWQE-NR  280

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +     T ++GEYK TG G+  + R  + + + D E K FI+LG+I+GS WLLPP
Sbjct  281   EAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDIEAKYFISLGYIQGSSWLLPP  335



>ref|XP_010666417.1| PREDICTED: putative pectinesterase 63 [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 235/358 (66%), Gaps = 10/358 (3%)
 Frame = -1

Query  1251  IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESN-PKHIR  1078
             IVL  +       D    IP N AEV++WF++ V+P++  K  L+P + +AE+   + I 
Sbjct  7     IVLASFFLVIFRIDAQTLIPENPAEVETWFNNVVKPISQVKGALEPSVIEAENGGVETID  66

Query  1077  VSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATP  901
             V +DG G F+TI DA+  V   N +RVII+IG G Y E+V IE+ + +IT YG DP   P
Sbjct  67    VRQDGSGKFKTIADAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFYGTDPKNRP  126

Query  900   FINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
              I F  T+ + GTV SAT+IVE+DYF A N+ I NSAPR +G TKG QA A+  SGD +A
Sbjct  127   TITFAGTAAQYGTVDSATLIVESDYFVAANLIISNSAPRPDGKTKGGQAAAIRISGDRSA  186

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAA  553
             +YNCK  GFQDT CDD+G HFFKDCYIEGTVDFIFG  +++YL+TELHVI G    +I A
Sbjct  187   FYNCKFTGFQDTVCDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPGDLEAMITA  246

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
              AR       GYSFVHCK+TG      LGR W A +RV+Y++ +++  +RP GW     K
Sbjct  247   HARGNQDGVGGYSFVHCKVTGTGSYAVLGRAWFAAARVVYSFCDISNVIRPEGWSD-NKK  305

Query  372   PHYGGTTYFGEYKNTGPGAKMDGR-PYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
               Y  T YFGEYKN G GA +  R PYF K LTD E K FI++ +I+ +KWLLPP K+
Sbjct  306   AAYQTTVYFGEYKNKGTGADIKKRVPYF-KNLTDLEAKQFISMEYIDAAKWLLPPPKV  362



>gb|KFK25127.1| hypothetical protein AALP_AA8G069600 [Arabis alpina]
Length=363

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 237/355 (67%), Gaps = 8/355 (2%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN---LDPELAKAESNPK  1087
             MV  L+ +  P V++DD  PIPA+KA+V+ WF ++V+P + R+    LDP L  AE  P+
Sbjct  8     MVAFLIVFAFPVVLADDVTPIPADKAQVEPWFKTHVKPFSVRRGRGILDPALEAAEVAPR  67

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I V+  G G+F++I +A+ S+P  NT+RVII +  G Y E+V I+  +PF+TL G P A
Sbjct  68    TITVNPKGGGNFKSINEAIKSIPTGNTKRVIIKLAPGVYHEKVTIDVGRPFVTLLGKPGA  127

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
                + +  T+ K GTV SAT+IV A  F A N+NI+N+ P  +  T+G QA+A+  +GD 
Sbjct  128   ETNLTYDGTAAKFGTVESATLIVWATNFIAANLNIINTNPMPKAGTQG-QALAMRINGDK  186

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+Y C+ YGFQDT CDD G HFFK CYIEGT DFIFG G +LYL+T LH + DG  VI 
Sbjct  187   AAFYRCRFYGFQDTLCDDRGNHFFKGCYIEGTYDFIFGRGASLYLNTHLHAVGDGLRVIT  246

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A  R +N E +GY+FVHCK+TG   G +LGR WM+  +V+YAYTEM+  V P GW     
Sbjct  247   AHNRQSNNEQSGYAFVHCKVTGVGTGIYLGRSWMSHPKVVYAYTEMSSVVNPSGWAENRQ  306

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             + H   T ++GEY+  GPG++ + R    +++ ++E   F++LG+I+GS WLLPP
Sbjct  307   RAH-DKTVFYGEYQCKGPGSQKEKRVAHTQEIDNKEANHFLSLGYIKGSSWLLPP  360



>ref|XP_008391732.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=365

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 223/341 (65%), Gaps = 11/341 (3%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRK------NLDPELAKAESNPKHIRVSKDGKGDFETITD  1036
             IP N +++ SW   N+   ANRK        D +L  AE   + I V KDG G F T+TD
Sbjct  27    IPPNFSQLDSWIXHNMRDYANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTD  86

Query  1035  ALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVH  856
             A+ S+P  NT+RV++ IGGG YTE+V+++  KPF+T YGD +  P I F  T+ K GT +
Sbjct  87    AVNSIPSGNTRRVVVFIGGGVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  146

Query  855   SATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCD  676
             S+TV VE+DYF A+NI  +NSAP  +G   G+QAVA+  SGD AA++NC+  GFQDT  D
Sbjct  147   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  206

Query  675   DEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVH  505
             D GRHFFKDC+++GTVDFIFGNGK+LYL+  +H +    GVI A AR   ++D+G++FVH
Sbjct  207   DRGRHFFKDCHVQGTVDFIFGNGKSLYLNNTIHSVANGMGVITAHARENVEDDSGFAFVH  266

Query  504   CKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTG  325
             C ITG     FLGR W    RV++AY  M   +   GW           T Y+GEYK  G
Sbjct  267   CNITGTGD-TFLGRAWRERPRVVFAYAYMGSLINKQGWSDYM-HTERDKTVYYGEYKCMG  324

Query  324   PGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             PG+   GR  +A+ L+DEE KPF++L FI+G+KW+LPP KL
Sbjct  325   PGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPKL  365



>ref|XP_010667524.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 228/339 (67%), Gaps = 8/339 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPV-ANRKNLDPELAKAESN-PKHIRVSKDGKGDFETITDALAS  1024
             IPAN AEV+ WF S V+P+ A +  L+P +  AE    + + V +DGKG F+TI+DA+  
Sbjct  27    IPANAAEVERWFQSVVKPISAAKGTLEPSVIAAEDGGVETLDVRQDGKGKFKTISDAVKH  86

Query  1023  VPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGTVHSAT  847
             V   N +RVII IG G Y E++ IE+ + +IT YG DP   P I F  T+ + GTV SAT
Sbjct  87    VKVGNKKRVIIKIGPGEYREKIKIERFQSYITFYGTDPKNRPTITFAGTAAQYGTVDSAT  146

Query  846   VIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEG  667
             +IVE+DYF A NI I NSAPR +G  KG+QA A+  SGD +A+YNCK  GFQDT CDD+G
Sbjct  147   LIVESDYFVAANIIISNSAPRPDGKKKGAQAAAIRISGDRSAFYNCKFVGFQDTVCDDKG  206

Query  666   RHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCK  499
             +HFFKDCYIEGTVDFIFG  ++LYL+TELHVI G    +I A AR     + GYSFVHCK
Sbjct  207   KHFFKDCYIEGTVDFIFGEARSLYLNTELHVIPGDREAMIVAHARKNQDGEGGYSFVHCK  266

Query  498   ITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPG  319
             +TG      LGR W   +R ++AY+ +++ ++P GW     +     T +FGEY NTGPG
Sbjct  267   VTGTGGHAVLGRAWFDAARSVFAYSTISDVIKPEGWSDNRNQ-KCQKTVFFGEYANTGPG  325

Query  318   AKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             A +  R  ++KKLT  E K FI+L +I+ +KWLLPP ++
Sbjct  326   ADLKRRVPYSKKLTAAEAKQFISLEYIDAAKWLLPPPRV  364



>ref|XP_009343360.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=366

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 224/341 (66%), Gaps = 11/341 (3%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRK------NLDPELAKAESNPKHIRVSKDGKGDFETITD  1036
             IP N +++ SW + N+    NRK        D +L  AE   + I V KDG G F T+TD
Sbjct  28    IPPNFSQLDSWIAHNMRGYTNRKATQATLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTD  87

Query  1035  ALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVH  856
             A+ S+P  NT+RV++ IGGG YTE+++++  KPF+T YGD +  P I F  T+ K GT +
Sbjct  88    AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  855   SATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCD  676
             S+TV VE+DYF A+NI  +NSAP  +G   G+QAVA+  SGD AA++NC+  GFQDT  D
Sbjct  148   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  675   DEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVH  505
             D GRHFFKDC+I+GTVDFIFGNGK+LYL+  +H +    GVI A AR   ++D+G++FVH
Sbjct  208   DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNTIHSVANGMGVITAHARANVEDDSGFAFVH  267

Query  504   CKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTG  325
             C ITG     FLGR W    RV++AYT M   +   GW           T Y+GEYK  G
Sbjct  268   CNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGWSDYM-HTERDKTVYYGEYKCMG  325

Query  324   PGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             PG+   GR  +A+ L+DEE KPF++L FI+G+KW+LPP KL
Sbjct  326   PGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPKL  366



>gb|KHN47850.1| Putative pectinesterase 63 [Glycine soja]
Length=300

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 208/295 (71%), Gaps = 9/295 (3%)
 Frame = -1

Query  1071  KDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFIN  892
             +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF+TLYG P+  P + 
Sbjct  2     QDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLT  61

Query  891   FHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYN  712
             F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QAVAL  SGD AA+YN
Sbjct  62    FGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYN  121

Query  711   CKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLY----LDTELHVIDG----VIA  556
             CK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY    + TEL  +      VI 
Sbjct  122   CKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVVSKISTELRTLGDNGITVIV  181

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M++ V  LGW     
Sbjct  182   AQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSN-NN  240

Query  375   KPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              P +  T  FGEY+N+GPGA   GR    K+L++ EVKP+ITL  IEGSKWLLPP
Sbjct  241   HPEHDKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSKWLLPP  295



>gb|KHN15646.1| Putative pectinesterase 63 [Glycine soja]
Length=296

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 207/291 (71%), Gaps = 5/291 (2%)
 Frame = -1

Query  1071  KDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFIN  892
             +DG G+F+TITDA+ SVP  NT+RVI+ IG GNY E++ IE+ KPF+TLYG P+  P + 
Sbjct  2     QDGSGEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLT  61

Query  891   FHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYN  712
             F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QAVAL  SGD AA+YN
Sbjct  62    FGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYN  121

Query  711   CKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQAR  544
             CK++GFQDT CDD  +HFFKDC I+GT+D+IFG+GK+LY+ TEL  +      VI AQAR
Sbjct  122   CKMFGFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQAR  181

Query  543   HTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHY  364
              +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M+  V  LGW      P +
Sbjct  182   KSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIVNKLGWSN-NNHPEH  240

Query  363   GGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               T  FGEY+NTGPGA   GR    K+L++ EVKP+ITL  IEGSKWLLPP
Sbjct  241   DKTVRFGEYQNTGPGADPKGRAPITKQLSETEVKPYITLAMIEGSKWLLPP  291



>ref|XP_002277518.1| PREDICTED: putative pectinesterase 63 isoform X2 [Vitis vinifera]
Length=379

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 237/380 (62%), Gaps = 23/380 (6%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR---  1132
             M  K M    V  L++    + ++ P VVSD +  IP++ +++ +W ++N+     R   
Sbjct  3     MPEKTMHLGAVTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWE  61

Query  1131  ------KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNY  970
                    +LDP L  AE+    I+V KDG GDF+TITDAL S+P+ N +R +I IGGG Y
Sbjct  62    SKKGLHSSLDPILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEY  121

Query  969   TERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSA  790
              E++ I++ KPFITLYG     P I +  T+ K GTV SATV VE+DYF A+NI  +NSA
Sbjct  122   WEKITIDRSKPFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSA  181

Query  789   PRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGN  610
             P  +G   G+QAVA+  SGD AA++NC   GFQDT CDD GRHFFKDC I+GTVDFIFG+
Sbjct  182   PMPDGKRVGAQAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGD  241

Query  609   GKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRV  439
             GK+LYL+T +  +    GVI AQAR    + +G++FVHC I+G     +LGR W    RV
Sbjct  242   GKSLYLNTMIQSVAKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLRPRV  300

Query  438   IYAYTEMTEAVRPLGW----HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDE  271
             ++AYT M   +   GW    H    K     T Y+GEY   GPGA   GR  FAK LT E
Sbjct  301   VFAYTYMGTLINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLLTGE  355

Query  270   EVKPFITLGFIEGSKWLLPP  211
             E KPF+++ +I G+KWLLPP
Sbjct  356   EAKPFLSMTYINGNKWLLPP  375



>ref|XP_004289004.1| PREDICTED: pectinesterase PPME1-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 233/367 (63%), Gaps = 18/367 (5%)
 Frame = -1

Query  1254  VIVLVHYLSPGV-VSDDSIPIPANKAEVKSWFSSNVEPVANRK------------NLDPE  1114
             V+V+  +L+  + VS     IP N+A++  W   N+     RK            + D E
Sbjct  9     VLVVSAFLTLALLVSGKPNLIPENEADLDDWIVRNMREYDKRKAVLNTRSDVPGTHFDTE  68

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             LA AE   + IRV KDG GDF+T+TDA+ S+P  N +RV++ IGGG Y E++++E  KPF
Sbjct  69    LAAAEDAGRVIRVKKDGTGDFKTVTDAVKSIPTGNKRRVVVWIGGGEYREKILVEMTKPF  128

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +T YGD +  P I +  T+   GT +SATV VE+DYF A+NI  +NSAP  +G  K +QA
Sbjct  129   VTFYGDKNDMPSITYDGTAAVYGTWNSATVAVESDYFVAVNIAFVNSAPMPDGIRKDAQA  188

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VA+  SGD AA+YNCK  GFQDT CDD+GRHFFKDC+I+GTVDFIFGNGK+LYL + L+ 
Sbjct  189   VAMRISGDKAAFYNCKFMGFQDTLCDDKGRHFFKDCFIQGTVDFIFGNGKSLYLKSTLNS  248

Query  573   ID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
             +    GVI A  R   ++DTG+SFV+C I G      LGR W   +RV++AYT M   V 
Sbjct  249   VANGVGVITAHGRSEAQDDTGFSFVYCTIKGTGD-TLLGRAWRGRARVVFAYTYMGNLVD  307

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
               GW           T Y+GEYK +GPG+  + R  +AK L+D E +PFI+L FI+G+KW
Sbjct  308   RKGWSDYNDNTR-ASTVYYGEYKCSGPGSSSNERVKYAKMLSDVEARPFISLTFIQGTKW  366

Query  222   LLPPIKL  202
             +LPP  L
Sbjct  367   VLPPPNL  373



>gb|KDP39969.1| hypothetical protein JCGZ_03500 [Jatropha curcas]
Length=404

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 226/322 (70%), Gaps = 8/322 (2%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDALASV  1021
             +P  +AEV +WF +NV+P+A+RK  L+ +L  AE+ PK I V  DG G+F+TITDA+ S+
Sbjct  1     MPEAEAEVNAWFEANVKPLADRKGTLNADLEAAEATPKTITVRADGSGEFKTITDAVKSI  60

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVI  841
             P  N QRVI+ IG G YTE++ +EK+KPF++  G P+ T  I F  T+ + GTV+SAT+ 
Sbjct  61    PAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGVPEKT-IIEFAGTAHEYGTVYSATLQ  119

Query  840   VEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRH  661
             VE+D+F    + I N+AP  +G   G+QAVA   +G M+++YNC+  GFQDT CDD+G H
Sbjct  120   VESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFYNCRFIGFQDTICDDKGFH  179

Query  660   FFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYSFVHCKIT  493
             FFKDCY+EGTVDFIFG+GK++YL+T+L V+      VI AQAR  N EDTG+SFVHC + 
Sbjct  180   FFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQARG-NAEDTGFSFVHCSVA  238

Query  492   GPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAK  313
             G  +G +LGR WM   + ++AY+ ++E + P GW      P      +FGE+KN+GPGA 
Sbjct  239   GKAKGAYLGRAWMPAPKAVFAYSTISEVICPEGWSNNE-HPEREPEIFFGEFKNSGPGAA  297

Query  312   MDGRPYFAKKLTDEEVKPFITL  247
              DGR  FAK+LT+ EVKPFI+L
Sbjct  298   ADGRVKFAKQLTEAEVKPFISL  319


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -1

Query  456  MAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLT  277
            M   + I+AY+ ++E + P GW      P      +FGE+KN+GPGA  DGR  FAK+LT
Sbjct  321  MPAPKAIFAYSTISEVICPEGWSNNE-HPEREPEIFFGEFKNSGPGAAPDGRAKFAKQLT  379

Query  276  DEEVKPFITLGFIEGSKWLLPPIKL  202
            + EVKPFI+L +IEGSKWLLPP KL
Sbjct  380  EAEVKPFISLIYIEGSKWLLPPPKL  404



>emb|CBI27759.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 237/380 (62%), Gaps = 23/380 (6%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR---  1132
             M  K M    V  L++    + ++ P VVSD +  IP++ +++ +W ++N+     R   
Sbjct  15    MPEKTMHLGAVTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWE  73

Query  1131  ------KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNY  970
                    +LDP L  AE+    I+V KDG GDF+TITDAL S+P+ N +R +I IGGG Y
Sbjct  74    SKKGLHSSLDPILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEY  133

Query  969   TERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSA  790
              E++ I++ KPFITLYG     P I +  T+ K GTV SATV VE+DYF A+NI  +NSA
Sbjct  134   WEKITIDRSKPFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSA  193

Query  789   PRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGN  610
             P  +G   G+QAVA+  SGD AA++NC   GFQDT CDD GRHFFKDC I+GTVDFIFG+
Sbjct  194   PMPDGKRVGAQAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGD  253

Query  609   GKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRV  439
             GK+LYL+T +  +    GVI AQAR    + +G++FVHC I+G     +LGR W    RV
Sbjct  254   GKSLYLNTMIQSVAKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLRPRV  312

Query  438   IYAYTEMTEAVRPLGW----HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDE  271
             ++AYT M   +   GW    H    K     T Y+GEY   GPGA   GR  FAK LT E
Sbjct  313   VFAYTYMGTLINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLLTGE  367

Query  270   EVKPFITLGFIEGSKWLLPP  211
             E KPF+++ +I G+KWLLPP
Sbjct  368   EAKPFLSMTYINGNKWLLPP  387



>ref|XP_007202075.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
 gb|EMJ03274.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
Length=434

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 226/352 (64%), Gaps = 11/352 (3%)
 Frame = -1

Query  1230  SPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK------NLDPELAKAESNPKHIRVSK  1069
             SP +V      IP + +++ +W   N+   ANRK        D +L  AE   K I V K
Sbjct  85    SPQLVLTHPNLIPPHLSQLDTWIVHNMRDYANRKATQVTLRFDSKLLSAEYAFKIITVKK  144

Query  1068  DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINF  889
             DG GDF+T+TDA+ S+P  N +RV++ I GG Y E+++++  +PF+T YGD +  P I F
Sbjct  145   DGTGDFKTVTDAVNSIPSWNKRRVVVFIDGGEYREKILVDVSRPFVTFYGDKNDVPSITF  204

Query  888   HKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNC  709
               T+ K GT  SATV +EADYF A+NI  +NSAP  +G   G+QAVA+  SGD AA+++C
Sbjct  205   DGTALKYGTWDSATVAIEADYFVAVNIAFVNSAPMPDGKRPGAQAVAMRISGDKAAFHSC  264

Query  708   KLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHT  538
             +  GFQDT CDD GRHFFKDCYI+GTVDFIFGNGK+LYL+  +H +    GVI A AR  
Sbjct  265   RFIGFQDTLCDDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSVANGMGVITAHARED  324

Query  537   NKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGG  358
               +D+G++FVHC ITG     FLGR W   +RV++AYT M   +   GW           
Sbjct  325   AADDSGFAFVHCNITG-TGDTFLGRAWRDRARVVFAYTYMGSLIDSQGWSDA-KHSERDK  382

Query  357   TTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             T Y+GEYK  GPG+   GR  +AK L+DEE KPF+++ FI G+KW+LPP KL
Sbjct  383   TVYYGEYKCMGPGSSSTGRVKYAKMLSDEEAKPFLSMTFIRGTKWVLPPPKL  434



>ref|XP_010666418.1| PREDICTED: pectinesterase 1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   335 bits (859),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 229/345 (66%), Gaps = 10/345 (3%)
 Frame = -1

Query  1212  DDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESN-PKHIRVSKDGKGDFETIT  1039
             D    IP N AEV++WFS+ V+P++  K  L+P +  AE+   + I V +DG G F+TI+
Sbjct  20    DAQTLIPENAAEVETWFSNVVKPISQAKGALEPSVIDAENGGVETIDVRQDGSGKFKTIS  79

Query  1038  DALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG-DPDATPFINFHKTSTKDGT  862
             DA+  V   N +RVII+IG G Y E+V IE+ + +IT YG DP   P I F  T+ + GT
Sbjct  80    DAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFYGTDPKNRPTITFGGTAAQYGT  139

Query  861   VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTF  682
             V SAT+IVE+DYF A N+ I NSAPR  G TKG QA A+  SGD +A+YNCK  GFQDT 
Sbjct  140   VDSATLIVESDYFVAANLIISNSAPRPNGKTKGGQAAAIRISGDRSAFYNCKFTGFQDTV  199

Query  681   CDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VIAAQARHTNKEDTGYS  514
             CDD+G HFFKDCYIEGTVDFIFG  +++YL+TELHVI G    +I A AR       GYS
Sbjct  200   CDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPGDLEAMITAHARGNQDGVGGYS  259

Query  513   FVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYK  334
             FVHCK+TG      LGR W   +RV+Y++ +++  +RP GW     K  Y  T YFGEYK
Sbjct  260   FVHCKVTGTGGIAVLGRAWFPAARVVYSFCDISNVIRPEGWSD-NKKAAYQTTVYFGEYK  318

Query  333   NTGPGAKMDGR-PYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             N G GA +  R PYF K LTD E K FI++ +I+ +KWLLPP K+
Sbjct  319   NKGTGADIKKRVPYF-KNLTDIEAKLFISMEYIDAAKWLLPPPKV  362



>ref|XP_008376964.1| PREDICTED: probable pectinesterase 48 [Malus domestica]
Length=316

 Score =   333 bits (854),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 209/296 (71%), Gaps = 8/296 (3%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             LIM I+L   ++    +DD+ PIP++ +++ +WF +N +P   R++ LDP +  AE+   
Sbjct  14    LIMTILLTATVA---TADDNTPIPSDHSQINTWFDNNXKPYTERQSTLDPAVVTAEAGQT  70

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              I+V +DGKGDF+T+TDA+ S+P  NT+RVI+  GGG Y E++ I + KPF+TLYG P  
Sbjct  71    VIKVMQDGKGDFKTVTDAINSIPAGNTKRVIVHXGGGEYNEKIXIPRNKPFVTLYGSPXN  130

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ K GTV+SATVI E+DYF A N+ I NS+PR +G   G+QAVAL  SG+ 
Sbjct  131   MPNLTFDGTAQKYGTVNSATVIAESDYFVAANLLIKNSSPRPDGKRVGAQAVALRVSGNN  190

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG----VI  559
             +A YNCKL GFQDT CDD G H FKDCYIEGTVDFI+G+GK+LYL+TELHV+      VI
Sbjct  191   SALYNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVI  250

Query  558   AAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
              AQAR +  EDTGYSFVHC ITG   G +LGR W    +V+YAYT MTE V P GW
Sbjct  251   TAQARDSASEDTGYSFVHCNITGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGW  306



>ref|XP_006572810.1| PREDICTED: uncharacterized protein LOC100306177 isoform X2 [Glycine 
max]
Length=328

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 217/305 (71%), Gaps = 6/305 (2%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP 
Sbjct  1     MASRTICFTIQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF
Sbjct  61    LVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I+GT+D+IFG+GK+LY+ TEL  
Sbjct  181   VALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRT  240

Query  573   IDG----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
             +      VI AQAR +  ED  YSFVHC +TG   G FLGR WM+  RV++AY+ M++ V
Sbjct  241   LGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIV  300

Query  405   RPLGW  391
               LGW
Sbjct  301   NKLGW  305



>ref|XP_009348900.1| PREDICTED: putative pectinesterase 63 isoform X1 [Pyrus x bretschneideri]
Length=366

 Score =   332 bits (852),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 231/361 (64%), Gaps = 11/361 (3%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK------NLDPELAKAES  1096
             +++V +   SP +       IP N +++ SW + N+    N K        D ++  AE 
Sbjct  8     LLVVNIFINSPQLGLSRPNLIPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEE  67

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
               + I V KDG G F T+TDA+ S+P  NT+RV++ IGGG YTE+++++  KPF+T YGD
Sbjct  68    IVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGD  127

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
              +  P I F  T+ K GT +S+TV VE+DYF A+NI  +NSAP  +G   G+QAVA+  S
Sbjct  128   QNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRIS  187

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---G  565
             GD AA++NC+  GFQDT  DD GRHFFKDC+I+GTVDFIFGNGK+LYL+  +H +    G
Sbjct  188   GDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSVANGMG  247

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
             VI A AR   ++D+G++FVHC ITG     FLGR W    RV++AYT M   +   GW  
Sbjct  248   VITAHARENVEDDSGFAFVHCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGWSD  306

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIK  205
                      T ++GEYK  GPG+   GR  +A+ L+DEE KPF++L FI+G+KW+LPP K
Sbjct  307   YM-HTERDKTVFYGEYKCMGPGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPK  365

Query  204   L  202
             +
Sbjct  366   I  366



>gb|KHG22980.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=363

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 237/373 (64%), Gaps = 24/373 (6%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  K +E   V  L++ I ++ + +P VVS    PIP +K++V++WF+  ++PV  R K 
Sbjct  1     MDGKRIEGNEVYALVICISILLF-APIVVSQ---PIPVDKSQVETWFNDIIKPVKERGKT  56

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LDPEL +A + P+ IRV + G G+F TIT  + SVP  N + VIISIG G+Y E++ IE+
Sbjct  57    LDPELVEAGTEPRIIRVMQGGGGEFNTITKTIESVPSGNGKHVIISIGPGSYKEKIRIER  116

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPFITL GDP   P + F  T  + GTV  A  I+E+ YF   N+NI+N+ PR +G   
Sbjct  117   NKPFITLVGDPKNMPNLTFDGTVKQYGTVDGAAFIIESSYFVGANLNIVNTPPRPDGKMV  176

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAVAL  SGD +A+YNCK+ GFQD   DD G HFFKDC+I GTVDFIF +G  LYL++
Sbjct  177   GAQAVALRVSGDRSAFYNCKIIGFQDILFDDRGNHFFKDCHIRGTVDFIFRSGTFLYLNS  236

Query  585   ELHV---IDG-----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYA  430
             E+ V   ++G     VI  QAR ++ EDTGYSF H +IT      FLGR W +  RV+Y+
Sbjct  237   EIFVEGDLEGDPEMAVITIQARKSSSEDTGYSFAHGRITETANDVFLGRAWKSSLRVVYS  296

Query  429   YTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFIT  250
             YTEM E V P G            T Y+GEYK TG  +    R  F K+L+D E +PF+ 
Sbjct  297   YTEMDEIVHPGGC-----------TVYYGEYKCTGKASTPATREKFVKQLSDAEAQPFLV  345

Query  249   LGFIEGSKWLLPP  211
             L ++EG+KWLLPP
Sbjct  346   LDYVEGTKWLLPP  358



>ref|XP_010656088.1| PREDICTED: putative pectinesterase 63 isoform X1 [Vitis vinifera]
Length=382

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/383 (47%), Positives = 237/383 (62%), Gaps = 26/383 (7%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR---  1132
             M  K M    V  L++    + ++ P VVSD +  IP++ +++ +W ++N+     R   
Sbjct  3     MPEKTMHLGAVTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWE  61

Query  1131  ------KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNY  970
                    +LDP L  AE+    I+V KDG GDF+TITDAL S+P+ N +R +I IGGG Y
Sbjct  62    SKKGLHSSLDPILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEY  121

Query  969   TERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININIL---  799
              E++ I++ KPFITLYG     P I +  T+ K GTV SATV VE+DYF A+NI  +   
Sbjct  122   WEKITIDRSKPFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVVRT  181

Query  798   NSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFI  619
             NSAP  +G   G+QAVA+  SGD AA++NC   GFQDT CDD GRHFFKDC I+GTVDFI
Sbjct  182   NSAPMPDGKRVGAQAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFI  241

Query  618   FGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAF  448
             FG+GK+LYL+T +  +    GVI AQAR    + +G++FVHC I+G     +LGR W   
Sbjct  242   FGDGKSLYLNTMIQSVAKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLR  300

Query  447   SRVIYAYTEMTEAVRPLGW----HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKL  280
              RV++AYT M   +   GW    H    K     T Y+GEY   GPGA   GR  FAK L
Sbjct  301   PRVVFAYTYMGTLINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLL  355

Query  279   TDEEVKPFITLGFIEGSKWLLPP  211
             T EE KPF+++ +I G+KWLLPP
Sbjct  356   TGEEAKPFLSMTYINGNKWLLPP  378



>ref|XP_006474682.1| PREDICTED: putative pectinesterase 63-like [Citrus sinensis]
Length=369

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 231/361 (64%), Gaps = 17/361 (5%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPELAK  1105
             ++++   LS   V      IP + +++++W   N+     RK           +D  LA 
Sbjct  8     MLLICFRLSITTVLAHPKQIPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAA  67

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE   + I V KDG+GDF+T+TDA+ S+P  NT+RV++ IGGG Y E++ +E+ K F+T 
Sbjct  68    AEDGFRVITVRKDGRGDFKTVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTF  127

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             +GDP   P I F+ T+   GTV+SATV VE+DYF A N+  +NSAP  +G   G+QAVA+
Sbjct  128   FGDPFDMPKIVFNGTALHFGTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAM  187

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               SGD AA++NCK  G+QDT CDD+GRHFFKDCYI+GTVDFIFGNGK+LYL T +  +  
Sbjct  188   RISGDKAAFHNCKFMGYQDTLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTIVSVAN  247

Query  567   --GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
               GVI AQAR    +D+G++FVHC ITG     +LGR W    RV++AYT M   +   G
Sbjct  248   GLGVITAQAREQVNDDSGFTFVHCNITGSGD-TYLGRAWKERPRVVFAYTYMGTLINSQG  306

Query  393   W-HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             W  G   + H   T Y+GEYK  GPGA   GR  FAK L++ E KPF+++ ++ G+KWLL
Sbjct  307   WAAGEQAQNH--KTVYYGEYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNGNKWLL  364

Query  216   P  214
             P
Sbjct  365   P  365



>ref|XP_006452876.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
 gb|ESR66116.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
Length=369

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 231/361 (64%), Gaps = 17/361 (5%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPELAK  1105
             ++++   LS   V      IP + +++++W   N+     RK           +D  LA 
Sbjct  8     MLLICFRLSITTVLGHPKQIPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAA  67

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE   + I V KDG+GDF+TITDA+ S+P  NT+RV++ IGGG Y E++ +E+ K F+T 
Sbjct  68    AEDGFRVITVRKDGRGDFKTITDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTF  127

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             +GDP   P I F+ T+   GTV+SATV VE+DYF A N+  +NSAP  +G   G+QAVA+
Sbjct  128   FGDPFDMPKIVFNGTALHFGTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAM  187

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               SGD AA++NCK  G+QDT CDD+GRHFFKDCYI+GTVDFIFGNGK+LYL T +  +  
Sbjct  188   RISGDKAAFHNCKFIGYQDTLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTIVSVAN  247

Query  567   --GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
               GVI AQAR    +D+G++FVHC ITG     +LGR W    RV++AYT M   +   G
Sbjct  248   GLGVITAQAREQVNDDSGFTFVHCNITGSGD-TYLGRAWKERPRVLFAYTYMGTLINSQG  306

Query  393   W-HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             W  G   + H   T Y+GEYK  GPGA   GR  FAK L++ E KPF+++ ++ G+KWLL
Sbjct  307   WAAGEHSQSH--KTVYYGEYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNGNKWLL  364

Query  216   P  214
             P
Sbjct  365   P  365



>gb|KDO73799.1| hypothetical protein CISIN_1g047018mg [Citrus sinensis]
Length=369

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 231/361 (64%), Gaps = 17/361 (5%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPELAK  1105
             ++++   LS   V      IP + +++++W   N+     RK           +D  LA 
Sbjct  8     MLLICFRLSITTVLAHPKQIPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAA  67

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE   + I V KDG+GDF+T+TDA+ S+P  NT+RV++ IGGG Y E++ +E+ K F+T 
Sbjct  68    AEDGFRVITVRKDGRGDFKTVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTF  127

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             +GDP   P I F+ T+   GTV+SATV VE+DYF A N+  +NSAP  +G   G+QAVA+
Sbjct  128   FGDPFDMPKIVFNGTALHFGTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAM  187

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               SGD AA++NCK  G+QDT CDD+GRHFFKDCYI+GTVDFIFGNGK+LYL T +  +  
Sbjct  188   RISGDKAAFHNCKFIGYQDTLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTIVSVAN  247

Query  567   --GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
               GVI AQAR    +D+G++FVHC ITG     +LGR W    RV++AYT M   +   G
Sbjct  248   GLGVITAQAREQVNDDSGFTFVHCNITGSGD-TYLGRAWKERPRVLFAYTYMGTLINSQG  306

Query  393   W-HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
             W  G   + H   T Y+GEYK  GPGA   GR  FAK L++ E KPF+++ ++ G+KWLL
Sbjct  307   WAAGEHSQSH--KTVYYGEYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNGNKWLL  364

Query  216   P  214
             P
Sbjct  365   P  365



>ref|XP_004169214.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
 gb|KGN48073.1| hypothetical protein Csa_6G428540 [Cucumis sativus]
Length=373

 Score =   330 bits (846),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 234/363 (64%), Gaps = 12/363 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN--LDPELAK  1105
             +RV + I+ +     +S  ++   S  IP  K+E+  W+S +V+    R    LD EL  
Sbjct  8     LRVTRWILFL----EVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDSELVA  63

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE N   I+V  DG GDF+TIT+A+ SVP  NT+RV+I IGGG Y E++ I++ KPF+TL
Sbjct  64    AEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKPFVTL  123

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             YG P+  P + F   ++K GTV+SAT+ VEADYFTA N+ I NS+PR +G  KG QA+A 
Sbjct  124   YGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQALAA  183

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
                G+  A YNCK  GFQDT CDD G H +KDC+I+GTVDFIFG G +LYL+T+L V+  
Sbjct  184   RIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFIFGGGTSLYLNTQLDVVVD  243

Query  567   ---GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                GVIAA +R    E +G+SFVHC ITG   +  +LGR W   SRV++AYT M + + P
Sbjct  244   GGLGVIAAHSREQESECSGFSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMADIIHP  303

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
              GW+ +     Y  T  FGEYK +G G+    R  + K+L+DE+V+ F++L +++   WL
Sbjct  304   KGWNDMD-NFGYDKTVSFGEYKCSGLGSNFSKRVQYGKQLSDEKVQQFVSLEYLKSDTWL  362

Query  219   LPP  211
             LPP
Sbjct  363   LPP  365



>ref|XP_004140274.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
Length=373

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 234/363 (64%), Gaps = 12/363 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN--LDPELAK  1105
             +RV + I+ +     +S  ++   S  IP  K+E+  W+S +V+    R    LD EL  
Sbjct  8     LRVTRWILFL----EVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDSELVA  63

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE N   I+V  DG GDF+TIT+A+ SVP  NT+RV+I IGGG Y E++ I++ KPF+TL
Sbjct  64    AEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKPFVTL  123

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             YG P+  P + F   ++K GTV+SAT+ VEADYFTA N+ I NS+PR +G  KG QA+A 
Sbjct  124   YGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQALAA  183

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
                G+  A YNCK  GFQDT CDD G H +KDC+I+GTVDF+FG G +LYL+T+L V+  
Sbjct  184   RIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFVFGKGTSLYLNTQLDVVVD  243

Query  567   ---GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                GVIAA +R    E +G+SFVHC ITG   +  +LGR W   SRV++AYT M + + P
Sbjct  244   GGLGVIAAHSREQESECSGFSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMADIIHP  303

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
              GW+ +     Y  T  FGEYK +G G+    R  + K+L+DE+V+ F++L +++   WL
Sbjct  304   KGWNDMD-NFGYDKTVSFGEYKCSGLGSNFSKRVQYGKQLSDEKVQQFVSLEYLKSDTWL  362

Query  219   LPP  211
             LPP
Sbjct  363   LPP  365



>emb|CDP21978.1| unnamed protein product, partial [Coffea canephora]
Length=263

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 200/265 (75%), Gaps = 7/265 (3%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M +N+ I+   L+    P V+SDD++P PA+KA++ SWF  NV+P+A+RK+ LDP L  A
Sbjct  1     MALNKAILFSTLLFI--PLVLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAA  58

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E+NP+ I++  DG G+F+TI DA+ S+P DNT RVIIS+G GNYTE++ IE+ KPFIT+ 
Sbjct  59    EANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITII  118

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             GDP+  P + F   + K GTV SAT+IVE+DYF A N+ + NSAPR  G  KG+QA+A+ 
Sbjct  119   GDPNNMPTLVFDGNAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVR  178

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG-  565
               GD A++YNCK  GFQDT CDD+G+H FKDCYIEGTVDFIFGNGK++YL+ ELHVI G 
Sbjct  179   IGGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGD  238

Query  564   ---VIAAQARHTNKEDTGYSFVHCK  499
                 I AQARHT+ EDTGYSFVHCK
Sbjct  239   QQAWITAQARHTDAEDTGYSFVHCK  263



>gb|KDP33954.1| hypothetical protein JCGZ_07525 [Jatropha curcas]
Length=374

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 222/346 (64%), Gaps = 16/346 (5%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRKN---------LDPELAKAESNPKHIRVSKDGK-GDFE  1048
             +P   ++++SW S N++     K+         LD  L  AE   + I V+K+    DFE
Sbjct  31    VPIEYSKLRSWVSDNIKDFNRHKSEDSEGTPIVLDERLVAAEDGVRVITVAKNSTVADFE  90

Query  1047  TITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKD  868
             TITDA+ SVP +NT R II I GG Y E++ +   KPFITLYG+    P I F+ T++  
Sbjct  91    TITDAINSVPVNNTARRIIWIRGGEYWEKITVNVSKPFITLYGEAADMPMIVFNGTASVY  150

Query  867   GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQD  688
             GT++SATV VE+DYF A+N+  LN+AP  +    G+QAVA+  SGD AA+YNCK  GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVVFLNAAPMPDVNITGAQAVAMRISGDKAAFYNCKFVGFQD  210

Query  687   TFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI---DGVIAAQARHTNKEDTGY  517
             T CDD GRHFFKDCY+ GTVDFIFGNGK+LYL+T +  +    GVI AQ R   +E++G+
Sbjct  211   TLCDDRGRHFFKDCYVVGTVDFIFGNGKSLYLNTTIESVANETGVITAQGRENTEEESGF  270

Query  516   SFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK-PHYGGTTYFGE  340
             +F+HC +TG     +LGR W    RV++AYT M   +   GW    GK P    T Y+GE
Sbjct  271   TFIHCNLTGIGNNTYLGRAWKVRPRVVFAYTYMGSIINGAGWS--TGKHPESNETAYYGE  328

Query  339   YKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
             Y   GPGA  DGR  +AK L++EE KPF+++ +I G+KWL+PP  L
Sbjct  329   YMCKGPGASSDGRVKYAKLLSEEEAKPFLSMTYINGNKWLIPPPNL  374



>gb|KDP39971.1| hypothetical protein JCGZ_03502 [Jatropha curcas]
Length=548

 Score =   334 bits (856),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 235/345 (68%), Gaps = 11/345 (3%)
 Frame = -1

Query  1275  RVNQLIMV---IVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELA  1108
             R++ L  V   I+ + + +  V SDD+ PIP  +AEV + F +NV+P+A+RK  L+ +L 
Sbjct  4     RLSLLAFVEYAIIAIVFTATTVTSDDAAPIPEAEAEVNACFEANVKPLADRKGTLNADLE  63

Query  1107  KAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFIT  928
              AE+ PK I+V  DG G+F+TIT+A+  +P  N QRVI+ IG G YTE++ +EK+KPF++
Sbjct  64    AAEATPKTIKVRADGSGEFKTITEAVKRIPAKNAQRVIVDIGPGTYTEKITVEKDKPFVS  123

Query  927   LYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVA  748
               G P+ T  I F  T+ + GTV+SAT+ VE+D+F    + I N+AP  +G   G+QAVA
Sbjct  124   FVGVPEKT-IIEFAGTAHEYGTVYSATLQVESDFFVGSGLVIKNTAPAPDGKRPGAQAVA  182

Query  747   LTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID  568
                +G M+++YNC+  GFQDT CDD+G HFFKDCY+EGTVDFIFG+GK++YL+T+L V+ 
Sbjct  183   FRIAGSMSSFYNCRFIGFQDTICDDKGFHFFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQ  242

Query  567   G----VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                  VI AQAR  N EDTG+SFVHC + G  +G +LGR WM   + ++AY+ ++E + P
Sbjct  243   DKEMTVIVAQAR-GNAEDTGFSFVHCSVAGKAKGAYLGRAWMPAPKAVFAYSTISEVICP  301

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEV  265
              GW      P      +FGE+KN+GPGA  DGR  FAK+LT+ E+
Sbjct  302   EGWSN-NEHPEREPEIFFGEFKNSGPGAAADGRVKFAKQLTEAEI  345



>ref|XP_008344163.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=324

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 213/322 (66%), Gaps = 11/322 (3%)
 Frame = -1

Query  1140  ANRK------NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGG  979
             ANRK        D +L  AE   + I V KDG G F T+TDA+ S+P  NT+RV++ IGG
Sbjct  5     ANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIGG  64

Query  978   GNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININIL  799
             G YTE+V+++  KPF+T YGD +  P I F  T+ K GT +S+TV VE+DYF A+NI  +
Sbjct  65    GVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAFV  124

Query  798   NSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFI  619
             NSAP  +G   G+QAVA+  SGD AA++NC+  GFQDT  DD GRHFFKDC+++GTVDFI
Sbjct  125   NSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHVQGTVDFI  184

Query  618   FGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAF  448
             FGNGK+LYL+  +H +    GVI A AR   ++D+G++FVHC ITG     FLGR W   
Sbjct  185   FGNGKSLYLNNTIHSVANGMGVITAHARENVEDDSGFAFVHCNITGTGD-TFLGRAWRER  243

Query  447   SRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEE  268
              RV++AY  M   +   GW           T Y+GEYK  GPG+   GR  +A+ L+DEE
Sbjct  244   PRVVFAYAYMGSLINKQGWSDYM-HTERDKTVYYGEYKCMGPGSSSSGRVKYARMLSDEE  302

Query  267   VKPFITLGFIEGSKWLLPPIKL  202
              KPF++L FI+G+KW+LPP KL
Sbjct  303   AKPFLSLTFIKGTKWVLPPPKL  324



>ref|XP_008450966.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=394

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/364 (45%), Positives = 228/364 (63%), Gaps = 11/364 (3%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-------NLDPELAK  1105
             +  +I+L+   S  +V   +  IPA+ +++  W + N+    +RK        LD  LA+
Sbjct  21    MFQLIILITIPSTVLVEARTKTIPADSSKLDEWIAHNMREYNDRKMNETGIKALDRRLAE  80

Query  1104  AESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL  925
             AE   + I V KDG+G+F TIT+A+ S+P  N +RV++ IGGG Y E++ I+  KPF+TL
Sbjct  81    AEDCVRLITVRKDGRGNFSTITEAIESIPSGNRRRVVVWIGGGVYREKITIDASKPFVTL  140

Query  924   YGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             YG     P I F  T+++ GTV SATV VE+DYF A+N+  +NSAP  E    G QAVA+
Sbjct  141   YGQKGKRPVITFDGTASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAM  200

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               SGD AA++ C   GFQDT CDD GRHFF+DCYI+GTVDFIFGNGK+LYL T ++ +  
Sbjct  201   RISGDKAAFHECHFIGFQDTLCDDRGRHFFRDCYIQGTVDFIFGNGKSLYLKTTINSVAE  260

Query  567   --GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
               GVI AQAR    +++G++F +C ITG     +LGR W   +RV++AYT M   +   G
Sbjct  261   GIGVITAQAREDATDESGFTFAYCNITGT-GNTYLGRAWKERTRVVFAYTYMGTLINTEG  319

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W           + Y+GEYK  GPGA   GR  +A+ L+D E K F+++ +I G+KWLLP
Sbjct  320   WSDKMHGSQPRKSMYYGEYKCKGPGATSSGRVKYARILSDVEAKAFLSMTYIHGNKWLLP  379

Query  213   PIKL  202
             P  L
Sbjct  380   PPDL  383



>ref|XP_010252431.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=370

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/349 (46%), Positives = 221/349 (63%), Gaps = 14/349 (4%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKN---------LDPELAKAESNPKHIRVSK  1069
             V+   S  +   + E+  W   +++    RK          L+P L  AE++ + I+V K
Sbjct  21    VIEVPSTALSQGETEIDRWIQKHIQAYVARKEELREGVDTALEPALKAAEASRRVIKVRK  80

Query  1068  DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINF  889
             +G GDF T+T+A++++P  NT+R I+ IG G + E++ + + +PF+T +  P   P + +
Sbjct  81    NGAGDFRTVTEAISTIPAGNTKRTIVWIGPGVFEEKIKVNRSQPFVTFFALPKDKPTLVY  140

Query  888   HKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNC  709
             H T+   GTV SA+VIVE+DYF A+NI   NSAP  +G  +G+QAVA+  SGDMAA+Y C
Sbjct  141   HGTAKDYGTVDSASVIVESDYFMAVNIIFKNSAPEPDGKREGAQAVAMRISGDMAAFYGC  200

Query  708   KLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHT  538
                GFQDT CDD+GRHFFKDCYIEGTVD+IFGNGK++YL+TELH +      I AQAR  
Sbjct  201   SFIGFQDTLCDDKGRHFFKDCYIEGTVDYIFGNGKSIYLNTELHSVSNRTAFITAQARER  260

Query  537   NKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGG  358
               +D+GYSF+HCKITG  +  +LGR W    RV+YAYT M   V+  GW    G      
Sbjct  261   VDDDSGYSFIHCKITGNGE-TYLGRAWKDRGRVVYAYTYMGTHVKAEGWSNF-GVASRDK  318

Query  357   TTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             T ++GEY+  GPGA    R  F K LT +E +PF++L +I G  WLLPP
Sbjct  319   TVFYGEYECKGPGAATKRRVPFVKLLTKQEAEPFLSLTYIHGITWLLPP  367



>ref|XP_002516214.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46216.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=378

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 230/366 (63%), Gaps = 19/366 (5%)
 Frame = -1

Query  1260  IMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN----------LDPEL  1111
             ++  +L   L P   S  S  +P + +++K+W + N+    NRK+          L+  L
Sbjct  13    LIAFILGLQLLPAANSH-SKQVPKDISKLKTWVADNINQFNNRKSDLSERIPRIILNKRL  71

Query  1110  AKAESNPKHIRVSK--DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKP  937
             A AES+ + I V+K  D   DF++I+DA+ S+P +N QR II I GG Y E++ I   KP
Sbjct  72    ADAESSVRVITVAKRDDQFADFQSISDAIDSIPINNKQRRIIWIKGGEYFEKITINTSKP  131

Query  936   FITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQ  757
             FITLYGDP   P I F+ T+ + GTV+SATV VE+ YF A+NI  +NSAP  +    G+Q
Sbjct  132   FITLYGDPGDMPKIVFNGTAARYGTVYSATVAVESKYFMAVNIAFVNSAPMPDVNKTGAQ  191

Query  756   AVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELH  577
             AVA+  SGD AA++NCK  GFQDT CDD GRH F+DCYI GTVDFIFGNGK+LYL+T + 
Sbjct  192   AVAMRISGDKAAFHNCKFVGFQDTLCDDRGRHVFRDCYIVGTVDFIFGNGKSLYLNTTIE  251

Query  576   VI---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAV  406
              +    GVI AQAR +  + + ++F+HC +TG     +LGR W    RV++AY  M   +
Sbjct  252   TVAQGTGVITAQARESVTDSSEFTFIHCNLTGIGNNTYLGRAWKERPRVVFAYAYMGSLI  311

Query  405   RPLGWHGVPGK-PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGS  229
                GW    GK P    T Y+GEYK  GPGA   GR  +AK L+DEE KPF+++  I G+
Sbjct  312   NAAGWS--TGKHPESNETVYYGEYKCKGPGAFSSGRVKYAKLLSDEEAKPFLSMTCINGN  369

Query  228   KWLLPP  211
             KWL+PP
Sbjct  370   KWLIPP  375



>ref|XP_010483849.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=309

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/300 (52%), Positives = 214/300 (71%), Gaps = 8/300 (3%)
 Frame = -1

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              ++V ++G+G F+TIT+A+ SV   NT RVII +G G Y E+V I++ KPFITLYG P+A
Sbjct  13    RVQVEQNGRGHFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPNA  72

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + +  T+ + GTV SAT+IV +DYF AINI + N+AP  +G  KG+QA+++  SG+ 
Sbjct  73    MPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNNAPMPDGKMKGAQALSMRISGNK  132

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI 
Sbjct  133   AAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVVGDGIRVIT  192

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGV--  382
             A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GW     
Sbjct  193   AHAGKSAQEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQENRD  252

Query  381   PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
              G+     T ++GEYK TGPG++ + R  F + + D + K FI+LG+I+GS WLLPP  L
Sbjct  253   TGRDK---TVFYGEYKCTGPGSRKEKRVKFTQYIDDIKAKYFISLGYIQGSSWLLPPPSL  309



>ref|XP_009402033.1| PREDICTED: putative pectinesterase 63 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 208/310 (67%), Gaps = 9/310 (3%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             L+P LA+ E + + + V KDG GDF TITDA+ S+P  NT R +I IG G Y E++++++
Sbjct  86    LEPLLAETERSGRVVTVRKDGNGDFRTITDAIKSIPSGNTARTVIKIGPGVYREKILVDQ  145

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              +P++T YG P A P I+F  T+ + GT +SATV VE+ YF A N+   N+AP      +
Sbjct  146   SRPYVTFYGQPGAMPTISFDGTAARYGTANSATVAVESSYFVASNVIFENTAPMPVDGVQ  205

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAVA+  SGDMAA+YNCK YG+QDT CDD GRHFFK+C+I GTVDFIFGNG+++Y + 
Sbjct  206   GAQAVAMRISGDMAAFYNCKFYGYQDTLCDDTGRHFFKNCFIRGTVDFIFGNGRSIYQNC  265

Query  585   ELH-VIDGV--IAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMT  415
             E+  V D V  I AQAR    + +G+SF+HC ITG     FL R W   SRV+++YT M 
Sbjct  266   EIESVADNVAYITAQARSNISDKSGFSFIHCNITGT-GNAFLSRAWREMSRVVFSYTHMG  324

Query  414   EAVRPLGW--HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGF  241
               + P GW   GV G+     T YFGEYK  GPGA  DGR  +A+ L D++ +PF+T+ F
Sbjct  325   RLIDPRGWDNKGVAGRNR---TVYFGEYKCLGPGAVTDGRVKYARLLNDKQARPFLTMDF  381

Query  240   IEGSKWLLPP  211
             I+   WLLPP
Sbjct  382   IQAQSWLLPP  391



>ref|XP_010109162.1| putative pectinesterase 50 [Morus notabilis]
 gb|EXC21091.1| putative pectinesterase 50 [Morus notabilis]
Length=361

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/365 (47%), Positives = 229/365 (63%), Gaps = 13/365 (4%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKA  1102
             M V   ++ I++    +  V+++  +PIP N+A+V +WF+ N+ P   RK  LDP L KA
Sbjct  1     MAVQAALLTILVA--TATVVLANGDVPIPENEAQVNTWFNQNIRPFGERKGTLDPNLVKA  58

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E   K IRV KDG  DF+ I DA+ ++P  NT+RVII IG G Y E+V+I+  +P+++L 
Sbjct  59    EEGVKIIRVRKDGSEDFKKIADAIKTIPAWNTKRVIIDIGPGEYHEKVLIDYNQPYVSLV  118

Query  921   GD-PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             G  P   P I +  T+ + GTV SATVIV A YF A N+   NSAPR +   K  QA+A 
Sbjct  119   GSSPKDRPTITYGATAKQYGTVDSATVIVLAPYFVAANLIFKNSAPRPDPYKKDGQALAF  178

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG  565
               +GD AA++N K  GFQDT CDD G HFFKDCYIEGTVDFIFG G +LYL+ +L VI  
Sbjct  179   RINGDKAAFFNSKFIGFQDTLCDDRGYHFFKDCYIEGTVDFIFGRGTSLYLNADLFVIGD  238

Query  564   ----VIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                 VI AQ R  ++  TGYSFVH +I G      FLGR W   ++V+Y YT M+  ++P
Sbjct  239   KGLTVITAQGRG-DRVSTGYSFVHSRIEGTGNSTTFLGRPWGDKTKVVYTYTYMSNVIQP  297

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
              GW             Y+GEYK+ GPG+    R  F+K+LT ++VKPFITLG+I+ S WL
Sbjct  298   GGWS---DNSQTSKNFYYGEYKSVGPGSSKGKRAKFSKQLTFDQVKPFITLGYIKASTWL  354

Query  219   LPPIK  205
             LP  K
Sbjct  355   LPAPK  359



>ref|XP_004140271.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=353

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/365 (46%), Positives = 230/365 (63%), Gaps = 30/365 (8%)
 Frame = -1

Query  1275  RVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKA  1102
             R+N L +  ++    +   +   S PIP  K+++  WF+ NV+P A  N+  LDP LA A
Sbjct  4     RINALAITRLVTFLATFTAILAVSPPIPVEKSQLAGWFTENVKPFAVRNKAELDPALATA  63

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E N   I+V  DG G+F+T+T+A+ASVP DN +RV+I IG G Y E++ I++ KPF+TLY
Sbjct  64    EENATVIKVMSDGTGNFKTVTEAIASVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLY  123

Query  921   G-DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             G DP   P + F   + K GTV+SAT+IVEADYFTA N+ I  +  + +           
Sbjct  124   GSDPKNMPKLTFDGDAAKYGTVYSATLIVEADYFTAANLIIEKNNIKTK-----------  172

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-D  568
                   AA YNCK  GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+T+L V  D
Sbjct  173   ------AAIYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTQLDVAGD  226

Query  567   GVIA---AQARHTNKEDTGYSFVHCKITGPRQGG---FLGRGWMAFSRVIYAYTEMTEAV  406
             G +A   A +R    + +GYSFVHC ITG   GG   +LGR WM  SRV++AYT + + +
Sbjct  227   GGLAGVTAHSREQEADTSGYSFVHCSITG--TGGKNTYLGRAWMPRSRVVFAYTTIADII  284

Query  405   RPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
              P GW+ +     +  T  FGEYK +GPGA   GR  + K+LTD EVKPF+ L +++  K
Sbjct  285   HPEGWNDMK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTDVEVKPFLGLEYVQSEK  343

Query  225   WLLPP  211
             WLLPP
Sbjct  344   WLLPP  348



>ref|XP_004144054.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 ref|XP_004159358.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 gb|KGN66331.1| Pectinesterase [Cucumis sativus]
Length=394

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 223/354 (63%), Gaps = 13/354 (4%)
 Frame = -1

Query  1221  VVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-------LDPELAKAESNPKHIRVSKDG  1063
             VV   +  IPA+ +++  W   N++   +RK        LD  LA+AE   + I V KDG
Sbjct  35    VVEAHTKTIPADSSKLDEWIGHNMKEYNDRKTNETGIKALDRRLAEAEDCVQLITVRKDG  94

Query  1062  KGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHK  883
             +G+F TIT+A+ S+P  N +RV++ IGGG Y E++ I+  KPF+TLYG     P I F  
Sbjct  95    RGNFSTITEAIDSIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQKGKRPMITFDG  154

Query  882   TSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKL  703
             T+++ GTV SATV VE+DYF A+N+  +NSAP  E    G QAVA+  SGD AA++ C  
Sbjct  155   TASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRISGDKAAFHGCHF  214

Query  702   YGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI---DGVIAAQARHTNK  532
              GFQDT CDD GRHFFKDCY++GTVDFIFGNGK+LYL T ++ +    GVI AQAR    
Sbjct  215   IGFQDTLCDDRGRHFFKDCYVQGTVDFIFGNGKSLYLKTTINSVAEGTGVITAQAREDAT  274

Query  531   EDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTT  352
             +++G++F +C ITG     +LGR W   +RV++AYT M   +   GW           + 
Sbjct  275   DESGFTFAYCNITGTGD-TYLGRAWKERTRVVFAYTYMGTLINTEGWSDKMHGSQPRKSM  333

Query  351   YFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP--IKLDP  196
             Y+GEYK  GPGA   GR  +A+ L+D E K F+++ +I G+KWLLPP  + L P
Sbjct  334   YYGEYKCKGPGATPSGRVKYARILSDVEAKAFLSMTYIHGNKWLLPPPDLSLSP  387



>ref|XP_010259713.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=336

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 212/317 (67%), Gaps = 16/317 (5%)
 Frame = -1

Query  1128  NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIE  949
             +LD  LA AE + K I+V+ DG G+F+T+TDAL S+P DN +RV+ISIG G Y E++ ++
Sbjct  28    SLDAALADAEKSKKVIKVNLDGSGEFKTVTDALKSIPTDNKERVVISIGPGEYVEKITVD  87

Query  948   KEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTT  769
             K  PFIT YG P   P ++F  T+ + GTV SA+V+V ADYF A NI + NSAP   G  
Sbjct  88    K--PFITFYGSPQNMPTLSFGGTAHEYGTVDSASVMVLADYFVAANIIMKNSAPIPTGQF  145

Query  768   K--GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLY  595
             +  G QAVA+  SGD AA+YNC+  GFQDT    +GRH+FKDCY+EGTVDF+FG GKTL+
Sbjct  146   RFNGGQAVAMRVSGDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFVFGGGKTLF  205

Query  594   LDTELHVIDG---VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYT  424
             ++TE+  I     +I AQAR    ED G+SFVHCK+TG     +LGR W  + R+I+A+T
Sbjct  206   MNTEIRSISNELVMIVAQARKNASEDNGFSFVHCKVTGTGD-IYLGRPWFPYGRIIFAFT  264

Query  423   EMTEAVRPLGWH--GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK-KLTDEEVKPFI  253
             +M   V PLGWH    P         YF EYKNTGPG+  D RP + K KL+D EV+PF+
Sbjct  265   DMCAQVNPLGWHEGAFPTT-----NVYFVEYKNTGPGSNTDKRPAWVKTKLSDAEVQPFL  319

Query  252   TLGFIEGSKWLLPPIKL  202
             + GFI G  WL PP  L
Sbjct  320   STGFINGDDWLTPPPSL  336



>ref|XP_007154546.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
 gb|ESW26540.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
Length=343

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/306 (49%), Positives = 203/306 (66%), Gaps = 10/306 (3%)
 Frame = -1

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG---  919
             K IRV  DG GDF T+T+A+ S+P  N +RV++ IG G Y E+V +++ KPF+T YG   
Sbjct  38    KVIRVRGDGSGDFRTVTEAVNSIPSGNKRRVVVWIGMGEYREKVTVDRSKPFVTFYGERN  97

Query  918   --DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
               D    P I +H T+ K GTV SATV V++DYF A+N+  +NS+PR +  + G+QA+A+
Sbjct  98    ESDSHTMPIITYHATALKYGTVDSATVAVDSDYFVAVNVAFVNSSPRPDENSVGAQALAM  157

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID-  568
               SGD AA+YNCK   FQDT CDD+GRHFFKDCYI+G+ DFIFGNGK++YL + +  +  
Sbjct  158   RISGDKAAFYNCKFVSFQDTLCDDKGRHFFKDCYIQGSYDFIFGNGKSIYLRSRIESVAK  217

Query  567   --GVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                VI AQ R +  EDTG++F+HC ITG   +  +LGR W    RV++AYT M   +R  
Sbjct  218   GLSVITAQGRESIGEDTGFTFLHCNITGSGNRNTYLGRAWRKSPRVVFAYTYMASLIRAR  277

Query  396   GWH-GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
             GW      +P    T Y+GEYK TG GA   GR  F K L+DEE KPF+++ +I G KW+
Sbjct  278   GWFTNQLSQPKSNNTIYYGEYKCTGAGAVSSGRVKFRKILSDEEAKPFMSMAYIHGGKWV  337

Query  219   LPPIKL  202
             +PP KL
Sbjct  338   VPPPKL  343



>ref|XP_010243601.1| PREDICTED: pectinesterase PPME1-like, partial [Nelumbo nucifera]
Length=341

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 212/303 (70%), Gaps = 9/303 (3%)
 Frame = -1

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E N K I+V+ DG GDF+T+TDA+ S+P  N  R+++SIG G Y E++ ++  KPF+T Y
Sbjct  40    EKNKKVIKVNADGSGDFKTMTDAINSIPAGNKDRIVLSIGPGEYVEKIKVDGNKPFVTFY  99

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSA--PRWEGTTKGSQAVA  748
             G P + P ++FH TS + GTV SA+VIV +DYF A NI   N+A  P  +G+ +G QAVA
Sbjct  100   GAPGSMPTLSFHGTSGEYGTVDSASVIVLSDYFVAANIIFKNTAPPPSGQGSGQGGQAVA  159

Query  747   LTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID  568
             +  SGDMAA+YNCK  GFQDT  DD+GRH+FKDCYIEGTVDFIFG+GK+LY++TELH + 
Sbjct  160   MRISGDMAAFYNCKFIGFQDTLLDDKGRHYFKDCYIEGTVDFIFGSGKSLYMNTELHSVA  219

Query  567   ---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                 VI AQAR ++ ED GYSFVHC +TG     +LGR W  F +VI+A TE+ + V P+
Sbjct  220   KDLAVITAQARKSDSEDDGYSFVHCTVTGTGD-IYLGRPWFPFGKVIFANTELCDKVNPV  278

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK-KLTDEEVKPFITLGFIEGSKWL  220
             GWH   G        +F EY+NTGPG+  D RP + K KL+D EV+PF++  +I+G  WL
Sbjct  279   GWH--VGVGVATDNVFFVEYQNTGPGSNTDKRPTWVKTKLSDAEVQPFLSTKYIDGDNWL  336

Query  219   LPP  211
              PP
Sbjct  337   QPP  339



>emb|CDY02121.1| BnaA03g40460D [Brassica napus]
Length=302

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 208/313 (66%), Gaps = 29/313 (9%)
 Frame = -1

Query  1266  QLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPK  1087
              LI+ I+LV    P V  +D+ PIP NK  ++ WF++NV                     
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVR--------------------  46

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
                  ++G+GDF+T+T+A+ SVP  N +RVII +G G Y E+V I++ KPFITLYGDP+A
Sbjct  47    -----QNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNA  101

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV SAT+IV +DYF AINI + NSAP  +G  KG+QA+++  SG+ 
Sbjct  102   MPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIA  556
             AA+YNCK YG+QDT CDD G HFFKDCYIEGT DFIFG+G++LYL T+L+V+ DG  VI 
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVVGDGLRVIT  221

Query  555   AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPG  376
             A A  + +E +GYSFVHCK+TG   G +LGR WM+  +V+YAYT+M+  V P GWH    
Sbjct  222   AHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHK-NT  280

Query  375   KPHYGGTTYFGEY  337
             +     T ++GEY
Sbjct  281   QTERDKTVFYGEY  293



>gb|EPS69429.1| hypothetical protein M569_05334, partial [Genlisea aurea]
Length=305

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 206/303 (68%), Gaps = 9/303 (3%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELA  1108
             M   R   L +++V   Y++     D+ IP  A+K+++ +WF+ NV     +  L   +A
Sbjct  1     MTQGRRTLLHLLLVTAVYIARSEPEDELIP--ADKSQLDTWFNRNV---GQKATLSTAVA  55

Query  1107  KAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFIT  928
              AE+    I VSKDG G F+TI DAL SVPE+N  RV+I IG GNYTE++ IE+ KP +T
Sbjct  56    DAEAKTTVISVSKDGSGKFKTIGDALKSVPENNKNRVVIHIGPGNYTEKIRIERSKPHVT  115

Query  927   LYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVA  748
             LYGDP   P + + +++ K   + SAT+IVE DYF+A+N+ I+NS+PR +G  K +QA A
Sbjct  116   LYGDPKNMPVLVYGESAAKVNIIESATLIVEGDYFSAVNLVIVNSSPRPDGKIKLAQAAA  175

Query  747   LTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID  568
             L  SGD A++YNC+ +GFQDT  DD GRH FKDCYIEGTVDFI G+G++LYL+TE+HVI 
Sbjct  176   LRTSGDGASFYNCRFHGFQDTILDDAGRHLFKDCYIEGTVDFICGSGQSLYLNTEVHVIP  235

Query  567   ----GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                 G I A AR T  +  GYSFVHC+ITG  +  +LGR W  ++RVIY+Y+++++ V P
Sbjct  236   GEPMGFITAHARKTTGDPGGYSFVHCRITGAGETAYLGRPWYPYARVIYSYSQLSDVVNP  295

Query  399   LGW  391
              GW
Sbjct  296   SGW  298



>ref|XP_010259712.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=337

 Score =   300 bits (769),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 204/300 (68%), Gaps = 16/300 (5%)
 Frame = -1

Query  1089  KHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             K I+V++DG G+F+T+T+AL S+P+ N +RV+ISIG G Y E++ ++K  PFIT YG P 
Sbjct  42    KVIKVNQDGSGEFKTVTEALKSIPKYNKERVVISIGPGEYVEKITVDK--PFITFYGSPQ  99

Query  909   ATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK--GSQAVALTQS  736
               P ++F  T+ + GTV SA+V+V A+YF A+NI + NSAP   G  +  G QAVA+  S
Sbjct  100   NMPTLSFDGTAHEYGTVDSASVMVLANYFVAVNIIMKNSAPIPTGKFRFNGGQAVAMRVS  159

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG---  565
             GD AA+YNC+  GFQDT    +GRH+FKDCY+EGTVDF+FG GKTL+++TE+  +     
Sbjct  160   GDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFVFGGGKTLFMNTEIRSVSNELV  219

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH-  388
             +I AQAR    ED G+SFVHC +TG     +LGR W  + R+I+A+TE+   V PLGWH 
Sbjct  220   MIVAQARKNASEDNGFSFVHCNVTGTGD-IYLGRPWFPYGRIIFAFTELCAQVNPLGWHE  278

Query  387   -GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK-KLTDEEVKPFITLGFIEGSKWLLP  214
               VP         YF EYKNTGPG+ +D RP + K KLTD EV+PF++  FI G  WL P
Sbjct  279   GAVPTT-----NVYFVEYKNTGPGSNIDKRPAWVKTKLTDAEVQPFLSTAFINGDDWLTP  333



>ref|XP_003541318.1| PREDICTED: putative pectinesterase 63-like [Glycine max]
Length=347

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/305 (48%), Positives = 197/305 (65%), Gaps = 16/305 (5%)
 Frame = -1

Query  1068  DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP--------  913
             DG GDF T+TDA+ S+P  N +RV++ IG G Y E++ +++ KPF+T YG+         
Sbjct  43    DGAGDFRTVTDAVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDND  102

Query  912   --DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
               D  P I +  T+ + GTV SATV V+ADYF A+N+  +NS+PR E  + G+QA+A+  
Sbjct  103   SRDIMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRI  162

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---  568
             SGD AA++NCK  GFQDT CDD+GRHFFKDCYI+GT DFIFGNGK++YL + +  +    
Sbjct  163   SGDKAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESVANGL  222

Query  567   GVIAAQARHTNKEDTGYSFVHCKITGPRQGG-FLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
              VI AQ R +  EDTG++F+HC ITG   G  +LGR W    RV++AYT M   +   GW
Sbjct  223   SVITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQGW  282

Query  390   --HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
               + V        T Y+GEY+  GPGA   GR  F K L+ EE KPF+++ +I G  W++
Sbjct  283   FNNQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKFRKILSKEEAKPFLSMAYIHGGTWVV  342

Query  216   PPIKL  202
             PP KL
Sbjct  343   PPPKL  347



>ref|XP_003609956.1| Pectinesterase [Medicago truncatula]
 gb|AES92153.1| pectinesterase [Medicago truncatula]
Length=345

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 205/316 (65%), Gaps = 18/316 (6%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             L+  L  AE+  + +RV KDG GDF T+TDA+ S+P  N +RV++ IG G Y E++ +++
Sbjct  40    LEEHLTAAETTVRVVRVRKDGTGDFTTVTDAVKSIPSGNKRRVVVWIGMGEYREKITVDR  99

Query  945   EKPFITLYG-----DPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRW  781
              K F+T YG     D D  P I +  T+ + GT+ SATV V+ADYF A+N+  +NS+P  
Sbjct  100   SKRFVTFYGERNGKDNDMMPIITYDATALRYGTLDSATVAVDADYFVAVNVAFVNSSPMP  159

Query  780   EGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKT  601
             +  + G QA+A+  SGD AA+YNCK  GFQDT CDD G+HFFKDC+I+GT DFIFGNGK+
Sbjct  160   DENSVGGQALAMRISGDKAAFYNCKFIGFQDTLCDDYGKHFFKDCFIQGTYDFIFGNGKS  219

Query  600   LYLDTELHVIDGVIAAQARHTNKEDTGYSFVHCKITGP-RQGGFLGRGWMAFSRVIYAYT  424
             +YL+  L     VI AQ R    +DTG++FVHC ITG   +  +LGRGW    RV++AYT
Sbjct  220   IYLN-RLQRGLNVITAQGRERMSDDTGFTFVHCNITGSGHRNTYLGRGWRRSPRVVFAYT  278

Query  423   EMTEAVRPLGWHGVPGKPHYGG--TTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFIT  250
              M   V   GW+      H+G   T +FGEYK +GPGA    R  + + L+DEE K F++
Sbjct  279   YMDSVVNSRGWY------HHGSNETIFFGEYKCSGPGAV---RLNYKRILSDEEAKHFLS  329

Query  249   LGFIEGSKWLLPPIKL  202
             + +I G +W+ PP KL
Sbjct  330   MAYIHGEQWVRPPPKL  345



>ref|XP_009123158.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
Length=295

 Score =   295 bits (755),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 200/294 (68%), Gaps = 5/294 (2%)
 Frame = -1

Query  1083  IRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDAT  904
             ++V+++G GDF+TI +A+ S+P  NT+RVII +  G Y E+V ++  +PF+TL G P A 
Sbjct  1     MQVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAE  60

Query  903   PFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMA  724
               + F  T++K GT+ SAT+I+ A YF A N+++ N+AP  +  T+G QA+A+  +GD A
Sbjct  61    TNLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQG-QALAMRINGDKA  119

Query  723   AYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI-DG--VIAA  553
             A+YNC+ YGFQDT CDD G HFFKDCYIEGT DFIFG G +LYL+T+LH + DG  VI A
Sbjct  120   AFYNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAVGDGLRVITA  179

Query  552   QARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGK  373
               R +  +  GYSFVHCKITG   G +LGR WM+  +V+YAYTEM+  V P GW     +
Sbjct  180   HNRQSENQQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENRNR  239

Query  372   PHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              +   T ++GEY  TGPG+  + R    + +   E   F+TLG+I+GS WLLPP
Sbjct  240   EN-DKTVFYGEYMCTGPGSHKEKRVAHTQDIDKNEANGFLTLGYIKGSLWLLPP  292



>ref|XP_004174112.1| PREDICTED: pectinesterase PPME1-like, partial [Cucumis sativus]
Length=309

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 203/299 (68%), Gaps = 9/299 (3%)
 Frame = -1

Query  1260  IMVIVLVHYLSP--GVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKAESN  1093
             + +  LV +L+    +++  S  +P +K ++++WFS NV+P A  N+  LDP +  AE N
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  1092  PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP  913
                ++V  DG GDF+TIT+A+ASVP +N  RV+I IG G Y E++ IEK KPFITL G P
Sbjct  64    VTIVKVMGDGTGDFKTITEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
                P ++F   ++K GTV+SAT+IVEADYF A N+ I N++PR  G  K +QA+A    G
Sbjct  124   KNVPTLSFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----G  565
               +A+YNCK +GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+TEL+V+      
Sbjct  183   TKSAFYNCKFFGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWH  388
             VI A +R    + +GYSFVHC ITG  +  +LGR WM  SRVI+AYT M + + P GW+
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWN  301



>gb|KHN07870.1| Putative pectinesterase 63 [Glycine soja]
Length=337

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 196/305 (64%), Gaps = 17/305 (6%)
 Frame = -1

Query  1068  DGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP--------  913
             +G GDF T+T A+ S+P  N +RV++ IG G Y E++ +++ KPF+T YG+         
Sbjct  34    NGAGDFTTVT-AVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDND  92

Query  912   --DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
               D  P I +  T+ + GTV SATV V+ADYF A+N+  +NS+PR E  + G+QA+A+  
Sbjct  93    SRDIMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRI  152

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---  568
             SGD AA++NCK  GFQDT CDD+GRHFFKDCYI+GT DFIFGNGK++YL + +  +    
Sbjct  153   SGDKAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESVANGL  212

Query  567   GVIAAQARHTNKEDTGYSFVHCKITGPRQGG-FLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
              VI AQ R +  EDTG++F+HC ITG   G  +LGR W    RV++AYT M   +   GW
Sbjct  213   SVITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQGW  272

Query  390   --HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
               + V        T Y+GEY+  GPGA   GR  F K L+ EE KPF+++ +I G  W++
Sbjct  273   FNNQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKFRKILSKEEAKPFLSMAYIHGGTWVV  332

Query  216   PPIKL  202
             PP KL
Sbjct  333   PPPKL  337



>ref|XP_007219703.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
 gb|EMJ20902.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
Length=330

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 205/332 (62%), Gaps = 36/332 (11%)
 Frame = -1

Query  1197  IPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETITDALASV  1021
             +PA+ ++V +WF++NV+P   R   LD  LA AE++ K I+V+KDG+G F+TI DA+ S 
Sbjct  27    LPADHSQVNTWFNNNVKPYTARNGTLDSTLAMAEASQKVIKVNKDGRGQFKTIADAVNSN  86

Query  1020  PEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVI  841
             P  NT+RVI+ IGG  Y E++ I + KPF+T YG P     + F  T+ K GTV S TVI
Sbjct  87    PVGNTKRVIVYIGGV-YNEKITIPQNKPFVTFYGSPTTMSTLTFAGTAQKYGTVDSTTVI  145

Query  840   VEADYFTAININIL--NSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEG  667
              E+DYF A    +L  NS+PR +G   G QA+AL  S + +A +NC+L GFQDT CDD G
Sbjct  146   AESDYFVAAITLLLRYNSSPRPDGKRVGEQALALRVSSNKSALFNCRLIGFQDTLCDDRG  205

Query  666   RHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIAAQARHTNKEDTGYSFVHCKITGP  487
              HFFKDC+IEGT+  +  N  T            VI AQAR +  EDTG SFVHC IT  
Sbjct  206   NHFFKDCFIEGTLHVLGNNEMT------------VITAQARDSTSEDTGDSFVHCNITEI  253

Query  486   RQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMD  307
               G +LG+ W    RV++AYT +                    T ++GEYK + PG+ M 
Sbjct  254   GNGTYLGKVWRTSPRVVFAYTSI--------------------TVFYGEYKCSSPGSSMV  293

Query  306   GRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
              R  +AK+LT E++KPF++L +I+GSKWLLPP
Sbjct  294   ERVKYAKQLTGEQIKPFLSLDYIQGSKWLLPP  325



>ref|XP_004174171.1| PREDICTED: probable pectinesterase 49-like, partial [Cucumis 
sativus]
Length=286

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 192/284 (68%), Gaps = 9/284 (3%)
 Frame = -1

Query  1260  IMVIVLVHYLSP--GVVSDDSIPIPANKAEVKSWFSSNVEPVA--NRKNLDPELAKAESN  1093
             + +  LV +L+    +++  S  +P +KA++++WFS NV+P A  N+  LDP +  AE N
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  1092  PKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP  913
                ++V  DG GDF+T+T+A+ASVP +N  RV+I IG G Y E++ IEK KPFITL G P
Sbjct  64    VTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
                P + F   ++K GTV+SAT+IVEADYF A N+ I N++PR  G  K +QA+A    G
Sbjct  124   KNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID----G  565
               +A+YNCK  GFQDT CDD+G H +KDC+I+GTVDF+FG G +LYL+TEL+V+      
Sbjct  183   TKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIY  433
             VI A +R    + +GYSFVHC ITG  +  FLGR WM  SRVI+
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIF  286



>ref|XP_007038215.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY22716.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=293

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 185/257 (72%), Gaps = 10/257 (4%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  K    + V   I  I++   L+P V+S +S PIP +K+++K+WF++N++P + R   
Sbjct  1     MTGKRSRNIEVGAAICTILV---LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGST  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             +DP LAKAE     I+V KDG GDF+TIT A+ASVP  NT+RVIISIGGG+Y E++ I++
Sbjct  58    IDPALAKAEVAAHIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDR  117

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPFIT YGDP   P +++  T+ + GTV SAT+IVE+DYF A NI I N+APR +G   
Sbjct  118   SKPFITFYGDPRNMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMV  177

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDT  586
             G+QAV+L  SGD AA+YNCK+ GFQDT CDD G HFFKDCYI GTVDFIFG+GK+LYL+T
Sbjct  178   GAQAVSLRISGDKAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNT  237

Query  585   ELHVIDG-----VIAAQ  550
              L+V DG     VI AQ
Sbjct  238   VLYV-DGQKGVTVITAQ  253



>ref|XP_006843862.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
 gb|ERN05537.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
Length=365

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 208/328 (63%), Gaps = 12/328 (4%)
 Frame = -1

Query  1173  KSWFSSNVEPVANRKNLDPE--LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQR  1000
             K+ + + +  +AN  N+  E  LA AE+  K + V KDG  D+ T+  A+ S+P  NTQR
Sbjct  36    KAMYEARMGQIANGINVTMEDALAVAENGTKVLVVCKDGSCDYGTLQAAVDSIPVGNTQR  95

Query  999   VIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFT  820
              I+ I  G Y E+V + + KPF+T  GDP   P I+++  S K GT +SATVIVEADYF 
Sbjct  96    YILKIKPGLYKEKVNVPRTKPFVTFLGDPINMPTISYNGNSAKYGTWNSATVIVEADYFI  155

Query  819   AININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYI  640
             A+N+   NS+PR +   +G QAVAL  SGD AA+Y C+  GFQDT CDD GRH FK+C+I
Sbjct  156   AMNVIFENSSPRPKDGEEG-QAVALRISGDKAAFYRCRFIGFQDTLCDDVGRHLFKNCFI  214

Query  639   EGTVDFIFGNGKTLYLDTELHVI---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFL  469
             +GTVDFIFG  ++LY + E++ +      I AQAR +  ++ G+SFV+CKITG  Q   L
Sbjct  215   QGTVDFIFGAARSLYSNCEINSVATGRTAITAQARSSESDEGGFSFVNCKITGTGQAT-L  273

Query  468   GRGWMAFSRVIYAYTEMTEAVRPLGW--HGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPY  295
              R W  +SRVI+A T M   +  LGW  HG   +     T ++GEY+  GPGA MDGR  
Sbjct  274   SRAWRKYSRVIFARTYMGNLIDKLGWDNHGYTDRDQ---TVFYGEYQCFGPGATMDGRVP  330

Query  294   FAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +AKKL  E+VKPF+ + +I G  WL  P
Sbjct  331   YAKKLRTEDVKPFLDVTYILGRTWLRTP  358



>ref|XP_009348902.1| PREDICTED: putative pectinesterase 63 isoform X2 [Pyrus x bretschneideri]
Length=335

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 191/298 (64%), Gaps = 10/298 (3%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK------NLDPELAKAES  1096
             +++V +   SP +       IP N +++ SW + N+    N K        D ++  AE 
Sbjct  8     LLVVNIFINSPQLGLSRPNLIPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEE  67

Query  1095  NPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD  916
               + I V KDG G F T+TDA+ S+P  NT+RV++ IGGG YTE+++++  KPF+T YGD
Sbjct  68    IVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGD  127

Query  915   PDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
              +  P I F  T+ K GT +S+TV VE+DYF A+NI  +NSAP  +G   G+QAVA+  S
Sbjct  128   QNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRIS  187

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---G  565
             GD AA++NC+  GFQDT  DD GRHFFKDC+I+GTVDFIFGNGK+LYL+  +H +    G
Sbjct  188   GDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSVANGMG  247

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
             VI A AR   ++D+G++FVHC ITG     FLGR W    RV++AYT M   +   GW
Sbjct  248   VITAHARENVEDDSGFAFVHCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGW  304



>ref|XP_007038216.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY22717.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=283

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 174/238 (73%), Gaps = 4/238 (2%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANR-KN  1126
             M  K    + V   I  I++   L+P V+S +S PIP +K+++K+WF++N++P + R   
Sbjct  1     MTGKRSRNIEVGAAICTILV---LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGST  57

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             +DP LAKAE     I+V KDG GDF+TIT A+ASVP  NT+RVIISIGGG+Y E++ I++
Sbjct  58    IDPALAKAEVAAHIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDR  117

Query  945   EKPFITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTK  766
              KPFIT YGDP   P +++  T+ + GTV SAT+IVE+DYF A NI I N+APR +G   
Sbjct  118   SKPFITFYGDPRNMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMV  177

Query  765   GSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYL  592
             G+QAV+L  SGD AA+YNCK+ GFQDT CDD G HFFKDCYI GTVDFIFG+GK+LYL
Sbjct  178   GAQAVSLRISGDKAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYL  235



>ref|NP_001234964.1| uncharacterized protein LOC100306177 precursor [Glycine max]
 gb|ACU14235.1| unknown [Glycine max]
Length=248

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 173/232 (75%), Gaps = 2/232 (1%)
 Frame = -1

Query  1260  IMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKAESNPK  1087
             I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP L  AE   K
Sbjct  10    IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAK  69

Query  1086  HIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
              ++V +DG G+++TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF+TLYG P+ 
Sbjct  70    VVKVMQDGSGEYKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  906   TPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDM  727
              P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QAVAL  SGD 
Sbjct  130   MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  726   AAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             AA+YNCK+YGFQDT CDD  RHFFKDC I+ T+D+IFG+GK+LY+ TEL  +
Sbjct  190   AAFYNCKMYGFQDTICDDRNRHFFKDCLIQSTMDYIFGSGKSLYVSTELRTL  241



>ref|XP_007219211.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
 gb|EMJ20410.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
Length=270

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 184/279 (66%), Gaps = 25/279 (9%)
 Frame = -1

Query  1218  VSDDSIPIPANKAEVKSWFSSNVEPVANRK-NLDPELAKAESNPKHIRVSKDGKGDFETI  1042
             V++DS PIPA+ ++V SWF +NV+P+  RK  LD  +  AE  PK I+V KDG G+F+T+
Sbjct  4     VANDSTPIPADGSQVGSWFDNNVKPLTERKGTLDAAIVTAEDGPKLIKVMKDGSGNFKTL  63

Query  1041  TDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGT  862
             T+A+ S+PE NT+RV++ IGGG Y E++ I + KPF+TLYG P+  P + F  T+ K GT
Sbjct  64    TEAINSIPERNTKRVVVYIGGGVYNEKIKIPQNKPFVTLYGSPNNMPNLTFDGTAQKYGT  123

Query  861   VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTF  682
             V+S T+IVE+DYF A NI +       +G    +QAVAL  SGD A++YNCK +GFQDT 
Sbjct  124   VYSGTLIVESDYFRAANIIVTP-----DGIRPDAQAVALQISGDKASFYNCKFFGFQDTL  178

Query  681   CDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIAAQARHTNKEDTGYSFVHC  502
              D +G HFFKDCYI+GTVDFIFG GK+LYL                    ED  +SFVHC
Sbjct  179   YDYKGLHFFKDCYIQGTVDFIFGKGKSLYLSAS-----------------EDNEFSFVHC  221

Query  501   KITGPR--QGGFLGRGWMAFSRVIYAYTEMTEAVRPLGW  391
             KITG    +G +LGR W +   V++AYT+M + V P  W
Sbjct  222   KITGTTYVRGTYLGRAWGSSPTVVFAYTDMADVVHPERW  260



>ref|XP_007145123.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
 gb|ESW17117.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
Length=370

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 200/342 (58%), Gaps = 21/342 (6%)
 Frame = -1

Query  1182  AEVKSWFSSNVEPVANRKNL--------DPELAKAESNPKHIRVSKDGKGDFETITDALA  1027
             A    W S N++    RKN+        D +L +AESN   I VS+DG  DF+TI++AL 
Sbjct  32    ANFDKWVSCNMKKYDERKNILKSKWKVADLKLRQAESNKVIITVSQDGSADFKTISEALN  91

Query  1026  SVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKD-------  868
             S+P  NT RVI+SI  G Y E+V+I +  PFITL G+    P I  + T++         
Sbjct  92    SIPPRNTMRVIVSISPGVYREKVMIPRTMPFITLSGEAGNPPTITGNDTASASKRNGTPL  151

Query  867   GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQD  688
             GT HSATV V+A YF AINI   NSAP  E   +G Q VAL  SG  AA+YNC   G QD
Sbjct  152   GTFHSATVAVDASYFVAINIKFENSAPH-EIGRRGEQGVALRISGTKAAFYNCSFNGAQD  210

Query  687   TFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGY  517
             T  D +G HFF +C I+G+VDFIFG  ++LY +  L+     +A   AQ R  +  D+G+
Sbjct  211   TLYDHKGLHFFHNCSIQGSVDFIFGYARSLYQNCYLNSTTKKVASITAQKRTNSSLDSGF  270

Query  516   SFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEY  337
             SF +C +TG  +  +LGR W  +SRV+++YT M   V P GW    G        Y+GEY
Sbjct  271   SFQNCTVTGSGK-VYLGRAWGDYSRVVFSYTYMDNLVLPKGWSDW-GDQKRDSRVYYGEY  328

Query  336   KNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               +GPGA M GR  +A+ LTDEE KPFI   FIEG  WL+ P
Sbjct  329   MCSGPGANMAGRVPWARVLTDEEAKPFIGTQFIEGDTWLISP  370



>gb|KHG12918.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=377

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 219/375 (58%), Gaps = 27/375 (7%)
 Frame = -1

Query  1272  VNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRK----------NL  1123
             ++ +++V+V+ +Y S    S +    P ++ E + W   N     +++           L
Sbjct  9     ISLIVLVLVICNYSSTTSASSN----PGSETEFEKWLGWNARNHRSKRLAADRSLVMSVL  64

Query  1122  DPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKE  943
             D  L  AE N   I VS+DG GDF+TI +AL S+P  NT+RVI+ I  G Y E++ I + 
Sbjct  65    DDNLVIAEKNNVMINVSRDGSGDFKTINEALNSIPLRNTRRVILVIKPGIYREKITIPRT  124

Query  942   KPFITLYGDPDATPFINFHKT---STKDG----TVHSATVIVEADYFTAININILNSAPR  784
              PFIT  GD +  P I  + T   S+KDG    T  SATV V+A+YF AINI   N+ P 
Sbjct  125   MPFITFQGDANNPPTITGNDTASSSSKDGRPLKTFQSATVAVDANYFVAINIKFENTVPH  184

Query  783   WEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGK  604
               G+ KG QAVA+  SG  AA+YNC  YG QDT  D +G H+F +C+I+G+VDFIFG G+
Sbjct  185   TIGS-KGGQAVAVRISGTKAAFYNCSFYGDQDTLYDHKGLHYFNNCFIQGSVDFIFGYGR  243

Query  603   TLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQG-GFLGRGWMAFSRVI  436
             +LY +  L+ I   +A   AQ R +    +G+SF    +TG   G  +LGR W  +SRV+
Sbjct  244   SLYENCYLNSIAKKVASLTAQKRSSASMASGFSFKDSVVTGNGTGLVYLGRAWGEYSRVV  303

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             ++YT M + VRP GW    G P      Y+GEYK +GPGA + GR  +A+ LTDEE +PF
Sbjct  304   FSYTFMDKVVRPQGWSDW-GNPKRDDRAYYGEYKCSGPGANLTGRVPWARILTDEEAEPF  362

Query  255   ITLGFIEGSKWLLPP  211
             +   ++EG  WL+ P
Sbjct  363   LGTYYVEGDTWLINP  377



>ref|XP_010262227.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=357

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 210/364 (58%), Gaps = 26/364 (7%)
 Frame = -1

Query  1254  VIVLVHYLSPGVVSDDSIP--IPANKAEVKSWFSSNVEPVANRKN---------LDPELA  1108
             +I ++  L+P V S D  P     +     +W  ++++    RK+         LD  LA
Sbjct  1     MITMLIVLAPIVFSQDQEPENTSNDPTSFDNWIENSMKTFYERKDQIRQGEDVVLDDALA  60

Query  1107  KAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFIT  928
             +AE + K I+V KDG GDF+T+ DA+AS+P  N QR+I+ IG G Y E++ ++K KPF+T
Sbjct  61    QAEKSSKVIKVRKDGTGDFKTVADAIASIPSGNKQRIILWIGPGEYAEKITVDKSKPFLT  120

Query  927   LYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWE--GTTKGSQA  754
              YG P+  P ++ H          SA+V VE+DYF A NI   NSAP  +  G  +G +A
Sbjct  121   FYGSPENMPILSSHGA--------SASVTVESDYFMAANIIFKNSAPETDGKGGGQGGEA  172

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
              A+  SGD A +Y+C   G   +  DD+GRH FKDCYIE T++FI GNGK+LY+ TE+H 
Sbjct  173   AAMRISGDKAVFYSCNFTGSDKSLYDDKGRHLFKDCYIESTLNFISGNGKSLYMFTEIHS  232

Query  573   ---IDGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
                 + +I +  +    EDTGY FV+C  TG     +LG+ W A  RVI+A  ++   + 
Sbjct  233   KAKTNALITSSTKEKENEDTGYCFVYCNFTGSGH-IYLGQEWRAKGRVIFANADIGLQIS  291

Query  402   PLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKW  223
             P G     GK     T Y+ EY  +GPG+  D  P + + L+D E +PF+++ ++ GS W
Sbjct  292   PQG-SSDGGKTTDEKTIYYAEYNCSGPGSCADKPPPYVRMLSDAEAQPFVSMTYVHGSTW  350

Query  222   LLPP  211
             LLPP
Sbjct  351   LLPP  354



>ref|XP_010094410.1| putative pectinesterase 53 [Morus notabilis]
 gb|EXB55991.1| putative pectinesterase 53 [Morus notabilis]
Length=381

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 204/353 (58%), Gaps = 32/353 (9%)
 Frame = -1

Query  1182  AEVKSWFSSNVE--------------PVANRKN-----LDPELAKAESNPKHIRVSKDGK  1060
             A+ K W S NV+              P    +N     LD  L KAE N   I VS+DG 
Sbjct  31    ADYKRWVSWNVQNYRKKTTLKAELKSPAGYYQNEAVDSLDERLKKAEMNKMRIAVSQDGS  90

Query  1059  GDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKT  880
             GDF TI+ AL ++P  NT+RVII+I  G Y E++ I +  PF+TL+GD D  P I  + T
Sbjct  91    GDFTTISQALNAIPPRNTRRVIINIKPGVYREKINIPRSMPFVTLFGDADDPPTITGNDT  150

Query  879   STKDG-------TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
             ++  G       T  SATV VEA+YF A+NI   N+AP   G  KG QAVA+  SG  AA
Sbjct  151   ASGTGKNGKPLRTFQSATVAVEANYFVALNIKFENTAPHVVGFRKG-QAVAVRISGSKAA  209

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIA---AQ  550
             +YNC  YG QDT  D +G H+F +C+I+G+VDFIFG G++ Y    LH     +A   AQ
Sbjct  210   FYNCSFYGTQDTLYDHKGLHYFYNCFIQGSVDFIFGYGRSFYEKCYLHSTAKKVAFLTAQ  269

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
              R T+  ++G+SF    +TG  Q  +LGR W  +SRV+++YT M + V P GW    G  
Sbjct  270   KRTTSSLESGFSFKDSVVTGSGQ-LYLGRAWGDYSRVVFSYTFMDKIVLPQGWSDW-GDQ  327

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
                   Y+GEYK +GPGA + GR  +A+ L+DEE +PFI   +++G  WL+ P
Sbjct  328   KRDSQVYYGEYKCSGPGANLKGRVAWARILSDEEAQPFIGTYYVDGDTWLISP  380



>gb|KDP28296.1| hypothetical protein JCGZ_14067 [Jatropha curcas]
Length=375

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 207/339 (61%), Gaps = 17/339 (5%)
 Frame = -1

Query  1185  KAEVKSWFSSNVEPVANRK----NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVP  1018
             + E   W S NV+    R     +LD +L KAE N   I V+++G GDF TI DA+ S+P
Sbjct  35    ETEYYQWVSWNVKNHRRRSILESSLDDKLRKAEMNSVRITVNQNGPGDFNTIGDAIKSIP  94

Query  1017  EDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TV  859
               NT+RVII+I  G Y E++ I +  PFIT  G+    P I  + T++   KDG    T 
Sbjct  95    SRNTRRVIIAIKPGVYREKISIPRTLPFITFLGESSDPPIITGNDTASVNGKDGMPLKTF  154

Query  858   HSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFC  679
              SATV V+A+YF AINI   N+AP  E  ++G QAVAL  SG  AA+Y+C  YG QDT  
Sbjct  155   QSATVAVDANYFVAINIIFENTAPH-EIGSRGGQAVALRISGTKAAFYSCSFYGNQDTLY  213

Query  678   DDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFV  508
             D +G H+F +C+I+G+VDFIFG+G++LY +  L+ +   +A   AQ R+ +  ++G+SF 
Sbjct  214   DHKGLHYFNNCFIQGSVDFIFGSGRSLYQNCRLNSVTKKVASLTAQKRNNSSLESGFSFK  273

Query  507   HCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNT  328
              C +TG     +LGR W  +SRV+++YT M + V P GW+   G        ++GEYK +
Sbjct  274   DCVVTGSGL-VYLGRAWGDYSRVVFSYTYMEKVVLPQGWNDW-GDQKRDARVFYGEYKCS  331

Query  327   GPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             GPGA   GR  +A+ LTDE+ KPFI   +++G  WL+ P
Sbjct  332   GPGANYTGRVPWARILTDEDAKPFIGTYYVDGDTWLISP  370



>ref|XP_006349162.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=386

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 196/322 (61%), Gaps = 13/322 (4%)
 Frame = -1

Query  1146  PVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYT  967
             P     +LDP+L  AE N   I VS+DG G+F TI +ALAS+P  N +RVI+ I  G Y 
Sbjct  67    PAPVSSSLDPKLIYAEMNKMIISVSQDGSGNFNTIKEALASIPLYNKRRVILDIKPGVYR  126

Query  966   ERVIIEKEKPFITLYGDPDATPFINFHKTSTKDGT-------VHSATVIVEADYFTAINI  808
             E++ I +  PF+T  GD    P I  + T++  GT         SATV V+ADYF AIN+
Sbjct  127   EKINIPRSLPFVTFRGDSSNPPRITGNDTASATGTGGTPLKTFQSATVSVDADYFIAINV  186

Query  807   NILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTV  628
                N+AP   GT  G QAVAL  SG+ AA+YNC  YG QDT  D +G H+F +C+I+G+V
Sbjct  187   IFENTAPHVVGTA-GEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSV  245

Query  627   DFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGW  457
             DFIFG G++LY + +L+ +   +A   AQ R  +   +G+SF +  ITG     +LGR W
Sbjct  246   DFIFGYGRSLYENCQLNSVAKKVASLTAQKRTNSSILSGFSFKNSTITGT-GSVYLGRAW  304

Query  456   MAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLT  277
               +SRVI++YT M   V PLGW+   GK       Y+GEY+ +GPGA M GR  +A+ L 
Sbjct  305   GDYSRVIFSYTYMDNIVLPLGWNDW-GKTIRDSRVYYGEYRCSGPGANMTGRVPWARILN  363

Query  276   DEEVKPFITLGFIEGSKWLLPP  211
             DEE  PFI   +++G+ WL+ P
Sbjct  364   DEEAMPFIETYYVDGNSWLMHP  385



>ref|XP_001769271.1| predicted protein [Physcomitrella patens]
 gb|EDQ65983.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/363 (42%), Positives = 206/363 (57%), Gaps = 21/363 (6%)
 Frame = -1

Query  1263  LIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKNLDPELAKAESNPKH  1084
             L++ + LV    P   +  S  +P  + EV + F+S V+ V  +       AK  +    
Sbjct  10    LLVTVALVCSAEP---AQGSQKVPETREEVIASFASWVQRVGEKHAAWERAAKTATTADE  66

Query  1083  ---------IRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFI  931
                      I V + G G+F+T+ +AL S+PE +   V I +  G Y ERV+I K K FI
Sbjct  67    FASKVGETVIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIPKSKEFI  126

Query  930   TLYGDPDATPFINFHKTSTKDGTVH-SATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             TL G       I     +   GT + SAT  V A +FTA NI+  NS+P  +G  +  QA
Sbjct  127   TLQGAGRDVTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFENSSPPPDGGAQ-QQA  185

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHV  574
             VAL  +GDM A+Y C  YG QDT  D  GRHFFKD  I GTVDFIFG+GK+LY + EL V
Sbjct  186   VALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDFIFGDGKSLYKNCELRV  245

Query  573   I---DGVIAAQARHTNKEDTGYSFVHCKIT--GPRQGGFLGRGWMAFSRVIYAYTEMTEA  409
             +    G + AQ R +  EDTGYSFV+CK+T  GP Q  +LGR W  +SRVI+A+TE    
Sbjct  246   LPSSGGSLTAQKRLSGSEDTGYSFVNCKVTGSGPPQ-VYLGRAWGPYSRVIFAFTEFANI  304

Query  408   VRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGS  229
             ++P GW+   G P    T ++G YK  GPGA    R Y++K+LTD E  PF++L +I+G 
Sbjct  305   IKPEGWYNW-GDPSREKTVFYGMYKCFGPGASSPSRAYYSKELTDAEAAPFLSLNYIDGG  363

Query  228   KWL  220
              W+
Sbjct  364   LWV  366



>ref|XP_010276487.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nelumbo nucifera]
Length=392

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 197/324 (61%), Gaps = 13/324 (4%)
 Frame = -1

Query  1152  VEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGN  973
               P A+ K LD +L KAE N   +RVS+DG GD+ +I +AL  +P  NT+RVI+ I  G 
Sbjct  65    ARPAADLKGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGV  124

Query  972   YTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAI  814
             Y E+++I + +PFIT  GD    P I  + T++   +DG    T  SATV V ADYF AI
Sbjct  125   YREKILIPRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAI  184

Query  813   NINILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEG  634
             NI   N+AP   G+T G QAVAL  SG+ AA++NC  YG QDT  D +G H+F +C+I+G
Sbjct  185   NIIFENTAPHDIGST-GEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQG  243

Query  633   TVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGR  463
             +VDFIFG G++LY +  L+ I   +A   AQ R      +G+SF    +TG     +LGR
Sbjct  244   SVDFIFGYGRSLYENCYLNSISKKVASLTAQKRTNISLSSGFSFKDSVVTGSGL-VYLGR  302

Query  462   GWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKK  283
              W   SRVI++YT M + V P GW    G      + Y+GEYK +GPGA + GR  +A+ 
Sbjct  303   AWGDRSRVIFSYTYMDKVVLPQGWSDW-GDQKRESSVYYGEYKCSGPGANLTGRVRWART  361

Query  282   LTDEEVKPFITLGFIEGSKWLLPP  211
             LTD+E KPFI   ++ G  WLL P
Sbjct  362   LTDKEAKPFIGAYYVNGKTWLLSP  385



>ref|XP_007051206.1| Pectinesterase [Theobroma cacao]
 gb|EOX95363.1| Pectinesterase [Theobroma cacao]
Length=388

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/388 (40%), Positives = 222/388 (57%), Gaps = 26/388 (7%)
 Frame = -1

Query  1302  MVRKNMETMRVNQLIMVIVLV--HYL-----SPGVVSDD----SIPIPANKAEVKSWFSS  1156
              VR  M +    QL++ +++    YL     +PG  +D     S  +  +K++   W + 
Sbjct  3     FVRLLMASEYYFQLVLFLIVFCNFYLKTTSSNPGSETDHDKWLSWHVRNHKSKQIFWQAE  62

Query  1155  NV--EPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIG  982
             ++   P A  + LD EL  AE N   I V +DG GDF TI +AL+S+P  N++RVI+ I 
Sbjct  63    SLIQSPGAKGRVLDDELRMAEMNKVRINVGQDGSGDFRTINEALSSIPSRNSRRVILVIK  122

Query  981   GGNYTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYF  823
              G Y E+V+I +  PFIT  GD    P I  + T++   KDG    T  SATV V+A+YF
Sbjct  123   PGIYREKVVIPRTLPFITFLGDASNPPTITGNDTASGPGKDGMPLKTFQSATVAVDANYF  182

Query  822   TAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCY  643
              AIN+   N+ P   G ++G QAVAL  SG  AA+YNC  YG QDT  D +G H+  +C+
Sbjct  183   VAINMKFENTVPHQIG-SRGGQAVALRISGTKAAFYNCSFYGDQDTLYDHKGLHYLNNCF  241

Query  642   IEGTVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGG-  475
             I+G+VDFIFG G++LY +  ++ I   +A   AQ R      +G+SF  C +TG   G  
Sbjct  242   IQGSVDFIFGYGRSLYENCTVNSISKKVASLTAQKRSNASLASGFSFKDCVVTGSSPGMV  301

Query  474   FLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPY  295
             +LGR W  +SRV+++YT M   V P GW    G      + Y+GEYK +GPGA   GR  
Sbjct  302   YLGRAWGDYSRVVFSYTFMDRVVLPQGWSDW-GDRKRDASVYYGEYKCSGPGANFTGRVP  360

Query  294   FAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +A+ LT+EE +PFI   ++EG  WL+ P
Sbjct  361   WARILTEEEAEPFIGTYYVEGDTWLISP  388



>ref|XP_011040796.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=399

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 198/322 (61%), Gaps = 13/322 (4%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LD +L +AE N   + VS+DG GDF+TIT+A  S+P  NT+RVII+I  G Y E++ I +
Sbjct  70    LDGKLRQAEMNSVRVTVSQDGTGDFKTITEATNSIPPYNTRRVIIAIKPGVYREKIFIPR  129

Query  945   EKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAININILNSAP  787
               PF+T  GD    P I  + T++   KDG    T  SATV V+A+YF AI++   N+AP
Sbjct  130   TMPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDANYFVAISMKFENTAP  189

Query  786   RWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNG  607
                GT +G QAVAL  SG  AA+YNC  YG QDT  D +G H+F +C+I+G+VDFIFG+G
Sbjct  190   HVIGTKQG-QAVALRISGTKAAFYNCSFYGNQDTLYDHKGLHYFNNCFIQGSVDFIFGSG  248

Query  606   KTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVI  436
             ++ Y +  L+ I   +A   AQ R  +   +G+SF    ITG     +LGR W  +SRVI
Sbjct  249   RSFYENCHLNSIAKKVASLTAQKRSNSSLASGFSFKDSTITGSGL-IYLGRAWGDYSRVI  307

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             ++YT M + + P GW+   G        Y+GEY+ TGPGA + GR  +A+ LTDEE +PF
Sbjct  308   FSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYQCTGPGANLTGRVAWARVLTDEEARPF  366

Query  255   ITLGFIEGSKWLLPPIKLDPHA  190
             I   ++EG  WL+ P  L   A
Sbjct  367   IGTYYVEGDTWLISPENLSSPA  388



>ref|XP_010276488.1| PREDICTED: probable pectinesterase 53 isoform X2 [Nelumbo nucifera]
Length=391

 Score =   258 bits (660),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 145/324 (45%), Positives = 197/324 (61%), Gaps = 14/324 (4%)
 Frame = -1

Query  1152  VEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGN  973
               P A+ K LD +L KAE N   +RVS+DG GD+ +I +AL  +P  NT+RVI+ I  G 
Sbjct  65    ARPAADLKGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGV  124

Query  972   YTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAI  814
             Y E+++I + +PFIT  GD    P I  + T++   +DG    T  SATV V ADYF AI
Sbjct  125   YREKILIPRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAI  184

Query  813   NINILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEG  634
             NI   N+AP   G+T G QAVAL  SG+ AA++NC  YG QDT  D +G H+F +C+I+G
Sbjct  185   NIIFENTAPHDIGST-GEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQG  243

Query  633   TVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGR  463
             +VDFIFG G++LY +  L+ I   +A   AQ R      +G+SF    +TG     +LGR
Sbjct  244   SVDFIFGYGRSLYENCYLNSISKKVASLTAQKRTNISLSSGFSFKDSVVTGSGL-VYLGR  302

Query  462   GWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKK  283
              W   SRVI++YT M + V P GW     +     + Y+GEYK +GPGA + GR  +A+ 
Sbjct  303   AWGDRSRVIFSYTYMDKVVLPQGWSDWGDQKRE--SVYYGEYKCSGPGANLTGRVRWART  360

Query  282   LTDEEVKPFITLGFIEGSKWLLPP  211
             LTD+E KPFI   ++ G  WLL P
Sbjct  361   LTDKEAKPFIGAYYVNGKTWLLSP  384



>ref|XP_010679463.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/376 (39%), Positives = 220/376 (59%), Gaps = 36/376 (10%)
 Frame = -1

Query  1257  MVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVE------------------PVANR  1132
             +  + +H++S   ++ D       + E +SW + NV+                  P    
Sbjct  14    LFFISLHHISLWSLATDP------QQEYESWLNWNVQNHRQRRPHTLPQPNTAATPAGPS  67

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             K+LD +L  AE+N   + V+++G GD+ TIT+A+ ++P  NT+RVI+ I  G Y E++ I
Sbjct  68    KDLDVKLKNAETNKVRLTVNQNGTGDYRTITEAIDNIPLRNTRRVILDISPGIYREKIHI  127

Query  951   EKEKPFITLYGDPDATPFINFHKTS--TKDG----TVHSATVIVEADYFTAININILNSA  790
              K KPFI+  GD    P I  + T+  T DG    T  SATV V+ADYF A+NI   N+A
Sbjct  128   PKTKPFISFVGDSSNPPTITGNDTASVTHDGTPLHTFQSATVAVDADYFVALNIIFENTA  187

Query  789   PRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGN  610
                E    G QAVAL  SG  A++Y    YG QDT  D +G H+F++C+I+G+VDFIFG 
Sbjct  188   TH-EVGKAGEQAVALRISGTKASFYEASFYGSQDTLYDHKGLHYFRNCFIQGSVDFIFGY  246

Query  609   GKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRV  439
             G++ Y +  ++ I   +A   AQ R  +  ++G+SF  CK+TG     +LGR W  +SRV
Sbjct  247   GRSFYENCTINSIAKKVASVTAQKRSKSSMESGFSFKDCKVTGSGL-VYLGRAWGDYSRV  305

Query  438   IYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKP  259
             +Y+++ + + V PLGW+   GK +   + Y+GEYK +GPG+ M GR ++A+ LTD+E +P
Sbjct  306   VYSFSFLDKLVLPLGWNNW-GKSNRDKSVYYGEYKCSGPGSNMTGRVHWARALTDKEAEP  364

Query  258   FITLGFIEGSKWLLPP  211
             FI   ++EG  WL+ P
Sbjct  365   FIGTYYVEGDTWLISP  380



>ref|XP_009787978.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nicotiana sylvestris]
Length=393

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 206/358 (58%), Gaps = 35/358 (10%)
 Frame = -1

Query  1188  NKAEVKSWFSSNV---------------EPVANRK-------NLDPELAKAESNPKHIRV  1075
             N  +++ W S NV               E V NRK       +LDP L  AE N   I V
Sbjct  39    NIGQLEEWISLNVKHYNRKRAASLKWMQESVRNRKQQVPSSSSLDPRLRNAELNKILISV  98

Query  1074  SKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFI  895
             +++G G+F+TI +ALAS+P  N +RVI+ I  G Y E++ I +  PF+T  GD    P I
Sbjct  99    NQEGIGNFKTIKEALASIPVYNKRRVILDIKPGVYREKINIPRSLPFVTFRGDSSDPPRI  158

Query  894   NFHKTSTKDGT-------VHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
               + T+   GT         SATV V+ADYF AIN+   N+A    G+  G QAVAL  S
Sbjct  159   TGNDTAAAAGTDGRPLKTFQSATVSVDADYFVAINVIFENTAAHVVGSV-GEQAVALRIS  217

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDGVIA  556
             G+ AA+Y+C  YG QDT  D +G H+F +C+++G+VDFIFG G++LY +  L+ +   +A
Sbjct  218   GNKAAFYDCSFYGSQDTLYDHKGLHYFNNCFVQGSVDFIFGYGRSLYENCHLNSVAKKVA  277

Query  555   ---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
                AQ R  +   +G+SF +  ITG     +LGR W  +SRVI++YT M E V PLGW  
Sbjct  278   SLTAQKRTNSSILSGFSFKNSTITGT-GSVYLGRAWGDYSRVIFSYTYMDEIVLPLGWSD  336

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPP  211
               GK       Y+GEY+ +GPGA M GR  +A+ LTDEE  PFI   +I+G+ WL+ P
Sbjct  337   W-GKTSRDSRVYYGEYRCSGPGANMTGRVPWARILTDEEAMPFIGTYYIDGNSWLIHP  393



>ref|XP_002975044.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
 gb|EFJ23829.1| hypothetical protein SELMODRAFT_102829 [Selaginella moellendorffii]
Length=318

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 187/314 (60%), Gaps = 11/314 (4%)
 Frame = -1

Query  1128  NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIE  949
             +L   L +AE N   I V++DG G+F +I +A+ S+PE N QRVI+ I  G Y E++ I 
Sbjct  6     HLIESLVEAERNQSVIVVARDGFGNFSSIAEAIDSIPEQNQQRVIVRIKAGVYREKIAIP  65

Query  948   KEKPFITLYGDPDATPFINFHKT-STKDGT-----VHSATVIVEADYFTAININILNSAP  787
             K KPF+TL GD  +   I ++ T S ++GT      +SAT+ + + +F A NI   N A 
Sbjct  66    KSKPFVTLQGDGSSLTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQNEAI  125

Query  786   RWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNG  607
                    G QAVAL  S DMAA+Y+C  +G QDT  D +GRH+FK C+++G+VDFIFG G
Sbjct  126   AHIHGETGKQAVALRISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDFIFGYG  185

Query  606   KTLYLDTELHVI---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVI  436
             ++LY D  L+ I    G I AQ R     ++G+SFV+C ITG  +  +LGR W   SRV+
Sbjct  186   RSLYKDCHLYSIANKTGAITAQKRTIRNMNSGFSFVNCSITGSGR-IYLGRAWGDRSRVV  244

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             Y+YT M   + P GW      P    T +F +Y+ +GPGAK   R  +A+ LT EE +PF
Sbjct  245   YSYTYMDALIAPQGWQNW-NHPERNRTVFFAQYECSGPGAKTSQRVAWARTLTFEEAQPF  303

Query  255   ITLGFIEGSKWLLP  214
             +   FI G  WLL 
Sbjct  304   LGTDFIHGETWLLS  317



>ref|XP_002974192.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
 gb|EFJ24414.1| hypothetical protein SELMODRAFT_101090 [Selaginella moellendorffii]
Length=318

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 187/314 (60%), Gaps = 11/314 (4%)
 Frame = -1

Query  1128  NLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIE  949
             +L   L +AE N   I V++DG G+F +I +A+ S+PE N QRVI+ I  G Y E++ I 
Sbjct  6     HLIESLVEAERNQSVIVVARDGLGNFSSIAEAIDSIPEQNQQRVIVWIKAGVYREKIAIP  65

Query  948   KEKPFITLYGDPDATPFINFHKT-STKDGT-----VHSATVIVEADYFTAININILNSAP  787
             K KPF+TL GD  +   I ++ T S ++GT      +SAT+ + + +F A NI   N A 
Sbjct  66    KSKPFVTLQGDGSSLTIITWNSTASDRNGTNLLKTYNSATISINSRFFIAKNITFQNEAI  125

Query  786   RWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNG  607
                    G QAVAL  S DMAA+Y+C  +G QDT  D +GRH+FK C+++G+VDFIFG G
Sbjct  126   AHIHGETGKQAVALRISADMAAFYDCNFHGGQDTLYDHKGRHYFKRCFVQGSVDFIFGYG  185

Query  606   KTLYLDTELHVI---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVI  436
             ++LY D  L+ I    G I AQ R     ++G+SFV+C ITG  +  +LGR W   SRV+
Sbjct  186   RSLYKDCHLYSIANKTGAITAQKRTIRNMNSGFSFVNCSITGSGR-IYLGRAWGDRSRVV  244

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             Y+YT M   + P GW      P    T +F +Y+ +GPGAK   R  +A+ LT EE +PF
Sbjct  245   YSYTYMDALIAPQGWQNW-NHPERNRTVFFAQYECSGPGAKTSQRVAWARTLTFEEAQPF  303

Query  255   ITLGFIEGSKWLLP  214
             +   FI G  WLL 
Sbjct  304   LDTDFIHGETWLLS  317



>ref|XP_003632380.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CAN79461.1| hypothetical protein VITISV_042494 [Vitis vinifera]
 emb|CBI36991.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 192/317 (61%), Gaps = 13/317 (4%)
 Frame = -1

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             K LD +L+KAE N   + VS+DG  D+ TI+DAL ++P  NT+RVI+ I  G Y E+V +
Sbjct  68    KALDIKLSKAEMNKVTMTVSQDGTADYTTISDALHTIPLYNTRRVILVIKPGVYREKVTV  127

Query  951   EKEKPFITLYGDPDATPFINFHKTSTKDG-------TVHSATVIVEADYFTAININILNS  793
              +  PF+T  GD    P I  + T++  G       T  SATV V+A+YF AINI   N+
Sbjct  128   PRALPFVTFLGDASDPPTITGNDTASVIGRNGVPLKTFQSATVGVDANYFVAINIKFENT  187

Query  792   APRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFG  613
             AP   G+  G QAVAL  SG  AA+YNC  YG QDT  D  G H+F +C+I+G+VDFIFG
Sbjct  188   APHVIGSA-GGQAVALRISGTKAAFYNCSFYGSQDTLYDHTGLHYFNNCFIQGSVDFIFG  246

Query  612   NGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSR  442
              G++LY +  L+ +   +A   AQ R T+   +G+SF  C +TG     +LGR W  +SR
Sbjct  247   YGRSLYENCSLNSVAKKVASLTAQKRSTSSMASGFSFKDCVVTGSGT-VYLGRAWGDYSR  305

Query  441   VIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVK  262
             V+++YT M + V P GW    GK       Y+GEYK +GPGA +  R  +A  +TDEE +
Sbjct  306   VVFSYTFMDKLVLPQGWSDW-GKKKLDSRVYYGEYKCSGPGANLTARVPWAHMMTDEEAE  364

Query  261   PFITLGFIEGSKWLLPP  211
             PF+   +++G  WL+ P
Sbjct  365   PFLATHYVDGDTWLISP  381



>ref|XP_002320279.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
 gb|EEE98594.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
Length=381

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 195/315 (62%), Gaps = 13/315 (4%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LD +L +AE N   + VS+DG G+F+TI +A+ S+P  NT+RVII+I  G Y E++ I +
Sbjct  70    LDGKLRQAEMNSVRVTVSQDGNGEFKTIKEAINSIPPYNTRRVIIAIKPGVYREKIFIPR  129

Query  945   EKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAININILNSAP  787
               PF+T  GD    P I  + T++   KDG    T  SATV V+A+YF AI++   N+AP
Sbjct  130   TFPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDANYFVAISMKFENTAP  189

Query  786   RWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNG  607
                GT K  QAVAL  SG  AA+YNC  +G QDT  D +G H+F +C+I+G+VDFIFG+G
Sbjct  190   HVIGT-KQEQAVALRISGTKAAFYNCSFFGDQDTLYDHKGLHYFNNCFIQGSVDFIFGSG  248

Query  606   KTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVI  436
             ++ Y +  L+ +   +A   AQ R  +   +G+SF    ITG     +LGR W  +SRVI
Sbjct  249   RSFYENCHLNSVAKKVASLTAQKRSNSSLASGFSFKDSTITGSGL-IYLGRAWGDYSRVI  307

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             ++YT M + + P GW+   G        Y+GEYK TGPGA + GR  +A+ LTDEE +PF
Sbjct  308   FSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYKCTGPGANLTGRVAWARVLTDEEARPF  366

Query  255   ITLGFIEGSKWLLPP  211
             I   ++EG  WL+ P
Sbjct  367   IGTYYVEGDTWLISP  381



>ref|XP_004229371.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=387

 Score =   251 bits (640),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 196/325 (60%), Gaps = 13/325 (4%)
 Frame = -1

Query  1155  NVEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGG  976
             +V P     + DP+L  AE N   I VS+DG  +F TI +ALA++P  N +RVI+ I  G
Sbjct  65    HVPPPPVSSSFDPKLIYAEMNKMIITVSQDGSSNFNTIKEALATIPLYNKRRVILDIKPG  124

Query  975   NYTERVIIEKEKPFITLYGDPDATPFI--NFHKTSTKDG-----TVHSATVIVEADYFTA  817
              Y E++ I +  PF+T  GD    P I  N   ++T+ G     T  SATV V+ADYF A
Sbjct  125   VYREKINIPRSSPFVTFRGDSSNPPRITGNDTASATRTGGTPLKTFQSATVSVDADYFIA  184

Query  816   ININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIE  637
             IN+   N+AP   GT  G QAVAL  SG+ AA+YNC  YG QDT  D +G H+F +C+I+
Sbjct  185   INVIFENTAPHVVGTA-GEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQ  243

Query  636   GTVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLG  466
             G+VDFIFG G++LY + +L+ +   +A   AQ R  +   +G+SF +  ITG     +LG
Sbjct  244   GSVDFIFGYGRSLYENCQLNSVAKKVASLTAQKRTNSSILSGFSFKNSTITG-TGSVYLG  302

Query  465   RGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK  286
             R W  +SRVI++YT M   V PLGW+   GK       Y+GEY+ +GPGA + GR  +A+
Sbjct  303   RAWGDYSRVIFSYTYMDNIVLPLGWNDW-GKTTRDSRVYYGEYRCSGPGANITGRVPWAR  361

Query  285   KLTDEEVKPFITLGFIEGSKWLLPP  211
              L DEE  PFI   +++G  WL+ P
Sbjct  362   ILNDEEAMPFIGTYYVDGDSWLIHP  386



>ref|XP_004495886.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=380

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 195/321 (61%), Gaps = 14/321 (4%)
 Frame = -1

Query  1140  ANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTER  961
             A  + LD +L +AES    I V+++G  DF+TIT+A+ S+P +NT+R I+SI  G Y E+
Sbjct  55    ATEQGLDLKLRQAESKIVRITVNQNGTADFKTITEAINSIPLNNTRRYIVSIAPGTYREK  114

Query  960   VIIEKEKPFITLYGDPDATPFINFHKTST---KDGT----VHSATVIVEADYFTAININI  802
             + I K+KPFIT  GD    P I  + T     +DGT     +++TV VEA YF AININ 
Sbjct  115   ITIPKKKPFITFLGDAMDRPTITGNDTKGMIGRDGTELKTFNTSTVAVEARYFIAININF  174

Query  801   LNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDF  622
              N+A R +  +K  Q VAL  S +  A+YNC  YG QDT  D +G H+FK+C I+GTVDF
Sbjct  175   ENTA-RHDNASKEEQGVALRVSANKTAFYNCSFYGAQDTLYDHKGLHYFKNCLIKGTVDF  233

Query  621   IFGNGKTLYLDTELHV---IDGVIAAQARHTNKE-DTGYSFVHCKITGPRQGGFLGRGWM  454
             IFG G++ Y +  +H        I AQ R  N    +G+SF + K+TG  Q  +LGR W 
Sbjct  234   IFGYGRSFYENCHIHSTTKTKSYITAQRRSKNTSMASGFSFKNSKVTGSGQ-TYLGRPWG  292

Query  453   AFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTD  274
              +SRV+++YT M   + P GW     +  Y    Y+GEYK +GPG+ +  R  +A+ LTD
Sbjct  293   NYSRVVFSYTYMDNTILPEGWSDWNHEHRYLN-AYYGEYKCSGPGSNLSERVPWARNLTD  351

Query  273   EEVKPFITLGFIEGSKWLLPP  211
             +E +PF+   FIEG+ WL+ P
Sbjct  352   QEAQPFLGTHFIEGNTWLISP  372



>ref|XP_008801747.1| PREDICTED: probable pectinesterase 53 [Phoenix dactylifera]
Length=386

 Score =   250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 155/388 (40%), Positives = 221/388 (57%), Gaps = 41/388 (11%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPI---PAN-KAEVKSWFSSNVE----PVANRKN-  1126
             +  N L+ +++L  +L P      S P+   P N + E   W S NV+     VA + N 
Sbjct  5     LHTNSLLPLVLLTFFLLP------STPLSSYPNNERDEFMKWISWNVQNHKRTVALQLNS  58

Query  1125  -----------LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGG  979
                        LD +LAKAE+      VS++G G +++I +A+ S+P  NT+RVI+ I  
Sbjct  59    NSGVLHGGSRSLDMKLAKAEAAATRYIVSQNGSGSYKSIREAIDSIPLHNTRRVILEIRS  118

Query  978   GNYTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFT  820
             G Y E+++I K   FIT  G+  + P I  + T+    KDG    T HS TV V A+YF 
Sbjct  119   GIYREKIVIPKSMSFITFLGNGASPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYFV  178

Query  819   AININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYI  640
             A NI   N+AP  E  T G QAVAL  SGD AA+YNC  YG QDT  D +G H+F +C+I
Sbjct  179   AANIKFENTAPYPEVGTTGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCFI  238

Query  639   EGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFL  469
             +G+VDFIFG G++LY +  L+ I      +AAQ       ++G+SF+   ITG     +L
Sbjct  239   QGSVDFIFGYGRSLYENCYLNSITKRVASLAAQKGSLKTMESGFSFLRSTITGSGL-VYL  297

Query  468   GRGWMAFSRVIYAYTEMTEAVRPLGWH--GVPGKPHYGGTTYFGEYKNTGPGAKMDGRPY  295
             GR W   SRV+++YT M + V P GW+  G+  +P   G  Y+GEY+ +GPGA   GR +
Sbjct  298   GRAWGDHSRVVFSYTYMDKVVIPEGWNSWGIQ-RPETSG-VYYGEYQCSGPGANWTGRVH  355

Query  294   FAKKLTDEEVKPFITLGFIEGSKWLLPP  211
             +A+ LTD+E +PF+   ++ G  WLL P
Sbjct  356   WARLLTDKEAQPFLGTYYVYGDSWLLGP  383



>gb|ACU13228.1| unknown [Glycine max]
Length=218

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 157/218 (72%), Gaps = 2/218 (1%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPANKA++  W+++NV P+  RK+ +DP 
Sbjct  1     MASRTICFTIQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVII IG GNY E++ IEK KPF
Sbjct  61    LVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             +TLYG P+  P + F  T+ + GTV SAT+IVE+DYF A NI I N+APR +  T G QA
Sbjct  121   VTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYI  640
             VAL  SGD AA+YNCK+YGFQDT CDD  RHFFKDC I
Sbjct  181   VALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLI  218



>ref|NP_001067039.1| Os12g0563700 [Oryza sativa Japonica Group]
 gb|ABA98964.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30058.1| Os12g0563700 [Oryza sativa Japonica Group]
 dbj|BAG91682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 191/323 (59%), Gaps = 16/323 (5%)
 Frame = -1

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             K LD EL+ AE+      VS DGKG F TIT+A+ +VPE N +RVI+ I  G Y E+++I
Sbjct  92    KALDAELSAAEAGAARYVVSGDGKGKFRTITEAIKAVPEYNKKRVILDIRPGTYKEKLLI  151

Query  951   EKEKPFITLYGDPDATPFINFH---KTSTKDG----TVHSATVIVEADYFTAININILNS  793
                KPFIT  G+P + P I +     T  KDG    T+ SATV VEADYF A +I   N+
Sbjct  152   PFTKPFITFVGNPRSPPTIMWDDRAATHGKDGQPMGTMLSATVAVEADYFMASSIIFKNN  211

Query  792   APRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFG  613
             AP       G QAVAL   G   A YNC + G QDT  D +G H+FK+C I G+VDFIFG
Sbjct  212   APMAAPGAHGGQAVALRVFGSKVAMYNCTIDGGQDTLYDHKGLHYFKNCLIRGSVDFIFG  271

Query  612   NGKTLYLDTELHVID---GVIAAQARHTNKE---DTGYSFVHCKITGPRQGGFLGRGWMA  451
              G++LY D  +  +     V+ AQ R  N     DTG+SF+ CKI+G  Q  +LGR W  
Sbjct  272   FGRSLYADCTIESVTKEVAVVTAQQRSKNIAEAIDTGFSFLRCKISGIGQ-IYLGRAWGD  330

Query  450   FSRVIYAYTEMTEAVRPLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTD  274
              SRV+Y+YT M + V P+GW G    KP + G  Y+GEYK +GPGA    R  ++  L+D
Sbjct  331   SSRVVYSYTTMGKEVVPIGWDGWEVQKPEHSG-IYYGEYKCSGPGALPSKRIGWSLVLSD  389

Query  273   EEVKPFITLGFIEGSKWLLPPIK  205
              + KPF    F+ G  W+LPP K
Sbjct  390   IQAKPFTGSHFVYGDSWILPPPK  412



>ref|XP_004964049.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=425

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/337 (43%), Positives = 196/337 (58%), Gaps = 14/337 (4%)
 Frame = -1

Query  1173  KSWFSSNVEPVANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVI  994
             K  +++ V+     K +D EL+ AE+      VS DGKG F TI DA+ +VPE+N +RVI
Sbjct  87    KQIYAAKVKNGTGGKAVDAELSAAEAGAVRYVVSADGKGKFRTINDAIKAVPENNKKRVI  146

Query  993   ISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVE  835
             + I  G Y E+V++   K FIT  GDP   P I +  T+    KDG    TV SATV VE
Sbjct  147   LDIRPGTYKEKVLVPYTKHFITFLGDPKQPPVIMWDDTAATRGKDGLPVGTVGSATVAVE  206

Query  834   ADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFF  655
             +DYF A  I   N AP      KG QAVAL   G  AA+YNC + G QDT  D +G H+F
Sbjct  207   SDYFLASGIVFRNHAPMAAPGAKGGQAVALRVFGTKAAFYNCTIDGGQDTLYDHKGLHYF  266

Query  654   KDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKED---TGYSFVHCKIT  493
             K C I+G+VDFIFG G++LY D  +  +     V+ AQ R  +  D   +G+SF+ C+++
Sbjct  267   KGCLIKGSVDFIFGFGRSLYEDCSIVSVTKQVAVLTAQQRTRSIADAIESGFSFLRCRVS  326

Query  492   GPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAK  313
             G  Q  +LGR W   SRV+YAYT+M + V P+GW G   +       Y+GEY+ +GPGA 
Sbjct  327   GDGQ-IYLGRAWGDSSRVVYAYTDMGKEVVPVGWDGWNIQTPERSGIYYGEYRCSGPGAL  385

Query  312   MDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLPPIKL  202
                R  ++  L D++ KPF    F+ G  W+LPP KL
Sbjct  386   AHKRIGWSLILNDDQAKPFTGTHFVYGDSWILPPPKL  422



>gb|EEC69509.1| hypothetical protein OsI_38743 [Oryza sativa Indica Group]
Length=415

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 189/323 (59%), Gaps = 16/323 (5%)
 Frame = -1

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             K LD EL+ AE+      VS DGKG F TITDA+ +VPE N +RVI+ I  G Y E+++I
Sbjct  93    KALDAELSAAEAGAARYVVSGDGKGKFRTITDAIKAVPEYNKKRVILDIRPGTYKEKLLI  152

Query  951   EKEKPFITLYGDPDATPFINFH---KTSTKDG----TVHSATVIVEADYFTAININILNS  793
                KPFIT  G+P + P I +     T  KDG    T+ SATV VEADYF A  I   N 
Sbjct  153   PFTKPFITFVGNPRSPPTIMWDDRAATHGKDGQPMGTMLSATVAVEADYFMASGIIFKNH  212

Query  792   APRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFG  613
             AP       G QAVAL   G   A YNC + G QDT  D +G H+FK+C I G+VDFIFG
Sbjct  213   APMAAPGAHGGQAVALRVFGSKVAMYNCTIDGGQDTLYDHKGLHYFKNCLIRGSVDFIFG  272

Query  612   NGKTLYLDTELHVID---GVIAAQARHTNKE---DTGYSFVHCKITGPRQGGFLGRGWMA  451
              G++LY D  +  +     V+ AQ R  N     DTG+SF+ CKI+G  Q  +LGR W  
Sbjct  273   FGRSLYADCTIESVTKEVAVVTAQQRSKNIAEAIDTGFSFLRCKISGIGQ-IYLGRAWGD  331

Query  450   FSRVIYAYTEMTEAVRPLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTD  274
              SRV+Y+YT M + V P+GW G    KP + G  Y+GEYK +GPGA    R  ++  L+D
Sbjct  332   SSRVVYSYTTMGKEVVPIGWDGWEVQKPEHSG-IYYGEYKCSGPGALPSKRIGWSLVLSD  390

Query  273   EEVKPFITLGFIEGSKWLLPPIK  205
              + KPF    F+ G  W+LPP K
Sbjct  391   IQAKPFTGSHFVYGDSWILPPPK  413



>gb|KEH25488.1| pectinesterase [Medicago truncatula]
Length=338

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 190/315 (60%), Gaps = 14/315 (4%)
 Frame = -1

Query  1125  LDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEK  946
             LD +L +AE+NP  I+VSKD    F+TI +AL S+P  N +RVI+SI  G Y E+++++ 
Sbjct  27    LDFKLRQAEANPVIIKVSKDASSKFKTIQEALNSIPPQNNRRVIVSIAAGVYREKILVKL  86

Query  945   EKPFITLYGDPDATPFINFHKTSTKDG-------TVHSATVIVEADYFTAININILNSAP  787
               PFIT  GDP   P +  + T+   G       T++SATV V++DYF A+N+   N+A 
Sbjct  87    --PFITFLGDPTDQPIVIGNDTAHDIGGDGKPLRTLNSATVAVDSDYFIAVNMKFQNTAS  144

Query  786   RWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNG  607
                G+    QAVAL  SG+ +A+YNC  YGFQDT  D +G H+F++C+I+G+VDFIFG+G
Sbjct  145   PRIGSND-DQAVALRTSGNKSAFYNCSFYGFQDTLYDHQGLHYFENCFIQGSVDFIFGHG  203

Query  606   KTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVI  436
             ++LY    +  I    G I AQ R     ++G+S  +    G  +  +LGR W  +SRVI
Sbjct  204   RSLYEGCIIKSIAEKMGFITAQDRSKESMESGFSIQNSHAIGSGKV-YLGRPWGVYSRVI  262

Query  435   YAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPF  256
             Y+YT M   + P GW       +   T Y+GEYK TG G+ + GRP +  +LTD E + F
Sbjct  263   YSYTSMDNLIFPQGWDDTMDNQNRSLTVYYGEYKCTGLGSNLAGRPPWVHRLTDTEARQF  322

Query  255   ITLGFIEGSKWLLPP  211
             I   FI+G  WL+ P
Sbjct  323   IGTQFIQGDTWLVRP  337



>ref|XP_004969916.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=403

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/346 (42%), Positives = 202/346 (58%), Gaps = 18/346 (5%)
 Frame = -1

Query  1209  DSIPIPAN--KAE-VKSWFSSNVEPVANRKNLDPELAKAESNPKH-IRVSKD-GKGDFET  1045
              + P PAN  +AE ++  F   V  +   ++   + A A + P + + V K+   GDF T
Sbjct  58    SAAPFPANATRAEMIERQFMEWVRYMGALRHSTFQHALARAFPSYSLVVDKNPAFGDFTT  117

Query  1044  ITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKD-  868
             I  A+ S+P  N  RV+I +  G YTE+V I   + FITL G    +  + +  T+    
Sbjct  118   IQAAIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGAGADSTIVQWGDTADSPT  177

Query  867   -------GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNC  709
                    GT +SAT  V A YF A NI   N++P  +    G QAVAL  S D AA+  C
Sbjct  178   GPKGRPLGTFNSATFAVNAQYFLARNITFKNTSPVPKPGATGKQAVALRVSADNAAFVGC  237

Query  708   KLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHT  538
             K  G QDT  D  GRH++K+CYIEG+VDFIFGN  +LY D  +H I    G + AQ R +
Sbjct  238   KFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLYEDCHVHAIARDYGALTAQNRQS  297

Query  537   NKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGG  358
               EDTG+SFV+C++TG     +LGR W  FSRV++AYT M   + P GW+   G P+   
Sbjct  298   MLEDTGFSFVNCRVTG-SGALYLGRAWGTFSRVVFAYTYMDNIIIPRGWYNW-GDPNREL  355

Query  357   TTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
             T ++G+YK TGPGA   GR  ++++LTD+E KPFI+L FI+G++W+
Sbjct  356   TVFYGQYKCTGPGASYAGRVAWSRELTDDEAKPFISLSFIDGTEWV  401



>ref|XP_010267113.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=379

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 195/327 (60%), Gaps = 14/327 (4%)
 Frame = -1

Query  1164  FSSNVEPVANRKNLDPELAKAESNPKHI-RVSKD-GKGDFETITDALASVPEDNTQRVII  991
             F   V+ VA+ K+     AK +  P +I  VSK+   GDF +I DA+ S+P  N  RV+I
Sbjct  53    FMKWVKFVASLKHSLFSTAKNKLFPSYILTVSKNPAAGDFTSIQDAIDSLPFINLVRVVI  112

Query  990   SIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTK-------DGTVHSATVIVEA  832
              +  G YTE+V I   K FIT+ G       + +  T+          GT +SAT  V +
Sbjct  113   KVNAGVYTEKVNIPPLKSFITIEGAGADKTIVQWGDTAQTLGPRGQPIGTFNSATFAVNS  172

Query  831   DYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFK  652
              YF A NI + N+ P       G QAVA   SGD AA+  C+  G QDT  D  GRH++K
Sbjct  173   AYFIAKNITLKNTNPLPPPGAVGKQAVAFRISGDTAAFLGCRFLGAQDTLYDHLGRHYYK  232

Query  651   DCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQ  481
             DCYIEG+VDFIFGNG +L+    +H I    G + AQ R +  EDTG+SFV+C++TG   
Sbjct  233   DCYIEGSVDFIFGNGLSLFEGCNVHAIAQNYGAVTAQNRMSLLEDTGFSFVNCRVTG-SG  291

Query  480   GGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGR  301
               +LGR W  FSRV++AYT M + V P GW+   G P+   T ++G+YK TGPGA   GR
Sbjct  292   ALYLGRAWGTFSRVVFAYTYMDDIVIPKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGR  350

Query  300   PYFAKKLTDEEVKPFITLGFIEGSKWL  220
               ++++LTDEE KPFITL FI+GS+W+
Sbjct  351   VSWSRELTDEEAKPFITLSFIDGSEWI  377



>gb|ACU18534.1| unknown [Glycine max]
Length=217

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 2/216 (1%)
 Frame = -1

Query  1287  METMRVNQLIMVIVLVHYLSPGVV-SDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPE  1114
             M +  +   I V ++V +L+  VV SDD++PIPA+KA++ +WFS+NV P+  RK+ +DP 
Sbjct  1     MASKTICTTIQVTLIVAFLTTQVVFSDDTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPA  60

Query  1113  LAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
             L  AE   K ++V +DG G+F+TITDA+ S+P  NT+RVI+ IG GNY E++ IEK KPF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPF  120

Query  933   ITLYGDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQA  754
             ITLYG P+  P + F +T+ K GTV SAT+IVE++YF A NI I NSAPR +G  +G QA
Sbjct  121   ITLYGVPEKMPNLTFGRTALKYGTVDSATLIVESNYFVAANIIISNSAPRPDGKIQGGQA  180

Query  753   VALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDC  646
             VAL  SGD AA+YNCK +GFQDT  DD  RHFFKDC
Sbjct  181   VALRISGDKAAFYNCKFFGFQDTIYDDRNRHFFKDC  216



>ref|XP_002531506.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF30860.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=367

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 149/350 (43%), Positives = 198/350 (57%), Gaps = 35/350 (10%)
 Frame = -1

Query  1170  SWFSSNVEPVANRKNLDPEL------AKAESNPKH---------------IRVSKDGK-G  1057
             SWF+SN    +NR  ++ E       AK   + KH               I+V+K  K G
Sbjct  19    SWFTSNGSN-SNRFVVNEEAYLQWLKAKQMGSFKHALFQKAKNKFKPCLTIKVNKKSKSG  77

Query  1056  DFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTS  877
             DF T+  AL S+P  N  RVIISIG G Y E++ I     +ITL G       I +  T+
Sbjct  78    DFVTLKKALNSIPVINNCRVIISIGAGTYREKIEIPGSMSYITLEGAGAGKTTIEWDDTA  137

Query  876   TKDG-------TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAY  718
              K G       T  SAT  + + YF A NI   N AP       G QAVAL  S D AA+
Sbjct  138   DKQGQGGHLLGTYGSATFAINSPYFIAKNITFKNKAPSPPSGALGKQAVALRISADTAAF  197

Query  717   YNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQA  547
               CK  G QDT  D  GRH+FK+CYIEG+VDFIFGNG +LY D  LH I    G + AQ 
Sbjct  198   IGCKFIGAQDTLYDHIGRHYFKECYIEGSVDFIFGNGLSLYDDCHLHAITNSFGALTAQK  257

Query  546   RHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPH  367
             R +  E+TG+SFV+CK+TG     +LGR W  FSRV++AYT M + + P GW+   G  +
Sbjct  258   RESMLEETGFSFVNCKVTGS-GALYLGRAWGTFSRVVFAYTYMDKIITPTGWYDW-GDKN  315

Query  366   YGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLL  217
                T ++G+YK +GPGA+  GR  ++++LT++E KPF+++ FI+G  WLL
Sbjct  316   REMTVFYGQYKCSGPGAQFGGRVSWSRELTEQEAKPFVSIDFIDGQDWLL  365



>ref|XP_010914653.1| PREDICTED: probable pectinesterase 53 [Elaeis guineensis]
Length=386

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 192/317 (61%), Gaps = 11/317 (3%)
 Frame = -1

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             + LD +LAKAE+      VS+DG G++++I +A+ S+P  NT+RVI+ I  G Y E+++I
Sbjct  68    RALDVKLAKAEAAAVRYIVSQDGSGNYKSIREAIDSIPLHNTRRVILEIRPGIYREKIVI  127

Query  951   EKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAININILNS  793
              K   F+T  G+  + P I  + T+    KDG    T HS TV V A+YF A NI   N+
Sbjct  128   PKSMSFVTFLGNGTSPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYFIAANIKFENT  187

Query  792   APRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFG  613
             AP  E  T G QAVAL  SGD AA+YNC  YG QDT  D +G H+F +C+I+G+VDFIFG
Sbjct  188   APYPEVGTMGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFG  247

Query  612   NGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSR  442
              G++LY +  L+ I   +A   AQ       ++G+SFV   ITG     +LGR W   SR
Sbjct  248   YGRSLYENCYLNSIAKRVASLTAQKGSIKTMESGFSFVRSAITGSGL-VYLGRAWGDHSR  306

Query  441   VIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVK  262
             V+++YT M + V P GW+    +       Y+GEY+ +GPGA   GR ++A+ LTDEE +
Sbjct  307   VVFSYTFMDKVVIPEGWNSWRIQQPETSGVYYGEYQCSGPGANWTGRVHWARLLTDEEAQ  366

Query  261   PFITLGFIEGSKWLLPP  211
             PF+   +I G  WLL P
Sbjct  367   PFLGTYYIYGDSWLLGP  383



>ref|XP_008673062.1| PREDICTED: pectinesterase isoform X1 [Zea mays]
 gb|ACR36293.1| unknown [Zea mays]
Length=391

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 198/342 (58%), Gaps = 16/342 (5%)
 Frame = -1

Query  1203  IPIPANKAE-VKSWFSSNVEPVANRKNLDPELAKAESNPKH-IRVSKD-GKGDFETITDA  1033
              P  A +AE ++  F   V  V   ++   + A A ++P + + V KD   GDF TI  A
Sbjct  50    FPANATRAEAIERQFVEWVRYVGGLRHSTFQHAVARASPSYSLVVDKDPALGDFTTIQAA  109

Query  1032  LASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKD-----  868
             + S+P  N  RV+I +  G YTE+V +   + FITL G       + +  T+        
Sbjct  110   VDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAFITLEGAGADKTVVQWGDTADSPTGPKG  169

Query  867   ---GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYG  697
                GT +SA+  V A YF A NI   N++P  +    G QAVAL  S D AA+  C+  G
Sbjct  170   RPLGTFNSASFAVNAQYFLARNITFKNTSPVPKPGAAGKQAVALRVSADNAAFVGCRFLG  229

Query  696   FQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GVIAAQARHTNKED  526
              QDT  D  GRH++KDCYI+G+VDFIFGN  +LY D  +H I    G + AQ R +  ED
Sbjct  230   AQDTLYDHSGRHYYKDCYIQGSVDFIFGNALSLYEDCHVHAIARDYGALTAQNRQSMLED  289

Query  525   TGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYF  346
             TG+SFV+C++TG     +LGR W  FSRV++AYT M + + P GW    G P+   T ++
Sbjct  290   TGFSFVNCRVTGS-GALYLGRAWGTFSRVVFAYTHMDDIIVPNGWFNW-GDPNRELTVFY  347

Query  345   GEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
             G+YK TGPGA   GR  ++ +LTD+E KPFI+L FI+G++W+
Sbjct  348   GQYKCTGPGATYAGRVAWSHELTDDEAKPFISLSFIDGTEWV  389



>ref|XP_011093645.1| PREDICTED: probable pectinesterase 53 isoform X2 [Sesamum indicum]
Length=386

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 177/290 (61%), Gaps = 12/290 (4%)
 Frame = -1

Query  1059  GDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKT  880
             GDF +I  AL S+P  N  RV+I++  G YTE+V I K K FIT+ G    +  + +  T
Sbjct  97    GDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKSFITIEGGGAESTIVEWGDT  156

Query  879   STKDG-------TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSGDMAA  721
             +   G       T  SAT  V+A YF A NI   N+ P       G+QAVA   SGD AA
Sbjct  157   AQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVPRAGETGTQAVAFRISGDTAA  216

Query  720   YYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELH---VIDGVIAAQ  550
             +  CK  G QDT  D  GRH++KDCYIEG+VDFIFGNG +L+ + E+H    + G + AQ
Sbjct  217   FVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNGLSLFEECEVHAVAAVTGAVTAQ  276

Query  549   ARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKP  370
              R +  +DTG+SFV+CK+TG     +LGR W  FSRV++AYT M   + P GWH   G P
Sbjct  277   GRSSMLDDTGFSFVNCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWHDW-GDP  334

Query  369   HYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
                 T ++G+YK  G GA   GR  ++++L+DEE KPFI+L FI+GS+W+
Sbjct  335   SRQLTVFYGQYKCRGAGASFAGRVSWSRELSDEEAKPFISLSFIDGSEWI  384



>ref|XP_008338574.1| PREDICTED: pectinesterase PPME1-like [Malus domestica]
Length=233

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 162/230 (70%), Gaps = 1/230 (0%)
 Frame = -1

Query  1278  MRVNQLIMVIVLVHYLSPGVVSDDSIPIPANKAEVKSWFSSNVEPVANRKN-LDPELAKA  1102
             M +N  +M+I ++   S   ++DD+IPIP++ ++V SWF +NV+    RK+ LDP L  A
Sbjct  1     MFINASLMIITILLTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNERKSTLDPALVAA  60

Query  1101  ESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLY  922
             E  P+ I+V +DG G+F+TITDA+ S+P  NT+R+ + I GG Y E++ I   KPF+T Y
Sbjct  61    EHAPQVIKVMQDGGGNFKTITDAINSIPAGNTKRMFVYIKGGVYNEKITIPHNKPFVTFY  120

Query  921   GDPDATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALT  742
             G P + P I F  T+ K GTV+S T+IVE+DYF A+N+ I+NSAP  +G  +G+QAVA+ 
Sbjct  121   GSPKSMPNITFDGTAQKYGTVYSGTLIVESDYFRAVNLVIINSAPEPDGIREGAQAVAVQ  180

Query  741   QSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYL  592
              SG+ AA+YNCK+ G+QDT  D +G H  KDC+I+GTVDFIF  GK LYL
Sbjct  181   ISGNKAAFYNCKMIGYQDTLYDYKGLHLXKDCFIQGTVDFIFRKGKXLYL  230



>ref|XP_006853729.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
 gb|ERN15196.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
Length=379

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 181/300 (60%), Gaps = 13/300 (4%)
 Frame = -1

Query  1086  HIRVSKD-GKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPD  910
             ++ V K+  KGDF TI  A+ S+P  N  RV+I +  G YTE+VII   K FIT+ G   
Sbjct  79    YLTVDKNPAKGDFTTIQSAIDSLPFINLVRVVIKVNPGTYTEKVIIPAMKAFITIEGAGA  138

Query  909   ATPFINFHKTSTK-------DGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAV  751
                 + +  T+          GT +SAT  V + YF A NI   N+ P  +    G QAV
Sbjct  139   DRTEVQWGDTAQTVGPTGQPIGTFNSATFAVNSPYFIAKNITFKNTTPVPKPGASGKQAV  198

Query  750   ALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI  571
             A   S D AA+  CK  G QDT  D  GRH++KDCYIEG+VDFIFGNG +LY    +H I
Sbjct  199   AFRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLYEGCHVHAI  258

Query  570   D---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRP  400
                 G + AQ R +  EDTG+SFV+CK+TG     +LGR W AFSRV++AYT M   + P
Sbjct  259   ANNYGALTAQNRMSLLEDTGFSFVNCKVTG-SGALYLGRAWGAFSRVVFAYTYMDNIIIP  317

Query  399   LGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
              GW+   G P+   T ++G+YK  GPGA   GR  ++++LTDEE KPFI+L FI+GS+W+
Sbjct  318   RGWYNW-GDPNREMTVFYGQYKCAGPGASFAGRVSWSRELTDEEAKPFISLSFIDGSEWI  376



>ref|XP_009406173.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 207/368 (56%), Gaps = 22/368 (6%)
 Frame = -1

Query  1263  LIMVIVLV-----HYLSPGVVSDDSIPIPANKAE---VKSWFSSNVEPVANRKNLDPELA  1108
             +I+++VLV     H  + G+      P P N      V+  F   V  V   ++     A
Sbjct  10    IIILLVLVDSGQVHCHTKGLRPGRRAPPPVNSTSAGMVEQQFMRWVRLVGGLRHSVFGRA  69

Query  1107  KAESNPKH-IRVSKD-GKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPF  934
               ++ P + + V K+   GDF TI +A+ S+P  N  RV+I +  G YTE+V +   + F
Sbjct  70    LNKAFPSYTLTVDKNPSVGDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPMRAF  129

Query  933   ITLYGDPDATPFINFHKTS-------TKDGTVHSATVIVEADYFTAININILNSAPRWEG  775
             IT+ G       + +  T+          GT +SAT  V A YF A NI   N+ P    
Sbjct  130   ITIQGAGADKTVVQWGDTAETLGPKKQPIGTFNSATFAVNAPYFIARNITFKNTTPVPPP  189

Query  774   TTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLY  595
                G QAV+L  SGD AA+  CK  G QDT  D  GRH++KDCYIEG+VDFIFGN  +LY
Sbjct  190   GAMGKQAVSLRISGDTAAFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLY  249

Query  594   LDTELHVID---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYT  424
                 +H I    G + AQ R +  EDTG+SFV+CK+TG     +LGR W  FSRVI+AYT
Sbjct  250   EGCHVHAIAQNYGALTAQNRMSLLEDTGFSFVNCKVTG-SGALYLGRAWGTFSRVIFAYT  308

Query  423   EMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLG  244
              M + + P GW+   G P+   T ++G+YK TGPGA   GR  ++++LTDEE KPFI++ 
Sbjct  309   YMDDIILPRGWYNW-GDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISMS  367

Query  243   FIEGSKWL  220
             FI+GS+W+
Sbjct  368   FIDGSEWI  375



>ref|XP_003530551.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Glycine 
max]
 ref|XP_006584808.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Glycine 
max]
 gb|KHN16649.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 189/322 (59%), Gaps = 9/322 (3%)
 Frame = -1

Query  1164  FSSNVEPVANRKNLDPELAKAESNPKH-IRVSKD-GKGDFETITDALASVPEDNTQRVII  991
             F   V+ V   K+     AK +  P H + VSK  GKG F +I  A+ S+P  N  RV+I
Sbjct  52    FMKWVKFVGGLKHSVFRTAKNKLFPSHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVI  111

Query  990   SIGGGNYTERVIIEKEKPFITLYGDPDATPFINFHKTSTKD--GTVHSATVIVEADYFTA  817
              +  G YTE+V I   K F+T+ G+      + +  T+     GT  SAT  V + YF A
Sbjct  112   KVHAGVYTEKVNISPFKSFVTIQGEGADKTIVQWGDTAQSQPLGTYGSATFAVNSPYFIA  171

Query  816   ININILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIE  637
              NI   N+AP       G Q VAL  S D A +  CK  G QDT  D  GRH++KDCYIE
Sbjct  172   KNITFKNTAPIPAPGAVGKQGVALRISADTAVFLGCKFLGAQDTLYDHIGRHYYKDCYIE  231

Query  636   GTVDFIFGNGKTLYLDTELHVI---DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLG  466
             G+VDFIFGN  +L+    +H I    G + AQ R++  EDTG+SFVHCK+TG     +LG
Sbjct  232   GSVDFIFGNALSLFEGCHVHAIAQLTGALTAQGRNSLLEDTGFSFVHCKVTG-SGALYLG  290

Query  465   RGWMAFSRVIYAYTEMTEAVRPLGWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK  286
             R W  FSRV++AYT M   + P GW+   G P+   T ++G+YK TGPGA   GR  +++
Sbjct  291   RAWGPFSRVVFAYTYMDNIIIPKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGRVSWSR  349

Query  285   KLTDEEVKPFITLGFIEGSKWL  220
             +L+DEE KPFI+L +I+GS+W+
Sbjct  350   ELSDEEAKPFISLSYIDGSEWI  371



>ref|XP_004136146.1| PREDICTED: probable pectinesterase 53-like [Cucumis sativus]
 gb|KGN45041.1| hypothetical protein Csa_7G414390 [Cucumis sativus]
Length=383

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 203/361 (56%), Gaps = 32/361 (9%)
 Frame = -1

Query  1206  SIPIPANKAEVKSWFSSNVEPVANRKNL------------------DPELAKAESNPKHI  1081
             S+ +   + + K+W S N++    + +L                  D +L KAE N   I
Sbjct  23    SLNVEERREDYKNWLSWNLQNYKKKASLVDRSTVKLGRSYNSGGVLDDKLKKAEMNKVRI  82

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDP-DAT  904
              VS+DG GDF T+ +AL S+P+ N++RVI+ I  G Y+E++II K  PF+T  G+  D  
Sbjct  83    IVSQDGTGDFRTVGEALNSIPKPNSKRVILVINPGVYSEKIIIPKSLPFVTFLGNVIDDQ  142

Query  903   PFINFHKTSTKD-------GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             P I  + T++         GT+ SATV V A+YF AIN+   N A    G+ +G Q VAL
Sbjct  143   PTITGNDTASMTGEDGKPLGTLKSATVAVNANYFVAINMKFENRAMHEIGSVRG-QGVAL  201

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG  565
               SG  AA++NC  YG QDT  D +G H+F +CYI+G+VDFIFG G++ Y    L  I  
Sbjct  202   RISGTKAAFHNCSFYGDQDTLYDHKGLHYFNNCYIQGSVDFIFGYGRSFYEKCYLKSITK  261

Query  564   VIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
              +A   AQ       ++G+SF    +TG  Q  +LGR W  +SRV+++YT M   V P G
Sbjct  262   KVASMTAQKGLKGSMESGFSFKDSVVTGSGQ-IYLGRAWGDYSRVVFSYTFMDNIVLPQG  320

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W+    +  +  T Y+GEYK +GPGA + GR  +A  LTDEE +PFI   +++   WLL 
Sbjct  321   WNDWGSQKRH-LTVYYGEYKCSGPGADLKGRVQWAHNLTDEEAQPFIGTHYVDADSWLLS  379

Query  213   P  211
             P
Sbjct  380   P  380



>gb|KDP46694.1| hypothetical protein JCGZ_06482 [Jatropha curcas]
Length=374

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 180/299 (60%), Gaps = 13/299 (4%)
 Frame = -1

Query  1083  IRVSKDGK-GDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDA  907
             I+V+K  K G F T+  A+ S+P  N  RV+ISI  G Y E+V I     +ITL GD   
Sbjct  76    IKVNKKSKSGGFVTVQKAIDSIPIVNNCRVVISISAGTYREKVEIPASMAYITLEGDGTG  135

Query  906   TPFINFHKTSTKDG-------TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVA  748
                I +  T+ K G       T  SAT  + + YF A NI   N AP       G QAVA
Sbjct  136   KTIIEWDDTADKMGQGGHRLGTYGSATFAINSPYFIAKNITFKNKAPSPPSGALGKQAVA  195

Query  747   LTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID  568
             L  S D AA+  C   G QDT  D  GRH+FKDCYIEG+VDFIFGNG +LY +  LH I 
Sbjct  196   LRISADTAAFIGCNFIGAQDTLYDHIGRHYFKDCYIEGSVDFIFGNGLSLYENCHLHAIT  255

Query  567   ---GVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPL  397
                G + AQ R +  ++TG+SFV+CK+TG     +LGR W +FSRV++AYT M + + P 
Sbjct  256   NSFGALTAQKRDSMLQETGFSFVNCKVTGS-GALYLGRAWGSFSRVVFAYTYMDKIITPR  314

Query  396   GWHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
             GW+   G  +   T ++G+YK +GPGA   GR  ++++LT+EE KPFI++GFI+G +WL
Sbjct  315   GWYNW-GDKNREMTVFYGQYKCSGPGADFGGRVSWSRELTEEEAKPFISIGFIDGHQWL  372



>ref|XP_009414378.1| PREDICTED: probable pectinesterase 53 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 197/325 (61%), Gaps = 13/325 (4%)
 Frame = -1

Query  1149  EP-VANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGN  973
             EP V   + +D +L+KAE+      VS+DG G++ +I +A+ ++P  NT+RVI+ I  G 
Sbjct  63    EPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIPLHNTRRVILEIRPGI  122

Query  972   YTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG-------TVHSATVIVEADYFTAI  814
             Y E+++I K  PFITL GDP + P I+ + T+ K G       T  S TV V +++F A 
Sbjct  123   YREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTFRSPTVAVNSNFFLAA  182

Query  813   NINILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEG  634
              I   N+AP  +   +G QAVA+  SGD AA+YNC  YG QDT  D +G H+FK+C+I+G
Sbjct  183   YIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLYDHKGLHYFKNCFIQG  242

Query  633   TVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGR  463
             +VDFIFG G++LY +  L+ +   +A   AQ R+    ++G+SFV   ITG     +LGR
Sbjct  243   SVDFIFGYGRSLYENCYLNSVAKKVAALTAQKRNMASMESGFSFVRSTITGSGL-VYLGR  301

Query  462   GWMAFSRVIYAYTEMTEAVRPLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK  286
              W   SRV+++YT M + V P GW+     +P      Y+GE++  GPGA   GR ++A+
Sbjct  302   AWGDHSRVVFSYTFMDKVVIPQGWNSWRIHRPEARSGVYYGEFQCGGPGANWTGRVHWAR  361

Query  285   KLTDEEVKPFITLGFIEGSKWLLPP  211
              LT EE +PF+   ++ G  WLL P
Sbjct  362   LLTHEEAQPFLGTYYVNGDSWLLGP  386



>ref|XP_003524409.1| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=375

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 179/298 (60%), Gaps = 9/298 (3%)
 Frame = -1

Query  1092  PKH-IRVSKD-GKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYG  919
             P H + VSK  GKG F +I  A+ S+P  N  RV+I +  G YTE+V I   K FIT+ G
Sbjct  76    PSHTLHVSKKHGKGGFSSIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFITIQG  135

Query  918   DPDATPFINFHKTSTKD--GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             +      + +  T+     GT  SAT  V + YF A NI   N+AP       G Q VAL
Sbjct  136   EGADKTIVQWGDTAQSQPLGTYGSATFAVNSAYFIAKNITFKNTAPIPAPGAVGKQGVAL  195

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVI--  571
               S D A +  CK  G QDT  D  GRH++KDCYIEG+VDFIFGN  +L+    +H I  
Sbjct  196   RISADTAVFQGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQ  255

Query  570   -DGVIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
               G + AQ R +  EDTG+SFVHCK+TG     +LGR W  FSRV++AYT M   + P G
Sbjct  256   LTGALTAQGRSSLLEDTGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKG  314

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
             W+   G P+   T ++G+YK TGPGA   GR  ++++LTDEE KPFI+L +I+GS+W+
Sbjct  315   WYNW-GDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISLSYIDGSEWI  371



>ref|XP_008461405.1| PREDICTED: probable pectinesterase 53 [Cucumis melo]
Length=384

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/361 (40%), Positives = 206/361 (57%), Gaps = 32/361 (9%)
 Frame = -1

Query  1206  SIPIPANKAEVKSWFSSNVEP------VANRKN------------LDPELAKAESNPKHI  1081
             S+ I   + + K+W S N++       + NR              LD +L KAE N   I
Sbjct  24    SLNIEEEREDYKNWLSWNLQNYKKKAGLVNRSTAKLGRSYKGGGVLDDKLKKAEMNKVRI  83

Query  1080  RVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGD-PDAT  904
              VS+DG GDF+T+ +A++S+P+ N++RVI+ I  G Y+E++ I K  PF+T  G+  D  
Sbjct  84    IVSQDGTGDFKTVGEAISSIPKPNSKRVILVINPGVYSEKITIPKSLPFVTFLGNGSDDQ  143

Query  903   PFINFHKTSTKDG-------TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVAL  745
             P I  + T++  G       T+ SATV V+A+YF AIN+   N A    G+ +G Q VAL
Sbjct  144   PTITGNDTASVTGADGKPLGTLKSATVAVDANYFVAINMKFENRAMHEIGSVRG-QGVAL  202

Query  744   TQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVIDG  565
               SG  AA++NC  YG QDT  D +G H+F +CYI+G+VDFIFG G++ Y    L  I  
Sbjct  203   RISGTKAAFHNCSFYGDQDTLYDHKGLHYFNNCYIQGSVDFIFGYGRSFYEKCYLKSITK  262

Query  564   VIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLG  394
              +A   AQ       ++G+SF    +TG  Q  +LGR W  +SRV+++YT M   V P G
Sbjct  263   KVASMTAQKGLKGSMESGFSFKDSVVTGSGQ-IYLGRAWGDYSRVVFSYTFMDNIVLPQG  321

Query  393   WHGVPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWLLP  214
             W+    +  +  T Y+GEYK +GPGA + GR  +A  LTDEE +PFI   +++   WLL 
Sbjct  322   WNDWGSQKRH-LTVYYGEYKCSGPGADLKGRVQWAHNLTDEEAQPFIGTHYVDADSWLLS  380

Query  213   P  211
             P
Sbjct  381   P  381



>ref|XP_003579301.1| PREDICTED: putative pectinesterase 63 [Brachypodium distachyon]
Length=412

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 193/323 (60%), Gaps = 16/323 (5%)
 Frame = -1

Query  1131  KNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVII  952
             K LD +L+ AE+      VS +GKG F TI++A+ ++PE N QRVI+ I  G Y E+ +I
Sbjct  92    KLLDADLSAAEAAKVRYVVSPNGKGKFRTISEAIKAIPEKNKQRVILDIQPGTYKEKFLI  151

Query  951   EKEKPFITLYGDPDATPFINFHKTST---KDG----TVHSATVIVEADYFTAININILNS  793
                KPF+T  G+P   P I +  T+    KDG    T+ SATV +E+DYF A  I   N 
Sbjct  152   PTTKPFVTFLGNPRNPPVITWDDTAGTRGKDGAPIGTLGSATVAIESDYFMASGIVFKNH  211

Query  792   APRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFG  613
             AP      KG QAVAL   G  AA+YNC   G QDT  D++G H+FK+C ++G+VDFIFG
Sbjct  212   APLAPPGAKGGQAVALRVFGTKAAFYNCTFDGGQDTLYDNKGLHYFKNCVVKGSVDFIFG  271

Query  612   NGKTLYLDTELHVID---GVIAAQARHTN---KEDTGYSFVHCKITGPRQGGFLGRGWMA  451
              G++LY+D  +  +     V+ AQ R  +     ++G+SFV CKI G  Q  +LGR W  
Sbjct  272   FGRSLYVDCTMVSVTSQVAVLTAQQRSRSIAEATESGFSFVRCKIMGMGQ-IYLGRAWGD  330

Query  450   FSRVIYAYTEMTEAVRPLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTD  274
              SRV+Y++T+M + V P+GW G    KP   G  Y+GEYK +GPGA    R  +A+ L D
Sbjct  331   SSRVVYSFTDMGKEVIPVGWDGWNVEKPERTG-VYYGEYKCSGPGAMSTQRIGWARVLDD  389

Query  273   EEVKPFITLGFIEGSKWLLPPIK  205
              + +PF    F+ G+ W+LPP K
Sbjct  390   TQARPFTGSHFVYGNSWILPPPK  412



>ref|XP_003567104.1| PREDICTED: probable pectinesterase 53 isoform X2 [Brachypodium 
distachyon]
Length=389

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/355 (40%), Positives = 196/355 (55%), Gaps = 19/355 (5%)
 Frame = -1

Query  1233  LSPGVVSDDSIPIPANKA---EVKSWFSSNVEPVANRKNLD---PELAKAESNPKHIRVS  1072
             + PG V+ +  P P N     E++  F   V  V   ++       LA+   +   +   
Sbjct  35    VRPGEVAKNQPPFPENATRAEELERLFLRWVRYVGGLQHTTFRHAPLARVFPSYSLVVDK  94

Query  1071  KDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPFIN  892
                 GDF +I  A+ S+P  N  RV+I +  G YTE+V I   + FITL G       + 
Sbjct  95    NPSSGDFTSIQAAVDSLPPINLVRVVIKVNAGTYTEKVNISPMRAFITLEGAGADRTVVQ  154

Query  891   FHKTSTKD--------GTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQS  736
             +  T+           GT  SA+  V A YF A NI   N++P  +    G QAVAL  S
Sbjct  155   WGDTADTPAGPRGRPLGTYGSASFAVNAQYFLARNITFKNTSPVPKAGASGKQAVALRVS  214

Query  735   GDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---G  565
              D AA+  CK  G QDT  D  GRH++KDCYIEG++DFIFGN  +LY    +H I    G
Sbjct  215   ADNAAFVGCKFLGAQDTLYDHTGRHYYKDCYIEGSIDFIFGNALSLYEGCHVHAIARDYG  274

Query  564   VIAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHG  385
              + AQ R +  EDTG+SFV+C++TG     +LGR W  FSRV++AYT M + + P GW+ 
Sbjct  275   ALTAQNRQSMLEDTGFSFVNCRVTG-SGALYLGRAWGTFSRVVFAYTYMDDIIIPRGWYN  333

Query  384   VPGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
               G P    T ++G+YK TGPGA   GR  ++++LTDEE KPFI+L FI+G++W+
Sbjct  334   W-GDPSRELTVFYGQYKCTGPGASYSGRVSWSRELTDEEAKPFISLSFIDGTEWV  387



>ref|XP_010249481.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=378

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 177/294 (60%), Gaps = 20/294 (7%)
 Frame = -1

Query  1059  GDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITL-----------YGDP  913
             GDF +I DA+ S+P  N  RV+I +  G YTE+V I   K FIT+           +GD 
Sbjct  89    GDFTSIQDAIDSLPSVNLVRVVIKVNAGVYTEKVNIPPLKSFITIEGAGADKTIVQWGDT  148

Query  912   DATPFINFHKTSTKDGTVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQSG  733
               TP  N        GT +SAT  V + YF A NI   N+ P       G QAVA   SG
Sbjct  149   AQTPGPNGRPI----GTFNSATFAVNSPYFIAKNITFKNTTPLPPPGAIGKQAVAFRISG  204

Query  732   DMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---GV  562
             D AA++ CK +G QDT  D  GRH++KDCYIEG+VDFIFGNG +L+    +H I    G 
Sbjct  205   DTAAFWGCKFFGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSLFEGCNVHAIAQKYGA  264

Query  561   IAAQARHTNKEDTGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVRPLGWHGV  382
             + AQ+R +  EDTG+SFV+C++TG     +LGR W  FSRV++AYT M   + P GW+  
Sbjct  265   VTAQSRMSLLEDTGFSFVNCRVTG-SGALYLGRAWGTFSRVVFAYTYMDNIIIPKGWYNW  323

Query  381   PGKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSKWL  220
              G P+   T ++G+YK TGPGA   GR  ++++LTD E KPF +L FI+GS+W+
Sbjct  324   -GDPNRQMTVFYGQYKCTGPGASFAGRVSWSRELTDAEAKPFTSLTFIDGSEWI  376



>ref|XP_009414379.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 198/325 (61%), Gaps = 14/325 (4%)
 Frame = -1

Query  1149  EP-VANRKNLDPELAKAESNPKHIRVSKDGKGDFETITDALASVPEDNTQRVIISIGGGN  973
             EP V   + +D +L+KAE+      VS+DG G++ +I +A+ ++P  NT+RVI+ I  G 
Sbjct  63    EPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIPLHNTRRVILEIRPGI  122

Query  972   YTERVIIEKEKPFITLYGDPDATPFINFHKTSTKDG-------TVHSATVIVEADYFTAI  814
             Y E+++I K  PFITL GDP + P I+ + T+ K G       T  S TV V +++F A 
Sbjct  123   YREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTFRSPTVAVNSNFFLAA  182

Query  813   NINILNSAPRWEGTTKGSQAVALTQSGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEG  634
              I   N+AP  +   +G QAVA+  SGD AA+YNC  YG QDT  D +G H+FK+C+I+G
Sbjct  183   YIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLYDHKGLHYFKNCFIQG  242

Query  633   TVDFIFGNGKTLYLDTELHVIDGVIA---AQARHTNKEDTGYSFVHCKITGPRQGGFLGR  463
             +VDFIFG G++LY +  L+ +   +A   AQ R+    ++G+SFV   ITG     +LGR
Sbjct  243   SVDFIFGYGRSLYENCYLNSVAKKVAALTAQKRNMASMESGFSFVRSTITGSGL-VYLGR  301

Query  462   GWMAFSRVIYAYTEMTEAVRPLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAK  286
              W   SRV+++YT M + V P GW+     +P   G  Y+GE++  GPGA   GR ++A+
Sbjct  302   AWGDHSRVVFSYTFMDKVVIPQGWNSWRIHRPEASG-VYYGEFQCGGPGANWTGRVHWAR  360

Query  285   KLTDEEVKPFITLGFIEGSKWLLPP  211
              LT EE +PF+   ++ G  WLL P
Sbjct  361   LLTHEEAQPFLGTYYVNGDSWLLGP  385



>gb|EMT04970.1| Putative pectinesterase 53 [Aegilops tauschii]
Length=413

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/307 (45%), Positives = 187/307 (61%), Gaps = 17/307 (6%)
 Frame = -1

Query  1077  VSKDGKGDFETITDALASVPEDNTQRVIISIGGGNYTERVIIEKEKPFITLYGDPDATPF  898
             VS DGKG+F+TITDA+ +VPE N +R I+ I  G Y E++ I   KPFIT  G+P   P 
Sbjct  105   VSPDGKGNFKTITDAIKAVPEKNKKRTILDIKPGTYKEKLTIPMWKPFITFVGNPKNPPV  164

Query  897   INFHKTST---KDG----TVHSATVIVEADYFTAININILNSAPRWEGTTKGSQAVALTQ  739
             I +  T+    KDG    T+ SATV VEADYF+A  +   N+AP  +   +G QAVAL  
Sbjct  165   ITWDDTAGTRGKDGNPLGTLASATVAVEADYFSASGVVFKNNAPLAKAGQEGGQAVALRL  224

Query  738   SGDMAAYYNCKLYGFQDTFCDDEGRHFFKDCYIEGTVDFIFGNGKTLYLDTELHVID---  568
              G  AA+YNC + G QDT  D +G H+FK+C I G+VDFIFG G++LY D  +  +    
Sbjct  225   FGTKAAFYNCTIDGGQDTLYDHKGLHYFKNCIIRGSVDFIFGFGRSLYTDCTIMSVTTEI  284

Query  567   GVIAAQARHTNKED-----TGYSFVHCKITGPRQGGFLGRGWMAFSRVIYAYTEMTEAVR  403
              V+ AQ R    +D     +G+SFV CKI G  Q  +LGR W   SRV+Y++T+M++ V 
Sbjct  285   AVLTAQQRSKTIDDKDAIESGFSFVRCKIFGLGQ-IYLGRAWGDSSRVVYSFTDMSKEVV  343

Query  402   PLGWHGVP-GKPHYGGTTYFGEYKNTGPGAKMDGRPYFAKKLTDEEVKPFITLGFIEGSK  226
             P+GW      KP   G  ++GEYK +GPGA  + R  +A+ L D + +PF    F+ G+ 
Sbjct  344   PVGWDKWKVEKPDRRGGVFYGEYKCSGPGAMSNERIGWARVLDDAQARPFTGSHFVYGNS  403

Query  225   WLLPPIK  205
             W+LPP K
Sbjct  404   WILPPAK  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288