BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24815_g1_i1 len=1311 path=[545:0-356 900:357-452 996:453-507
1051:508-524 1068:525-938 1477:939-980 246:981-1013 1550:1014-1059
388:1060-1099 1635:1100-1129 1665:1130-1202 1737:1203-1230
112:1231-1310]

Length=1311
                                                                      Score     E

ref|XP_006365884.1|  PREDICTED: cysteine-rich receptor-like prote...    188   2e-52   
ref|XP_009626038.1|  PREDICTED: putative receptor-like protein ki...    192   1e-50   
emb|CAC83606.1|  putative receptor-like serine-threonine protein ...    191   3e-50   Solanum tuberosum [potatoes]
emb|CAC84552.1|  putative receptor-like serine-threonine protein ...    191   3e-50   Solanum tuberosum [potatoes]
emb|CAC83607.1|  putative receptor-like serine-threonine protein ...    189   2e-49   Solanum tuberosum [potatoes]
ref|XP_010316622.1|  PREDICTED: putative receptor-like protein ki...    186   7e-49   
ref|XP_010316621.1|  PREDICTED: putative receptor-like protein ki...    187   1e-48   
ref|XP_009768670.1|  PREDICTED: putative receptor-like protein ki...    185   5e-48   
ref|XP_004232751.1|  PREDICTED: putative receptor-like protein ki...    180   2e-46   
gb|EYU27837.1|  hypothetical protein MIMGU_mgv1a002310mg                180   3e-46   
gb|EYU23767.1|  hypothetical protein MIMGU_mgv1a019684mg                170   1e-45   
ref|XP_010317315.1|  PREDICTED: cysteine-rich repeat secretory pr...    172   2e-45   
ref|XP_009785801.1|  PREDICTED: putative receptor-like protein ki...    176   6e-45   
ref|XP_009785802.1|  PREDICTED: putative receptor-like protein ki...    176   6e-45   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...    177   3e-44   
emb|CAC84518.1|  putative receptor-like serine-threonine protein ...    174   3e-44   Solanum tuberosum [potatoes]
gb|EYU23765.1|  hypothetical protein MIMGU_mgv1a011805mg                166   4e-44   
ref|XP_011076612.1|  PREDICTED: putative receptor-like protein ki...    173   5e-44   
ref|XP_009626039.1|  PREDICTED: putative receptor-like protein ki...    173   6e-44   
ref|XP_006365890.1|  PREDICTED: cysteine-rich receptor-like prote...    165   7e-44   
ref|XP_006348198.1|  PREDICTED: cysteine-rich receptor-like prote...    169   1e-42   
ref|XP_010316618.1|  PREDICTED: putative receptor-like protein ki...    168   3e-42   
gb|KDP20813.1|  hypothetical protein JCGZ_21284                         161   6e-42   
gb|EYU44078.1|  hypothetical protein MIMGU_mgv1a002897mg                167   6e-42   
ref|XP_007143180.1|  hypothetical protein PHAVU_007G050200g             165   2e-41   
ref|XP_002316621.2|  hypothetical protein POPTR_0011s03270g             164   6e-41   Populus trichocarpa [western balsam poplar]
emb|CDP09634.1|  unnamed protein product                                163   1e-40   
gb|KHN02664.1|  Cysteine-rich receptor-like protein kinase 29           155   4e-40   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...    161   5e-40   Vitis vinifera
ref|XP_006589610.1|  PREDICTED: cysteine-rich receptor-like prote...    161   6e-40   
ref|XP_007143173.1|  hypothetical protein PHAVU_007G049800g             154   8e-40   
ref|XP_006365883.1|  PREDICTED: cysteine-rich receptor-like prote...    160   1e-39   
ref|XP_006467960.1|  PREDICTED: cysteine-rich repeat secretory pr...    155   2e-39   
gb|KDO75586.1|  hypothetical protein CISIN_1g021048mg                   155   2e-39   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25           160   2e-39   
ref|XP_007143168.1|  hypothetical protein PHAVU_007G049400g             159   2e-39   
ref|XP_006449122.1|  hypothetical protein CICLE_v10015972mg             154   2e-39   
gb|KDO75587.1|  hypothetical protein CISIN_1g040542mg                   152   3e-39   
ref|XP_006468227.1|  PREDICTED: cysteine-rich repeat secretory pr...    152   3e-39   
ref|XP_007025550.1|  Cysteine-rich RLK 8, putative                      154   4e-39   
ref|XP_006449123.1|  hypothetical protein CICLE_v10018168mg             152   4e-39   
ref|XP_003556008.1|  PREDICTED: cysteine-rich receptor-like prote...    159   4e-39   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase         158   5e-39   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein              158   8e-39   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase         158   8e-39   
ref|XP_010999534.1|  PREDICTED: cysteine-rich receptor-like prote...    157   1e-38   
ref|XP_011098674.1|  PREDICTED: putative receptor-like protein ki...    156   2e-38   
ref|XP_011098665.1|  PREDICTED: putative receptor-like protein ki...    156   2e-38   
ref|XP_010092052.1|  Cysteine-rich receptor-like protein kinase 29      156   2e-38   
ref|XP_007025935.1|  Cysteine-rich RLK 29, putative isoform 1           156   2e-38   
gb|EYU23768.1|  hypothetical protein MIMGU_mgv1a020214mg                156   2e-38   
gb|AAD21872.1|  receptor-like protein kinase homolog RK20-1             156   3e-38   Phaseolus vulgaris [French bean]
ref|XP_006377262.1|  hypothetical protein POPTR_0011s03240g             150   3e-38   
emb|CBI38478.3|  unnamed protein product                                155   4e-38   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    155   9e-38   
gb|EPS66204.1|  hypothetical protein M569_08573                         149   9e-38   
ref|XP_007025926.1|  Cysteine-rich RLK 29, putative isoform 2           154   1e-37   
ref|XP_008364117.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    155   1e-37   
ref|XP_010646644.1|  PREDICTED: cysteine-rich repeat secretory pr...    151   1e-37   
ref|XP_007025925.1|  Cysteine-rich RLK 29, putative isoform 1           154   2e-37   
gb|KCW76447.1|  hypothetical protein EUGRSUZ_D00839                     148   2e-37   
gb|KHN01552.1|  Cysteine-rich receptor-like protein kinase 29           153   4e-37   
ref|XP_006373161.1|  hypothetical protein POPTR_0017s09240g             149   4e-37   
ref|XP_010999539.1|  PREDICTED: cysteine-rich repeat secretory pr...    147   4e-37   
gb|EYU34178.1|  hypothetical protein MIMGU_mgv1a023742mg                147   5e-37   
emb|CBI23450.3|  unnamed protein product                                150   6e-37   
ref|XP_006377265.1|  hypothetical protein POPTR_0011s03300g             146   6e-37   
ref|XP_010999538.1|  PREDICTED: cysteine-rich repeat secretory pr...    147   8e-37   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...    154   1e-36   
ref|XP_004172021.1|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-36   
ref|XP_008371136.1|  PREDICTED: cysteine-rich receptor-like prote...    149   1e-36   
ref|XP_011010157.1|  PREDICTED: cysteine-rich repeat secretory pr...    146   1e-36   
ref|XP_007143172.1|  hypothetical protein PHAVU_007G049700g             145   2e-36   
ref|NP_001238174.1|  receptor-like protein kinase                       150   2e-36   
ref|XP_011010156.1|  PREDICTED: cysteine-rich repeat secretory pr...    146   2e-36   
ref|XP_006387935.1|  hypothetical protein POPTR_0470s00200g             144   2e-36   
ref|XP_006605286.1|  PREDICTED: receptor-like protein kinase isof...    151   2e-36   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...    150   2e-36   
ref|XP_007025924.1|  Cysteine-rich RLK 29, putative isoform 3           149   2e-36   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29           150   3e-36   
ref|XP_007143165.1|  hypothetical protein PHAVU_007G0492000g            144   4e-36   
gb|KHN07228.1|  Cysteine-rich receptor-like protein kinase 14           144   4e-36   
ref|XP_008355945.1|  PREDICTED: cysteine-rich receptor-like prote...    150   5e-36   
ref|XP_009759100.1|  PREDICTED: uncharacterized protein LOC104211704    152   6e-36   
ref|XP_007208684.1|  hypothetical protein PRUPE_ppa026449mg             149   7e-36   
ref|XP_008371138.1|  PREDICTED: cysteine-rich receptor-like prote...    149   9e-36   
ref|XP_007025551.1|  Cysteine-rich RLK 8, putative                      146   9e-36   
ref|XP_003635677.2|  PREDICTED: putative receptor-like protein ki...    149   9e-36   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...    149   1e-35   
ref|XP_011096162.1|  PREDICTED: cysteine-rich receptor-like prote...    151   1e-35   
emb|CBI23455.3|  unnamed protein product                                148   1e-35   
ref|XP_002518557.1|  DUF26 domain-containing protein 1 precursor,...    144   1e-35   Ricinus communis
ref|XP_003615455.1|  Cysteine-rich receptor-like protein kinase         148   2e-35   
ref|XP_010112670.1|  Cysteine-rich receptor-like protein kinase 29      148   2e-35   
ref|XP_007025922.1|  Cysteine-rich RLK 29, putative isoform 1           148   2e-35   
ref|XP_010089691.1|  hypothetical protein L484_006313                   145   2e-35   
ref|XP_007025939.1|  Cysteine-rich RLK 29                               150   2e-35   
gb|KCW76445.1|  hypothetical protein EUGRSUZ_D00835                     142   3e-35   
ref|XP_003556003.1|  PREDICTED: cysteine-rich receptor-like prote...    147   3e-35   
ref|XP_010090762.1|  Cysteine-rich receptor-like protein kinase 29      149   3e-35   
gb|KGN49142.1|  hypothetical protein Csa_6G516500                       146   3e-35   
ref|XP_006606898.1|  PREDICTED: cysteine-rich receptor-like prote...    147   4e-35   
ref|XP_009588247.1|  PREDICTED: putative cysteine-rich receptor-l...    142   4e-35   
gb|KEH43962.1|  cysteine-rich receptor-kinase-like protein              147   4e-35   
ref|XP_009367095.1|  PREDICTED: cysteine-rich receptor-like prote...    146   5e-35   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...    147   5e-35   
emb|CAN74851.1|  hypothetical protein VITISV_019620                     148   5e-35   Vitis vinifera
gb|EYU27842.1|  hypothetical protein MIMGU_mgv1a020186mg                145   6e-35   
ref|XP_008371196.1|  PREDICTED: cysteine-rich receptor-like prote...    141   7e-35   
ref|XP_011004254.1|  PREDICTED: putative receptor-like protein ki...    146   8e-35   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                     146   8e-35   
ref|XP_007025928.1|  Receptor protein kinase isoform 2                  140   8e-35   
ref|XP_006590219.1|  PREDICTED: cysteine-rich receptor-like prote...    138   8e-35   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-34   
ref|XP_010112612.1|  Cysteine-rich receptor-like protein kinase 29      145   1e-34   
ref|XP_011004253.1|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-34   
ref|XP_011004252.1|  PREDICTED: putative receptor-like protein ki...    146   1e-34   
ref|XP_007025966.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    140   1e-34   
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-34   
gb|EYU34183.1|  hypothetical protein MIMGU_mgv1a003394mg                145   2e-34   
gb|KGN49140.1|  hypothetical protein Csa_6G515490                       142   2e-34   
gb|EYU34186.1|  hypothetical protein MIMGU_mgv1a0026692mg               139   2e-34   
ref|XP_007208199.1|  hypothetical protein PRUPE_ppa020541mg             142   2e-34   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg             145   2e-34   
ref|XP_003638020.1|  Cysteine-rich receptor-like protein kinase         143   2e-34   
ref|XP_007206688.1|  hypothetical protein PRUPE_ppa022095mg             145   2e-34   
gb|KEH43957.1|  cysteine-rich receptor-kinase-like protein              144   2e-34   
gb|KEH40073.1|  cysteine-rich receptor-kinase-like protein              145   2e-34   
ref|XP_008377957.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    144   2e-34   
ref|XP_007025929.1|  Receptor protein kinase isoform 3                  139   3e-34   
ref|XP_007139784.1|  hypothetical protein PHAVU_008G058600g             145   3e-34   
ref|XP_007143181.1|  hypothetical protein PHAVU_007G050300g             147   3e-34   
ref|XP_007139785.1|  hypothetical protein PHAVU_008G058600g             145   3e-34   
ref|XP_003637942.1|  Cysteine-rich receptor-like protein kinase         144   3e-34   
emb|CDP09635.1|  unnamed protein product                                144   4e-34   
ref|XP_002518563.1|  serine-threonine protein kinase, plant-type,...    147   4e-34   Ricinus communis
ref|XP_004134968.1|  PREDICTED: cysteine-rich receptor-like prote...    146   5e-34   
ref|XP_007139788.1|  hypothetical protein PHAVU_008G058700g             144   5e-34   
gb|KEH40075.1|  salt stress response/antifungal domain protein          139   5e-34   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182    146   6e-34   
ref|XP_008377959.1|  PREDICTED: cysteine-rich receptor-like prote...    144   6e-34   
ref|XP_006449124.1|  hypothetical protein CICLE_v10018264mg             135   7e-34   
ref|XP_010089688.1|  Cysteine-rich receptor-like protein kinase 29      144   7e-34   
ref|XP_010644356.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-33   
ref|XP_006388607.1|  hypothetical protein POPTR_0138s00210g             142   1e-33   
emb|CBI23396.3|  unnamed protein product                                141   1e-33   
gb|KEH40076.1|  cysteine-rich receptor-kinase-like protein              143   1e-33   
ref|XP_010316620.1|  PREDICTED: putative receptor-like protein ki...    143   1e-33   
ref|XP_010316619.1|  PREDICTED: putative receptor-like protein ki...    142   2e-33   
ref|XP_008371201.1|  PREDICTED: cysteine-rich receptor-like prote...    142   2e-33   
ref|XP_009349606.1|  PREDICTED: cysteine-rich repeat secretory pr...    138   2e-33   
emb|CAN65760.1|  hypothetical protein VITISV_001837                     138   2e-33   Vitis vinifera
ref|XP_006589611.1|  PREDICTED: cysteine-rich receptor-like prote...    142   2e-33   
ref|XP_009349605.1|  PREDICTED: cysteine-rich repeat secretory pr...    138   2e-33   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...    142   2e-33   
ref|XP_004172020.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    142   2e-33   
ref|XP_006387886.1|  hypothetical protein POPTR_0499s002001g            140   2e-33   
gb|KEH43970.1|  cysteine-rich RLK (receptor-like kinase) protein        137   2e-33   
ref|XP_003638010.1|  Cysteine-rich receptor-like protein kinase         140   2e-33   
gb|KHN15831.1|  Cysteine-rich receptor-like protein kinase 29           144   2e-33   
ref|XP_007025927.1|  Receptor protein kinase isoform 1                  138   3e-33   
ref|XP_008345852.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-33   
gb|KEH43969.1|  cysteine-rich RLK (receptor-like kinase) protein        137   3e-33   
gb|KGN49146.1|  hypothetical protein Csa_6G516540                       137   3e-33   
ref|XP_010054433.1|  PREDICTED: cysteine-rich receptor-like prote...    141   3e-33   
gb|KHN23189.1|  Cysteine-rich receptor-like protein kinase 29           142   4e-33   
gb|KHN02669.1|  Cysteine-rich receptor-like protein kinase 29           140   5e-33   
ref|XP_007025923.1|  Cysteine-rich RLK 29, putative isoform 2           141   5e-33   
gb|KGN49148.1|  hypothetical protein Csa_6G516560                       135   5e-33   
ref|XP_010052402.1|  PREDICTED: putative receptor-like protein ki...    141   5e-33   
ref|XP_007143158.1|  hypothetical protein PHAVU_007G048700g             141   5e-33   
gb|KDO37599.1|  hypothetical protein CISIN_1g008238mg                   139   6e-33   
gb|AFK43013.1|  unknown                                                 135   6e-33   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g             140   7e-33   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687    142   8e-33   
gb|KGN49149.1|  hypothetical protein Csa_6G516570                       136   9e-33   
gb|AES98412.2|  cysteine-rich receptor-kinase-like protein              139   9e-33   
ref|XP_010108868.1|  Cysteine-rich receptor-like protein kinase 26      141   9e-33   
ref|XP_010054430.1|  PREDICTED: cysteine-rich receptor-like prote...    136   1e-32   
ref|XP_009352870.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   1e-32   
gb|KEH43956.1|  cysteine-rich receptor-kinase-like protein              140   1e-32   
ref|XP_003615454.1|  Cysteine-rich receptor-like protein kinase         139   1e-32   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                     140   1e-32   
ref|XP_010247023.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   1e-32   
ref|XP_006388054.1|  hypothetical protein POPTR_0379s00230g             133   1e-32   
ref|XP_003637940.1|  Cysteine-rich receptor-like protein kinase         140   1e-32   
ref|XP_002518561.1|  ATP binding protein, putative                      139   1e-32   Ricinus communis
gb|KCW76449.1|  hypothetical protein EUGRSUZ_D00841                     139   2e-32   
ref|XP_007011084.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    139   2e-32   
ref|XP_010052450.1|  PREDICTED: putative receptor-like protein ki...    139   2e-32   
gb|KDO37598.1|  hypothetical protein CISIN_1g008238mg                   139   2e-32   
ref|XP_006373163.1|  hypothetical protein POPTR_0017s09260g             139   2e-32   
ref|XP_006383968.1|  hypothetical protein POPTR_0004s02560g             139   2e-32   
ref|XP_007226376.1|  hypothetical protein PRUPE_ppa022854mg             139   2e-32   
gb|KHN01549.1|  Cysteine-rich receptor-like protein kinase 26           133   2e-32   
ref|XP_003637938.1|  Cysteine-rich receptor-like protein kinase         138   2e-32   
ref|XP_007143157.1|  hypothetical protein PHAVU_007G048600g             139   3e-32   
ref|XP_008234279.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-32   
ref|XP_008234232.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-32   
ref|XP_008370332.1|  PREDICTED: cysteine-rich repeat secretory pr...    135   3e-32   
ref|XP_008219910.1|  PREDICTED: uncharacterized protein LOC103320073    141   3e-32   
ref|XP_008441095.1|  PREDICTED: cysteine-rich receptor-like prote...    140   3e-32   
gb|KCW76450.1|  hypothetical protein EUGRSUZ_D00842                     138   4e-32   
ref|XP_007025932.1|  Receptor protein kinase isoform 1                  133   4e-32   
ref|XP_007025950.1|  ATP binding protein, putative                      133   4e-32   
emb|CBI29181.3|  unnamed protein product                                137   5e-32   
ref|XP_008234245.1|  PREDICTED: cysteine-rich receptor-like prote...    135   5e-32   
ref|XP_007143156.1|  hypothetical protein PHAVU_007G048500g             138   5e-32   
ref|XP_007025964.1|  Cysteine-rich RLK 29, putative                     138   6e-32   
gb|KHN01561.1|  Cysteine-rich receptor-like protein kinase 29           137   6e-32   
ref|XP_003635308.1|  PREDICTED: cysteine-rich receptor-like prote...    138   7e-32   
ref|XP_008387503.1|  PREDICTED: cysteine-rich receptor-like prote...    134   7e-32   
emb|CBI41018.3|  unnamed protein product                                138   7e-32   
ref|XP_003637950.1|  Cysteine-rich receptor-like protein kinase         136   7e-32   
ref|XP_007208249.1|  hypothetical protein PRUPE_ppa016784mg             137   8e-32   
ref|XP_003589298.1|  Cysteine-rich receptor-like protein kinase         134   8e-32   
ref|XP_003635160.1|  PREDICTED: putative receptor-like protein ki...    137   8e-32   
ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733    139   9e-32   
gb|KHN02662.1|  Cysteine-rich receptor-like protein kinase 26           137   1e-31   
ref|XP_008245043.1|  PREDICTED: cysteine-rich receptor-like prote...    135   1e-31   
ref|XP_008377950.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   1e-31   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             137   1e-31   
gb|EYU27840.1|  hypothetical protein MIMGU_mgv1a023015mg                137   2e-31   
ref|XP_008441594.1|  PREDICTED: cysteine-rich repeat secretory pr...    133   2e-31   
ref|XP_003555314.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-31   
ref|XP_008347602.1|  PREDICTED: cysteine-rich receptor-like prote...    130   2e-31   
ref|XP_007207895.1|  hypothetical protein PRUPE_ppa021055mg             130   2e-31   
ref|XP_008446476.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-31   
ref|XP_008441577.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   2e-31   
ref|XP_008441587.1|  PREDICTED: cysteine-rich repeat secretory pr...    133   2e-31   
gb|ACU20179.1|  unknown                                                 130   2e-31   Glycine max [soybeans]
ref|XP_006383966.1|  hypothetical protein POPTR_0004s02550g             135   4e-31   
ref|XP_008439946.1|  PREDICTED: cysteine-rich receptor-like prote...    130   4e-31   
ref|XP_010999622.1|  PREDICTED: cysteine-rich receptor-like prote...    135   4e-31   
ref|XP_007143161.1|  hypothetical protein PHAVU_007G049000g             135   4e-31   
ref|XP_003637954.1|  Cysteine-rich receptor-like protein kinase         129   5e-31   
ref|XP_004155666.1|  PREDICTED: cysteine-rich receptor-like prote...    137   5e-31   
gb|EYU27838.1|  hypothetical protein MIMGU_mgv1a002249mg                135   6e-31   
ref|XP_008439945.1|  PREDICTED: cysteine-rich receptor-like prote...    130   6e-31   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g             135   7e-31   
ref|XP_008224869.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   8e-31   
ref|XP_004155667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   8e-31   
ref|XP_007143169.1|  hypothetical protein PHAVU_007G0495001g            133   8e-31   
ref|XP_007025946.1|  Cysteine-rich protein, putative                    135   8e-31   
gb|KHG01974.1|  Cysteine-rich receptor-like protein kinase 26           134   8e-31   
gb|KDO37425.1|  hypothetical protein CISIN_1g005846mg                   132   8e-31   
ref|XP_007224869.1|  hypothetical protein PRUPE_ppa022744mg             134   9e-31   
gb|KGN64567.1|  hypothetical protein Csa_1G065380                       133   9e-31   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   134   1e-30   
ref|XP_008350333.1|  PREDICTED: cysteine-rich receptor-like prote...    134   1e-30   
gb|KDO37424.1|  hypothetical protein CISIN_1g005846mg                   132   1e-30   
ref|XP_008439953.1|  PREDICTED: cysteine-rich receptor-like prote...    134   1e-30   
gb|KDO37426.1|  hypothetical protein CISIN_1g005846mg                   132   1e-30   
emb|CAN80209.1|  hypothetical protein VITISV_010568                     131   1e-30   Vitis vinifera
ref|XP_003637955.1|  Cysteine-rich receptor-like protein kinase         128   1e-30   
ref|XP_006287210.1|  hypothetical protein CARUB_v10000385mg             134   2e-30   
emb|CBI23453.3|  unnamed protein product                                129   2e-30   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29           134   2e-30   
ref|XP_008446488.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-30   
gb|KDO37427.1|  hypothetical protein CISIN_1g005846mg                   132   2e-30   
ref|XP_006606016.1|  PREDICTED: cysteine-rich receptor-like prote...    133   2e-30   
gb|AES59548.2|  cysteine-rich receptor-kinase-like protein              133   2e-30   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...    133   2e-30   
ref|XP_008222716.1|  PREDICTED: putative receptor-like protein ki...    133   3e-30   
ref|XP_009349608.1|  PREDICTED: cysteine-rich receptor-like prote...    133   3e-30   
ref|XP_011002064.1|  PREDICTED: putative receptor-like protein ki...    132   3e-30   
ref|XP_011002062.1|  PREDICTED: putative receptor-like protein ki...    133   3e-30   
ref|XP_008234313.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    132   3e-30   
ref|XP_011002063.1|  PREDICTED: putative receptor-like protein ki...    132   4e-30   
gb|KGN64573.1|  hypothetical protein Csa_1G065930                       131   4e-30   
ref|XP_007221601.1|  hypothetical protein PRUPE_ppa026879mg             132   4e-30   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483    134   4e-30   
gb|KDO37423.1|  hypothetical protein CISIN_1g005846mg                   131   6e-30   
ref|XP_006606897.1|  PREDICTED: cysteine-rich receptor-like prote...    132   6e-30   
ref|XP_006348196.1|  PREDICTED: cysteine-rich receptor-like prote...    125   6e-30   
gb|KDO75585.1|  hypothetical protein CISIN_1g044262mg                   129   9e-30   
gb|KEH40074.1|  cysteine-rich receptor-kinase-like protein              132   1e-29   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg             132   1e-29   
ref|XP_007143171.1|  hypothetical protein PHAVU_007G049600g             131   1e-29   
ref|XP_009372972.1|  PREDICTED: cysteine-rich receptor-like prote...    131   1e-29   
ref|NP_192429.1|  cysteine-rich receptor-like protein kinase 25         131   1e-29   
ref|XP_002518562.1|  ATP binding protein, putative                      130   1e-29   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    131   1e-29   
ref|XP_004153298.1|  PREDICTED: cysteine-rich receptor-like prote...    131   1e-29   
ref|XP_004169839.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    130   1e-29   
ref|XP_004145167.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-29   
ref|XP_004153194.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-29   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   131   2e-29   
emb|CDY39159.1|  BnaC09g21850D                                          130   2e-29   
ref|XP_007025958.1|  Cysteine-rich RLK 29, putative                     130   2e-29   
ref|XP_002874837.1|  hypothetical protein ARALYDRAFT_911789             127   2e-29   
ref|XP_008446448.1|  PREDICTED: cysteine-rich receptor-like prote...    130   2e-29   
gb|EYU34174.1|  hypothetical protein MIMGU_mgv11b015381mg               125   2e-29   
ref|XP_007213217.1|  hypothetical protein PRUPE_ppb014490mg             129   2e-29   
emb|CAN79089.1|  hypothetical protein VITISV_006673                     129   2e-29   
ref|XP_007223972.1|  hypothetical protein PRUPE_ppa014621mg             130   2e-29   
ref|XP_010059674.1|  PREDICTED: putative cysteine-rich receptor-l...    127   2e-29   
ref|XP_008224868.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    130   2e-29   
ref|XP_006484824.1|  PREDICTED: cysteine-rich repeat secretory pr...    124   3e-29   
gb|KHN01540.1|  Cysteine-rich receptor-like protein kinase 26           130   3e-29   
ref|XP_009114496.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    129   4e-29   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             130   4e-29   
ref|XP_006373162.1|  hypothetical protein POPTR_0017s09250g             130   4e-29   
ref|XP_007213440.1|  hypothetical protein PRUPE_ppa025278mg             130   4e-29   
ref|XP_003635345.2|  PREDICTED: cysteine-rich receptor-like prote...    129   4e-29   
emb|CBI39959.3|  unnamed protein product                                128   4e-29   
ref|XP_008222715.1|  PREDICTED: putative receptor-like protein ki...    130   4e-29   
gb|KDO56718.1|  hypothetical protein CISIN_1g006317mg                   127   4e-29   
ref|XP_010646640.1|  PREDICTED: putative receptor-like protein ki...    129   4e-29   
ref|XP_007143159.1|  hypothetical protein PHAVU_007G048800g             129   5e-29   
gb|KCW75403.1|  hypothetical protein EUGRSUZ_E04157                     124   5e-29   
ref|XP_010418756.1|  PREDICTED: putative cysteine-rich receptor-l...    124   6e-29   
ref|XP_010059525.1|  PREDICTED: putative cysteine-rich receptor-l...    125   6e-29   
ref|XP_004145164.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   7e-29   
gb|KGN49150.1|  hypothetical protein Csa_6G516580                       128   7e-29   
gb|KGN49153.1|  hypothetical protein Csa_6G516610                       129   7e-29   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...    129   7e-29   
ref|XP_006606021.1|  PREDICTED: cysteine-rich receptor-like prote...    129   7e-29   
ref|XP_010655887.1|  PREDICTED: uncharacterized protein LOC100244284    130   7e-29   
ref|XP_006429439.1|  hypothetical protein CICLE_v10011354mg             128   8e-29   
ref|XP_008225006.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   8e-29   
ref|XP_010059668.1|  PREDICTED: cysteine-rich receptor-like prote...    124   9e-29   
ref|XP_007213237.1|  hypothetical protein PRUPE_ppb018758mg             123   1e-28   
ref|XP_006467961.1|  PREDICTED: putative cysteine-rich receptor-l...    128   1e-28   
emb|CBI39957.3|  unnamed protein product                                126   1e-28   
gb|KHN01545.1|  Cysteine-rich receptor-like protein kinase 29           128   1e-28   
gb|EYU44085.1|  hypothetical protein MIMGU_mgv11b016362mg               124   1e-28   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     128   1e-28   
gb|EYU27835.1|  hypothetical protein MIMGU_mgv1a002149mg                128   1e-28   
gb|KDO56717.1|  hypothetical protein CISIN_1g006317mg                   127   1e-28   
gb|KEH43951.1|  cysteine-rich receptor-kinase-like protein              128   1e-28   
ref|XP_010056929.1|  PREDICTED: cysteine-rich receptor-like prote...    127   1e-28   
gb|KGN64566.1|  hypothetical protein Csa_1G065370                       126   2e-28   
gb|KEH16074.1|  salt stress response/antifungal domain protein          124   2e-28   
ref|XP_004134966.1|  PREDICTED: cysteine-rich receptor-like prote...    128   2e-28   
ref|XP_008446434.1|  PREDICTED: cysteine-rich receptor-like prote...    129   2e-28   
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...    126   2e-28   
gb|KDO48492.1|  hypothetical protein CISIN_1g0460102mg                  123   2e-28   
ref|XP_008224867.1|  PREDICTED: cysteine-rich repeat secretory pr...    122   2e-28   
gb|KCW75419.1|  hypothetical protein EUGRSUZ_E04179                     127   2e-28   
ref|XP_010059150.1|  PREDICTED: cysteine-rich receptor-like prote...    123   2e-28   
ref|XP_003637967.1|  Cysteine-rich receptor-like protein kinase         128   2e-28   
gb|KHN01554.1|  Cysteine-rich receptor-like protein kinase 29           127   2e-28   
ref|XP_008357370.1|  PREDICTED: cysteine-rich receptor-like prote...    121   2e-28   
ref|XP_007207670.1|  hypothetical protein PRUPE_ppa023045mg             127   2e-28   
ref|XP_007025954.1|  Cysteine-rich RLK 10, putative isoform 1           127   2e-28   
gb|KDO56716.1|  hypothetical protein CISIN_1g006317mg                   127   2e-28   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    127   2e-28   
gb|KCW74851.1|  hypothetical protein EUGRSUZ_E03589                     127   2e-28   
ref|XP_010661211.1|  PREDICTED: putative receptor-like protein ki...    127   3e-28   
ref|XP_007025955.1|  Cysteine-rich RLK 10, putative isoform 2           127   3e-28   
ref|XP_004134967.1|  PREDICTED: uncharacterized protein LOC101208125    129   3e-28   
gb|KDO60896.1|  hypothetical protein CISIN_1g036866mg                   122   3e-28   
ref|XP_006481075.1|  PREDICTED: putative cysteine-rich receptor-l...    127   3e-28   
gb|KDP20815.1|  hypothetical protein JCGZ_21286                         127   3e-28   
ref|XP_006437221.1|  hypothetical protein CICLE_v10032523mg             122   3e-28   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...    127   3e-28   
ref|XP_007212506.1|  hypothetical protein PRUPE_ppa017718mg             124   3e-28   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...    127   4e-28   
ref|XP_010247620.1|  PREDICTED: cysteine-rich receptor-like prote...    127   4e-28   
ref|XP_010089692.1|  Cysteine-rich receptor-like protein kinase 29      127   4e-28   
ref|XP_010057674.1|  PREDICTED: putative receptor-like protein ki...    127   4e-28   
ref|XP_010647003.1|  PREDICTED: putative receptor-like protein ki...    126   4e-28   
gb|EPS67040.1|  hypothetical protein M569_07736                         126   5e-28   
ref|XP_006606019.1|  PREDICTED: cysteine-rich receptor-like prote...    125   6e-28   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    126   6e-28   
ref|XP_009787631.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   6e-28   
ref|XP_008224861.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   7e-28   
ref|XP_006449121.1|  hypothetical protein CICLE_v10014534mg             126   7e-28   
ref|XP_008441094.1|  PREDICTED: uncharacterized protein LOC103485320    127   7e-28   
ref|XP_010059504.1|  PREDICTED: cysteine-rich receptor-like prote...    121   7e-28   
ref|XP_010510317.1|  PREDICTED: putative cysteine-rich receptor-l...    120   7e-28   
ref|XP_008441090.1|  PREDICTED: cysteine-rich receptor-like prote...    126   7e-28   
emb|CAN62393.1|  hypothetical protein VITISV_021304                     125   7e-28   
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002    127   7e-28   
gb|AES98408.2|  cysteine-rich receptor-kinase-like protein              126   7e-28   
ref|XP_010041722.1|  PREDICTED: cysteine-rich receptor-like prote...    127   7e-28   
gb|EYU44081.1|  hypothetical protein MIMGU_mgv1a023731mg                126   8e-28   
ref|XP_010661208.1|  PREDICTED: putative receptor-like protein ki...    125   8e-28   
ref|XP_006449126.1|  hypothetical protein CICLE_v10014521mg             122   9e-28   
ref|XP_004295243.1|  PREDICTED: cysteine-rich receptor-like prote...    122   9e-28   
ref|XP_006606018.1|  PREDICTED: cysteine-rich receptor-like prote...    125   1e-27   
gb|KCW74373.1|  hypothetical protein EUGRSUZ_E03054                     125   1e-27   
ref|XP_003615450.1|  Cysteine-rich receptor-like protein kinase         125   1e-27   
ref|XP_008372641.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   1e-27   
ref|XP_008357369.1|  PREDICTED: cysteine-rich receptor-like prote...    124   1e-27   
ref|XP_008244704.1|  PREDICTED: cysteine-rich repeat secretory pr...    120   1e-27   
gb|KHN01550.1|  Cysteine-rich receptor-like protein kinase 29           124   2e-27   
ref|XP_004166549.1|  PREDICTED: cysteine-rich receptor-like prote...    126   2e-27   
ref|XP_010042180.1|  PREDICTED: cysteine-rich receptor-like prote...    125   2e-27   
ref|XP_003536563.1|  PREDICTED: cysteine-rich receptor-like prote...    125   2e-27   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             125   2e-27   
ref|XP_007049618.1|  Receptor-like protein kinase-related family ...    119   2e-27   
ref|XP_009605992.1|  PREDICTED: cysteine-rich repeat secretory pr...    119   2e-27   
ref|XP_010059676.1|  PREDICTED: cysteine-rich receptor-like prote...    120   2e-27   
ref|XP_006494831.1|  PREDICTED: putative cysteine-rich receptor-l...    124   2e-27   
ref|NP_001234947.1|  receptor-like protein kinase precursor             124   2e-27   
ref|XP_010529377.1|  PREDICTED: cysteine-rich receptor-like prote...    124   2e-27   
ref|XP_002304943.2|  hypothetical protein POPTR_0004s02390g             120   2e-27   
ref|XP_006449128.1|  hypothetical protein CICLE_v10014521mg             122   3e-27   
gb|EPS60084.1|  hypothetical protein M569_14721                         125   3e-27   
ref|XP_006588368.1|  PREDICTED: receptor-like protein kinase isof...    124   3e-27   
gb|KCW74848.1|  hypothetical protein EUGRSUZ_E03585                     124   3e-27   
ref|XP_010529376.1|  PREDICTED: cysteine-rich receptor-like prote...    124   3e-27   
ref|XP_006588367.1|  PREDICTED: receptor-like protein kinase isof...    124   3e-27   
ref|XP_010059141.1|  PREDICTED: cysteine-rich receptor-like prote...    120   3e-27   
ref|XP_010057675.1|  PREDICTED: putative receptor-like protein ki...    124   3e-27   
ref|XP_006286141.1|  hypothetical protein CARUB_v10007696mg             123   3e-27   
ref|XP_010686980.1|  PREDICTED: cysteine-rich receptor-like prote...    125   4e-27   
ref|XP_010059648.1|  PREDICTED: putative cysteine-rich receptor-l...    121   5e-27   
ref|XP_006449130.1|  hypothetical protein CICLE_v10014521mg             122   6e-27   
gb|AES59550.2|  cysteine-rich receptor-kinase-like protein              123   6e-27   
ref|XP_002518555.1|  ATP binding protein, putative                      123   6e-27   
ref|XP_009793791.1|  PREDICTED: cysteine-rich repeat secretory pr...    117   8e-27   
ref|XP_007212929.1|  hypothetical protein PRUPE_ppa022450mg             123   8e-27   
ref|XP_003589299.1|  Cysteine-rich receptor-like protein kinase         123   9e-27   
gb|KCW75001.1|  hypothetical protein EUGRSUZ_E03762                     121   9e-27   
ref|XP_003637957.1|  Cysteine-rich receptor-like protein kinase         119   1e-26   
ref|XP_007024474.1|  Receptor-like protein kinase-related family ...    117   1e-26   
ref|XP_009334798.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    122   1e-26   
ref|XP_010059673.1|  PREDICTED: cysteine-rich receptor-like prote...    122   1e-26   
gb|KHN01544.1|  Cysteine-rich receptor-like protein kinase 8            121   1e-26   
ref|XP_004492208.1|  PREDICTED: cysteine-rich repeat secretory pr...    117   1e-26   
gb|KEH43968.1|  salt stress response/antifungal domain protein          117   1e-26   
ref|XP_010686941.1|  PREDICTED: putative receptor-like protein ki...    122   1e-26   
gb|KEH43944.1|  cysteine-rich receptor-kinase-like protein              122   2e-26   
ref|XP_009802722.1|  PREDICTED: cysteine-rich receptor-like prote...    121   2e-26   
gb|KEH43966.1|  cysteine-rich receptor-kinase-like protein              122   2e-26   
ref|XP_008224864.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    123   2e-26   
gb|KEH43945.1|  cysteine-rich receptor-kinase-like protein              122   2e-26   
ref|XP_010051151.1|  PREDICTED: cysteine-rich repeat secretory pr...    116   2e-26   
ref|XP_003638007.1|  Cysteine-rich receptor-like protein kinase         122   2e-26   
gb|KCW45414.1|  hypothetical protein EUGRSUZ_L00892                     122   2e-26   
gb|KEH43943.1|  cysteine-rich receptor-kinase-like protein              122   2e-26   
gb|KHG11982.1|  Cysteine-rich receptor-like protein kinase 26           122   2e-26   
ref|XP_010646645.1|  PREDICTED: cysteine-rich repeat secretory pr...    117   2e-26   
ref|XP_010040185.1|  PREDICTED: putative receptor-like protein ki...    121   2e-26   
ref|XP_006606017.1|  PREDICTED: cysteine-rich receptor-like prote...    122   2e-26   
gb|KCW75432.1|  hypothetical protein EUGRSUZ_E04193                     121   2e-26   
ref|XP_009349613.1|  PREDICTED: cysteine-rich receptor-like prote...    121   2e-26   
ref|XP_006449131.1|  hypothetical protein CICLE_v10014521mg             121   2e-26   
ref|XP_010647004.1|  PREDICTED: cysteine-rich repeat secretory pr...    117   2e-26   
gb|KDO75584.1|  hypothetical protein CISIN_1g010329mg                   119   3e-26   
ref|XP_002515716.1|  DUF26 domain-containing protein 2 precursor,...    116   3e-26   
gb|KCW74353.1|  hypothetical protein EUGRSUZ_E030282                    119   3e-26   
ref|XP_007143179.1|  hypothetical protein PHAVU_007G050100g             115   3e-26   
ref|XP_009802721.1|  PREDICTED: cysteine-rich receptor-like prote...    121   3e-26   
ref|XP_010059691.1|  PREDICTED: cysteine-rich receptor-like prote...    117   3e-26   
ref|XP_009359012.1|  PREDICTED: cysteine-rich repeat secretory pr...    116   3e-26   
ref|XP_003638028.1|  Cysteine-rich receptor-like protein kinase         119   3e-26   
ref|XP_006351953.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   3e-26   
gb|KHN01559.1|  Cysteine-rich receptor-like protein kinase 26           121   3e-26   
ref|XP_007224264.1|  hypothetical protein PRUPE_ppa018525mg             120   3e-26   
emb|CDO99704.1|  unnamed protein product                                122   3e-26   
gb|KCW74339.1|  hypothetical protein EUGRSUZ_E03012                     116   3e-26   
ref|XP_010059506.1|  PREDICTED: cysteine-rich receptor-like prote...    119   3e-26   
ref|XP_003551283.1|  PREDICTED: cysteine-rich repeat secretory pr...    116   3e-26   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                         121   3e-26   
gb|KCW74377.1|  hypothetical protein EUGRSUZ_E03056                     121   3e-26   
ref|XP_010051179.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   3e-26   
gb|KGN49155.1|  hypothetical protein Csa_6G516630                       117   4e-26   
ref|XP_004155664.1|  PREDICTED: cysteine-rich receptor-like prote...    117   4e-26   
ref|XP_010059147.1|  PREDICTED: putative cysteine-rich receptor-l...    119   4e-26   
ref|XP_002274668.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   4e-26   
ref|XP_008441097.1|  PREDICTED: uncharacterized protein LOC103485324    122   4e-26   
ref|XP_010533171.1|  PREDICTED: cysteine-rich receptor-like prote...    120   4e-26   
ref|XP_002870513.1|  predicted protein                                  120   4e-26   
ref|XP_010241766.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   4e-26   
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...    120   4e-26   
gb|KHN01558.1|  Cysteine-rich receptor-like protein kinase 26           120   5e-26   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           120   5e-26   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                     120   5e-26   
ref|XP_010529576.1|  PREDICTED: cysteine-rich receptor-like prote...    119   5e-26   
ref|XP_009124036.1|  PREDICTED: cysteine-rich receptor-like prote...    118   5e-26   
ref|XP_003543377.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   5e-26   
ref|XP_010057984.1|  PREDICTED: cysteine-rich receptor-like prote...    119   5e-26   
gb|AFK33693.1|  unknown                                                 115   6e-26   
ref|XP_009124035.1|  PREDICTED: cysteine-rich receptor-like prote...    118   6e-26   
ref|XP_009591406.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   6e-26   
ref|XP_003615209.1|  Cysteine-rich receptor-like protein kinase         120   6e-26   
ref|XP_008224866.1|  PREDICTED: cysteine-rich receptor-like prote...    114   6e-26   
emb|CDY46371.1|  BnaA09g19850D                                          120   6e-26   
emb|CBI39033.3|  unnamed protein product                                120   7e-26   
ref|XP_004145165.1|  PREDICTED: cysteine-rich receptor-like prote...    115   7e-26   
gb|KDO75583.1|  hypothetical protein CISIN_1g010329mg                   119   7e-26   
gb|EYU27836.1|  hypothetical protein MIMGU_mgv1a024707mg                119   8e-26   
ref|XP_009372187.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   8e-26   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...    120   8e-26   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    120   8e-26   
ref|XP_010655874.1|  PREDICTED: cysteine-rich receptor-like prote...    120   8e-26   
gb|KHN36561.1|  Cysteine-rich repeat secretory protein 38               114   8e-26   
ref|XP_010267806.1|  PREDICTED: putative receptor-like protein ki...    119   8e-26   
emb|CBI35672.3|  unnamed protein product                                120   9e-26   
ref|XP_010267805.1|  PREDICTED: putative receptor-like protein ki...    119   1e-25   
ref|XP_010686985.1|  PREDICTED: uncharacterized protein LOC104901135    120   1e-25   
ref|XP_008224870.1|  PREDICTED: cysteine-rich repeat secretory pr...    115   1e-25   
gb|KCW75405.1|  hypothetical protein EUGRSUZ_E04159                     117   1e-25   
ref|XP_010442801.1|  PREDICTED: putative cysteine-rich receptor-l...    119   1e-25   
ref|XP_007214594.1|  hypothetical protein PRUPE_ppa024485mg             114   1e-25   
ref|XP_003638036.1|  Cysteine-rich receptor-like protein kinase         120   1e-25   



>ref|XP_006365884.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Solanum tuberosum]
Length=264

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 157/253 (62%), Gaps = 5/253 (2%)
 Frame = +2

Query  125  QEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvn  304
            Q+  +F++  ++     IA     P+  +  CG +GNYT NS Y +NLNTLLSSLS+N++
Sbjct  5    QKLQVFLVFHIYFHYLIIA----QPDLLFSDCGLNGNYTQNSAYQSNLNTLLSSLSSNID  60

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            +YGFYN SVG++++  SA VLCRGDVEL  CR+CV++ A ++ + CP QKEAF  Y+ C 
Sbjct  61   EYGFYNASVGRNTDIVSAIVLCRGDVELQECRNCVNNTAQKLVRSCPEQKEAFGGYDDCM  120

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + Y+  SIIG+    P +          P +FN++L  LVD LR +AVNG P  KYA  S
Sbjct  121  LQYTSRSIIGTSSNKPLLYMWDSGNASKPEEFNRELKKLVDSLRGEAVNGDPLRKYATGS  180

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P+ QTIYA VQCTPDLS +DC +CL  A+      + NG  G+R + P C FRY+  
Sbjct  181  ATDPNDQTIYALVQCTPDLSPQDCSDCLTKAYGAMATCRCNGYRGSRQIGPRCNFRYQSY  240

Query  845  PFFGASLINGSHS  883
             FF    +  SHS
Sbjct  241  RFFKQVAVE-SHS  252



>ref|XP_009626038.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
tomentosiformis]
Length=674

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 158/246 (64%), Gaps = 2/246 (1%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsn  295
            M  Q+W++F+ L ++L    I A    P+  +  CG +GNYT NSTY NNLNTLLSSLS+
Sbjct  3    MVIQKWLLFLYLHIYLLQDLILAQL--PDLTYSSCGNNGNYTENSTYQNNLNTLLSSLSS  60

Query  296  nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
            N+++YGFYN S+GQ+++  SA V+CRGDVEL  CR CV++ + ++ Q C N+KEAF  Y+
Sbjct  61   NMDKYGFYNASIGQNTDMVSAIVICRGDVELEKCRGCVNNVSQKLVQLCSNKKEAFGGYD  120

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA  655
             C + YS+ SI+G+   +  +   +      P +FNQ+L  L+D LR QA  GGP  KYA
Sbjct  121  ECMLQYSNRSILGTTSFSTLLYMWNTGNSSKPEEFNQELRKLLDDLRGQAAGGGPLRKYA  180

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
            + +  GP+ QTIYA VQCTPDLS ++C +CL  A+        NG  G R+L   C FRY
Sbjct  181  SGNATGPNFQTIYALVQCTPDLSPQNCVDCLTGAYGDMPNCPCNGKRGGRILGVRCNFRY  240

Query  836  EISPFF  853
            E   FF
Sbjct  241  ESYRFF  246



>emb|CAC83606.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 158/248 (64%), Gaps = 8/248 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsn  295
            M  Q+W++ + L +H+ +         P+  +  CG +GNYT NSTY NNLNTLL+SLS+
Sbjct  1    MAIQKWLLILFLHIHVLNIVAQL----PDLRFGSCGGNGNYTENSTYKNNLNTLLTSLSS  56

Query  296  nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
             ++ YGFYN S+GQ+S+RAS  VLCRGDVEL+ CR CV +   +I Q CPNQKE F  Y+
Sbjct  57   KIDNYGFYNASIGQNSDRASVIVLCRGDVELADCRGCVDNVVQKIAQLCPNQKEVFGGYD  116

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQ--NPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
             C + YS++SI+ +  T+  ++ +   P     PG+FNQ+L  L++ LR +AV+ GP  K
Sbjct  117  GCMLQYSNQSILET--TSFSLKYYFWNPANATKPGEFNQELGRLLENLRDRAVDDGPLQK  174

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            YA+ +  GPD Q IYA VQCTPDLS + C +CL  A+    +    G  G R++   C F
Sbjct  175  YASGNATGPDFQAIYALVQCTPDLSRQSCFSCLSDAYGNMPRCPCLGKRGGRIIGVRCNF  234

Query  830  RYEISPFF  853
            RYE S FF
Sbjct  235  RYESSRFF  242



>emb|CAC84552.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 143/219 (65%), Gaps = 0/219 (0%)
 Frame = +2

Query  197  PNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRG  376
            P+  +  CG SGNYT NSTY N+LNTLL+SLS+ +++YGFYN S+GQ+S+RAS  VLCRG
Sbjct  24   PDLRFGICGKSGNYTENSTYKNDLNTLLTSLSSKIDKYGFYNASIGQNSDRASVIVLCRG  83

Query  377  DVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSIT  556
            DVEL  CR CV +   +I Q CPNQKE F  Y+ C + YS++SII +   + ++   +  
Sbjct  84   DVELDDCRGCVDNVVQKIAQLCPNQKEVFGGYDGCMLQYSNQSIIDTPSLSVQLFLWNTA  143

Query  557  PVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDC  736
                P +FNQ+L  L++ LR +A  GGP  KYA  +T GPD Q IYA VQCTPDLS + C
Sbjct  144  NASKPEEFNQELGKLLENLRDRAAQGGPLQKYATGTTIGPDIQPIYALVQCTPDLSRQSC  203

Query  737  ENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             +CL  A+    +    G  G R++   C FRYEIS FF
Sbjct  204  FDCLTDAYGTLPQCPCLGKTGGRIIGIRCNFRYEISRFF  242



>emb|CAC83607.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=676

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 157/248 (63%), Gaps = 8/248 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsn  295
            M  Q+W++ + L +H+ +         P+  +  CG +GNYT NSTY NNLNTLL+SLS+
Sbjct  1    MAIQKWLLILFLHIHVLNIVAQL----PDLRFGSCGGNGNYTENSTYKNNLNTLLTSLSS  56

Query  296  nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
             ++ YGFYN S+GQ+S+RAS  VLCRGDVEL+ CR CV +   +I Q CPNQKE F  Y+
Sbjct  57   KIDNYGFYNASIGQNSDRASVIVLCRGDVELADCRGCVDNVVQKIAQLCPNQKEVFGGYD  116

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQ--NPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
             C + YS++SI+ +  T+  ++ +   P     P +FNQ+L  L++ LR +AV+ GP  K
Sbjct  117  GCMLQYSNQSILET--TSFSLKYYFWNPANATKPEEFNQELGRLLENLRDRAVDDGPLQK  174

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            YA+ +  GPD Q IYA VQCTPDLS + C +CL  A+    +    G  G R++   C F
Sbjct  175  YASGNATGPDFQAIYALVQCTPDLSRQSCFSCLSDAYGNMPRRPCLGKRGGRIIGVRCNF  234

Query  830  RYEISPFF  853
            RYE S FF
Sbjct  235  RYESSRFF  242



>ref|XP_010316622.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Solanum lycopersicum]
Length=605

 Score =   186 bits (473),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 153/247 (62%), Gaps = 4/247 (2%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYN  322
            I L  H+    I A    P+  +  CG +GNYT NS Y +NLNTLLSSLS+N+++YGFYN
Sbjct  9    IFLIFHIFHCLIIAQ---PDLLFSDCGLNGNYTQNSAYQSNLNTLLSSLSSNMDEYGFYN  65

Query  323  GSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHE  502
             S+G++++  SA VLCRGDVEL  CR+CV++ A ++ + CP QKEAF  Y+ C + Y+  
Sbjct  66   TSIGRNTDIVSAIVLCRGDVELQECRNCVNNTAHKLVRSCPEQKEAFGGYDDCMLQYTSR  125

Query  503  SIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDS  682
            SIIG+    P +          P +FN++L  LVDRLR +A NG P  KYA  S   P+ 
Sbjct  126  SIIGTSSNDPLLYMWDSGNASKPEEFNRELKKLVDRLRGEAANGDPLRKYATGSATDPND  185

Query  683  QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            QTIYA VQCTPDLS +DC +CL +A+        NG  G+R + P C FRY+   FF   
Sbjct  186  QTIYALVQCTPDLSPQDCSDCLTNAYGAMATCPCNGNRGSRQIGPRCNFRYQSYRFFKQV  245

Query  863  LINGSHS  883
             +  SHS
Sbjct  246  AVQ-SHS  251



>ref|XP_010316621.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Solanum lycopersicum]
Length=666

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 153/247 (62%), Gaps = 4/247 (2%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYN  322
            I L  H+    I A    P+  +  CG +GNYT NS Y +NLNTLLSSLS+N+++YGFYN
Sbjct  9    IFLIFHIFHCLIIAQ---PDLLFSDCGLNGNYTQNSAYQSNLNTLLSSLSSNMDEYGFYN  65

Query  323  GSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHE  502
             S+G++++  SA VLCRGDVEL  CR+CV++ A ++ + CP QKEAF  Y+ C + Y+  
Sbjct  66   TSIGRNTDIVSAIVLCRGDVELQECRNCVNNTAHKLVRSCPEQKEAFGGYDDCMLQYTSR  125

Query  503  SIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDS  682
            SIIG+    P +          P +FN++L  LVDRLR +A NG P  KYA  S   P+ 
Sbjct  126  SIIGTSSNDPLLYMWDSGNASKPEEFNRELKKLVDRLRGEAANGDPLRKYATGSATDPND  185

Query  683  QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            QTIYA VQCTPDLS +DC +CL +A+        NG  G+R + P C FRY+   FF   
Sbjct  186  QTIYALVQCTPDLSPQDCSDCLTNAYGAMATCPCNGNRGSRQIGPRCNFRYQSYRFFKQV  245

Query  863  LINGSHS  883
             +  SHS
Sbjct  246  AVQ-SHS  251



>ref|XP_009768670.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
sylvestris]
Length=683

 Score =   185 bits (469),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 146/219 (67%), Gaps = 0/219 (0%)
 Frame = +2

Query  197  PNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRG  376
            P+  +  CG +GNYT NSTY NNLN LLSSLS+N+++YGFYN S+GQ+ + ASA VLCRG
Sbjct  27   PDLRYSVCGNNGNYTENSTYQNNLNKLLSSLSSNMDKYGFYNASIGQNIDTASAIVLCRG  86

Query  377  DVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSIT  556
            DVE+  CR CV++ + ++ Q CPNQKEAF  Y+ C + YS++SI+G+   + +    +  
Sbjct  87   DVEVEECRGCVNNVSQKLVQLCPNQKEAFGGYDECMLQYSNQSILGTTSFSTKYYLWNSG  146

Query  557  PVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDC  736
                P +FNQ+L  L+D LR QA  GGP  KYA+ +  GP+ QTIYA  QCTPDLS ++C
Sbjct  147  DASKPEEFNQELRKLLDDLRGQAAGGGPLRKYASGNATGPNFQTIYALAQCTPDLSPQNC  206

Query  737  ENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             +CL +A+        NG  G R++   C FRYE S FF
Sbjct  207  VDCLTNAYGDMPNCPCNGKRGGRIIGVRCNFRYESSRFF  245



>ref|XP_004232751.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=676

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 141/223 (63%), Gaps = 1/223 (0%)
 Frame = +2

Query  197  PNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRG  376
            P   +  CG +GNYT NSTY NNLNTLL+SL + ++ YGFYN S+GQ+++RAS  VLCRG
Sbjct  24   PQLRFGSCGENGNYTENSTYKNNLNTLLTSLPSKIDNYGFYNASIGQNTDRASVIVLCRG  83

Query  377  DVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSIT  556
            DVEL  CR CV +   +I Q CPNQKE F  Y+ C + YS++SII +   +      +  
Sbjct  84   DVELDDCRVCVDNVVEKIGQLCPNQKEVFGGYDECMLQYSNQSIIETPSLSVRYFLWNAA  143

Query  557  PVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDC  736
               NP +FNQ+L  L++ LR +A  GGP  KYA  +TA    Q IYA VQCTPDLS ++C
Sbjct  144  NASNPEEFNQELRQLLENLRDRAAQGGPLQKYATGNTAA-GLQPIYALVQCTPDLSRQNC  202

Query  737  ENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASL  865
             NCL  A+    +    G IG R++   C FRYEIS FF A +
Sbjct  203  FNCLTDAYGSMPQCPCLGKIGGRIIGVRCNFRYEISRFFTADV  245



>gb|EYU27837.1| hypothetical protein MIMGU_mgv1a002310mg [Erythranthe guttata]
Length=689

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 135/212 (64%), Gaps = 1/212 (0%)
 Frame = +2

Query  218  CGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVC  397
            C  +GNYT NSTY +NL+ +LSSL  N+   GF+N SVGQ+ +RA+AAVLCRGDV+L  C
Sbjct  27   CINNGNYTVNSTYASNLDAVLSSLYANITSDGFHNASVGQNPDRANAAVLCRGDVDLDEC  86

Query  398  RSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ  577
            R C+ D   ++ Q CPNQK+A  W + C + YS+ES+ G L+T P     +     +P Q
Sbjct  87   RRCLRDITTKLLQSCPNQKQAVDWADECMLRYSNESMFGILQTVPGFWMRNPNNATSPAQ  146

Query  578  FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSA  757
            F +DL +L+D LR +AV GG   K+AA +   PD Q IY+ +QCTPDLS  DC NCL  A
Sbjct  147  FKEDLRTLIDDLRTKAVGGGGMRKFAAGNATAPDFQDIYSLLQCTPDLSPEDCNNCLTGA  206

Query  758  FALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             A       N   G RVL PSC  R+EI PFF
Sbjct  207  AADIPGCCDNKR-GGRVLLPSCNLRFEIYPFF  237



>gb|EYU23767.1| hypothetical protein MIMGU_mgv1a019684mg, partial [Erythranthe 
guttata]
Length=267

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 137/213 (64%), Gaps = 1/213 (0%)
 Frame = +2

Query  230  GNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCV  409
            GNYT NS Y +NLN +L SL   ++  GFYN S+GQ+ +RA+AAVLCRGD+EL  CR C+
Sbjct  11   GNYTTNSAYMSNLNAVLFSLPTGLSSTGFYNASLGQNPDRANAAVLCRGDIELDECRQCL  70

Query  410  SDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQD  589
             D   ++ + CPNQK+A  W + C + YS+E++ G L T P +   ++  V +P +F ++
Sbjct  71   RDITAKLLKSCPNQKQATEWDDRCMLRYSNETMFGVLATYPGLWIWNLNNVTSPDRFKEN  130

Query  590  LTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALW  769
            L +L+D LR +A  GG   K AA +   PD QTIY+ VQC+PDLS  DC  CL +A A  
Sbjct  131  LRTLIDGLRIKAAAGGRTRKVAAGNAPAPDFQTIYSLVQCSPDLSHEDCNICLSTAQADI  190

Query  770  NKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
             +   +   GARVL  SC  RYEI+PFF  +++
Sbjct  191  PRC-CDSKTGARVLLQSCTLRYEITPFFNETVL  222



>ref|XP_010317315.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
lycopersicum]
Length=371

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 146/244 (60%), Gaps = 2/244 (1%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGF  316
            + I+L LH+    I A    P+  +  CG +GNYT NSTY NNLNTLL+SL + ++ YGF
Sbjct  9    LLIILFLHIRVLNIVAQ--LPDLRYGSCGENGNYTENSTYKNNLNTLLTSLPSKIDNYGF  66

Query  317  YNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYS  496
            Y  S+GQ+ +RAS  VLCRGDVEL  CR CV + + ++ Q CPNQKEA   Y+ C + YS
Sbjct  67   YKASIGQNIDRASVIVLCRGDVELQECRDCVYNVSQKLVQVCPNQKEAAGGYDKCMLVYS  126

Query  497  HESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGP  676
            +ESI  +   +     + I     PG+FN++L  L+ RLR  A +G P  KYA+ +  GP
Sbjct  127  NESITDATTFSKLFYLNEIQNASKPGEFNKELGKLLVRLRVVAAHGDPRRKYASGNATGP  186

Query  677  DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFG  856
            D Q I+A VQCTPDL  ++C +CL  A+         G  G R++   C FRY  S FF 
Sbjct  187  DFQNIFALVQCTPDLPPQNCFDCLTKAYEDMINCPCMGKKGGRIIGARCNFRYGTSRFFR  246

Query  857  ASLI  868
              ++
Sbjct  247  LDVV  250



>ref|XP_009785801.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nicotiana sylvestris]
Length=677

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 154/248 (62%), Gaps = 7/248 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLS-LHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssls  292
            M  Q+W++F+  + +   S    AD     + +  CG + NYT NS Y NNLN LLSSLS
Sbjct  1    MAIQKWLLFLFFAYISSWSHPSTAD-----FPYTLCGNNNNYTENSAYHNNLNKLLSSLS  55

Query  293  nnvnQYGFYNGSVGQDSERASAAVLCRGDVEL-SVCRSCVSDNAVRIKQWCPNQKEAFRW  469
            +N+++YGFYN SVGQ+++  SA VLCRGDVEL   CR+CV++    + Q CPNQKEA   
Sbjct  56   SNMDKYGFYNASVGQNTDMVSAIVLCRGDVELLEACRTCVNNVVQNLTQLCPNQKEASGG  115

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
             + C ++YS+ SI+G+   +      +      P +FNQ+L  L++ LR +A NGGPF K
Sbjct  116  SDECMLHYSNRSILGTKSFSTPYYLWNTGNASKPEEFNQELRKLLENLRDRAANGGPFRK  175

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            YA+ +  GP+ QTIYA VQCTPDLS ++C +CL  A+        NG  G R++   C F
Sbjct  176  YASGNATGPNFQTIYALVQCTPDLSPQNCFDCLTDAYGDMPNCPCNGKRGGRIIGTRCNF  235

Query  830  RYEISPFF  853
            RYE + FF
Sbjct  236  RYESARFF  243



>ref|XP_009785802.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Nicotiana sylvestris]
Length=671

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 154/248 (62%), Gaps = 7/248 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLS-LHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssls  292
            M  Q+W++F+  + +   S    AD     + +  CG + NYT NS Y NNLN LLSSLS
Sbjct  1    MAIQKWLLFLFFAYISSWSHPSTAD-----FPYTLCGNNNNYTENSAYHNNLNKLLSSLS  55

Query  293  nnvnQYGFYNGSVGQDSERASAAVLCRGDVEL-SVCRSCVSDNAVRIKQWCPNQKEAFRW  469
            +N+++YGFYN SVGQ+++  SA VLCRGDVEL   CR+CV++    + Q CPNQKEA   
Sbjct  56   SNMDKYGFYNASVGQNTDMVSAIVLCRGDVELLEACRTCVNNVVQNLTQLCPNQKEASGG  115

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
             + C ++YS+ SI+G+   +      +      P +FNQ+L  L++ LR +A NGGPF K
Sbjct  116  SDECMLHYSNRSILGTKSFSTPYYLWNTGNASKPEEFNQELRKLLENLRDRAANGGPFRK  175

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            YA+ +  GP+ QTIYA VQCTPDLS ++C +CL  A+        NG  G R++   C F
Sbjct  176  YASGNATGPNFQTIYALVQCTPDLSPQNCFDCLTDAYGDMPNCPCNGKRGGRIIGTRCNF  235

Query  830  RYEISPFF  853
            RYE + FF
Sbjct  236  RYESARFF  243



>ref|XP_011096160.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Sesamum 
indicum]
Length=1317

 Score =   177 bits (449),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 1/215 (0%)
 Frame = +2

Query  218  CGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVC  397
            C  +GNYT NSTY  NL+ +LSSL  NV+  GFYN SVGQ+ +R +A VLCRGD++L  C
Sbjct  29   CLNNGNYTSNSTYKANLDAVLSSLPTNVDSNGFYNASVGQNPDRVNAVVLCRGDIQLDTC  88

Query  398  RSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ  577
            R CV +    ++  CPNQK+A  W  +C + YS+E+++G L T P     ++    +P +
Sbjct  89   RECVRNATAELRTSCPNQKQAINWQELCMLRYSNEALVGILATGPGWYLWNMQNATSPDR  148

Query  578  FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSA  757
            F QDL +L+D LR +A  GGP  K AA + +GPD QTI+  VQCTPDLS  DC +CL  A
Sbjct  149  FKQDLRTLLDSLRGEAAYGGPLRKVAARNISGPDFQTIFGLVQCTPDLSPDDCSSCLIGA  208

Query  758  FALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
             A       +G  G RVLRPSC  R+E  PF+  +
Sbjct  209  TAEIPIC-CDGKKGGRVLRPSCTLRFESDPFYNGT  242


 Score =   124 bits (310),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 130/234 (56%), Gaps = 13/234 (6%)
 Frame = +2

Query  212  HQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELS  391
            +QC   GNYT NSTY  NLN+LLSSL++++N+ GFY+ SVGQ+S+   A VLCR D  L 
Sbjct  683  YQCLNKGNYTSNSTYSANLNSLLSSLASSINETGFYSVSVGQNSDTVEAIVLCRADRTLD  742

Query  392  VCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPE---IEQHSITPV  562
             CRSCV D AV + + CP QK A  WY  C + YS+   I  + TT +   I +++ +  
Sbjct  743  QCRSCVQDAAVEVVRSCPYQKGAILWYEFCMLRYSNLQSIYGIPTTTDPRIILRNTFSAE  802

Query  563  QNPGQFNQDLTSLVDRLRRQAV--------NGGPFLKYAANSTAGPDSQTIYAYVQCTPD  718
                +F +D   L++ LR QA           G F   +   T      TIY  VQCTPD
Sbjct  803  SFLERFREDRRILMNDLRVQAAMNGGSSGKASGGFRNTSDIGTIYGLDNTIYGLVQCTPD  862

Query  719  LSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLINGSH  880
            LS ++C++CL  A  L  +   +   G R+L PSC  RYE+ PF+  + +   H
Sbjct  863  LSPQECDDCLIQAGEL--RECCDNARGVRMLMPSCNLRYELYPFYNETRLRELH  914



>emb|CAC84518.1| putative receptor-like serine-threonine protein kinase [Solanum 
tuberosum]
Length=651

 Score =   174 bits (440),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 145/246 (59%), Gaps = 29/246 (12%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsn  295
            M  Q+W++ + L +H+ +         P+  +  CG +GNYT NSTY NNLNTLL+SLS+
Sbjct  1    MAIQKWLLILFLHIHVLNIVAQL----PDLRFGSCGGNGNYTENSTYKNNLNTLLTSLSS  56

Query  296  nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
             ++ YGFYN S+GQ+S+RAS  VLCRGDVEL+ CR CV +   +I Q CPNQKE F  Y+
Sbjct  57   KIDNYGFYNASIGQNSDRASVIVLCRGDVELADCRGCVDNVVQKIAQLCPNQKEVFGGYD  116

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA  655
                        GS  T PE             +FNQ+L  L++ LR +AV+ GP  KYA
Sbjct  117  ------------GSNATKPE-------------EFNQELGRLLENLRDRAVDDGPLQKYA  151

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
            + +  GPD Q IYA VQCTPDLS + C +CL  A+    +    G  G R++   C FRY
Sbjct  152  SGNATGPDFQAIYALVQCTPDLSRQSCFSCLSDAYGNMPRCPCLGKRGGRIIGVRCNFRY  211

Query  836  EISPFF  853
            E S FF
Sbjct  212  ESSRFF  217



>gb|EYU23765.1| hypothetical protein MIMGU_mgv1a011805mg [Erythranthe guttata]
Length=270

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 136/213 (64%), Gaps = 1/213 (0%)
 Frame = +2

Query  230  GNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCV  409
            GNYT NS+Y +NLN +LSSL   ++  GFYN SVG + +R++AAVLCRGDVEL  CR C+
Sbjct  7    GNYTTNSSYMSNLNAVLSSLPTGLSSTGFYNASVGLNPDRSNAAVLCRGDVELDECRQCL  66

Query  410  SDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQD  589
             D   ++ + CPNQK+A  W + C + YS+E++ G L T P +   ++    +  +F +D
Sbjct  67   RDITAKLLKSCPNQKQAVEWEDHCMLRYSNETMFGVLATYPGLWMWNLRNATSTVRFKED  126

Query  590  LTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALW  769
            L +L+D LR +A  GG   K AA +   PD QTIY+ VQC+PDLS +DC  CL +A A  
Sbjct  127  LRTLIDGLRIKAAAGGGTRKVAAGNITAPDFQTIYSLVQCSPDLSQKDCNLCLSTAAADI  186

Query  770  NKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
             +   +  IGARVL  SC  RYE  PFF  +++
Sbjct  187  PRC-CDSKIGARVLLQSCNLRYETYPFFNETVL  218



>ref|XP_011076612.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum 
indicum]
Length=683

 Score =   173 bits (438),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 112/251 (45%), Positives = 151/251 (60%), Gaps = 10/251 (4%)
 Frame = +2

Query  113  VMDSQEWII-FILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssl  289
            ++ SQ  ++  I L L   SA + + ++        C  +GNYT NSTY  NL+T+LSSL
Sbjct  15   LLHSQTMLLPLIFLILANLSAFVQSQSV--------CLNNGNYTSNSTYKANLDTVLSSL  66

Query  290  snnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRW  469
              NV++ GFYN S GQ+ +RA+A VLCRGD++L  CR CV D A  +   CPNQK+A  W
Sbjct  67   PTNVHRNGFYNASFGQNPDRANAIVLCRGDIQLDTCRGCVRDAAAALLASCPNQKQAVNW  126

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
               C++ YS+E+++G L T P     +     +  QF +DL++L+D LR QAV GG   K
Sbjct  127  QERCTLRYSNETLVGILATMPGYYWWNPENATSVDQFKEDLSTLLDDLRGQAVYGGSLRK  186

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
             AA +  GPD Q I+A VQC+PDLS  DC +CL  A A   K       G RVLRPSC  
Sbjct  187  VAAGNITGPDFQRIFALVQCSPDLSPEDCSSCLIGAAADIPKCCDRKR-GGRVLRPSCTL  245

Query  830  RYEISPFFGAS  862
            R+EI PF+  +
Sbjct  246  RFEIYPFYNGT  256



>ref|XP_009626039.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
tomentosiformis]
Length=679

 Score =   173 bits (438),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 152/249 (61%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  VMDSQEWIIFILLS-LHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssl  289
             M   +W++F+  + +   S   AAD     + +  CG + NYT NS Y NNLN LLSSL
Sbjct  2    TMAIHKWLLFLFFAYISSWSYPSAAD-----FPYTLCGNNNNYTENSAYHNNLNKLLSSL  56

Query  290  snnvnQYGFYNGSVGQDSERASAAVLCRGDVEL-SVCRSCVSDNAVRIKQWCPNQKEAFR  466
            S+N+++YGFYN S+GQ+++  SA VLCRGDVEL   CRSCVS+    + Q CPNQKEA  
Sbjct  57   SSNMDKYGFYNASIGQNTDMVSAIVLCRGDVELLEACRSCVSNVVQNLTQLCPNQKEASG  116

Query  467  WYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFL  646
              + C ++YS+ +I+G+   +      +      P +FNQ+L  L++ LR  A NG PF 
Sbjct  117  GSDECMLHYSNRNILGTKSFSTPYYLWNTGNASKPEEFNQELRKLLENLRDHAANGDPFR  176

Query  647  KYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCF  826
            KYA+ +  GP+ QTIYA VQCTPDLS ++C +CL  A+        NG  G R++   C 
Sbjct  177  KYASGNATGPNFQTIYALVQCTPDLSPQNCFDCLTDAYGDMPNCPCNGKRGGRIIGTRCN  236

Query  827  FRYEISPFF  853
            FRYE + FF
Sbjct  237  FRYESARFF  245



>ref|XP_006365890.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Solanum tuberosum]
Length=264

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 149/250 (60%), Gaps = 9/250 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLH-LCSATIAADNIDPNYEWHQCGTSGN---YTPnstydnnlntlls  283
            M   +W++ +L   + L   +IA     PN+    C T  N   ++PNS YD NLNT+LS
Sbjct  1    MSLLKWLVILLFQFYYLFDLSIA----QPNFTSSVCSTDSNITEFSPNSAYDTNLNTILS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
            S+S N++ +GFYN S+G +S+  S    CRGDV+L  CR C+S+   +I + CP ++ A 
Sbjct  57   SVSQNMDSFGFYNSSIGLNSDTVSVIAQCRGDVQLQACRDCISNATRKILEVCPYKRWAL  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             +Y+ C + YS+ESIIG+L T P     ++    +P +F QDL ++++ LR +A  GG  
Sbjct  117  GYYDRCMLRYSNESIIGNLATQPGRILFNMANASSPDEFMQDLRTMLESLRSEASQGGK-  175

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSC  823
             KYA+N+T GPD QTIYA VQCT DL+ +DC +CL S F            G   L PSC
Sbjct  176  QKYASNTTQGPDFQTIYALVQCTADLTAQDCFSCLDSGFRSLPTCLCYRKQGLNFLMPSC  235

Query  824  FFRYEISPFF  853
             FRYEI  FF
Sbjct  236  NFRYEIYSFF  245



>ref|XP_006348198.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=655

 Score =   169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 138/220 (63%), Gaps = 2/220 (1%)
 Frame = +2

Query  200  NYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGD  379
            + ++ QCG +GNYT +S Y NNLNTLL SLS N+++YGFYN S+GQ+S + SA VLCRGD
Sbjct  27   DLKYVQCGGNGNYTEDSAYKNNLNTLLYSLSLNIDEYGFYNASIGQNSNKVSAIVLCRGD  86

Query  380  VELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQH-SIT  556
            + L  CR CV +   R+ + CPNQKEA   Y+ C + YS+ SII    + P +    +  
Sbjct  87   IGLDRCRYCVDNIGQRLVEICPNQKEANAGYDECLLQYSNRSIINDTTSFPTLYYFWNHE  146

Query  557  PVQNPGQFNQDLTSLVDRLRRQAVNGG-PFLKYAANSTAGPDSQTIYAYVQCTPDLSVRD  733
                P +FNQDL  L+  LR QA NGG P  KYA+ +  GPD QTIYA VQCTP+LS ++
Sbjct  147  NASQPEEFNQDLEKLLVDLRGQAANGGDPRRKYASGNATGPDFQTIYALVQCTPNLSPQN  206

Query  734  CENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            C +CL  A+         G    R++  SC+FRYE   FF
Sbjct  207  CFDCLTGAYGNMPSCPCKGKTSGRIIGLSCYFRYETYRFF  246



>ref|XP_010316618.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=671

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = +2

Query  197  PNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRG  376
            P  ++  CG +GNYT NSTY NNLNTLL+SL + ++ YGFY  S+G+     S  VLCRG
Sbjct  24   PQLQFGSCGENGNYTENSTYKNNLNTLLTSLPSKIDGYGFYYDSIGE----VSGIVLCRG  79

Query  377  DVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH-ESIIGSLRTTPEIEQHSI  553
            DV+L  CR CV + A ++ Q CP QKE    Y  C + YS+ +SII +   +      + 
Sbjct  80   DVKLDDCRVCVYNAAQKLVQLCPTQKEVLGGYGECLLLYSNNQSIIETPSFSVRYFFWNA  139

Query  554  TPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRD  733
                 P +FNQ+L  L++ LR +A+NGGPF KYA+ +  GPD QTIYA VQCTPDL+ R+
Sbjct  140  ANASKPEEFNQELHKLLENLRGRAINGGPFRKYASGNVTGPDDQTIYALVQCTPDLTPRN  199

Query  734  CENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            C NCL   +    +    G IG R++ P C FRYEIS FF
Sbjct  200  CFNCLTDIYNNMPQCPCLGKIGGRIIGPRCNFRYEISRFF  239



>gb|KDP20813.1| hypothetical protein JCGZ_21284 [Jatropha curcas]
Length=315

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 142/248 (57%), Gaps = 5/248 (2%)
 Frame = +2

Query  122  SQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnn  298
            S+  ++F    + L   TIA   I P + +  C  +GN+T NST   N    L S  SN 
Sbjct  4    SRLLLLFYPTLIQLLVVTIAQP-IPPLFYF--CNNNGNFTANSTYSSNLDRILTSLSSNT  60

Query  299  vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
                GFYN S+GQ++++ +A  LCRGD +  +CRSC+ ++++ +KQ CPNQKEA  WY+ 
Sbjct  61   KISSGFYNDSIGQNTDKVNAIALCRGDTKPEICRSCIGNSSLALKQLCPNQKEAITWYDN  120

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + YS+ S+ GS+   P     ++  V    QFN+ L +L+D L  Q  +G    K+A 
Sbjct  121  CMLRYSNRSLFGSMEINPSFVMWNVNNVSQVTQFNRVLKTLLDSLVTQVASGDSLRKFAT  180

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
             +     +QTIYA  QCTPDLS ++C +CL  A  +  +   +G  GARV  PSC FRYE
Sbjct  181  GNARTTSNQTIYALAQCTPDLSKQNCSDCLAKATGIIPQC-CDGKQGARVGTPSCNFRYE  239

Query  839  ISPFFGAS  862
            I  F+ ++
Sbjct  240  IELFYDSA  247



>gb|EYU44078.1| hypothetical protein MIMGU_mgv1a002897mg [Erythranthe guttata]
Length=627

 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 147/252 (58%), Gaps = 10/252 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsn  295
            M+SQ W+   L+   +C+   A +        + C  +GNYT N+TY NNLNTLLSSLS 
Sbjct  1    MNSQNWVWLTLILTRVCALATAQN--------YNCFNNGNYTSNTTYSNNLNTLLSSLSP  52

Query  296  nvnQYGFYNGSV-GQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY  472
            N+N  GFY+ S  G   +RA A  +CR D++L  CR+CV +  V +   CP QK+A  W 
Sbjct  53   NLNDTGFYSASSSGGQPDRAYATAVCRTDIQLDTCRTCVQNGTVELLGLCPYQKQAILWR  112

Query  473  NICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKY  652
              C+I YS E + G    +P +   +        QF +DL +L+D LR QA +GG  +K 
Sbjct  113  EFCTIRYSDEPVFGIRADSPAVLLRNTMNASGAAQFKEDLRTLIDDLRSQAASGGSLVKV  172

Query  653  AANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFR  832
            AA + +GPD QTI+  +QC+PDLS  DC+ CL SA A +     +G  G R+L PSC  R
Sbjct  173  AAGNISGPDFQTIFGMLQCSPDLSADDCDGCLISA-AQYIPGCCDGSRGVRILAPSCNLR  231

Query  833  YEISPFFGASLI  868
            YEISP++  + I
Sbjct  232  YEISPYYNITRI  243



>ref|XP_007143180.1| hypothetical protein PHAVU_007G050200g [Phaseolus vulgaris]
 gb|ESW15174.1| hypothetical protein PHAVU_007G050200g [Phaseolus vulgaris]
Length=657

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 137/241 (57%), Gaps = 6/241 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQY  310
            IF+ + L L S  I+  N  P +  HQC    GNYT NST ++N    L +  SN    Y
Sbjct  17   IFLFIFLQLIS--ISQCNAQPVFHLHQCMNHKGNYTANSTYHNNLNTLLSNLSSNTDIDY  74

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ+S+R +A  LCRGD +   CR C+SD+ V + Q CPNQKEA  WY+ C + 
Sbjct  75   GFYNFSYGQESDRVNAIGLCRGDAKPDACRMCLSDSKVLLTQLCPNQKEAILWYDYCMLR  134

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI  ++  TP   + +     +   FN+ L +L++ L  QA  G    K+A  + +
Sbjct  135  YSNRSIFKTMEATPGFSKRTYNAT-DGDSFNEVLRNLLENLTSQASTGDSLRKFAVANAS  193

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            GP  QTI+  VQCTPDLS + C+ CL    +   +   NG  GA+  +PSC  RYEI PF
Sbjct  194  GPAFQTIFGLVQCTPDLSEKHCDECLLKTISEIPQC-CNGSKGAKFFKPSCIIRYEIFPF  252

Query  851  F  853
            +
Sbjct  253  Y  253



>ref|XP_002316621.2| hypothetical protein POPTR_0011s03270g [Populus trichocarpa]
 gb|EEE97233.2| hypothetical protein POPTR_0011s03270g [Populus trichocarpa]
Length=682

 Score =   164 bits (415),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 147/260 (57%), Gaps = 16/260 (6%)
 Frame = +2

Query  116  MDSQEWIIFILLS---LHLCSATIAADNIDPNYEWHQCG--TSGNYTPnst-ydnnlntl  277
            MDS + ++ +  S   LH  S T A     PN+ ++ C    +GNYT NST   N  + L
Sbjct  8    MDSSKLVLLLSFSYILLHQPSLTAA----QPNFIYYNCNYNNTGNYTTNSTYQRNLNSLL  63

Query  278  lsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKE  457
             S  S+    YGFYN SVG+  +R +A  LCRGDV + VCRSCV+D+  +I + CPN+  
Sbjct  64   SSLASDTQIDYGFYNLSVGEFPDRVNAIALCRGDVAVDVCRSCVNDSTHKILEVCPNKMG  123

Query  458  AFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGG  637
            AF  Y +C I YS+ SI G +   P I Q +   V +   FNQ L +L  RLR +A +G 
Sbjct  124  AFGVYALCMIRYSNTSIFGVVDEKPSIYQANGKNVLDVTLFNQALQTLFARLRAKAASGN  183

Query  638  PFLKYA-ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG---NGMIGAR  805
               K+A  N +AG   +T+YA VQCTPDLS   C +CL   F +     G    G IGA+
Sbjct  184  SLKKFATGNQSAG--VETVYAIVQCTPDLSEGQCSSCLLGVFRMITNCCGGNVQGKIGAK  241

Query  806  VLRPSCFFRYEISPFFGASL  865
            ++ PSC  R+EI PFF  +L
Sbjct  242  LITPSCNLRWEIGPFFNGTL  261



>emb|CDP09634.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   163 bits (413),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 146/246 (59%), Gaps = 9/246 (4%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlntllsslsnnvnQY  310
            + F+L +L     T +A    P++    C  + GNY+ NS Y  NLNTLLSSLS NV+ Y
Sbjct  14   VFFVLTTLF--GLTFSA----PDFTQFFCSNNIGNYSKNSKYQANLNTLLSSLSTNVSPY  67

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN SVG+D +R  A VLCRGD     C +CV+D+A  I Q CPNQKEA  WY IC I 
Sbjct  68   GFYNSSVGEDPDRTYALVLCRGDASFQDCETCVNDSANMILQLCPNQKEAIGWYTICMIR  127

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+++  G++ T P     S     N   FNQDL++L + LR Q V GG  LK+AA +  
Sbjct  128  YSNKNFFGNMSTRPNFNLQSSVVPPNLSIFNQDLSNLTNSLRDQTV-GGFSLKFAAGTRK  186

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
               + TIYA +QCTPD+   DC  CL  A  + ++    G  GARV+ PSC F YE+ PF
Sbjct  187  SDSNITIYALMQCTPDIDGGDCNLCLGWALQVLSQC-CYGTEGARVVGPSCSFWYEVFPF  245

Query  851  FGASLI  868
            +   +I
Sbjct  246  YNERVI  251



>gb|KHN02664.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=261

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 110/182 (60%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++ +A  LCRGD++   CRSC++D    + Q CPNQKEA  +Y+ C +
Sbjct  65   YGFYNLSYGENEDKVNAIGLCRGDLKPDECRSCLNDARGNLTQRCPNQKEAIIYYDECLL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS  SI G + T+P+    +I    N GQFNQ L +L+  L   A +G    KYAA S 
Sbjct  125  RYSDRSIFGVMETSPDYVLFNIQNATNVGQFNQVLRNLMRMLTGIAASGDSRRKYAAASA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + Q IY  VQCTPDLS  +C++CL  A +   +   NG IG RVLRPSC  RYE  P
Sbjct  185  TATNIQAIYGLVQCTPDLSQPECKHCLIGAISEIPRC-CNGKIGGRVLRPSCNIRYENYP  243

Query  848  FF  853
            F+
Sbjct  244  FY  245



>ref|XP_002271125.3| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=692

 Score =   161 bits (408),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 148/253 (58%), Gaps = 12/253 (5%)
 Frame = +2

Query  113  VMDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlntlls  283
            +MD    ++F+   L+LHL + T+ A    P++ +H C    GNYT NSTY  NLNTLLS
Sbjct  10   IMDPPRLLLFLYPFLTLHLLAVTVFAQ---PDFLYHFCIEGVGNYTSNSTYKANLNTLLS  66

Query  284  sl-snnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            SL S+N   YGFYN S GQ+SER +A  LCRGDV    CRSC++D+ +++ + CPNQKEA
Sbjct  67   SLPSDNAIDYGFYNFSAGQNSERVNAIGLCRGDVTPDACRSCLNDSRLQLTELCPNQKEA  126

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGP  640
              WY+ C + YS+ SI  +    P    H++  V N  +FN+ L +L   L+ +  +G  
Sbjct  127  IGWYDNCMLRYSNRSIFSTKEDLPAFSMHNVNNVSNGDEFNEALGNLFASLKSKVASGDS  186

Query  641  FLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG--NGMIGARVLR  814
              K+A         Q IYA VQCTPDLS   C NC++ A    N   G  +   G RV++
Sbjct  187  RYKFATGEVNVSSFQNIYALVQCTPDLSQLSCSNCIEGAI---NGIPGCCDRKQGGRVVK  243

Query  815  PSCFFRYEISPFF  853
            PSC  R+E+  F+
Sbjct  244  PSCNIRFELYRFY  256



>ref|XP_006589610.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=666

 Score =   161 bits (407),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 140/225 (62%), Gaps = 4/225 (2%)
 Frame = +2

Query  197  PNYEWHQC-GTSGNYTPnstydnnlntllsslsnnvnQY--GFYNGSVGQDSERASAAVL  367
            P++ +H C    GNYT NS+Y  NLNTLLS+LS++  Q   GFYN S GQ+S++ +A  +
Sbjct  26   PSFLYHFCTNDKGNYTANSSYQTNLNTLLSTLSSSNTQIDSGFYNFSEGQNSDKVNAIGM  85

Query  368  CRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQH  547
            CRGDV+   CRSC++D+ V + Q CPNQKEA  WY+ C + YS+ SI  ++   P     
Sbjct  86   CRGDVKPDACRSCLNDSRVLLTQRCPNQKEAIGWYDDCMLRYSNRSIFETMEPNPTYFLW  145

Query  548  SITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSV  727
            + +   +  QFN+ L  LVD LR +A +G    KYAA S AGP  QTI+A +QCTPDLS 
Sbjct  146  TQSNATDMDQFNEALRGLVDGLRSKAASGDSLKKYAAGSAAGPSFQTIFALLQCTPDLSE  205

Query  728  RDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            + C NCL  A    + S   G    R+ +PSC  R++ SPF+ ++
Sbjct  206  QQCNNCLVRAITDIS-SCCAGRTSGRIGKPSCNLRFDTSPFYDSA  249



>ref|XP_007143173.1| hypothetical protein PHAVU_007G049800g [Phaseolus vulgaris]
 gb|ESW15167.1| hypothetical protein PHAVU_007G049800g [Phaseolus vulgaris]
Length=260

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 108/183 (59%), Gaps = 4/183 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++S++  A  +CRGDV+   CRSC++++ V + Q CPNQKEA  WY+ C +
Sbjct  67   YGFYNLSYGENSDKVYAIGVCRGDVKPDECRSCINNSTVLLTQLCPNQKEAIGWYDKCML  126

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLR-RQAVNGGPFLKYAANS  664
             YS+ SI G + T+P           N  QFNQ L +LV  L    A +G    KYAA +
Sbjct  127  RYSNRSIFGLMETSPLFYTLEFVNATNVDQFNQVLDNLVSNLTGIAAASGDSLRKYAAGN  186

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            +  P+ +TIY  VQCTPDLS +DC  CL  AF+   +   +G I  RV  PSC  RYE  
Sbjct  187  STAPNLETIYGVVQCTPDLSQQDCNRCLVEAFS---RITSSGKISGRVATPSCNIRYENY  243

Query  845  PFF  853
             F+
Sbjct  244  RFY  246



>ref|XP_006365883.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=676

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 149/251 (59%), Gaps = 10/251 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSL-HLCSATIAADNIDPNYEWHQCGTSG--NYTPnstydnnlntllss  286
            M   +W++ ++    ++   +IA     P +E+H C  S    ++PNSTYD NLNT LSS
Sbjct  1    MSFLKWLVLVMFQFNYIFHLSIA----QPEFEFHVCADSNITEFSPNSTYDTNLNTTLSS  56

Query  287  lsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFR  466
            +S N++ +GFYN S+  +S+  S    CRGDV+L VCR C+S+   +I + CP +K AF 
Sbjct  57   VSRNMDSFGFYNSSIALNSDTISVIAQCRGDVQLQVCRDCISNATRKILEVCPYKKSAFG  116

Query  467  WYNICSIYYSHESIIGS-LRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
            +Y  C + YS+ESIIG+ L   P    +S     N  +F +D+ +L++ LRR+A  GG  
Sbjct  117  YYESCQLRYSNESIIGTVLIINPPNILYSTANASNLNEFMEDVRTLLESLRREASRGGK-  175

Query  644  LKYAANSTAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPS  820
             KYA+NSTAG    QTIYA VQCT DLS   C NCL + +      +  G IG R   PS
Sbjct  176  RKYASNSTAGRLVFQTIYALVQCTADLSAESCSNCLTAGYQTLPNCECYGTIGLRYRVPS  235

Query  821  CFFRYEISPFF  853
            C F+YE S FF
Sbjct  236  CKFQYETSSFF  246



>ref|XP_006467960.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=320

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 111/184 (60%), Gaps = 1/184 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GF+N S GQ+ ++ +A  LCRGDV+   CRSC++   + +   CPNQKEA  WY+ C + 
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATLALPTRCPNQKEAIIWYDNCMLR  127

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+    G++   P    +++    +   FNQ + SL+D L+ +A  G  F    AN++A
Sbjct  128  YSNRFFFGNMEFGPRFSMYNLKNASDASTFNQAVKSLLDSLKIKAAPGDKFATGNANTSA  187

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            G  SQTIYA VQCTPDLS + C +CL +A  L  K   +G +G RV+ PSC FRYEI  F
Sbjct  188  GAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKC-CDGRLGGRVIAPSCNFRYEIDRF  246

Query  851  FGAS  862
            +  +
Sbjct  247  YDVT  250



>gb|KDO75586.1| hypothetical protein CISIN_1g021048mg [Citrus sinensis]
Length=318

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 111/184 (60%), Gaps = 1/184 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GF+N S GQ+ ++ +A  LCRGDV+   CRSC++   + +   CPNQKEA  WY+ C + 
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATLALPTRCPNQKEAIIWYDNCMLR  127

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+    G++   P    +++    +   FNQ + SL+D L+ +A  G  F    AN++A
Sbjct  128  YSNRFFFGNMEFGPRFSMYNLKNASDASTFNQAVKSLLDSLKIKAAPGDKFATGNANTSA  187

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            G  SQTIYA VQCTPDLS + C +CL +A  L  K   +G +G RV+ PSC FRYEI  F
Sbjct  188  GAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKC-CDGRLGGRVIAPSCNFRYEIDRF  246

Query  851  FGAS  862
            +  +
Sbjct  247  YDVT  250



>gb|KHN15830.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=675

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 136/239 (57%), Gaps = 3/239 (1%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQYGF  316
            I L + +   +I+  N  P + +H C    GNY+ NST  +N    L +  SN    YGF
Sbjct  9    IFLCILVILISISQSNAQPGFLYHFCINDKGNYSANSTYQNNLNTLLSNLSSNTQIDYGF  68

Query  317  YNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYS  496
            YN S GQ+S+R +A  LCRGD +   CRSC +D+ V + Q CPNQKEA  WY+ C + YS
Sbjct  69   YNFSYGQESDRVNAIGLCRGDFKPDACRSCFNDSKVVLTQLCPNQKEAIVWYDNCMLRYS  128

Query  497  HESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGP  676
            + SI  ++  +P     +     +  QFNQ L +L+  L  Q  +G    K+AA + +GP
Sbjct  129  NRSIFNTMEASPSAYMWNPGNATDVDQFNQVLRTLLYSLVSQGSSGDSRHKFAAANVSGP  188

Query  677  DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
              QTIY  VQCTPDLS ++C +CL  A +   +   +   G RV+RPSC FRYE  PF+
Sbjct  189  SFQTIYGLVQCTPDLSEQECTSCLVDAISEIPRC-CDSKKGGRVMRPSCNFRYETYPFY  246



>ref|XP_007143168.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris]
 gb|ESW15162.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris]
Length=672

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 112/184 (61%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN S GQ++++ +A  LCRGDV+   CR C++D+A+ I Q CPNQKEA  W N   C
Sbjct  66   YGFYNFSHGQNNDKVNAIGLCRGDVKPDECRRCLNDSALTITQLCPNQKEALLWLNTSKC  125

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YSH +I G + ++P     ++  V    +FNQ L++L+  L   A +G   LKYAA+
Sbjct  126  LLRYSHRTIFGVMESSPGFYLTNVNNVTEADKFNQALSNLMRNLTVVAASGDSRLKYAAD  185

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            S    + QT+Y  VQCTPDLS  DC  CL  A +      GN M G RVLRPSC  R+E 
Sbjct  186  SAIAANFQTVYGLVQCTPDLSETDCNRCLDGAISEIPSCCGNKM-GGRVLRPSCNIRFES  244

Query  842  SPFF  853
            + F+
Sbjct  245  AIFY  248



>ref|XP_006449122.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
 gb|ESR62362.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
Length=317

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 112/184 (61%), Gaps = 1/184 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GF+N S GQ+ ++ +A  LCRGDV+   CRSC++   V + + CPN+KEA  WY+ C + 
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATVELPKRCPNEKEAIIWYDNCMLR  127

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+    G++   P    +++    +   FNQ + SL+D L+ +A  G  F    AN++A
Sbjct  128  YSNRFFFGNMEFGPWFSMYNLKNASDASTFNQAVKSLLDSLKIKAAPGDKFATGNANTSA  187

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            G  SQTIYA VQCTPDLS + C +CL +A  L  K   +G +G RV+ PSC FRYEI  F
Sbjct  188  GAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKC-CDGRLGGRVIAPSCNFRYEIGRF  246

Query  851  FGAS  862
            +  +
Sbjct  247  YDVT  250



>gb|KDO75587.1| hypothetical protein CISIN_1g040542mg, partial [Citrus sinensis]
Length=250

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 115/186 (62%), Gaps = 1/186 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY  S G+++++ +A  LCRGDV  + CRSC+  +AV +++ CPNQKEA  WY+ C +
Sbjct  65   YGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCML  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+    G++   P    +++  V +   FN+D+ +L++ L+ +A +G    K+A  + 
Sbjct  125  RYSNRYFFGNMEFGPWFWMYNLHNVSDATTFNRDVATLLNILKNKATSGDNCRKFATGNA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               +S TIYA VQCTPDL  + C +CL +A AL  K   +G  G RV+ PSC FRYEI  
Sbjct  185  TTTNSLTIYALVQCTPDLEKQQCIDCLNNATALLPKC-CDGRQGGRVIAPSCNFRYEIGR  243

Query  848  FFGASL  865
            F+  ++
Sbjct  244  FYDLTV  249



>ref|XP_006468227.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=251

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 115/186 (62%), Gaps = 1/186 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY  S G+++++ +A  LCRGDV  + CRSC+  +AV +++ CPNQKEA  WY+ C +
Sbjct  65   YGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCML  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+    G++   P    +++  V +   FN+D+ +L++ L+ +A +G    K+A  + 
Sbjct  125  RYSNRYFFGNMEFGPWFWMYNLHNVSDATTFNRDVATLLNILKNKATSGDNCRKFATGNA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               +S TIYA VQCTPDL  + C +CL +A AL  K   +G  G RV+ PSC FRYEI  
Sbjct  185  TTTNSLTIYALVQCTPDLEKQQCIDCLNNATALLPKC-CDGRQGGRVIAPSCNFRYEIGR  243

Query  848  FFGASL  865
            F+  ++
Sbjct  244  FYDLTV  249



>ref|XP_007025550.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
 gb|EOY28172.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
Length=316

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 139/252 (55%), Gaps = 16/252 (6%)
 Frame = +2

Query  116  MDSQEW-IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnsty-dnnlntllssl  289
            MDS    ++F L+S+ L + T    ++ P      C T  N+T NSTY +N  +   +  
Sbjct  1    MDSSRLALLFFLVSIQLSALT----SVQPEKLLRLCSTQSNFTMNSTYGNNLKHLFSTIT  56

Query  290  snnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRW  469
            SN    YGFYN S GQ+S+  +A  LCRGDV+  +CRSC+++      + CPNQ+EA  W
Sbjct  57   SNTQIDYGFYNVSYGQNSDEVNALGLCRGDVKPDICRSCITNATNEFTENCPNQREAIVW  116

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
            Y+ C + YS+ SI G ++  P     ++  V N  QFNQ L  L+  LR QA +G    K
Sbjct  117  YDECMLRYSNRSIFGKMQFPPAWVMENVNNVSNVNQFNQVLAILLGDLRIQAASGDSLHK  176

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSA---FALWNKSKGNGMIGARVLRPS  820
            +A  +    +SQ IYA  QCTPDLS  +C NCL +A     LW        +GAR+L PS
Sbjct  177  FATGNATVSNSQAIYALAQCTPDLSQVECNNCLSNATESLPLWR-------VGARILTPS  229

Query  821  CFFRYEISPFFG  856
            C  RYE   F+G
Sbjct  230  CTVRYENYIFYG  241



>ref|XP_006449123.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
 gb|ESR62363.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
Length=250

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 115/186 (62%), Gaps = 1/186 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY  S G+++++ +A  LCRGDV  + CRSC+  +AV +++ CPNQKEA  WY+ C +
Sbjct  65   YGFYTASYGRNNDQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCML  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+    G++   P    +++  V +   FN+D+ +L++ L+ +A +G    K+A  + 
Sbjct  125  RYSNRYFFGNMEFGPWFWMYNLHNVSDATTFNRDVATLLNILKNKAASGDNCRKFATGNA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               +S TIYA VQCTPDL  + C +CL +A AL  K   +G  G RV+ PSC FRYEI  
Sbjct  185  TTTNSLTIYALVQCTPDLEKQQCIDCLNNATALLPKC-CDGRQGGRVIAPSCNFRYEIGR  243

Query  848  FFGASL  865
            F+  ++
Sbjct  244  FYDLTV  249



>ref|XP_003556008.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=675

 Score =   159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 135/239 (56%), Gaps = 3/239 (1%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQYGF  316
            I L + +   +I+  N  P + +H C    GNY+ NST  +N    L +  SN    YGF
Sbjct  9    IFLCILVILISISQSNAQPGFLYHFCINDKGNYSANSTYQNNLNTLLSNLSSNTQIDYGF  68

Query  317  YNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYS  496
            YN S GQ+S+R +A  LCRGDV+   CR C +D+ V + Q CPNQKEA  WY+ C + YS
Sbjct  69   YNFSYGQESDRVNAIGLCRGDVKPDACRICFNDSKVLLTQLCPNQKEAIGWYDNCMLRYS  128

Query  497  HESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGP  676
            + SI  ++   P     +     +  QFNQ L +L+  L  Q  +G    K+AA + +GP
Sbjct  129  NRSIFNTMEALPSFSMRNHGNTTDVDQFNQVLRTLLYSLVGQGSSGDSRHKFAAANVSGP  188

Query  677  DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
              +TIY  VQCTPDLS ++C +CL  A +   +   +   G RV+RPSC FRYE  PF+
Sbjct  189  GFETIYGLVQCTPDLSEQECTSCLVDAISEIPRC-CDSKKGGRVVRPSCNFRYETYPFY  246



>ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=552

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY+ C +
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS+ SI G +  +P+    +I  V    QFNQ L +L+ +L+ +A +     K+A +  
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +    + QTIY  VQCTPDLS +DC NCL  A +    S  N  IG RVL+PSC  RYE 
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDI-PSCCNNKIGGRVLKPSCNIRYET  246

Query  842  SPFF  853
            S F+
Sbjct  247  SSFY  250



>gb|KEH43963.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=671

 Score =   158 bits (399),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY+ C +
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS+ SI G +  +P+    +I  V    QFNQ L +L+ +L+ +A +     K+A +  
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +    + QTIY  VQCTPDLS +DC NCL  A +    S  N  IG RVL+PSC  RYE 
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDI-PSCCNNKIGGRVLKPSCNIRYET  246

Query  842  SPFF  853
            S F+
Sbjct  247  SSFY  250



>ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=671

 Score =   158 bits (399),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY+ C +
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS+ SI G +  +P+    +I  V    QFNQ L +L+ +L+ +A +     K+A +  
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +    + QTIY  VQCTPDLS +DC NCL  A +    S  N  IG RVL+PSC  RYE 
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDI-PSCCNNKIGGRVLKPSCNIRYET  246

Query  842  SPFF  853
            S F+
Sbjct  247  SSFY  250



>ref|XP_010999534.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=683

 Score =   157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 147/260 (57%), Gaps = 16/260 (6%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLC---SATIAADNIDPNYEWHQCG--TSGNYTPnst-ydnnlntl  277
            MDS + ++ +  S  L    S T A     P + ++ C    +GNYT NST   N  + L
Sbjct  8    MDSSKLVLLLSFSYILLLQPSLTTA----QPKFIYYNCNYNNTGNYTTNSTYQRNLNSLL  63

Query  278  lsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKE  457
             S  S+    YGFYN SVG+  +R +A  LCRGDV + VCRSCV+D+A +I + CPN+  
Sbjct  64   SSLASDTQIDYGFYNLSVGEFPDRVNAIALCRGDVAVDVCRSCVNDSAHKILEVCPNKMG  123

Query  458  AFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGG  637
            AF  Y +C I YS+ SI G +   P     ++  V +   FNQ L +L  RLR +A +G 
Sbjct  124  AFGVYALCMIRYSNRSIFGVVDEQPSFYNWNLQNVLDVTLFNQALQTLFARLRDKAASGN  183

Query  638  PFLKYA-ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFAL-WNKSKGN--GMIGAR  805
               K+A  N +AG   +T+YA VQCTPDLS   C +CL   F +  N   GN  G IGA+
Sbjct  184  SLKKFATGNQSAG--VETVYAIVQCTPDLSEGQCSSCLLDLFRMSTNCCNGNVRGKIGAK  241

Query  806  VLRPSCFFRYEISPFFGASL  865
            ++RPSC  R+EI  FF  +L
Sbjct  242  LIRPSCNLRWEIGQFFNGTL  261



>ref|XP_011098674.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Sesamum indicum]
Length=593

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFY  S G     A+A VLCRGD++L+ CRSCV   A  I Q C NQ  A RW+  C + 
Sbjct  55   GFYAASEGP----ANAIVLCRGDLQLNECRSCVDVVASEIVQLCGNQLRAIRWHINCMLR  110

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS E ++G++ TTP     S   V +P +F + L  L+D LR +A  GG  LK AA + +
Sbjct  111  YSDEPMLGTMATTPNTTVWSELNVTSPDRFKEVLGGLMDDLRGEAAYGGSSLKAAAGNRS  170

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            GPD QTIYA +QCTPDLS   C++CL  A  L   S     IGARV  PSC  RYEISPF
Sbjct  171  GPDGQTIYAMLQCTPDLSNESCDSCLSQAAQL---SPAWYPIGARVYTPSCIIRYEISPF  227

Query  851  F  853
            +
Sbjct  228  Y  228



>ref|XP_011098665.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Sesamum indicum]
Length=638

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFY  S G     A+A VLCRGD++L+ CRSCV   A  I Q C NQ  A RW+  C + 
Sbjct  55   GFYAASEGP----ANAIVLCRGDLQLNECRSCVDVVASEIVQLCGNQLRAIRWHINCMLR  110

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS E ++G++ TTP     S   V +P +F + L  L+D LR +A  GG  LK AA + +
Sbjct  111  YSDEPMLGTMATTPNTTVWSELNVTSPDRFKEVLGGLMDDLRGEAAYGGSSLKAAAGNRS  170

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            GPD QTIYA +QCTPDLS   C++CL  A  L   S     IGARV  PSC  RYEISPF
Sbjct  171  GPDGQTIYAMLQCTPDLSNESCDSCLSQAAQL---SPAWYPIGARVYTPSCIIRYEISPF  227

Query  851  F  853
            +
Sbjct  228  Y  228



>ref|XP_010092052.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB49966.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=604

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/253 (36%), Positives = 142/253 (56%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  VMDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssls  292
            ++ S+ + I   + L L  AT       P+++++ C   G     +   N  N L S + 
Sbjct  4    ILPSRPFYILCPIFLLLIRATT-----QPDFQYYFCAKDGGNVTYAYRANLDNLLSSLVI  58

Query  293  nnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY  472
               N +GFYN S G   ++     LCRGDV+   CR+C++D A  ++Q C N+ EA  WY
Sbjct  59   KEDNGFGFYNLSNGNAPDKVYTMGLCRGDVDSKFCRTCLNDCAYLLRQRCSNKAEAVGWY  118

Query  473  NICSIYYSHESIIGSLRTTPEIEQ-HSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
            + C++ YS+ S++G + T+      ++     N   F Q+L++L++ L++QA  GG   K
Sbjct  119  DNCTLRYSNRSMLGIMETSRTYSMWNTRNLTSNVDGFFQNLSTLLNNLKKQAAAGGSLRK  178

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            +A  +T+ PD  TIYA VQC+PDLS RDC++CL   F     +  +G +G RV+ P+C F
Sbjct  179  FATGNTSAPDFITIYALVQCSPDLSQRDCDDCLDDQFGFI-PTCCDGKVGGRVVGPTCNF  237

Query  830  RYEISPFFGASLI  868
            RYEI  FFG + +
Sbjct  238  RYEIYLFFGPAYV  250



>ref|XP_007025935.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28557.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=666

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 132/248 (53%), Gaps = 11/248 (4%)
 Frame = +2

Query  122  SQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnn  298
            S+  ++F  + L L + T+ AD   P ++     T+GNYT NST  +N  N      S  
Sbjct  6    SRVLLLFYSVLLFLATLTLGAD---PFFQARCVNTAGNYTANSTYQNNLDNIFSQVTSLT  62

Query  299  vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
               YGF+N S GQ+  + +A  LCRGD  L  C SC+++    ++Q CP  KE   W   
Sbjct  63   EFNYGFHNLSSGQNPNKVNAIALCRGDTNLDNCNSCLNETVSELRQRCPLYKEVVGWSEF  122

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + Y++  I+G +  +P     +   V N  QFNQ L +L++ L  QA   GP  KYAA
Sbjct  123  CMLRYANRDILGEMEVSPSACLLNTQDVTNADQFNQALENLLNNLSSQAAAEGPLRKYAA  182

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGN---GMIGARVLRPSCFF  829
            ++      QT+Y  VQCTPDLS ++C  CL     +     GN   G  G RVLRPSCF 
Sbjct  183  DNLTAGVFQTVYTMVQCTPDLSEQECGECL----TVVKNGIGNCCLGKRGCRVLRPSCFL  238

Query  830  RYEISPFF  853
            R+E SPFF
Sbjct  239  RFESSPFF  246



>gb|EYU23768.1| hypothetical protein MIMGU_mgv1a020214mg, partial [Erythranthe 
guttata]
Length=631

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = +2

Query  314  FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYY  493
            FYN SVGQ  +RA+AAVLC  DVEL  CR C+ D   +I   CPN K+AF W   C + Y
Sbjct  28   FYNASVGQYPDRANAAVLCGADVELDECRRCLRDITPKILTSCPNYKQAFEWDEGCVLRY  87

Query  494  SHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAG  673
            S+E++ G L   P +   ++    +P +F +DL +L+D LR +A  G    K AA +   
Sbjct  88   SNETMFGVLAMYPGLWWWNLNNATSPVRFKEDLRTLIDGLRIKAAAGDGTRKVAAGNITA  147

Query  674  PDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            PD QTIYA VQC+PDLS +DC  CL +A A   +   N  +G RVL  SC+ RYE  PFF
Sbjct  148  PDFQTIYALVQCSPDLSQKDCNICLLTAEADIPRCCDN-RVGGRVLLQSCYLRYETYPFF  206

Query  854  GASLI  868
              +++
Sbjct  207  NETVL  211



>gb|AAD21872.1| receptor-like protein kinase homolog RK20-1 [Phaseolus vulgaris]
Length=666

 Score =   156 bits (395),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 113/187 (60%), Gaps = 3/187 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN S GQ++++ +A  LCRGDV+   CR C++D+A+ I Q CPNQKEA  W N   C
Sbjct  60   YGFYNFSHGQNNDKVNAIGLCRGDVKPDECRRCLNDSALTITQLCPNQKEALLWLNTSKC  119

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YSH +I G + ++P     ++  V    +FNQ L++L+      A +G   LKYAA+
Sbjct  120  LLRYSHRTIFGVMESSPGFYLTNVNNVTEADKFNQALSNLMRNPTVVAASGDSRLKYAAD  179

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            S    + QT+Y  VQCTPDLS  DC  CL  A +      GN M G RVLRPSC  R+E 
Sbjct  180  SAIAANFQTVYGLVQCTPDLSETDCNRCLDGAISEIPSCCGNKM-GGRVLRPSCNIRFES  238

Query  842  SPFFGAS  862
            + F+ ++
Sbjct  239  AIFYDSN  245



>ref|XP_006377262.1| hypothetical protein POPTR_0011s03240g [Populus trichocarpa]
 gb|ABK96183.1| unknown [Populus trichocarpa]
 gb|ERP55059.1| hypothetical protein POPTR_0011s03240g [Populus trichocarpa]
Length=257

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 2/183 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY GS G++ ++A A  LCRGD +   CRSC+ +++  + Q CPNQKEA+ WY+ C +
Sbjct  66   YGFYTGSFGENIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCPNQKEAYIWYDDCML  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NS  664
             Y++ +I  S+   P    +S+  V +  +FN+ L +L+ RL   A  G    K+AA N+
Sbjct  126  RYANHTIFNSMEFGPYFWMYSLVNVTDENEFNEVLNALLGRLINFAALGDSRRKFAAGNA  185

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            TA    QT+YA VQCTPDL+ + C +CL  A  L   +  +   G RV+ PSC FRYE  
Sbjct  186  TAEKSQQTMYALVQCTPDLTQQQCSDCLNQAIKLI-PTCCSKRQGGRVVSPSCHFRYEKD  244

Query  845  PFF  853
            PF+
Sbjct  245  PFY  247



>emb|CBI38478.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 141/254 (56%), Gaps = 17/254 (7%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P + +++C    GNYT NST   N    L S
Sbjct  1    MESPRLLFFLYPILILHL----LAVTNAQPKFLYYRCSNGVGNYTNNSTYKANLNTLLTS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGDV  + CRSC++D+ +++ + CPNQKEA 
Sbjct  57   LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTRLCPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             WY+ C + YS++SI G  +T+P     ++  V N   FNQ L +L+  LR +A +G   
Sbjct  117  GWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMASLRSKAASGDWR  176

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAF----ALWNKSKGNGMIGARVL  811
             K+A         Q+IY  +QCTPDLS   C NCL+ A        N+ K       RV+
Sbjct  177  RKFATEEANVTSFQSIYGLMQCTPDLSELSCSNCLEGAINEIPTCCNRRK-----AGRVV  231

Query  812  RPSCFFRYEISPFF  853
            +PSC  RY    F+
Sbjct  232  KPSCNLRYATYHFY  245



>ref|XP_003635466.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=675

 Score =   155 bits (391),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 141/254 (56%), Gaps = 17/254 (7%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P + +++C    GNYT NST   N    L S
Sbjct  1    MESPRLLFFLYPILILHL----LAVTNAQPKFLYYRCSNGVGNYTNNSTYKANLNTLLTS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGDV  + CRSC++D+ +++ + CPNQKEA 
Sbjct  57   LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTRLCPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             WY+ C + YS++SI G  +T+P     ++  V N   FNQ L +L+  LR +A +G   
Sbjct  117  GWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMASLRSKAASGDWR  176

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAF----ALWNKSKGNGMIGARVL  811
             K+A         Q+IY  +QCTPDLS   C NCL+ A        N+ K       RV+
Sbjct  177  RKFATEEANVTSFQSIYGLMQCTPDLSELSCSNCLEGAINEIPTCCNRRK-----AGRVV  231

Query  812  RPSCFFRYEISPFF  853
            +PSC  RY    F+
Sbjct  232  KPSCNLRYATYHFY  245



>gb|EPS66204.1| hypothetical protein M569_08573 [Genlisea aurea]
Length=290

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 107/187 (57%), Gaps = 4/187 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GF++ S GQD +R +A  LCR DV+   CR CV +    +   CP   EA  + N+C + 
Sbjct  60   GFFSSSAGQDPDRVTATALCRADVQSGDCRDCVGNATSELVAACPFNGEAISYRNLCVVR  119

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NST  667
            +S+ SI G+L  +P I   +     +  +F++DL SL+D LR  A  GGP LK AA N T
Sbjct  120  FSNRSIAGALAVSPGILLRNNENASDAQRFSRDLGSLLDDLRALAAGGGPLLKAAAGNRT  179

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
             GP + T+YA VQCTPD+S  DC+ CL +A     +      +G R L PSC  RYE +P
Sbjct  180  TGPGNATVYALVQCTPDISAGDCDLCLLNA---TQRIPAFAPVGFRALFPSCNLRYEATP  236

Query  848  FFGASLI  868
            FF  S I
Sbjct  237  FFNLSRI  243



>ref|XP_007025926.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY28548.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
Length=545

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 129/244 (53%), Gaps = 11/244 (5%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQY  310
            + F    L L   T+ AD   P ++     ++GNYT NST   N  +      S     Y
Sbjct  8    LFFYSALLFLAIFTLGAD---PYFQSRCVNSAGNYTANSTYQANLNSVFSQVTSLTEFNY  64

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ+  + +A  LCRGD     C SC++D    ++Q CP   E   W   C + 
Sbjct  65   GFYNLSAGQNPNKVNAIALCRGDRNQDDCNSCLNDTVSELRQRCPLYNEVVGWSEFCMLR  124

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            Y++  I+G +  +PE   ++   V N  QFNQ L +L+++L  +A   GP  KYAA+++ 
Sbjct  125  YANRDILGKMECSPEACLYNTLDVTNADQFNQALDTLLNKLSSRAAAAGPLRKYAADNST  184

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGN---GMIGARVLRPSCFFRYEI  841
                QT+YA VQCTPDLS ++C  CL  A        GN   G  G RVLRPSCF R+E 
Sbjct  185  VGVLQTVYAMVQCTPDLSEQECGKCLSVA----KNGIGNCCLGKRGCRVLRPSCFLRFES  240

Query  842  SPFF  853
            SPF+
Sbjct  241  SPFY  244



>ref|XP_008364117.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 29 [Malus domestica]
Length=684

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 150/258 (58%), Gaps = 10/258 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllss--  286
            MDS  ++ F L  +       A   + P + +H C   +GNYT NSTY  NLN LLSS  
Sbjct  1    MDSSRFL-FCLFPILFLMINQALGQV-PGFLYHFCINENGNYTTNSTYQTNLNRLLSSLP  58

Query  287  lsnnvnQYGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
             + N N YGFYN S  +   +E   A  LCRGD ++  CRSC++D+   + Q CPN+KEA
Sbjct  59   SNENGNGYGFYNASYRLNSSNEHIYAIGLCRGDAKVENCRSCLNDSRYALPQLCPNKKEA  118

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNG  634
              WY+ C + YS+ S+ G + T+P   + +   + + GQ  FNQ+L  L+D +R +A  G
Sbjct  119  IGWYDNCMLRYSNSSLYGVMETSPSFYKRNNNNISSSGQDGFNQELNKLLDSIRSEAAAG  178

Query  635  GPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLR  814
            G   K+A  +T+ P  Q I+A+ QCTPD+S ++C +CL +AF    K   +G  G RV R
Sbjct  179  GSLRKFAFRNTSAPTFQRIFAFSQCTPDISEQECSDCLVAAFGYIPKC-CDGKEGGRVYR  237

Query  815  PSCFFRYEISPFFGASLI  868
            PSC+FR+E+  F   + +
Sbjct  238  PSCYFRFEVYRFIDPTTV  255



>ref|XP_010646644.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=373

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 140/250 (56%), Gaps = 9/250 (4%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P +  + C    GNYT NST   N    L S
Sbjct  1    MESPRLLFFLYPILILHL----LAVTNAQPRFLSYWCSNGVGNYTNNSTYKANLNTLLTS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGDV  + CRSC++D+ +++ Q CPNQKEA 
Sbjct  57   LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTQLCPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             WY+ C + YS++SI G+ +++P     +     N  +FNQ L +++  LR +A +G   
Sbjct  117  GWYDNCMLRYSNDSIFGTQQSSPYFYMRNSKNASNVEEFNQVLGNMMASLRSKAASGDWR  176

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSC  823
             K+A         Q+IY  +QCTPDLS   C NCL+ A      +  +   G RV++PSC
Sbjct  177  RKFATGEANVTSFQSIYGLMQCTPDLSELSCSNCLEGATNEI-PTCCDSRKGGRVVKPSC  235

Query  824  FFRYEISPFF  853
              RYE   F+
Sbjct  236  NLRYETYRFY  245


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            YGFYN SVGQ+  + +A  LCRGD+    C SC++D+ + + Q CP Q EA
Sbjct  322  YGFYNISVGQNPNKVNAIALCRGDITQDKCHSCLNDSRLLLPQRCPYQNEA  372



>ref|XP_007025925.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28547.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=653

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 127/237 (54%), Gaps = 11/237 (5%)
 Frame = +2

Query  155  LHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSV  331
            L L   T+ AD   P ++     ++GNYT NST   N  +      S     YGFYN S 
Sbjct  15   LFLAIFTLGAD---PYFQSRCVNSAGNYTANSTYQANLNSVFSQVTSLTEFNYGFYNLSA  71

Query  332  GQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESII  511
            GQ+  + +A  LCRGD     C SC++D    ++Q CP   E   W   C + Y++  I+
Sbjct  72   GQNPNKVNAIALCRGDRNQDDCNSCLNDTVSELRQRCPLYNEVVGWSEFCMLRYANRDIL  131

Query  512  GSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTI  691
            G +  +PE   ++   V N  QFNQ L +L+++L  +A   GP  KYAA+++     QT+
Sbjct  132  GKMECSPEACLYNTLDVTNADQFNQALDTLLNKLSSRAAAAGPLRKYAADNSTVGVLQTV  191

Query  692  YAYVQCTPDLSVRDCENCLKSAFALWNKSKGN---GMIGARVLRPSCFFRYEISPFF  853
            YA VQCTPDLS ++C  CL  A        GN   G  G RVLRPSCF R+E SPF+
Sbjct  192  YAMVQCTPDLSEQECGKCLSVA----KNGIGNCCLGKRGCRVLRPSCFLRFESSPFY  244



>gb|KCW76447.1| hypothetical protein EUGRSUZ_D00839 [Eucalyptus grandis]
Length=271

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 133/216 (62%), Gaps = 3/216 (1%)
 Frame = +2

Query  218  CGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVC  397
            CG++GN+T NSTY  NLNTLL+S++    + GFYN S G+     +A  LCRGDV  + C
Sbjct  27   CGSNGNFTANSTYGANLNTLLASVAAADGR-GFYNLSAGRSPNAVNAIFLCRGDVGAADC  85

Query  398  RSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPV-QNPG  574
            RSC++++A  I + CP QKEA  WY+ C + YS+ SI G +  +P +   ++  V +N  
Sbjct  86   RSCLNESAAEIARQCPVQKEAIVWYDKCMLRYSNRSIFGVVEVSPYMYMWNVNNVSKNVD  145

Query  575  QFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKS  754
            QFNQDL +L D LR +A +G    K+A  +   P+ +T++  +QCTPDLS   CE+CL  
Sbjct  146  QFNQDLRNLTDDLRDRAASGNSTRKFAVGNATAPNFKTLFGLMQCTPDLSQLQCEDCLTR  205

Query  755  AFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            A     +   +   G RV+ PSC  R+E+ PFF +S
Sbjct  206  AVGDIPRC-CDQKEGGRVIYPSCKIRFEVYPFFDSS  240



>gb|KHN01552.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=658

 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN S GQ+ ++ +A  LCRGDVE   CRSC++D+ V IKQ+CPNQKEA  W N   C
Sbjct  39   YGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKEALLWLNTSKC  98

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS  SI G +   P     +I  V  P +F+Q L +L+  L+  A +G    KYA +
Sbjct  99   MLRYSPRSIFGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATD  158

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +      QTIY   +CTPDLS +DC +CL  A +    +     IG RVLRPSC  R+E 
Sbjct  159  NVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKI-PTCCQDKIGGRVLRPSCNIRFES  217

Query  842  SPFF  853
            + F+
Sbjct  218  ASFY  221



>ref|XP_006373161.1| hypothetical protein POPTR_0017s09240g [Populus trichocarpa]
 gb|ERP50958.1| hypothetical protein POPTR_0017s09240g [Populus trichocarpa]
Length=327

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 132/242 (55%), Gaps = 5/242 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYT-PnstydnnlntllsslsnnvnQY  310
            ++F    + +    ++    DP Y  H C  +GN+T  +    N  N L S  SN    Y
Sbjct  10   LLFFFCPIFIYLLVLSIAQADPLY--HFCSKTGNFTNSSDYKSNLNNLLSSFSSNTKIDY  67

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ++++ +A  LCRGD +   CRSC+++++  + Q CPNQKEA+ WY+ C + 
Sbjct  68   GFYNDSYGQNNDKVTAISLCRGDKKPETCRSCITNSSQVLTQLCPNQKEAYIWYDDCMLR  127

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NST  667
            YS+  I+GS+   P    +++  V +  +F + L  L+  L   A  G    K+A  N+T
Sbjct  128  YSNRFIVGSMEFGPHFWMYNVNNVTDEKEFYEKLNVLLGNLTNLAALGDSRRKFATGNAT  187

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 Q +YA VQCTPDL+ + C +CL  A  L   +  +   G RV+ PSC FRYE  P
Sbjct  188  TENSQQKMYALVQCTPDLTRQQCSDCLNQAIKLI-PTCCSKRQGGRVVSPSCHFRYEKDP  246

Query  848  FF  853
            F+
Sbjct  247  FY  248



>ref|XP_010999539.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Populus euphratica]
Length=273

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 114/192 (59%), Gaps = 2/192 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY GS G++ ++A A  LCRGD +   CRSC+ +++  + Q C NQKEA+ WY+ C +
Sbjct  66   YGFYTGSFGKNIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCSNQKEAYIWYDDCML  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NS  664
             Y++ +I  S+   P    +++  V +  +FN+ L +L+ RL   A  G    K+AA N+
Sbjct  126  RYANHTIFNSMEFGPYFWMYNLVNVTDEIEFNEVLNALLGRLINFAALGDSRRKFAAGNA  185

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            TA    QT+YA VQCTPDL+ + C +CL  A  L   +  +   G RV+ PSC FRYE  
Sbjct  186  TAEKSQQTMYALVQCTPDLTRQQCSDCLNQAIKLI-PTCCSKRQGGRVVSPSCHFRYEKD  244

Query  845  PFFGASLINGSH  880
            PF+  + +  SH
Sbjct  245  PFYDLARLRHSH  256



>gb|EYU34178.1| hypothetical protein MIMGU_mgv1a023742mg, partial [Erythranthe 
guttata]
Length=265

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 137/240 (57%), Gaps = 11/240 (5%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYG  313
            +I +L+  +L S  I+       YE   C  +GNYT  S Y  +LN+LL+SLS+N++  G
Sbjct  1    MISLLIITNLFSLAIS------QYEAFFCSQNGNYTKESLYRADLNSLLNSLSSNIDNTG  54

Query  314  FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYY  493
            FY+ SVGQ    A+A  LCR D++ + C+ CV+  A  I   CPNQ +A  WY  C + Y
Sbjct  55   FYSASVGQ----ANAIALCRADIQHNTCQGCVNIVAKEILGICPNQYQAVMWYEFCMVRY  110

Query  494  SHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAG  673
            S+++I G L  +P    ++   + +PG F      L+D +R +A NGGP  K A  +  G
Sbjct  111  SNDNITGRLAISPGTYSYNRNNMTSPGSFKVVREELMDDVRARAANGGPLRKAAVGNRTG  170

Query  674  PDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            PD Q I+A +QCTPDLS  +C  CL  A   +  +  N  IG R+  PSC +RYE S F+
Sbjct  171  PDDQEIFALLQCTPDLSPVNCSRCLVQA-TQYISALVNDTIGIRLYTPSCLYRYEPSQFY  229



>emb|CBI23450.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 138/253 (55%), Gaps = 12/253 (5%)
 Frame = +2

Query  113  VMDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntll  280
            +MD    ++F+   L LHL   T+ A     ++ +H C  S GNYT NST   N    L 
Sbjct  47   IMDPPRLLLFLYPFLILHLLGVTVLAQT---DFLYHDCSDSVGNYTDNSTYEANLNTLLS  103

Query  281  sslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            S  SNN   YGFYN S GQ+S++ +A  LCRGDV    CRSCV+D+ +++ Q CPNQKEA
Sbjct  104  SLSSNNEIDYGFYNFSYGQNSDKVNAIALCRGDVVTDACRSCVNDSRIQLTQLCPNQKEA  163

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGP  640
              WY+ C + YS+ SI G+ +T+      +     N   FNQ L +L+  LR +A +G  
Sbjct  164  IGWYDKCMLRYSNNSIFGTAQTSLSFYMWNPENASNVEDFNQVLGNLMASLRSKAASGDS  223

Query  641  FLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG--NGMIGARVLR  814
              K+A          TIY  +QCTPDLS   C +CL+ A    N+     +   G RV++
Sbjct  224  RHKFATGEANVTSFVTIYGLMQCTPDLSEASCRDCLEGA---TNEIPNCCDSKKGGRVIK  280

Query  815  PSCFFRYEISPFF  853
            PSC  R+E   F+
Sbjct  281  PSCNLRFETYRFY  293



>ref|XP_006377265.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
 gb|ERP55062.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
Length=257

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 110/183 (60%), Gaps = 2/183 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY GS G++ ++A A  LCRGD +   CRSC+ +++  + Q CPNQKEA+ WY+ C +
Sbjct  66   YGFYTGSFGENIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCPNQKEAYIWYDDCML  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NS  664
             Y++ +I  S+   P    ++   V +  +FN+ L +L+ RL   A  G    K+AA N+
Sbjct  126  RYANHTIFNSMEFGPYFWMYNPVNVTDENEFNEVLNALLGRLINFAALGDSRRKFAAGNA  185

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            TA    QT+YA VQCTPDL+ + C +CL  A  L   +  +   G RV+ PSC FRYE  
Sbjct  186  TAEKSQQTMYALVQCTPDLTQQQCSDCLNQAIKLI-PTCCSKRQGGRVVSPSCHFRYEKD  244

Query  845  PFF  853
            PF+
Sbjct  245  PFY  247



>ref|XP_010999538.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Populus euphratica]
Length=298

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 112/192 (58%), Gaps = 2/192 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY GS G++ ++A A  LCRGD +   CRSC+ +++  + Q C NQKEA+ WY+ C +
Sbjct  66   YGFYTGSFGKNIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCSNQKEAYIWYDDCML  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NS  664
             Y++ +I  S+   P    +++  V +  +FN+ L +L+ RL   A  G    K+AA N+
Sbjct  126  RYANHTIFNSMEFGPYFWMYNLVNVTDEIEFNEVLNALLGRLINFAALGDSRRKFAAGNA  185

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            TA    QT+YA VQCTPDL+ + C +CL  A  L          G RV+ PSC FRYE  
Sbjct  186  TAEKSQQTMYALVQCTPDLTRQQCSDCLNQAIKLIPTCCSKRQ-GGRVVSPSCHFRYEKD  244

Query  845  PFFGASLINGSH  880
            PF+  + +  SH
Sbjct  245  PFYDLARLRHSH  256



>ref|XP_003635322.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=1243

 Score =   154 bits (390),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 141/254 (56%), Gaps = 17/254 (7%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P + +++C    GNYT NST   N    L S
Sbjct  1    MESPRLLFFLYPILILHL----LAVTNAQPKFLYYRCSNGVGNYTNNSTYKANLNTLLTS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGDV  + CRSC++D+ +++ + CPNQKEA 
Sbjct  57   LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTRLCPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             WY+ C + YS++SI G  +T+P     ++  V N   FNQ L +L+  LR +A +G   
Sbjct  117  GWYDGCMLRYSNDSIFGKAQTSPSFTMWNLQNVSNVEDFNQVLGNLMASLRSKAASGDWR  176

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAF----ALWNKSKGNGMIGARVL  811
             K+A         Q+IY  +QCTPDLS   C NCL+ A        N+ K       RV+
Sbjct  177  RKFATEEANVTSFQSIYGLMQCTPDLSELSCSNCLEGAINEIPTCCNRRK-----AGRVV  231

Query  812  RPSCFFRYEISPFF  853
            +PSC  RY    F+
Sbjct  232  KPSCNLRYGTYRFY  245


 Score =   142 bits (357),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 141/265 (53%), Gaps = 9/265 (3%)
 Frame = +2

Query  89   LDDPGLE*VMDSQEWIIF--ILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstyd  259
            + +  +E  MD    + F   +L  HL + T+A     P+  +H C  + G Y+ NSTY 
Sbjct  675  ITEEAMEMRMDFPRLVFFAYTILIPHLVAVTVA----QPDLVYHNCSENVGTYSNNSTYQ  730

Query  260  nnlntllsslsn-nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQ  436
            +NLNTLLS+L +     YGFYN SVGQ     +A  LCRGD+    C SC++D+ +++ Q
Sbjct  731  SNLNTLLSTLFSYKEINYGFYNFSVGQSPNEVNAIALCRGDITQDKCHSCLNDSRLQLPQ  790

Query  437  WCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLR  616
             CP Q EA   Y+ C + YS+ SI  +L   P     +   V N   FNQ L +L+D LR
Sbjct  791  RCPYQNEAIGGYDECMLRYSNRSIFRTLEILPSFYVPNPNNVSNEDVFNQALKTLLDSLR  850

Query  617  RQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMI  796
             +A +G   LK+A     G   + IY ++QCTPDL+   C +CL+ A        GN   
Sbjct  851  SKAASGNSLLKFATGEATGTGDKRIYGFMQCTPDLNESSCSSCLEGAINDVPACCGNKE-  909

Query  797  GARVLRPSCFFRYEISPFFGASLIN  871
            G R+ +PSC  R+E   F+  +  N
Sbjct  910  GGRIFKPSCSLRFETFRFYDFTAAN  934



>ref|XP_004172021.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like, 
partial [Cucumis sativus]
Length=282

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 104/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S G++ +RA+A  LCRG+V    CRSCV+D+A RI Q CPNQKEA  WY  C I 
Sbjct  67   GFYNASSGENPDRATAMALCRGNVAFEKCRSCVNDSAHRIIQECPNQKEAVGWYQDCQIR  126

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G   ++      ++    +P  F+Q L SL+D LR +A +G    K AA   A
Sbjct  127  YSNNSIFGVRDSSVMRAYMNLQKSPDPIGFSQTLRSLLDGLRNEAASGTSTRKSAAGQLA  186

Query  671  --GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P   TIYA V C PDLS  DC  CL S    +  +  N  IGAR+   SC   YEI 
Sbjct  187  VPSPSVDTIYALVDCFPDLSSLDCNGCL-SQLQSYIPACCNASIGARITATSCQLNYEIQ  245

Query  845  PFF  853
            PFF
Sbjct  246  PFF  248



>ref|XP_008371136.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 [Malus 
domestica]
Length=383

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 117/195 (60%), Gaps = 11/195 (6%)
 Frame = +2

Query  308  YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
            YGFYN S  +   +E   A  LCRGDV +  CRSC++++   + Q CPNQKEAF  Y  C
Sbjct  62   YGFYNASYRLNSSNEHIYAIGLCRGDVXVGDCRSCLNNSRYDLLQRCPNQKEAFGSYEKC  121

Query  482  SIYYSHESIIGSLRTTPEIEQ------HSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
            ++ YS+ SI G + T P          ++I+  +  G FNQ+L  L+D +RR+A  GG  
Sbjct  122  NLRYSNRSIYGVMETEPSRPSPYYWNINNISSSELDG-FNQELEKLLDSIRREAAAGGSL  180

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSC  823
             K+A  +T+ P  QTI+A  QCTPD+S ++C +CL  AFA    S   G +G  V +PSC
Sbjct  181  RKFAFGNTSAPTFQTIFALAQCTPDISEQNCSDCLVGAFAY--SSNFYGKVGGGVNKPSC  238

Query  824  FFRYEISPFFGASLI  868
            +FR+++ PF+  + +
Sbjct  239  YFRFDLYPFYDPTTV  253



>ref|XP_011010157.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Populus euphratica]
Length=304

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 130/242 (54%), Gaps = 5/242 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYT-PnstydnnlntllsslsnnvnQY  310
            ++F+   + +    ++    DP Y  H C  +GN+T  +    N  N L S  SN    Y
Sbjct  8    LLFLFCPIFINLLVLSIAQSDPLY--HICSETGNFTNSSDYKSNLNNLLSSFSSNTKIDY  65

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ++ + +A  LCRGD +   CRSC+++++  + Q CPNQKEA+ WY+ C + 
Sbjct  66   GFYNDSYGQNNGKVNAISLCRGDKKPETCRSCITNSSRVLTQLCPNQKEAYIWYDDCMLR  125

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-ANST  667
            YS+ SI G + + P    +++  V +  +F + L  L+D L   A  G    K+A  N T
Sbjct  126  YSNRSIAGIMESGPYFWMYNVNNVTDEKEFYEKLNVLLDNLTNLAALGDSRRKFATGNET  185

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 + +YA VQCTPDL+ + C  CL  A  L  +       G RV+ PSC FRYE  P
Sbjct  186  TENSQEKMYALVQCTPDLTEQQCSGCLNQAIKLIPRCCYKKQ-GGRVISPSCHFRYEKDP  244

Query  848  FF  853
            F+
Sbjct  245  FY  246



>ref|XP_007143172.1| hypothetical protein PHAVU_007G049700g [Phaseolus vulgaris]
 gb|ESW15166.1| hypothetical protein PHAVU_007G049700g [Phaseolus vulgaris]
Length=257

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 104/182 (57%), Gaps = 4/182 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S+  +A  LCRGDV    CRSC++D    + Q CPNQKEA  +++ C +
Sbjct  67   YGFYNFSYGQNSDEVNAIGLCRGDVMPDECRSCLNDARDNLTQLCPNQKEAILYHDKCML  126

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI G + T P    ++        QFNQ L+SL+  L   A +G    KYAA S 
Sbjct  127  RYSNRSIFGLMETKPSYYMYNTNNATEVYQFNQVLSSLMRILTGIAASGDSRRKYAAASA  186

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QTIY  VQCTPDLS ++C +CL  A A        G IG RV RPSC  RYE   
Sbjct  187  GASNFQTIYGAVQCTPDLSRQECFHCLFGAIA----EIPTGKIGGRVGRPSCNIRYENYT  242

Query  848  FF  853
            F+
Sbjct  243  FY  244



>ref|NP_001238174.1| receptor-like protein kinase [Glycine max]
 gb|ACJ31801.1| receptor-like protein kinase [Glycine max]
Length=609

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN S GQ+ ++ +A  LCRGDVE   CRSC++D+ V IKQ+CPNQK+A  W N   C
Sbjct  39   YGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKKALLWLNTSKC  98

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS  SI G +   P     +I  V  P +F+Q L +L+  L+  A +G    KYA +
Sbjct  99   MLRYSPRSIFGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATD  158

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +      QTIY   +CTPDLS +DC +CL  A +    +     IG RVLRPSC  R+E 
Sbjct  159  NVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKI-PTCCQDKIGGRVLRPSCNIRFES  217

Query  842  SPFF  853
            + F+
Sbjct  218  ASFY  221



>ref|XP_011010156.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Populus euphratica]
Length=311

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 130/242 (54%), Gaps = 5/242 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYT-PnstydnnlntllsslsnnvnQY  310
            ++F+   + +    ++    DP Y  H C  +GN+T  +    N  N L S  SN    Y
Sbjct  8    LLFLFCPIFINLLVLSIAQSDPLY--HICSETGNFTNSSDYKSNLNNLLSSFSSNTKIDY  65

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ++ + +A  LCRGD +   CRSC+++++  + Q CPNQKEA+ WY+ C + 
Sbjct  66   GFYNDSYGQNNGKVNAISLCRGDKKPETCRSCITNSSRVLTQLCPNQKEAYIWYDDCMLR  125

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NST  667
            YS+ SI G + + P    +++  V +  +F + L  L+D L   A  G    K+A  N T
Sbjct  126  YSNRSIAGIMESGPYFWMYNVNNVTDEKEFYEKLNVLLDNLTNLAALGDSRRKFATGNET  185

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 + +YA VQCTPDL+ + C  CL  A  L  +       G RV+ PSC FRYE  P
Sbjct  186  TENSQEKMYALVQCTPDLTEQQCSGCLNQAIKLIPRCCYKKQ-GGRVISPSCHFRYEKDP  244

Query  848  FF  853
            F+
Sbjct  245  FY  246



>ref|XP_006387935.1| hypothetical protein POPTR_0470s00200g, partial [Populus trichocarpa]
 gb|ERP46849.1| hypothetical protein POPTR_0470s00200g, partial [Populus trichocarpa]
Length=215

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 109/183 (60%), Gaps = 2/183 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY GS G++ ++A A  LCRGD +   CRSC+ +++  + Q CPN KEA+ WY+ C +
Sbjct  24   YGFYTGSFGENIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCPNLKEAYIWYDDCML  83

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NS  664
             Y++ +I  S+   P    ++   V +  +FN+ L +L+ RL   A  G    K+AA N+
Sbjct  84   RYANHTIFNSMEFGPYFWMYNPVNVTDENEFNEVLNALLGRLINFAALGDSRRKFAAGNA  143

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            TA    QT+YA VQCTPDL+ + C +CL  A  L   +  +   G RV+ PSC FRYE  
Sbjct  144  TAEKSQQTMYALVQCTPDLTQQQCSDCLNQAIKLI-PTCCSKRQGGRVVSPSCHFRYEKD  202

Query  845  PFF  853
            PF+
Sbjct  203  PFY  205



>ref|XP_006605286.1| PREDICTED: receptor-like protein kinase isoform X1 [Glycine max]
Length=675

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN S GQ+ ++ +A  LCRGDVE   CRSC++D+ V IKQ+CPNQK+A  W N   C
Sbjct  65   YGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKKALLWLNTSKC  124

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS  SI G +   P     +I  V  P +F+Q L +L+  L+  A +G    KYA +
Sbjct  125  MLRYSPRSIFGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATD  184

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +      QTIY   +CTPDLS +DC +CL  A +    +     IG RVLRPSC  R+E 
Sbjct  185  NVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKI-PTCCQDKIGGRVLRPSCNIRFES  243

Query  842  SPFF  853
            + F+
Sbjct  244  ASFY  247



>ref|XP_010646639.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Vitis vinifera]
Length=681

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 138/253 (55%), Gaps = 12/253 (5%)
 Frame = +2

Query  113  VMDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntll  280
            +MD    ++F+   L LHL   T+ A     ++ +H C  S GNYT NST   N    L 
Sbjct  7    IMDPPRLLLFLYPFLILHLLGVTVLAQT---DFLYHDCSDSVGNYTDNSTYEANLNTLLS  63

Query  281  sslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            S  SNN   YGFYN S GQ+S++ +A  LCRGDV    CRSCV+D+ +++ Q CPNQKEA
Sbjct  64   SLSSNNEIDYGFYNFSYGQNSDKVNAIALCRGDVVTDACRSCVNDSRIQLTQLCPNQKEA  123

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGP  640
              WY+ C + YS+ SI G+ +T+      +     N   FNQ L +L+  LR +A +G  
Sbjct  124  IGWYDKCMLRYSNNSIFGTAQTSLSFYMWNPENASNVEDFNQVLGNLMASLRSKAASGDS  183

Query  641  FLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG--NGMIGARVLR  814
              K+A          TIY  +QCTPDLS   C +CL+ A    N+     +   G RV++
Sbjct  184  RHKFATGEANVTSFVTIYGLMQCTPDLSEASCRDCLEGA---TNEIPNCCDSKKGGRVIK  240

Query  815  PSCFFRYEISPFF  853
            PSC  R+E   F+
Sbjct  241  PSCNLRFETYRFY  253



>ref|XP_007025924.1| Cysteine-rich RLK 29, putative isoform 3 [Theobroma cacao]
 gb|EOY28546.1| Cysteine-rich RLK 29, putative isoform 3 [Theobroma cacao]
Length=458

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 124/243 (51%), Gaps = 5/243 (2%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFY  319
            +++SL   +A   AD  DP +E       GNYT NST   N    +    S     YGF+
Sbjct  29   VIVSL---AALALADESDPYFECRHVEDKGNYTANSTYQANLNGIVSQLSSLTEFNYGFF  85

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N S G+  ++ +A  LC GD     C SC++  A  + Q CP  KEA  WY+ C + Y++
Sbjct  86   NLSAGESPDKVNAIALCSGDRTQDECNSCLNHTATVLLQRCPWYKEATAWYDFCLVRYAN  145

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
              I G L   P    ++     NP QFN  L+ L++ L   A  GGP  KY A +    +
Sbjct  146  RDIFGQLENEPRTCAYNERNASNPEQFNNGLSELLNNLSSIAAAGGPLRKYEAGNAPAGN  205

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGA  859
             QT+YA VQCTPD+  ++C  CL      + K    G IG RVLRP+C  RYE  PF+  
Sbjct  206  LQTVYAAVQCTPDMDEQNCTACLNHGKQEFLKC-CYGRIGCRVLRPTCILRYESDPFYNQ  264

Query  860  SLI  868
            +L+
Sbjct  265  TLV  267



>gb|KHN02663.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=633

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDVE   CRSC++D    + Q CPNQK+A  +Y+ C +
Sbjct  61   YGFYNFSYGQNTDKVNAIGLCRGDVEPDECRSCLNDARGNLTQRCPNQKKAIIYYDNCML  120

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ +I G + T+P +   +     +  QFNQ L +L+  L  +A +G    KYA + T
Sbjct  121  RYSNTTIFGVMETSPALFLGNTVNATDAEQFNQVLQTLMSNLTDRAASGDSRRKYATDDT  180

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 Q IY  VQCTPDLS  DC +CL  A         +G  G RV+RPSC  R+E+ P
Sbjct  181  TAASFQRIYGLVQCTPDLSGLDCSSCLVGAIENIQDC-CSGKRGGRVIRPSCNVRFELGP  239

Query  848  FFGAS  862
            F+G +
Sbjct  240  FYGQT  244



>ref|XP_007143165.1| hypothetical protein PHAVU_007G0492000g, partial [Phaseolus vulgaris]
 ref|XP_007143166.1| hypothetical protein PHAVU_007G0492000g, partial [Phaseolus vulgaris]
 gb|ESW15159.1| hypothetical protein PHAVU_007G0492000g, partial [Phaseolus vulgaris]
 gb|ESW15160.1| hypothetical protein PHAVU_007G0492000g, partial [Phaseolus vulgaris]
Length=269

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            +YGFYN S GQ+++   A  LCRGD +   CRSC++++ V I Q CPNQK+A  W + C 
Sbjct  58   EYGFYNFSYGQNTDTVYAIGLCRGDQQPGECRSCLNNSRVGIMQSCPNQKKAILWSDQCM  117

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS+++I   + T+P     ++  V    QFN+ L +L+  LR  A +G    KYA A 
Sbjct  118  LRYSYDTIFHKMETSPTYYWWNVGNVTEVDQFNEVLGNLMKSLRDIAASGDSRRKYATAE  177

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +  G + QTIY  VQCTPDLS ++C +CL  A +    +  NG IG RVL+PSC  R+E 
Sbjct  178  NATGLNFQTIYGLVQCTPDLSQQECYHCLDGAISEI-PNCCNGKIGGRVLKPSCNLRFES  236

Query  842  SPFFG  856
            + F+G
Sbjct  237  NNFYG  241



>gb|KHN07228.1| Cysteine-rich receptor-like protein kinase 14 [Glycine soja]
Length=280

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 142/242 (59%), Gaps = 5/242 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQ-CGTS-GNYTPnstydnnlntllsslsnnvn-Q  307
            +F L  L+L    I   +  P+YE+ + C  S GNYT NS Y  NLNTLLS+L+++    
Sbjct  9    LFFLCCLYLI-IVICEASFGPSYEYSKYCNNSNGNYTANSIYQTNLNTLLSTLTSHTEID  67

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S++  A  LCRGDV+   CRSC++++ V + + CP Q EA  W   C +
Sbjct  68   YGFYNFSHGQNSDKVYAIGLCRGDVKPDECRSCLNNSRVSLTRLCPKQLEAINWEEKCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ +I  ++  +     +++    +  +FN+ L  L+  L  +A +G    KYAA++ 
Sbjct  128  RYSNRAIFHTMDASFSYHMNNVNNATDAEEFNKVLGELLRNLSDKAASGDSRRKYAADTA  187

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QTIY  VQCTPDLS +DC  CL  + A +     N  +GA VLRPSC  RYEI P
Sbjct  188  VFANLQTIYGLVQCTPDLSRQDCGKCLHWSLADFGNVFKNK-VGAVVLRPSCNVRYEIYP  246

Query  848  FF  853
            F+
Sbjct  247  FY  248



>ref|XP_008355945.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=673

 Score =   150 bits (378),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 138/231 (60%), Gaps = 8/231 (3%)
 Frame = +2

Query  197  PNYEWHQC-GTSGNYTPnstydnnlntllss--lsnnvnQYGFYNGS--VGQDSERASAA  361
            P + +H C   SGNYT NSTY  NLN LLSS   + + N YGFYN S  +   +E   A 
Sbjct  10   PGFLYHFCINESGNYTTNSTYQTNLNRLLSSLPSNESGNGYGFYNASYRLNSSNEHIYAT  69

Query  362  VLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIE  541
             LCRGDV+   CRSC++++   + Q CPNQKEA  WY+ C + YS+ SI G + T+P   
Sbjct  70   GLCRGDVKXEDCRSCLNNSRYALPQXCPNQKEAIGWYDNCMLRYSNRSIYGVMETSPSFY  129

Query  542  QHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTP  715
              +   + + G   FNQ+L+ ++D +R +A  GG   K+A  +T+ P  QTI+A  QCTP
Sbjct  130  MWNNNNISSSGLDGFNQELSKVLDSIRSEAAAGGSLRKFAFRNTSAPTFQTIFALAQCTP  189

Query  716  DLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
            D+S ++C +CL  AF     +  +G  G RV RPSC+FR+E+  F   + +
Sbjct  190  DISQQECSDCLVGAFGDI-PNCCDGKEGGRVYRPSCYFRFEVYRFIDPTTV  239



>ref|XP_009759100.1| PREDICTED: uncharacterized protein LOC104211704 [Nicotiana sylvestris]
Length=1351

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 114/182 (63%), Gaps = 2/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S+GQ+ ++ S    CRGDVE   CR+C+++  ++I + CP +K  F +Y+ C++
Sbjct  746  YGFYNTSIGQNPDKVSVVAQCRGDVESQTCRNCITNATLKILEVCPYKKAGFGYYDDCTL  805

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQ-DLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ESIIG++   P +   +   V +P  F Q DL +L++ L+ +A  GG   K+A NS
Sbjct  806  RYSNESIIGTVSNNPLVFIFNTANVSSPDVFMQEDLRTLLESLQSKASAGGK-RKFARNS  864

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T GPD QTI+A VQCT DLS  +C NCL++ +         G   A VL PSC F ++++
Sbjct  865  TRGPDFQTIHALVQCTADLSAEECFNCLRTGYESLPSCPCYGKRAATVLMPSCNFIFQVN  924

Query  845  PF  850
            PF
Sbjct  925  PF  926


 Score =   142 bits (358),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 133/247 (54%), Gaps = 8/247 (3%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQ-C-GTSGNYTPnstydnnlntllsslsnnvnQ  307
            II I    +L   +IA     PN+ +   C G    Y+PN  Y  NLNT+LSSLS N++ 
Sbjct  16   IILIFHFYYLFYLSIA----QPNFAFQSPCEGNETEYSPNGAYGTNLNTVLSSLSRNIDS  71

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
             GFYN S+GQD ++ S    CRGDV+L  CR C+ +    I + CP +K AF  Y+ C I
Sbjct  72   DGFYNTSIGQDPDKVSVIAQCRGDVDLQTCRDCIKNATRLILELCPQKKSAFGIYDKCLI  131

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQ-FNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ES IG++ T P+   +      NP   FN+ LT +++ LR +A  GG   K+AAN 
Sbjct  132  RYSNESFIGTVSTDPQKIYYYNQNFSNPQLFFNRYLTPVLENLRSRASEGGK-RKFAANI  190

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T  PD   IY  VQCT DLS  DC NCL + +      +     G   L PSC  RYE  
Sbjct  191  TNAPDFARIYVLVQCTADLSADDCFNCLTTGYQTLPSCECYAKRGNYYLMPSCIIRYEPY  250

Query  845  PFFGASL  865
             FF  S 
Sbjct  251  SFFNESF  257



>ref|XP_007208684.1| hypothetical protein PRUPE_ppa026449mg [Prunus persica]
 gb|EMJ09883.1| hypothetical protein PRUPE_ppa026449mg [Prunus persica]
Length=568

 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 7/183 (4%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++  A  LCRGDV + +CR C+S    ++ Q CPNQKEAF  +++C++
Sbjct  65   YGFYNSSYGENPDQVYAIGLCRGDVTVDICRDCLSKGTQQLTQVCPNQKEAFGVFDLCTL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
            +Y++ SI G++ T P    +++  V N   F Q+L +L+D LR QA   G   K+A  + 
Sbjct  125  HYANRSIYGAIETFPAFRWYNVQNVSNVDGFFQELRTLLDALRGQAAGNGSLRKFAVGTA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA---LWNKSKGNGMIGARVLRPSCFFRYE  838
              P+ QTIY   QC PDL+ ++C  CL S+ A    +   K  G+I     +PSC  RYE
Sbjct  185  TAPNFQTIYGLAQCRPDLTEQNCIYCLGSSMADIPEYFPGKEGGLIS----KPSCDLRYE  240

Query  839  ISP  847
            I P
Sbjct  241  IYP  243



>ref|XP_008371138.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=692

 Score =   149 bits (377),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 148/258 (57%), Gaps = 10/258 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllss--  286
            MDS  ++ F L  +       A   + P++ +H C    GNYT NSTY  NLN LLSS  
Sbjct  4    MDSSRFL-FCLFPILFLMINQALGQV-PDFLYHFCINEKGNYTTNSTYQTNLNRLLSSLP  61

Query  287  lsnnvnQYGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
             + + N YGFYN S  +   +E   A  LCRGDV+   CRSC++++   + Q CPNQKEA
Sbjct  62   SNESGNGYGFYNASYRLNSSNEHIYATGLCRGDVKEEDCRSCLNNSRYALPQLCPNQKEA  121

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNG  634
              WY+ C + YS+ SI G + T+P     +   + + G   FNQ+L+ ++D +R +A  G
Sbjct  122  IGWYDNCMLRYSNRSIYGVMETSPSFYMWNNNNISSSGLDGFNQELSKVLDSIRSEAAAG  181

Query  635  GPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLR  814
            G   K+A  +T+ P  QTI+A  QCTPD+S ++C +CL  AF     +  +G  G RV R
Sbjct  182  GSLRKFAFRNTSAPTFQTIFALAQCTPDISQQECSDCLVGAFGDI-PNCCDGKEGGRVYR  240

Query  815  PSCFFRYEISPFFGASLI  868
            PSC+FR+E+  F   + +
Sbjct  241  PSCYFRFEVYRFIDPTTV  258



>ref|XP_007025551.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
 gb|EOY28173.1| Cysteine-rich RLK 8, putative [Theobroma cacao]
Length=383

 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 4/187 (2%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
             +GF++ S G+DS++ +A  LCRGD+   +CRSC++D      ++CPNQ+EA  WY+ C 
Sbjct  63   DHGFFSASYGEDSDKVNAIGLCRGDLVADICRSCINDAINDFAEYCPNQREAIAWYDECM  122

Query  485  IYYSHESIIGSLRTTP---EIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA  655
            + YS+ SI G +   P    +  + +  V N   FNQ L +L+DRL+ QA +G    + A
Sbjct  123  LRYSNRSIFGKMEVEPFRSLVNVNVVNNVTNVTHFNQVLATLLDRLKTQAASGRSLRRVA  182

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              +     SQT+YA VQCTPDLS  DC +CL++      +   NG  GARVL PSC  RY
Sbjct  183  TGNANVSKSQTLYAMVQCTPDLSPEDCNDCLRNVTESLPRC-CNGRKGARVLTPSCNIRY  241

Query  836  EISPFFG  856
            E   F+G
Sbjct  242  ENHLFYG  248



>ref|XP_003635677.2| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=684

 Score =   149 bits (376),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 138/251 (55%), Gaps = 8/251 (3%)
 Frame = +2

Query  113  VMDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntll  280
            +MD    ++F+   L LHL    +    +  ++ ++ C  S GNYT NST   N    L 
Sbjct  10   IMDPPRLLLFLYPFLILHLLGVIVL---VQSDFLYNFCSESVGNYTDNSTYEANLNTLLS  66

Query  281  sslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            S  SNN   YGFYN S GQ+S++ +A  LCRGDV    CRSCV+++ +++ Q CPNQKEA
Sbjct  67   SLSSNNEIDYGFYNFSYGQNSDKVNAIALCRGDVMTDACRSCVNNSRIQLTQLCPNQKEA  126

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGP  640
              WY+ C + YS+ SI G+ +T+P     ++    N   FNQ L +L+  LR +A +G  
Sbjct  127  IGWYDECMLRYSNNSIFGTAQTSPSFYMWNVENASNVEDFNQVLGNLMASLRSKAASGDW  186

Query  641  FLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPS  820
              K+A          TIY  +QCTPDL    C +CL+ A     K   +   G RV+RPS
Sbjct  187  RHKFATGEANVSSFVTIYGLMQCTPDLPESSCRDCLEGATNEIPKC-CDSKKGGRVVRPS  245

Query  821  CFFRYEISPFF  853
            C  R+E S F+
Sbjct  246  CNLRFETSRFY  256



>ref|XP_003517662.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=674

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 135/242 (56%), Gaps = 5/242 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQ-CGTS-GNYTPnst-ydnnlntllsslsnnvnQ  307
            +F L  L+L    I   +  P+YE+ + C  S GNYT NS    N    L +  S+    
Sbjct  20   LFFLCCLYLI-IVICEASFGPSYEYSKYCNNSNGNYTANSIYQTNLNTLLSTLTSHTEID  78

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S++  A  LCRGDV+   CRSC++++ V + + CP Q EA  W   C +
Sbjct  79   YGFYNFSHGQNSDKVYAIGLCRGDVKPDECRSCLNNSRVSLTRLCPKQLEAINWEEKCML  138

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ +I  ++  +     +++    +  +FN+ L  L+  L  +A +G P  KYAA++ 
Sbjct  139  RYSNRAIFHTMDASFSYHMNNVNNATDAEEFNKVLGELLRNLSDKAASGDPRRKYAADTA  198

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QTIY  VQCTPDLS +DC  CL  + A +     N  +GA VLRPSC  RYEI P
Sbjct  199  VFANLQTIYGLVQCTPDLSRQDCGKCLHWSLADFGNVFKNK-VGAVVLRPSCNVRYEIYP  257

Query  848  FF  853
            F+
Sbjct  258  FY  259



>ref|XP_011096162.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Sesamum 
indicum]
Length=1074

 Score =   151 bits (381),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 141/230 (61%), Gaps = 7/230 (3%)
 Frame = +2

Query  173  TIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERA  352
            TIA D  +P    +QC  +GNYT NSTY  NLN+LLSSL++N+N  GFY+ SVG++++ A
Sbjct  423  TIAQDQ-NP----YQCLNNGNYTSNSTYSANLNSLLSSLASNINDTGFYSASVGRNTDTA  477

Query  353  SAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTP  532
            +A VLCRGD  L  CR+CV + AV + Q CPN+++A  WY +C++ YS+E + G     P
Sbjct  478  NAVVLCRGDQTLDQCRTCVQNAAVGLVQLCPNRRQAIVWYELCTLRYSNEPLYGIQTNDP  537

Query  533  EIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCT  712
             I   +   V N   F +D  +L++ LR +A NG    K  A      +S TIY  +QCT
Sbjct  538  GIILRNSFSVLNADPFREDRRTLLNDLRDRAANGSSVRKVGAGFRNTSNSLTIYGLLQCT  597

Query  713  PDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            PDLS  +C+NCL  A  +  +S  +   G R+L PSC  RYE+ PF+  +
Sbjct  598  PDLSAENCDNCLIRASQV--ESCCDSARGVRILLPSCNLRYEVYPFYNET  645



>emb|CBI23455.3| unnamed protein product [Vitis vinifera]
Length=635

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/256 (38%), Positives = 135/256 (53%), Gaps = 9/256 (4%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P +  + C    GNYT NST   N    L S
Sbjct  1    MESPRLLFFLYPILILHL----LAVTNAQPRFLSYWCSNGVGNYTNNSTYKANLNTLLTS  56

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGD+    CRSC++D+ +++ Q CP Q EA 
Sbjct  57   LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDITQDKCRSCLNDSRLQLPQRCPYQNEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
              Y+ C + YS+ SI  +L   P     +   V N   FNQ L +L+D LR +A +G   
Sbjct  117  GGYDECMLRYSNRSIFRTLEILPSFYVPNPNNVSNEDVFNQALKTLLDSLRSKAASGNSL  176

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSC  823
            LK+A     G   + IY ++QCTPDL    C +CL+ A        GN   G R+ +PSC
Sbjct  177  LKFATGEATGTGDKRIYGFMQCTPDLDESSCSSCLEGAINDVPACCGNKE-GGRIFKPSC  235

Query  824  FFRYEISPFFGASLIN  871
              R+E   F+  +  N
Sbjct  236  SLRFETFRFYDFTAAN  251



>ref|XP_002518557.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF43944.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
Length=295

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 136/248 (55%), Gaps = 9/248 (4%)
 Frame = +2

Query  122  SQEWIIFILLS---LHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssl-  289
            S    +  LLS   L L + T+A     P   ++ C  +GNYT NSTY  NLN LL+S+ 
Sbjct  4    SISLFVLSLLSIQFLALANVTVA----QPAMLYNYCVNNGNYTTNSTYQTNLNHLLTSIY  59

Query  290  snnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRW  469
            +N    YGFYN S GQ+ ++ SA  LCR D+    CR+CV + +  +   CPN KEA   
Sbjct  60   TNTEITYGFYNFSYGQNPDKVSAIALCRPDISPDACRACVRNASDSLMTICPNSKEAIGG  119

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
            Y+ C + Y++ SI G +   P    + +  V +   FNQ   +L+D+L  QA +G    K
Sbjct  120  YDNCMLRYANRSIFGQVEGGPYFWVYGLNNVSDVTGFNQSRAALLDKLTDQAASGNSSYK  179

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            YA   T  P+SQ IYA +QCTPDLS + C +CL  +  L  +   N   G RV+ PSC F
Sbjct  180  YATGHTGAPNSQNIYALLQCTPDLSKQQCMDCLTQSIELIPQC-CNERQGGRVITPSCNF  238

Query  830  RYEISPFF  853
            RYE   F+
Sbjct  239  RYETGLFY  246



>ref|XP_003615455.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES98413.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=666

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 129/241 (54%), Gaps = 6/241 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQY  310
             + ++++  LC  TIA     P++       +GNYT NST   N    L +  SN    Y
Sbjct  9    FLLLIITTFLCYETIA----QPDFTPRCADDNGNYTKNSTYQQNLNTLLSTLTSNTEITY  64

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S G+D+ +  A  LCRGDV  + CRSC++++ V + Q CPNQKEA  W + C + 
Sbjct  65   GFYNFSFGEDNNKVYAIGLCRGDVNPNDCRSCLNNSRVLLTQKCPNQKEAIGWIDKCMLR  124

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            Y+  SI G + T P +   +     +   +N+ L  L++ L+ QA  G    KYA  +  
Sbjct  125  YASTSIFGQMETEPGLSLWNPFNATDVDNYNKVLNKLLNDLKNQAATGDSLKKYATANVT  184

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            GP+ Q IY+ +QCTPD+S  DC  CL  A A       N  IG RV+ PSC  RYE   F
Sbjct  185  GPNFQDIYSLMQCTPDVSYLDCNQCLVQAIASLPSCCENK-IGGRVIGPSCILRYERYLF  243

Query  851  F  853
            +
Sbjct  244  Y  244



>ref|XP_010112670.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXC34525.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=660

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 146/251 (58%), Gaps = 7/251 (3%)
 Frame = +2

Query  122  SQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllssl--s  292
            S+  I+FIL  + +   T A  N  P + +H C    GNYT NSTY+ NLN LLS+   S
Sbjct  8    SEVIILFILFQIFILRITQA--NAQPTFLYHFCENDRGNYTSNSTYEANLNHLLSTSFPS  65

Query  293  nnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY  472
             + N  GFY+ S G  S++  A  LCRGD    VC  C+++ +  + + CPNQKEA  W+
Sbjct  66   QDGNGSGFYSLSYGNSSDQVYAIGLCRGDANPDVCSGCLNNASQLLPRVCPNQKEAVGWH  125

Query  473  NICSIYYSHESIIGSLRTTPEIEQHSITPVQ-NPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
            + C + YS+ S+ G + T  ++   +   V  N  +F QDL +L+D L+ QA +G    K
Sbjct  126  DYCMLRYSNRSLFGVMETYQKVFLWNRQNVSSNVDEFFQDLRTLLDGLKNQATSGSSLRK  185

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            +A  + + PD QT+YA VQCTPDLS +DC NCL  AFA    +  +  IG RV+  +C F
Sbjct  186  FATGNASAPDFQTLYALVQCTPDLSHQDCNNCLDDAFADI-PACCDRKIGGRVIGTNCNF  244

Query  830  RYEISPFFGAS  862
            RYEI  F+  +
Sbjct  245  RYEIRLFYNLT  255



>ref|XP_007025922.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28544.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=689

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 122/235 (52%), Gaps = 2/235 (1%)
 Frame = +2

Query  167  SATIAADNIDPNYEWHQCGTSGNYTPnstydnnln-tllsslsnnvnQYGFYNGSVGQDS  343
            +A   AD  DP +E       GNYT NSTY  NLN  +    S     YGF+N S G+  
Sbjct  34   AALALADESDPYFECRHVEDKGNYTANSTYQANLNGIVSQLSSLTEFNYGFFNLSAGESP  93

Query  344  ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLR  523
            ++ +A  LC GD     C SC++  A  + Q CP  KEA  WY+ C + Y++  I G L 
Sbjct  94   DKVNAIALCSGDRTQDECNSCLNHTATVLLQRCPWYKEATAWYDFCLVRYANRDIFGQLE  153

Query  524  TTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYV  703
              P    ++     NP QFN  L+ L++ L   A  GGP  KY A +    + QT+YA V
Sbjct  154  NEPRTCAYNERNASNPEQFNNGLSELLNNLSSIAAAGGPLRKYEAGNAPAGNLQTVYAAV  213

Query  704  QCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
            QCTPD+  ++C  CL      + K    G IG RVLRP+C  RYE  PF+  +L+
Sbjct  214  QCTPDMDEQNCTACLNHGKQEFLKC-CYGRIGCRVLRPTCILRYESDPFYNQTLV  267



>ref|XP_010089691.1| hypothetical protein L484_006313 [Morus notabilis]
 gb|EXB38214.1| hypothetical protein L484_006313 [Morus notabilis]
Length=386

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 140/245 (57%), Gaps = 4/245 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlntllssl-snnvnQ  307
            I+F +LS H+    IA     P +  + C    GNYT NSTY+ NLN LLS+L S + N 
Sbjct  8    ILFFILS-HIFILLIAQVTSQPEFLNNFCENDRGNYTRNSTYEANLNHLLSTLPSQDGND  66

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G  S++     LCRGD +   CRSC++D+ + + Q C +QKEA  WY+ C +
Sbjct  67   YGFYNLSYGNSSDKVYTIALCRGDAKPDACRSCLNDSTLLLPQRCRDQKEAVGWYDNCML  126

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ S+ G + T+      S+  V +   F + L +L+++L+ QA  G    K+A  + 
Sbjct  127  RYSNRSMFGIVETSQIFYMWSVQNVTDADGFYEKLRTLINQLKNQAAAGDSLRKFATGND  186

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              P+ +TIYA VQCTPDLS   C NCL S F    +  G G  G RV+ PSC  RYE   
Sbjct  187  TTPEFKTIYALVQCTPDLSKEQCNNCLDSVFGYIPQCCG-GKKGGRVIGPSCNVRYEDYL  245

Query  848  FFGAS  862
            F+ ++
Sbjct  246  FYDST  250



>ref|XP_007025939.1| Cysteine-rich RLK 29 [Theobroma cacao]
 gb|EOY28561.1| Cysteine-rich RLK 29 [Theobroma cacao]
Length=1349

 Score =   150 bits (379),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 131/248 (53%), Gaps = 11/248 (4%)
 Frame = +2

Query  122  SQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnn  298
            S+  + F  + L   + T+ AD   P ++     ++GNYT NST   N  +      S  
Sbjct  689  SRLLLFFYSVVLFFATLTLGAD---PLFQSDCANSAGNYTANSTYQTNLDSIFSQVTSLT  745

Query  299  vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
               YGFYN S GQ+  + +A  LCRGD     C SC++D    ++Q CP  KE   W   
Sbjct  746  EFNYGFYNLSAGQNPNKVNAIALCRGDRNQDECNSCLNDTVSELRQRCPLSKEVVGWSEF  805

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C++ Y++ +I+G +  +P     +   V N  QFNQ L+ L++ L   A   GP  KYAA
Sbjct  806  CTLRYANRNILGEMEISPGSCLLNTQNVTNANQFNQALSDLLNNLSSLAAAAGPLRKYAA  865

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGN---GMIGARVLRPSCFF  829
             ++     QT+YA VQCTPDLS  +C+ CL  A     +  G+   G +G RVLRPSCF 
Sbjct  866  GNSEVRLFQTVYALVQCTPDLSEEECDECLNVA----KEGIGSCCEGKMGCRVLRPSCFL  921

Query  830  RYEISPFF  853
            R+E S F+
Sbjct  922  RFESSQFY  929


 Score =   140 bits (354),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 131/252 (52%), Gaps = 6/252 (2%)
 Frame = +2

Query  116  MDSQEWIIFI-LLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllssl  289
            MDS     F  L+   L S T+     +P Y +    TSGN+T NST   N    L S  
Sbjct  1    MDSSRQFFFSSLIVTFLLSLTVTQQ--EPLYNFC-LDTSGNFTRNSTYEANLNRLLSSFS  57

Query  290  snnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRW  469
            SN  N  GFYN S GQ SE A+   LCRGDV    C  C+++    ++  CPNQKEA  W
Sbjct  58   SNTANDNGFYNMSSGQGSETANVIALCRGDVNSGDCLDCINNATTELRNLCPNQKEAIIW  117

Query  470  YNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK  649
            Y+ C + Y++ SI G   T P     +   V +   FNQ L++L++ LR  A +G    K
Sbjct  118  YDFCMLRYTNRSIFGVAETNPSFYMWNPNNVTDVDAFNQSLSALMNNLRTNASSGTSLRK  177

Query  650  YAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFF  829
            +A  S      QTIYA VQCTPDL+  +C +CL  A      +  +   G RV+ PSC F
Sbjct  178  FATGSRQVTAFQTIYALVQCTPDLTEPECSSCLSQAIEFI-PTCCDRKQGGRVIGPSCNF  236

Query  830  RYEISPFFGASL  865
            R+EI  F+  ++
Sbjct  237  RFEIERFYNLTI  248



>gb|KCW76445.1| hypothetical protein EUGRSUZ_D00835 [Eucalyptus grandis]
Length=277

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 129/216 (60%), Gaps = 3/216 (1%)
 Frame = +2

Query  218  CGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVC  397
            CG++GN+T NSTY  NLNTLL+S++    + GFYN S G   +  +A  LCRGDV  + C
Sbjct  33   CGSNGNFTANSTYGANLNTLLASVAAADGR-GFYNLSTGGSPDAVNAIALCRGDVGAADC  91

Query  398  RSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQ-HSITPVQNPG  574
            RSC++D+A  I + CP QKEA  WY+ C + YS+ SI G +  +P +   +      N  
Sbjct  92   RSCLNDSAAEIARQCPVQKEAIIWYDNCMLRYSNRSIFGVVEVSPYLYMWNVNNVTNNVD  151

Query  575  QFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKS  754
            QFNQDL +L D LR +A +G    K+A  +   P  +T++  +QCTPDLS   CE+CL  
Sbjct  152  QFNQDLRNLTDDLRDRAASGNSTRKFAVGNATAPKFKTLFGLMQCTPDLSQLQCEDCLTR  211

Query  755  AFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            A     +   +   G RV+ PSC  R+E+ PFF +S
Sbjct  212  AVGDIPRC-CDQKEGGRVIYPSCNIRFEVYPFFDSS  246



>ref|XP_003556003.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=672

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQY  310
            + + L LH    ++A     PN+  H C   +GNYT NST   N    L +  SN    Y
Sbjct  19   LLLFLILHAILMSLATS--QPNFVKHYCFDQNGNYTANSTFQANLNTLLSNLSSNTEIDY  76

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ++++ +   +CRGD++   CRSC++++ + + Q CPNQKEA  WY+ C + 
Sbjct  77   GFYNFSNGQNTDKVNVIGMCRGDLKPEACRSCLNNSRILLTQLCPNQKEAIGWYDQCMLR  136

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS  SI G + + P     +     N  Q+N+ +  L+  L  +A  G   LKYA  +  
Sbjct  137  YSTRSIFGIMESDPLYNIRNNQNATNVDQYNEVVGDLLRSLGNRAAAGDSQLKYAQANKT  196

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
            GP  QTI+A+VQCTPDL+  +C  CL      +  +   G +  R+  PSC  R++ +P+
Sbjct  197  GPSFQTIFAHVQCTPDLTDLECNQCLFGKLISYIPNCCAGKVRGRIFTPSCNLRFDTTPY  256

Query  851  F  853
            F
Sbjct  257  F  257



>ref|XP_010090762.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB40709.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=900

 Score =   149 bits (376),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 2/184 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S+GQ+  + +A  LCRGD+    C+SC++D+   + + CPN+KEA  WY  C + 
Sbjct  74   GFYNTSLGQNPNKVNAIALCRGDLTAEKCQSCLNDSNYGLLERCPNRKEAILWYEKCMLR  133

Query  491  YS-HESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
            YS  +SI  +    P  E  S  P  N  QF Q L  L+D L  +A +G    KYA  + 
Sbjct  134  YSSRDSIFSAEEKEPSKEVPSPQPTSNAQQFKQTLKPLLDDLTNKASSGDSLKKYAHGNV  193

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              PD+++I+A +QCTPDLS ++C +CL++A ++       G  GAR+L+PSC  RYE  P
Sbjct  194  TVPDAESIFALLQCTPDLSQKECSDCLQNATSMI-PGCCEGKQGARILKPSCNLRYESGP  252

Query  848  FFGA  859
            F+ +
Sbjct  253  FYDS  256


 Score =   130 bits (328),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 111/195 (57%), Gaps = 4/195 (2%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVR-IKQWCPNQKEAFRWYNIC  481
            Q GFYN S+G+  +R  A  LCRGD+    CR+CV+ ++ R I + CP ++EA  W+  C
Sbjct  308  QAGFYNSSLGETPDRVYAIALCRGDLSQEDCRNCVNTSSERLIFRRCPGRREAVLWHERC  367

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + +S++SI       P +   S   V N   F+  L  L++ L   A +G    KYA+ 
Sbjct  368  MVRFSNKSIFSVKIDDPRLNVKSKYKVWNRDLFSLTLKPLLNNLTSTAASGDSLSKYASG  427

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
             +  P  + IYA  QCTPDL  + C +CL++A  L+     +G+ GAR+L+PSC  RYE+
Sbjct  428  ESTVPGYEKIYATAQCTPDLDKQQCSDCLENA-NLFIPQCCDGLNGARLLKPSCNLRYEV  486

Query  842  SPFFGASLINGSHST  886
            + F+ A+  +  HS+
Sbjct  487  TQFYAAT--DDDHSS  499



>gb|KGN49142.1| hypothetical protein Csa_6G516500 [Cucumis sativus]
Length=561

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 104/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S G++ +RA+A  LCRG+V    CRSCV+D+A RI Q CPNQKEA  WY  C I 
Sbjct  67   GFYNASSGENPDRATAMALCRGNVAFEKCRSCVNDSAHRIIQECPNQKEAVGWYQDCQIR  126

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G   ++      ++    +P  F+Q L SL+D LR +A +G    K AA   A
Sbjct  127  YSNNSIFGVRDSSVMRAYMNLQKSPDPIGFSQTLRSLLDGLRNEAASGTSTRKSAAGQLA  186

Query  671  --GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P   TIYA V C PDLS  DC  CL S    +  +  N  IGAR+   SC   YEI 
Sbjct  187  VPSPSVDTIYALVDCFPDLSSLDCNGCL-SQLQSYIPACCNASIGARITATSCQLNYEIQ  245

Query  845  PFF  853
            PFF
Sbjct  246  PFF  248



>ref|XP_006606898.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=657

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 101/187 (54%), Gaps = 2/187 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQD ++  A  LCRGD     C +C+ D      Q CPNQKEA  W   C +
Sbjct  61   YGFYNFSYGQDPDKVYAIGLCRGDQNQDDCLACLDDARANFTQLCPNQKEAINWDGECML  120

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNP-GQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI G +   P +E      V  P  QFN+ L SL+  L   A +G    KY   S
Sbjct  121  RYSNRSIFGIMENEPFVETVLTMNVTGPVDQFNEALQSLMRNLTSTAASGDSRRKYGTAS  180

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T  P+ QTIY Y QCTPDLS+ DC NCL  A A   +   +G  G  VL+PSC  R++  
Sbjct  181  THAPNFQTIYGYAQCTPDLSLEDCTNCLGEAIAEIPRC-CSGKAGGNVLKPSCRIRFDPY  239

Query  845  PFFGASL  865
             FFG ++
Sbjct  240  NFFGPTI  246



>ref|XP_009588247.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
9 [Nicotiana tomentosiformis]
Length=281

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 136/254 (54%), Gaps = 9/254 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLH-LCSATIAADNIDPNYEWHQC--GTSGNYTPnstydnnlntllss  286
            M   +W++ ++   + L   +IA     PN+ +     G    Y+PN  Y  NLNT+LSS
Sbjct  8    MSFLKWLVILIFHFYFLFYLSIA----QPNFTFQSTCEGNETEYSPNGAYGTNLNTVLSS  63

Query  287  lsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFR  466
            LS N++  GFYN S+GQD  + S    CRGDV+L  CR C+ +    I + CP++K AF 
Sbjct  64   LSLNIDSDGFYNTSIGQDPNKVSVIAQCRGDVDLQTCRDCIKNATRLILEVCPHKKSAFG  123

Query  467  WYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ-FNQDLTSLVDRLRRQAVNGGPF  643
             Y+ C I YS+ S IG++ T P+   +      NP   FN+ LT +++ LR +A  GG  
Sbjct  124  IYDKCLIRYSNVSFIGTVLTDPKKIYYYNQNFSNPQLFFNRYLTPMLESLRSRASEGGK-  182

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSC  823
             K+A N T  PD  T+YA VQCT DLS  DC NCL + +      +     G   L PSC
Sbjct  183  RKFATNITLAPDFVTVYALVQCTADLSADDCFNCLTTGYQTLPDCECYAKRGNYYLMPSC  242

Query  824  FFRYEISPFFGASL  865
              RYE   FF  S 
Sbjct  243  IIRYEPYSFFNESF  256



>gb|KEH43962.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=653

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 117/192 (61%), Gaps = 12/192 (6%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  +CRSC++D+ V + + CP QKEA  WY+ C +
Sbjct  69   YGFYNFSYGQNTDKVNAIGLCRGDVKPDLCRSCLNDSRVLLTKLCPTQKEAISWYDNCML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI G + T+    + +   V +  QFNQ L +L+ +L   A +G    K+A  + 
Sbjct  129  RYSNRSIFGIMDTSFSYYKWNNRNVTDVAQFNQVLGNLMRKLNEIAASGDSRRKFAT-AN  187

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA-----LWNKSKGNGMIGARVLRPSCFFR  832
            A  + +TIY  VQCTPDLS +DC +CL+ A +      +NK      IG RVL+ SC  R
Sbjct  188  ATLNFETIYGLVQCTPDLSGQDCNDCLERAISETPSFFYNK------IGGRVLKLSCNIR  241

Query  833  YEISPFFGASLI  868
            YEI  F+G + +
Sbjct  242  YEIYSFYGPTTV  253



>ref|XP_009367095.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 isoform 
X2 [Pyrus x bretschneideri]
Length=596

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 145/249 (58%), Gaps = 10/249 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllssls  292
            MD+  ++ F LL +       A   + P + +H C   SGNY+ NSTY  NLN LLSSL 
Sbjct  4    MDTSRFL-FCLLPILFLMINQALGQV-PGFLYHFCINKSGNYSTNSTYQTNLNRLLSSLP  61

Query  293  nnvnQ--YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            +N +   YGFYN S  +   +E   A  LCRGDV+   CRSC++++   + Q CPNQKEA
Sbjct  62   SNESSNGYGFYNASYRLNSSNEHIYAIGLCRGDVKAEDCRSCLNNSRYALPQLCPNQKEA  121

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNG  634
              WY+ C + YS+ SI G + T+P     +   + + G   FNQ+L+ ++  +R +   G
Sbjct  122  IGWYDNCMLRYSNRSIYGVMETSPSFYMWNKNNISSSGLDGFNQELSKVLASIRSETAAG  181

Query  635  GPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLR  814
            G   K+A  +T+ P  QTI+A+ QCTPD+S ++C +CL  AF        +G  G RV R
Sbjct  182  GSLRKFAFRNTSAPTFQTIFAFAQCTPDISEQECSDCLVGAFGDIPNC-CDGKEGGRVYR  240

Query  815  PSCFFRYEI  841
            PSC+FR+E+
Sbjct  241  PSCYFRFEV  249



>ref|XP_006590220.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=673

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++ +A  LCRGD++   CRSC++D    + Q CPNQKEA  +Y+ C +
Sbjct  65   YGFYNLSYGENEDKVNAIGLCRGDLKPDECRSCLNDARGNLTQRCPNQKEAIIYYDNCML  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ +I G + T+P +   +     +  QFNQ L +L+  L  +A +G    KYA + T
Sbjct  125  RYSNTTIFGVMETSPALFLGNTVNATDVEQFNQVLQTLMSNLTDRAASGDSRRKYATDDT  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 Q IY  VQCTPDLS  DC +CL  A     +   +G  G RV+RPSC  R+E+ P
Sbjct  185  TAASFQRIYGLVQCTPDLSGLDCSSCLVGAIENI-QDCCSGKRGGRVIRPSCNVRFELGP  243

Query  848  FFGAS  862
            F+G +
Sbjct  244  FYGQT  248



>emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera]
Length=839

 Score =   148 bits (374),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 141/252 (56%), Gaps = 13/252 (5%)
 Frame = +2

Query  116  MDSQEWIIFI--LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntlls  283
            M+S   + F+  +L LHL    +A  N  P +  + C    GNYT NST   N    L S
Sbjct  165  MESPRLLFFLYPILILHL----LAVTNAQPRFLSYWCSNGVGNYTNNSTYKANLNTLLTS  220

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
              SNN   YGFYN S GQ+S++ +A  LCRGDV  + CRSC++D+ +++ Q CPNQKEA 
Sbjct  221  LSSNNEIDYGFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTQLCPNQKEAI  280

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             WY+ C + YS++SI G+ +++P     +     +  +FNQ L +++  LR +A +G   
Sbjct  281  GWYDNCMLRYSNDSIFGTQQSSPYFYMRNSKNASDVEEFNQVLGNMMASLRSKAASGDWR  340

Query  644  LKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG--NGMIGARVLRP  817
             K+A         Q+IY  +QCTPDLS   C NCL+ A    N+     +   G RV++P
Sbjct  341  RKFATGEANVTSFQSIYGLMQCTPDLSELSCSNCLEGA---TNEIPTCCDSRKGGRVVKP  397

Query  818  SCFFRYEISPFF  853
            SC  RYE   F+
Sbjct  398  SCNLRYETYRFY  409



>gb|EYU27842.1| hypothetical protein MIMGU_mgv1a020186mg, partial [Erythranthe 
guttata]
Length=569

 Score =   145 bits (367),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 103/181 (57%), Gaps = 1/181 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFY+ S GQ     +A VLCR D  L  CR C+ D    + + CPNQK+A  WY  C + 
Sbjct  58   GFYSASAGQTPYMVNAIVLCRIDAPLDTCRRCIQDLTAALLKECPNQKQAIGWYEFCMVR  117

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS ++I G+L T+P +    +T V +P ++N+ L +++D LR QA NGG   K AA +  
Sbjct  118  YSDQTIFGTLATSPFVYWWILTKVTSPDKYNEGLRTVLDSLRNQASNGGSLRKIAAGNVT  177

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
             PD Q I+A VQCTPDLS  DC +CL SA    +    NG   A +  PSC   Y+ +  
Sbjct  178  VPDFQIIFALVQCTPDLSADDCNSCLISAAGDLSTC-CNGFKAASMNYPSCTIVYQTNNH  236

Query  851  F  853
            F
Sbjct  237  F  237



>ref|XP_008371196.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=280

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 112/191 (59%), Gaps = 6/191 (3%)
 Frame = +2

Query  308  YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
            YGFYN S  +   +E   A  LCRGDV +  CRSC++++   + Q CPNQKEAF  Y  C
Sbjct  43   YGFYNASYRLNSSNEHIYAIGLCRGDVTVGDCRSCLNNSRYDLLQRCPNQKEAFGSYEKC  102

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYA  655
             + YS+ SI G + T P    ++   V +     FNQ+L  L++ +R +A  GG   K+A
Sbjct  103  MLRYSNRSIYGVMETEPSPAYYNXNNVSSSDLDGFNQZLRKLLESIRSEAAAGGSLRKFA  162

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              +T+ P  QTI+A  QCTPD+S + C +CL  AFA  + S   G +G  V +PSC FR+
Sbjct  163  FGNTSAPSFQTIFALAQCTPDISEQLCSDCLVGAFA--DISSIYGKVGGGVNKPSCKFRF  220

Query  836  EISPFFGASLI  868
            ++ PF+  + +
Sbjct  221  DLYPFYDPTTV  231



>ref|XP_011004254.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X3 [Populus euphratica]
Length=625

 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 135/249 (54%), Gaps = 16/249 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
              IF  + LHL   TIA  +   N         GNYT NS+   N  + L S  SN    
Sbjct  2    LFIFSCILLHLAFLTIAQTDFCSN-------DVGNYTTNSSFQRNLNSVLSSLDSNTQID  54

Query  308  YGFYNGSVGQDS-ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YGFYN SVGQ   ++A+   LCRGD+ +  C++C+ +++ +I Q CPNQKEAF   + C 
Sbjct  55   YGFYNLSVGQPGPDQANVIALCRGDIGVDECQNCIRNSSGKILQVCPNQKEAFGVADTCI  114

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS++SI G +   P     ++    +  QFNQ L +L+ RLR  A +G    K+A  N
Sbjct  115  LRYSNKSIFGVMEEKPVSILVNVVNATDVNQFNQALQTLMSRLRSTAASGNSLRKFATGN  174

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMI----GARVLRPSCFF  829
             TAG D  TIY  VQCTPDLS   C+ C+  A  +      +G +    GAR+ RPSC  
Sbjct  175  ETAGFD--TIYGLVQCTPDLSEPQCDECIAGAIRVIATCCDDGQLVGRQGARITRPSCNL  232

Query  830  RYEISPFFG  856
            RYE+  FFG
Sbjct  233  RYEVYSFFG  241



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score =   146 bits (369),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 101/249 (41%), Positives = 134/249 (54%), Gaps = 8/249 (3%)
 Frame = +2

Query  116  MDSQEWIIFI-LLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllss  286
            MDS     F  L+   L S T+A    +P +  H C  TSGN+T NST   N    L S 
Sbjct  1    MDSSRQFFFSSLIVTFLLSLTVAQQ--EPLF--HFCLDTSGNFTRNSTYEANLNRQLSSF  56

Query  287  lsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFR  466
             SN  N YGFYN S GQ SERA+   LCRGDV    C  C+++    ++  CPNQKEA  
Sbjct  57   SSNTANDYGFYNMSSGQGSERANVIALCRGDVNSGDCLHCINNATPELRNRCPNQKEAII  116

Query  467  WYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFL  646
            WY+ C + Y++ SI G + T P     ++  V +   FNQ L++L++ LR  A +G    
Sbjct  117  WYDFCMLRYTNRSIFGIMETEPSFYMWNLNNVTDVDAFNQALSALMNNLRTNASSGTSLG  176

Query  647  KYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCF  826
             +A  S      QTIYA VQCTPDL+  +C +CL  A      +  +   G RV+ PSC 
Sbjct  177  NFATGSRQVTAFQTIYALVQCTPDLTEPECSSCLSQAIEFI-PTCCDRKQGGRVIGPSCN  235

Query  827  FRYEISPFF  853
            FR+EI  F+
Sbjct  236  FRFEIERFY  244



>ref|XP_007025928.1| Receptor protein kinase isoform 2 [Theobroma cacao]
 gb|EOY28550.1| Receptor protein kinase isoform 2 [Theobroma cacao]
Length=273

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 127/238 (53%), Gaps = 5/238 (2%)
 Frame = +2

Query  143  ILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvn-QYGFY  319
            +++SL   +A   AD+ D  +E       GNYT NS+Y  NLN ++S LS+     YGF+
Sbjct  13   VIVSL---AAIAFADDYDNYFECGFVEDRGNYTANSSYQANLNRIVSQLSSLTEFNYGFF  69

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N S G+  +   A  LC GD     C SC+   A  + Q CP  KEA  W   C + Y++
Sbjct  70   NLSAGESPDEVKAIALCTGDRTQDECNSCLHRTATELIQRCPWHKEATAWSEFCLVRYAN  129

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
              I G L + P     +     NP QFN  L+ L++ L   A  GGP  KYAA +    +
Sbjct  130  RDIFGQLESEPRTCAFNTRKASNPVQFNDGLSELLNNLSNIAAAGGPLRKYAAGNATAGN  189

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             QTIYA VQCTPD+  ++C +CL    A +  +   G IG RVLRP+C  R+E +PF+
Sbjct  190  LQTIYAAVQCTPDMDKQNCTHCLDDGKAEF-LNCCYGRIGCRVLRPTCILRFESNPFY  246



>ref|XP_006590219.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
 gb|KHN02665.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=185

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 99/170 (58%), Gaps = 1/170 (1%)
 Frame = +2

Query  344  ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLR  523
            ++ +A  LCRGDV+   C SC++++ V + Q CPNQKEA  WY+ C + YS+ SI G + 
Sbjct  2    DKVNAIGLCRGDVKPDECSSCLNNSTVLLTQLCPNQKEAIGWYDKCMLRYSNRSIYGVME  61

Query  524  TTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYV  703
            T+P      IT   +  QFNQ L +L+  L   A +G    KYAA +   P+SQTIY   
Sbjct  62   TSPLFYLSEITNATDVDQFNQVLGNLMSNLTGIAASGNSLRKYAAANATAPNSQTIYGAA  121

Query  704  QCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            QCTPDLS +DC +CL  AF+    S   G I  RV  PSC  RYE   F+
Sbjct  122  QCTPDLSEQDCNSCLVEAFSRI-TSCCIGNISGRVAAPSCNIRYENFRFY  170



>ref|XP_009367024.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=709

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 145/249 (58%), Gaps = 10/249 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllssls  292
            MD+  ++ F LL +       A   + P + +H C   SGNY+ NSTY  NLN LLSSL 
Sbjct  4    MDTSRFL-FCLLPILFLMINQALGQV-PGFLYHFCINKSGNYSTNSTYQTNLNRLLSSLP  61

Query  293  nnvnQ--YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEA  460
            +N +   YGFYN S  +   +E   A  LCRGDV+   CRSC++++   + Q CPNQKEA
Sbjct  62   SNESSNGYGFYNASYRLNSSNEHIYAIGLCRGDVKAEDCRSCLNNSRYALPQLCPNQKEA  121

Query  461  FRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNG  634
              WY+ C + YS+ SI G + T+P     +   + + G   FNQ+L+ ++  +R +   G
Sbjct  122  IGWYDNCMLRYSNRSIYGVMETSPSFYMWNKNNISSSGLDGFNQELSKVLASIRSETAAG  181

Query  635  GPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLR  814
            G   K+A  +T+ P  QTI+A+ QCTPD+S ++C +CL  AF        +G  G RV R
Sbjct  182  GSLRKFAFRNTSAPTFQTIFAFAQCTPDISEQECSDCLVGAFGDIPNC-CDGKEGGRVYR  240

Query  815  PSCFFRYEI  841
            PSC+FR+E+
Sbjct  241  PSCYFRFEV  249



>ref|XP_010112612.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXC34337.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=634

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 136/237 (57%), Gaps = 7/237 (3%)
 Frame = +2

Query  161  LCS--ATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSV  331
            LCS  A +   +  P +++ QC    GNYT NSTY  NLN +LS L +  N  GFYN S 
Sbjct  24   LCSVYAPVIQSSAQPTFQYEQCQNHKGNYTTNSTYQGNLNRVLSILPSRGNGNGFYNSSY  83

Query  332  GQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESII  511
            G++S++  A  LCRGD+E + CR+C+  +A  +   CPN+KEA   ++ C +  S+   +
Sbjct  84   GRNSDKVYATGLCRGDIEPNGCRNCLVKSAQILTLVCPNKKEAIGGFDECMLRCSNLPSL  143

Query  512  GSLRTTPEIEQHSITPVQN--PGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQ  685
            G + T+P     S   V +     F +DL  L+D L+ +A  GGP  KYA  +T+ P+ Q
Sbjct  144  GVMETSPIFHSWSTESVSSIYLNGFFRDLRILLDELKNRAAAGGPLRKYATGNTSAPEFQ  203

Query  686  TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFG  856
             IYA  QC PDLS   C NCL  AF   +  +  G +G RV+ PSC FRYE+  F+G
Sbjct  204  IIYALAQCRPDLSQLGCNNCLDKAFQ--DIPRYYGKVGGRVVTPSCNFRYEVYRFYG  258



>ref|XP_011004253.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 isoform 
X2 [Populus euphratica]
Length=665

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 135/249 (54%), Gaps = 16/249 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
              IF  + LHL   TIA  +   N         GNYT NS+   N  + L S  SN    
Sbjct  2    LFIFSCILLHLAFLTIAQTDFCSN-------DVGNYTTNSSFQRNLNSVLSSLDSNTQID  54

Query  308  YGFYNGSVGQDS-ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YGFYN SVGQ   ++A+   LCRGD+ +  C++C+ +++ +I Q CPNQKEAF   + C 
Sbjct  55   YGFYNLSVGQPGPDQANVIALCRGDIGVDECQNCIRNSSGKILQVCPNQKEAFGVADTCI  114

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS++SI G +   P     ++    +  QFNQ L +L+ RLR  A +G    K+A  N
Sbjct  115  LRYSNKSIFGVMEEKPVSILVNVVNATDVNQFNQALQTLMSRLRSTAASGNSLRKFATGN  174

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMI----GARVLRPSCFF  829
             TAG D  TIY  VQCTPDLS   C+ C+  A  +      +G +    GAR+ RPSC  
Sbjct  175  ETAGFD--TIYGLVQCTPDLSEPQCDECIAGAIRVIATCCDDGQLVGRQGARITRPSCNL  232

Query  830  RYEISPFFG  856
            RYE+  FFG
Sbjct  233  RYEVYSFFG  241



>ref|XP_011004252.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Populus euphratica]
Length=667

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 135/249 (54%), Gaps = 16/249 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
              IF  + LHL   TIA  +   N         GNYT NS+   N  + L S  SN    
Sbjct  2    LFIFSCILLHLAFLTIAQTDFCSN-------DVGNYTTNSSFQRNLNSVLSSLDSNTQID  54

Query  308  YGFYNGSVGQDS-ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YGFYN SVGQ   ++A+   LCRGD+ +  C++C+ +++ +I Q CPNQKEAF   + C 
Sbjct  55   YGFYNLSVGQPGPDQANVIALCRGDIGVDECQNCIRNSSGKILQVCPNQKEAFGVADTCI  114

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS++SI G +   P     ++    +  QFNQ L +L+ RLR  A +G    K+A  N
Sbjct  115  LRYSNKSIFGVMEEKPVSILVNVVNATDVNQFNQALQTLMSRLRSTAASGNSLRKFATGN  174

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMI----GARVLRPSCFF  829
             TAG D  TIY  VQCTPDLS   C+ C+  A  +      +G +    GAR+ RPSC  
Sbjct  175  ETAGFD--TIYGLVQCTPDLSEPQCDECIAGAIRVIATCCDDGQLVGRQGARITRPSCNL  232

Query  830  RYEISPFFG  856
            RYE+  FFG
Sbjct  233  RYEVYSFFG  241



>ref|XP_007025966.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 26 [Theobroma 
cacao]
 gb|EOY28588.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 26 [Theobroma 
cacao]
Length=269

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 136/249 (55%), Gaps = 15/249 (6%)
 Frame = +2

Query  131  WIIFILLSL-HLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntl-lsslsnnvn  304
            ++IF    L  L + TIA   IDP +E      +GNYT NS Y+ +L++L     S    
Sbjct  10   FLIFFFPGLTSLVTLTIA---IDPYFESRCANNTGNYTANSAYERDLSSLFNEISSTTKL  66

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
              GF++   G+     +A  LCRGDV+L+VC SC++D    +K+ CP  KEA  W   C 
Sbjct  67   NSGFFHSKFGE----VNAIALCRGDVKLNVCTSCLNDTISEMKERCPRYKEAIGWSEFCM  122

Query  485  IYYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
            + YS   I   L  +PE   + +  V  +   + Q++  LVD LR +A  GG  LKYAA+
Sbjct  123  LRYSSRDISERLELSPEACIYDLNDVIGDRDAYIQEVVMLVDNLRSRAAAGGTLLKYAAD  182

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG--NGMIGARVLRPSCFFRY  835
            +++    Q +YA VQCTPDLS +DC +CL+ A     K +G   G  G RVL PSC  R+
Sbjct  183  NSSHGAYQMLYALVQCTPDLSKQDCNDCLEGA---TRKIRGCCTGKNGCRVLLPSCNLRF  239

Query  836  EISPFFGAS  862
            E  PF  A+
Sbjct  240  ESYPFSDAA  248



>ref|XP_006603573.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=710

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 135/242 (56%), Gaps = 5/242 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDPNYEWHQ-CGTS-GNYTPnst-ydnnlntllsslsnnvnQ  307
            +F L  L+L    I   +  P+YE+ + C  S GNYT NS    N    L +  S+    
Sbjct  20   LFFLCCLYLI-IVICEASFGPSYEYSKYCNNSNGNYTANSIYQTNLNTLLSTLTSHTEID  78

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S++  A  LCRGDV+   CRSC++++ V + + CP Q EA +W   C +
Sbjct  79   YGFYNFSHGQNSDKVYAIGLCRGDVKPDECRSCLNNSRVSLTRLCPKQFEAIKWEEKCML  138

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ +I  ++  +      +I    +  +FN+ L  L+  L  +A +G    KYAA++ 
Sbjct  139  RYSNRAIFHTMDASFSYPMSNINNATDAEEFNKVLGELLRNLSDKAASGDSRRKYAADTA  198

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QTIY  VQCTPDLS +DC +CL  + A +     N  +GA VLRPSC  RYEI P
Sbjct  199  VFANLQTIYGLVQCTPDLSRQDCGDCLHWSLADFGNVFKNK-VGAVVLRPSCNVRYEIYP  257

Query  848  FF  853
            F+
Sbjct  258  FY  259



>gb|EYU34183.1| hypothetical protein MIMGU_mgv1a003394mg [Erythranthe guttata]
Length=588

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 138/251 (55%), Gaps = 11/251 (4%)
 Frame = +2

Query  125  QEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvn  304
            Q ++I  +L+    S  +A       YE   C  +GNY+  S Y ++LN +L SLS+ ++
Sbjct  3    QPFLIIFILTPLFDSGVLA------QYEVFVCSNNGNYSSESLYRSDLNGVLRSLSSKID  56

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
              GFY+ S G+    AS   LCR DVEL+ C+ CV+  A  I   CPNQ +A  W   C 
Sbjct  57   NTGFYSTSDGE----ASVIALCRADVELNACQGCVNIIAGEILTRCPNQYQAIMWSQYCM  112

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS+E+I+G+L   P    +++    +P +F      L+D +R QA  GG   K A  +
Sbjct  113  VRYSNETILGNLAMRPGRILYNMANSTSPDRFKVVRDELMDDVRAQAARGGSLQKAAVGN  172

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
              GPD+Q I+A +QCTPDLS  +C +CL  A A +     +  IG RV  PSC +RYE S
Sbjct  173  RTGPDNQVIFAMLQCTPDLSPENCTSCLVQA-AGYIPGYIDDAIGVRVYTPSCIYRYETS  231

Query  845  PFFGASLINGS  877
            PF+  + +  S
Sbjct  232  PFYNITRLQES  242



>gb|KGN49140.1| hypothetical protein Csa_6G515490 [Cucumis sativus]
Length=361

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 116/217 (53%), Gaps = 8/217 (4%)
 Frame = +2

Query  212  HQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVEL  388
            H C  +GNYT NS    N  N L S  SN    YGFYN S GQD +R +A  LC  D+ +
Sbjct  30   HSCSNTGNYTTNSVYKQNLDNLLSSIASNTEIDYGFYNFSAGQDPDRVNAIALCLADLTV  89

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESI--IGSLRTTPEIEQHSITPV  562
              CR C+ ++  RI + CPNQKEA  WY +C + YS+ SI  +G+ R    +     T  
Sbjct  90   DECRRCIQNSTRRILEDCPNQKEAIGWYTVCMVRYSNRSIFRVGNDRVLGPVFVSGQTAS  149

Query  563  QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCEN  742
               G + + L +L+ RLR +A +G    KYA       +   I+ +VQCTPDLS  DC N
Sbjct  150  DIDG-YTRSLRTLLQRLRNEASSGDSRHKYAVGEVEATNLDNIFGFVQCTPDLSSVDCNN  208

Query  743  CLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            CL  A     ++  NG +G R+   SCF RYE +  F
Sbjct  209  CLMKA----AENVRNGSMGTRIFSTSCFLRYETNDIF  241



>gb|EYU34186.1| hypothetical protein MIMGU_mgv1a0026692mg, partial [Erythranthe 
guttata]
Length=253

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 124/217 (57%), Gaps = 5/217 (2%)
 Frame = +2

Query  203  YEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDV  382
            +E   C T+GNYT  S Y  +LN +L SLS+N+N  GFY+ SVG    RA+ A LCRGDV
Sbjct  6    FEEFVCSTTGNYTTESLYRADLNGVLRSLSSNMNAGGFYSASVG----RANVAALCRGDV  61

Query  383  ELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPV  562
            +L+ C+ CV+  +  I   CPNQ  A  W   C + YS+ES +G L T+P    +  T  
Sbjct  62   QLNQCQGCVNIVSQTILVNCPNQFGAIMWSEFCMVRYSNESFLGRLSTSPARILYIGTNS  121

Query  563  QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCEN  742
             +P +F      L+D +R +A +GG   K AA +T GPD Q I+  +QCTPDLS  +C  
Sbjct  122  TSPVRFRAAREELLDDVRARAADGGSLRKAAAGNTTGPDDQGIFTLLQCTPDLSAENCTR  181

Query  743  CLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            CL  A A + +   N   G RV  PSC +RY    F+
Sbjct  182  CLVEA-AGYIQGYINDSTGIRVYTPSCIYRYVNQQFY  217



>ref|XP_007208199.1| hypothetical protein PRUPE_ppa020541mg, partial [Prunus persica]
 gb|EMJ09398.1| hypothetical protein PRUPE_ppa020541mg, partial [Prunus persica]
Length=367

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 111/188 (59%), Gaps = 2/188 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++  A  LCRGDV + +CR C+S+    + + CPNQKEAF  ++ C++
Sbjct  71   YGFYNSSYGENPDQVYAIGLCRGDVTVDICRGCLSNATQLLTEVCPNQKEAFGVFDQCTL  130

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             Y++ SI G++ T P +  +++  V  +   F Q+L +L++ LR QA   G   K+A  +
Sbjct  131  RYANRSIYGAMETFPSLMWYNVQNVSSDVDGFFQELRTLLEDLRDQAAGNGSLRKFAVGT  190

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P+ QTIY   QCTPDL+ + C +CL S+     K    G  GAR+ +PSC  RYE  
Sbjct  191  ATAPNFQTIYGLAQCTPDLTEQICSDCLVSSLGDIPKF-CPGKQGARISKPSCDVRYETY  249

Query  845  PFFGASLI  868
             FF  + I
Sbjct  250  RFFDPTTI  257



>ref|XP_007213610.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
 gb|EMJ14809.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
Length=689

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 147/257 (57%), Gaps = 8/257 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlntllss--  286
            M S  ++ F++ ++ L    I      P + +H C  + GNYT NSTY  NLNTLLSS  
Sbjct  1    MVSSRFLFFLIYAILLL-IMITQAFAQPAFLYHFCKNNIGNYTTNSTYHKNLNTLLSSLP  59

Query  287  lsnnvnQYGFYNGSVGQDSERASAAV-LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
             + N N YGFYN S GQ+S+    A+ LCRGDV+   CRSC++++   + + CPNQKEA 
Sbjct  60   SNENGNGYGFYNSSYGQNSDDQVYAIGLCRGDVKAEDCRSCLNNSRYALTRLCPNQKEAI  119

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGG  637
             WY+ C + YS+ S+ G + T P     +   + + G   FNQ+L  L++ +R +A  GG
Sbjct  120  GWYDNCMLRYSNSSMYGVMATMPAFYMRNPKNISSSGMDGFNQELRKLLESVRSEAAAGG  179

Query  638  PFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRP  817
               K+A  +   P  QTI+A  QCTP++S + C +CL  AF    +      +G RV+RP
Sbjct  180  SLRKFAYGNATAPTFQTIFAIAQCTPEISEQACSDCLVGAFGEIPQCCPEK-VGGRVVRP  238

Query  818  SCFFRYEISPFFGASLI  868
            SC FR+E+  F   + I
Sbjct  239  SCNFRFEVYRFIEPTTI  255



>ref|XP_003638020.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=423

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 110/182 (60%), Gaps = 2/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY  C +
Sbjct  68   YGFYNFSYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYVDCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI G +  +P   + ++       QFNQ L +L+ +L+  A +     K+A  + 
Sbjct  128  RYSNRSIFGVMEASPSYLKWTLKNATEVDQFNQVLGNLMRKLKEIAASSDSRRKFAT-AN  186

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            A  + +T Y  VQCTPDLS +DC +CL+ A +       N  +G  VL+PSC  R+EI  
Sbjct  187  ATLNFETTYGLVQCTPDLSQQDCNDCLERAISEI-PIYFNNKVGGIVLKPSCNIRHEIYS  245

Query  848  FF  853
            F+
Sbjct  246  FY  247



>ref|XP_007206688.1| hypothetical protein PRUPE_ppa022095mg [Prunus persica]
 gb|EMJ07887.1| hypothetical protein PRUPE_ppa022095mg [Prunus persica]
Length=705

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 2/181 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++     LCRGDV + +CR C+S    ++ Q CPNQKEAF  +++C++
Sbjct  65   YGFYNSSYGENPDQVYTIGLCRGDVTVDICRDCLSKGTQQLTQVCPNQKEAFGVFDLCTL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQ-NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            +Y++ SI G++ T P +  +++  V  +   F Q+L +L+D LR QA   G   K+A  +
Sbjct  125  HYANRSIYGAIETFPPLMWYNVQNVSYDVDGFFQELKTLLDDLRGQAAGNGSLRKFAVGT  184

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P+ QTIY   QC PDL+ +DC  CL S+ A   +    G  G  + +PSC  RYEI 
Sbjct  185  VTAPNFQTIYGLAQCRPDLTAQDCSYCLGSSMADI-QEYFPGKEGGLISKPSCDLRYEIY  243

Query  845  P  847
            P
Sbjct  244  P  244



>gb|KEH43957.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=605

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 136/242 (56%), Gaps = 4/242 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F   S+      ++     PN+  + C   +GNYT NST  +N    L +  SN    
Sbjct  8    LLFSFYSVLFIIIIVSQAQGQPNFLRNYCINNNGNYTANSTYQNNLSTLLSNLTSNTEIN  67

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY  C +
Sbjct  68   YGFYNFSYGQNTDKVNAVGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYVDCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI G +  +P   + ++       QFNQ L +L+ +L+  A +     K+A  + 
Sbjct  128  RYSNRSIFGVMEASPSYLKWTLKNATEVDQFNQVLGNLMRKLKEIAASSDSRRKFAT-AN  186

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            A  + +T Y  VQCTPDLS +DC +CL+ A +       N  +G  VL+PSC  R+EI  
Sbjct  187  ATLNFETTYGLVQCTPDLSQQDCNDCLERAISEI-PIYFNNKVGGIVLKPSCNIRHEIYS  245

Query  848  FF  853
            F+
Sbjct  246  FY  247



>gb|KEH40073.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=667

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 138/245 (56%), Gaps = 8/245 (3%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQY  310
            +IFI  S  L +A I  DN    Y   Q    GNYT NST + N    L +  SN    Y
Sbjct  10   LIFIFTS-QLTTANINNDN-KLQYFCDQNNDGGNYTTNSTYHKNLNTLLSTLTSNKDINY  67

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NICS  484
            GFYN S G ++++ +A  LCRGDV+ + C++C+ +++V + Q C N+KEA  WY  + C 
Sbjct  68   GFYNSSYGINTDKVNAIGLCRGDVKPNDCQNCIKNSSVFLTQLCQNRKEAIGWYDEDTCM  127

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS+ SI G   T P     S+    N  +F++ L +L+D LR +A +G   LKYA  S
Sbjct  128  LRYSYRSIFGLNETRPFYLGWSLNNATNEDEFDKVLKNLLDNLRNRASSGDSDLKYAVGS  187

Query  665  --TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
                  ++QTIYA VQCTPDLS   C++CL  +     +   N  +GAR++RPSC+ RYE
Sbjct  188  DEVGQNNNQTIYALVQCTPDLSKSLCDDCLVKSIKAIPRC-CNNRLGARIVRPSCYLRYE  246

Query  839  ISPFF  853
                F
Sbjct  247  TDSLF  251



>ref|XP_008377957.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At4g00960 [Malus domestica]
Length=610

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 106/170 (62%), Gaps = 3/170 (2%)
 Frame = +2

Query  365  LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQ  544
            LCRGD ++  CRSC++D+   + Q CPN+KEA  WY+ C + YS+ S+ G + T+P   +
Sbjct  15   LCRGDAKVENCRSCLNDSRYALPQLCPNKKEAIGWYDNCMLRYSNSSLYGVMETSPSFYK  74

Query  545  HSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPD  718
             +   + + GQ  FNQ+L  L+D +R +A  GG   K+A  +T+ P  Q I+A+ QCTPD
Sbjct  75   RNNNNISSSGQDGFNQELNKLLDSIRSEAAAGGSLRKFAFRNTSAPTFQRIFAFSQCTPD  134

Query  719  LSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
            +S ++C +CL +AF    K   +G  G RV RPSC+FR+E+  F   + +
Sbjct  135  ISEQECSDCLVAAFGYIPKC-CDGKEGGRVYRPSCYFRFEVYRFIDPTTV  183



>ref|XP_007025929.1| Receptor protein kinase isoform 3 [Theobroma cacao]
 gb|EOY28551.1| Receptor protein kinase isoform 3 [Theobroma cacao]
Length=271

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 99/186 (53%), Gaps = 1/186 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGF+N S G+  +   A  LC GD     C SC+   A  + Q CP  KEA  W   C +
Sbjct  64   YGFFNLSAGESPDEVKAIALCTGDRTQDECNSCLHRTATELIQRCPWHKEATAWSEFCLV  123

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             Y++  I G L + P     +     NP QFN  L+ L++ L   A  GGP  KYAA + 
Sbjct  124  RYANRDIFGQLESEPRTCAFNTRKASNPVQFNDGLSELLNNLSNIAAAGGPLRKYAAGNA  183

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QTIYA VQCTPD+  ++C +CL    A +  +   G IG RVLRP+C  R+E +P
Sbjct  184  TAGNLQTIYAAVQCTPDMDKQNCTHCLDDGKAEF-LNCCYGRIGCRVLRPTCILRFESNP  242

Query  848  FFGASL  865
            F+  ++
Sbjct  243  FYHTAV  248



>ref|XP_007139784.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 ref|XP_007139786.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 gb|ESW11778.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 gb|ESW11780.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
Length=672

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 136/247 (55%), Gaps = 4/247 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQ-CGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F L  LH+   T   D+  P++   + C +S NYT NST   N    L +  S+    
Sbjct  10   LLFFLFWLHVI-MTACEDSFGPDFGASKICISSMNYTANSTFNTNLHTLLSTLTSHTEIN  68

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S++  A  LCRGD+++  CRSC++ +   ++Q CPNQKEA  W   C +
Sbjct  69   YGFYNFSHGQNSDKVYAIGLCRGDLKVDECRSCLNSSQANLRQLCPNQKEAISWEEKCML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I  ++ T+P    H+     +  +FN+ L  L+  LR +A  G    KYA ++ 
Sbjct  129  RYSNRPIFHTMDTSPPYYMHNTYNATDVDEFNKVLGGLLRNLREKAAGGDSRRKYATDTA  188

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + Q I   +QCTPDLS +DC +CL  + +   K   +  +GA VL PSC  R+EI  
Sbjct  189  IVANFQPINGLMQCTPDLSRQDCGDCLDWSISTLPKFAKDK-VGALVLLPSCNLRFEIYE  247

Query  848  FFGASLI  868
            F+ ++ I
Sbjct  248  FYNSTAI  254



>ref|XP_007143181.1| hypothetical protein PHAVU_007G050300g [Phaseolus vulgaris]
 gb|ESW15175.1| hypothetical protein PHAVU_007G050300g [Phaseolus vulgaris]
Length=1072

 Score =   147 bits (370),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 111/189 (59%), Gaps = 14/189 (7%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQDS   +A  LCRGDV+   CR C++D+ V + Q CPNQKEA  WY+ C +
Sbjct  607  YGFYNFSYGQDSSTVNAIGLCRGDVKPDACRRCLNDSKVLLTQLCPNQKEAIGWYDQCML  666

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPG------QFNQDLTSLVDRLRRQAVN-GGPFL  646
             YS+ S+  ++ T+     HS   + NPG      QFN  L +L+D L  QA   G    
Sbjct  667  RYSNRSLFNTMETS-----HSF-ALWNPGNASDIDQFNLVLGNLLDSLIGQATTLGDSQR  720

Query  647  KYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCF  826
            K+AA + +    QTIY  VQCTPDLS +DC  CL  A +   +   +G  G R+LRPSC 
Sbjct  721  KFAAANVSESVFQTIYGLVQCTPDLSEQDCSECLTGAISEIPQC-CDGKRGGRILRPSCN  779

Query  827  FRYEISPFF  853
            FRYEI  F+
Sbjct  780  FRYEIYRFY  788


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 81/185 (44%), Gaps = 3/185 (2%)
 Frame = +2

Query  317  YNGSVGQDSERA-SAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYY  493
            Y  ++G  S  A +   LCR D+  +    CV+     I++ CPNQ E+  WY+ C + Y
Sbjct  71   YTTTMGFGSTNAVNGLFLCRADLFSATSNDCVATAVTEIRRRCPNQTESIIWYDECMVRY  130

Query  494  SHESII-GSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            +       S+     +         + G FNQ L+SL+  L  +A       K+A     
Sbjct  131  TDRYFSPTSVVPRANLWDDKNISTSDWGSFNQTLSSLLSGLATKAAGSQSASKFAIGEMN  190

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
               +  +Y   QC   ++   CE CL +A ++   +   G  GAR L   C  RY++  F
Sbjct  191  FTATSRVYGLAQCASGMTNAQCEACLVNA-SITLGTCCQGKQGARALLAWCDIRYDLYQF  249

Query  851  FGASL  865
            +  S+
Sbjct  250  YNTSI  254



>ref|XP_007139785.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 ref|XP_007139787.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 gb|ESW11779.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
 gb|ESW11781.1| hypothetical protein PHAVU_008G058600g [Phaseolus vulgaris]
Length=673

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 136/247 (55%), Gaps = 4/247 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQ-CGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F L  LH+   T   D+  P++   + C +S NYT NST   N    L +  S+    
Sbjct  10   LLFFLFWLHVI-MTACEDSFGPDFGASKICISSMNYTANSTFNTNLHTLLSTLTSHTEIN  68

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S++  A  LCRGD+++  CRSC++ +   ++Q CPNQKEA  W   C +
Sbjct  69   YGFYNFSHGQNSDKVYAIGLCRGDLKVDECRSCLNSSQANLRQLCPNQKEAISWEEKCML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I  ++ T+P    H+     +  +FN+ L  L+  LR +A  G    KYA ++ 
Sbjct  129  RYSNRPIFHTMDTSPPYYMHNTYNATDVDEFNKVLGGLLRNLREKAAGGDSRRKYATDTA  188

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + Q I   +QCTPDLS +DC +CL  + +   K   +  +GA VL PSC  R+EI  
Sbjct  189  IVANFQPINGLMQCTPDLSRQDCGDCLDWSISTLPKFAKDK-VGALVLLPSCNLRFEIYE  247

Query  848  FFGASLI  868
            F+ ++ I
Sbjct  248  FYNSTAI  254



>ref|XP_003637942.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=615

 Score =   144 bits (363),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 136/242 (56%), Gaps = 4/242 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F   S+      ++     PN+  + C   +GNYT NST  +N    L +  SN    
Sbjct  8    LLFSFYSVLFIIIIVSQAQGQPNFLRNYCINNNGNYTANSTYQNNLSTLLSNLTSNTEIN  67

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRSC++D+ V + + CPNQKEA  WY  C +
Sbjct  68   YGFYNFSYGQNTDKVNAVGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYVDCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI G +  +P   + ++       QFNQ L +L+ +L+  A +     K+A  + 
Sbjct  128  RYSNRSIFGVMEASPSYLKWTLKNATEVDQFNQVLGNLMRKLKEIAASSDSRRKFAT-AN  186

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            A  + +T Y  VQCTPDLS +DC +CL+ A +       N  +G  VL+PSC  R+EI  
Sbjct  187  ATLNFETTYGLVQCTPDLSQQDCNDCLERAISEI-PIYFNNKVGGIVLKPSCNIRHEIYS  245

Query  848  FF  853
            F+
Sbjct  246  FY  247



>emb|CDP09635.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 130/219 (59%), Gaps = 13/219 (6%)
 Frame = +2

Query  230  GNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCV  409
            GNYT NSTY  NL +LLSSLS+N+N YGFYN S GQ  +R +A VLCRGDV+   CR CV
Sbjct  37   GNYTENSTYQANLKSLLSSLSSNINPYGFYNSSFGQGLDRVNAIVLCRGDVDQETCRVCV  96

Query  410  SDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQD  589
             ++A ++ Q CPN+KEA  WY+ C + YS++SI G +   P     +     NP  F+Q+
Sbjct  97   QNSAGKLTQVCPNEKEAVGWYDQCMLRYSNKSIFGVMSNLPPFTLQNPLNSTNPILFSQE  156

Query  590  LTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFAL-  766
            +++L   L  +  +G P  K+A   +   + +TIYA +QCTPD+    C  CL+    + 
Sbjct  157  VSNLATSLENRIFSGNPDRKFAVEKSNNSNVETIYALMQCTPDIDPGTCNFCLRLTSNMM  216

Query  767  -----WNKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
                 W++       GARV+ PSC F YE+ PF+  S I
Sbjct  217  SQCCSWSQ-------GARVVGPSCSFWYELIPFYNESAI  248



>ref|XP_002518563.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43950.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1390

 Score =   147 bits (370),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 111/188 (59%), Gaps = 14/188 (7%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN SVGQ  ++ +A  LC+GDV L  CR C+ ++   I Q CPNQKE   +Y+ C  
Sbjct  33   YGFYNLSVGQAPDQVNALALCKGDVSLDECRGCIRNSTREITQHCPNQKEVLGFYDSCMF  92

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-ANS  664
             YS+ SI G + T P I   +   V +  QFNQ L +L+ RLR +A  G    K+A  N 
Sbjct  93   RYSNRSIFGVMETQPTIHMKNEENVTDVNQFNQALQTLLSRLRSKAAAGNSTRKFATGNE  152

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKG-----NGMIGARVLRPSCFF  829
            +AG   +TI+  +QCTPD++ +DC +C+ +A      ++      NG +G RV++PSC F
Sbjct  153  SAG--FETIFGLMQCTPDITEQDCNDCIVAA------TRDIPICCNGKLGGRVIKPSCNF  204

Query  830  RYEISPFF  853
            RYE   F+
Sbjct  205  RYENYRFY  212


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 106/242 (44%), Gaps = 12/242 (5%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllsslsnnvnQY  310
            +IF+L+   + SA  ++ +    Y  H C G + +    +   N    L S  S      
Sbjct  751  LIFLLI---IISALASSIDCQATYNAHICLGAANDTASANFKSNLTALLNSLSSKATLNN  807

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
             FYN S    S    +  LCRGDV    C+ CV      I++ CP+ K A  WY+ C + 
Sbjct  808  SFYNDS----SNGVYSLYLCRGDVSSGTCQLCVETAIQEIQRQCPSNKSAIIWYDQCMLR  863

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+    G  +T+P +   +I    +P + +     L+  L   +V     +     S  
Sbjct  864  YSNTKFFGLAQTSPRVLMWNIQNNTSPDEPDYGALGLIYTL-TGSVPYKAMMFGTEESET  922

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAF-ALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               SQ  YA VQCT D+    C +CL     ++ +  +G    G R+L PSC  RYE + 
Sbjct  923  NNGSQKRYALVQCTRDIDSSACSSCLGELIDSITDCCQGKK--GWRILAPSCNLRYEETL  980

Query  848  FF  853
            FF
Sbjct  981  FF  982



>ref|XP_004134968.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Cucumis sativus]
Length=1112

 Score =   146 bits (369),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 104/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S G++ +RA+A  LCRG+V    CRSCV+D+A RI Q CPNQKEA  WY  C I 
Sbjct  682  GFYNASSGENPDRATAMALCRGNVAFEKCRSCVNDSAHRIIQECPNQKEAVGWYQDCQIR  741

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G   ++      ++    +P  F+Q L SL+D LR +A +G    K AA   A
Sbjct  742  YSNNSIFGVRDSSVMRAYMNLQKSPDPIGFSQTLRSLLDGLRNEAASGTSTRKSAAGQLA  801

Query  671  --GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P   TIYA V C PDLS  DC  CL S    +  +  N  IGAR+   SC   YEI 
Sbjct  802  VPSPSVDTIYALVDCFPDLSSLDCNGCL-SQLQSYIPACCNASIGARITATSCQLNYEIQ  860

Query  845  PFF  853
            PFF
Sbjct  861  PFF  863


 Score =   142 bits (357),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 118/224 (53%), Gaps = 22/224 (10%)
 Frame = +2

Query  212  HQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVEL  388
            H C  +GNYT NS    N  N L S  SN    YGFYN S GQD +R +A  LC  D+ +
Sbjct  30   HSCSNTGNYTTNSVYKQNLDNLLSSIASNTEIDYGFYNFSAGQDPDRVNAIALCLADLTV  89

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESI--IGSLRTTPEIEQHSITPV  562
              CR C+ ++  RI + CPNQKEA  WY +C + YS+ SI  +G+ R         + PV
Sbjct  90   DECRRCIQNSTRRILEDCPNQKEAIGWYTVCMVRYSNRSIFRVGNDRV--------LGPV  141

Query  563  QNPGQ-------FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDL  721
               GQ       + + L +L+ RLR +A +G    KYA       +   I+ +VQCTPDL
Sbjct  142  FVSGQTASDIDGYTRSLRTLLQRLRNEASSGDSRHKYAVGEVEATNLDNIFGFVQCTPDL  201

Query  722  SVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            S  DC NCL  A     ++  NG +G R+   SCF RYE +  F
Sbjct  202  SSVDCNNCLMKA----AENVRNGSMGTRIFSTSCFLRYETNDIF  241



>ref|XP_007139788.1| hypothetical protein PHAVU_008G058700g [Phaseolus vulgaris]
 gb|ESW11782.1| hypothetical protein PHAVU_008G058700g [Phaseolus vulgaris]
Length=635

 Score =   144 bits (362),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 135/253 (53%), Gaps = 16/253 (6%)
 Frame = +2

Query  134  IIFILLSLHL----CSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnn  298
            ++F L  LH     C  T   D     +    C +S NYT NST   N    L +  S+ 
Sbjct  10   LLFFLFWLHAIMTACETTFGPDFGTSKF----CDSSMNYTANSTFSTNLHTLLSTLTSHK  65

Query  299  vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
               YGFYN S GQ+S++  A  LCRGD+++  CRSC++ +   ++Q CPNQKEA +W   
Sbjct  66   EINYGFYNFSHGQNSDKVYAIGLCRGDLKVDECRSCINSSQANLRQLCPNQKEAIKWEEK  125

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + YS+  I  ++ T+P    ++        +FN+ L  L+  LR +A  G    KYA 
Sbjct  126  CMLRYSNRPIFHTMETSPPYYTNNDENATKVDEFNKVLGGLLRNLREKAAGGDSRRKYAT  185

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLK---SAFALWNKSKGNGMIGARVLRPSCFF  829
            ++    + Q I+  +QCTPDLS +DC +CL    SA   + K K    +GA VL PSC  
Sbjct  186  DTAFVDNFQPIHGLMQCTPDLSRQDCGDCLDWSISAIPTFAKDK----VGALVLLPSCNL  241

Query  830  RYEISPFFGASLI  868
            R+EI  F+ +++I
Sbjct  242  RFEIYNFYNSTVI  254



>gb|KEH40075.1| salt stress response/antifungal domain protein [Medicago truncatula]
Length=313

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 93/245 (38%), Positives = 133/245 (54%), Gaps = 8/245 (3%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNY-TPnstydnnlntllsslsnnvnQY  310
            +IFI  S    + T  A+     Y   Q    GNY T ++ + N    L +  SN    Y
Sbjct  10   LIFIFTSQLTIATTDTANKFQ--YFCDQNNDGGNYPTNSTYHTNLNTLLSTLTSNKDINY  67

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--CS  484
            GFYN S G ++++ +A  LCRGDV+L+ C++C+ ++ V + Q C N+KEA  WYN   C 
Sbjct  68   GFYNSSYGNNTDKVNAIGLCRGDVKLNDCQNCLKNSTVLLTQHCQNRKEAIGWYNDEECM  127

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS+ SI G     P     +     N  +FN+ +   +D LR +A +G   LKYA  S
Sbjct  128  LRYSNRSIFGLNEIGPAYFVWNTNNATNEVEFNKVVNFFLDSLRNRAASGDSDLKYAVGS  187

Query  665  -TAGP-DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
               GP ++QTIY  VQCTPDLS   C++CL  +    +    N  +GAR++RPSC  RYE
Sbjct  188  DEVGPSNNQTIYGLVQCTPDLSKTLCDDCLVQSIKEISNC-CNNRLGARIVRPSCNLRYE  246

Query  839  ISPFF  853
             + FF
Sbjct  247  TNSFF  251



>ref|XP_010247032.1| PREDICTED: uncharacterized protein LOC104590182 [Nelumbo nucifera]
Length=1289

 Score =   146 bits (368),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 101/242 (42%), Positives = 132/242 (55%), Gaps = 15/242 (6%)
 Frame = +2

Query  140  FILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGF  316
             IL+ L L SA        PNY +H C   GNYT NST   N    L S  SN   Q GF
Sbjct  646  LILIRLGLSSAQ------QPNYTYHFC-FGGNYTSNSTYQTNLNLLLSSLSSNAALQNGF  698

Query  317  YNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYS  496
            YN + G + + A    LC GDV   VC++CV   +  I Q CPN+KEA  WY++C + YS
Sbjct  699  YNTTAGLNPDIAYGLFLCEGDVTSEVCQNCVITASKEIMQRCPNKKEAIIWYDLCLLRYS  758

Query  497  HESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAV---NGGPFLKYAANST  667
            ++SI  +++  P +   +I  + NP +FNQ L  L++ L R+A    + G F    AN T
Sbjct  759  NQSIFSTMQQIPGVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGEANFT  818

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            +      IY  VQCTPD+S  DC  CL  A +   +   NG  G RVLRPSC+ RYEI P
Sbjct  819  S---FLKIYGLVQCTPDISDTDCNICLTGAVSDIPRC-CNGKQGGRVLRPSCYIRYEIYP  874

Query  848  FF  853
            F+
Sbjct  875  FY  876


 Score =   142 bits (359),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 132/245 (54%), Gaps = 15/245 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++  +L+ L L SA        P+Y +H C   G YT NST   N    L S  SN   Q
Sbjct  9    FVCLMLIRLGLSSAQ------QPDYAYHSC-LGGIYTSNSTYQANLNLLLSSLSSNAALQ  61

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
             GFYN + G +   A    LCRGDV   VC++CV   +  I Q CPN+KEA  WY++C +
Sbjct  62   NGFYNTTAGLNPNTAYGLFLCRGDVTSEVCQNCVEAASKEILQRCPNKKEAIIWYDLCLL  121

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAV---NGGPFLKYAA  658
             YS++SI  +++ +P +   +I  + NP +FNQ L  L++ L R+A    + G F    A
Sbjct  122  RYSNQSIFSTMQQSPGVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGEA  181

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
            N T+    Q +Y  VQCTPD+S  DC  CL  A         NG  G RVLRPSC+ RYE
Sbjct  182  NFTS---FQQVYGLVQCTPDISQSDCNICLAEAVGQIPIC-CNGKRGGRVLRPSCYIRYE  237

Query  839  ISPFF  853
            I  F+
Sbjct  238  IDLFY  242



>ref|XP_008377959.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=672

 Score =   144 bits (362),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 132/231 (57%), Gaps = 8/231 (3%)
 Frame = +2

Query  197  PNYEWHQC-GTSGNYTPnstydnnlntllss--lsnnvnQYGFYNGS--VGQDSERASAA  361
            P + +H C   SGNYT NSTY  NLN LLSS   + + N YGFYN S  +   +E   A 
Sbjct  26   PGFLYHFCINESGNYTTNSTYQTNLNRLLSSLPSNESGNGYGFYNASYRLNSSNEHIYAX  85

Query  362  VLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIE  541
             LCRGDV    C SC++++     Q CPNQKEA  WY+ C + YS+ S  G + T+P   
Sbjct  86   GLCRGDVXXEDCXSCLNNSXYAXPQXCPNQKEAIGWYDNCMLRYSNRSJYGXMETSPSFY  145

Query  542  QHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTP  715
              +   + + G   FNQ+L   +D +R +A  GG   K+A  +T+ P  QTI+A  QCTP
Sbjct  146  MWNXNNISSSGLDGFNQELXKXLDSIRSEAAAGGSLRKFAFRNTSAPTFQTIFALAQCTP  205

Query  716  DLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLI  868
            D+S ++C +CL  AF     +  +G  G RV RPSC+FR+E+  F   + +
Sbjct  206  DISQQECSDCLVGAFGDI-PNCCDGKEGGRVYRPSCYFRFEVYRFIDPTTV  255



>ref|XP_006449124.1| hypothetical protein CICLE_v10018264mg, partial [Citrus clementina]
 gb|ESR62364.1| hypothetical protein CICLE_v10018264mg, partial [Citrus clementina]
Length=183

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 103/183 (56%), Gaps = 2/183 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY  S G   ++ +A  LC GDV ++ CR C+  +   +++ CPNQKEA  WY+ C +
Sbjct  3    YGFYKTSYGAKQDQVNAIALCTGDVNVASCRQCIYRSTFVLQKRCPNQKEAVIWYDNCML  62

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+    G++   P    +++  V NPG F + + SL++ L  +A +G   LKYA   T
Sbjct  63   RYSNRYFFGNMEFGPWFWMYNLKKVPNPGAFTRAVRSLLNTLILKAASGSSRLKYATGFT  122

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                S  IYA VQC+PDLS   C  CL ++ AL +K    G  G R + P+C FRYE   
Sbjct  123  T-RSSPNIYALVQCSPDLSKHGCITCLNNSIALLSKC-CTGKQGGRFVAPNCNFRYETGR  180

Query  848  FFG  856
            F+G
Sbjct  181  FYG  183



>ref|XP_010089688.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=679

 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 107/186 (58%), Gaps = 2/186 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFY    G  S +  A  LCRGD    VC SC+++   R+ Q CPNQKEA  WY+ C +
Sbjct  69   YGFYYLPYGNSSNQVYAIGLCRGDANPDVCVSCLNNATQRLPQNCPNQKEAVGWYDYCML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ S+ G + T+ ++   +   V  N  +F  DL +L+D L+ +A +G    K+A  +
Sbjct  129  RYSNRSMFGVMETSLKVYLWNTQNVSSNVDEFFSDLRTLLDGLKNRAASGSSLRKFATGN  188

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
             + PD QT+YA VQCTPDLS +DC NCL  AF        N  IG RV+  +C FRYEI 
Sbjct  189  ASAPDFQTLYALVQCTPDLSKQDCNNCLDDAFDDIPTCCDNK-IGGRVIGTNCNFRYEIR  247

Query  845  PFFGAS  862
             F+  +
Sbjct  248  LFYNQT  253



>ref|XP_010644356.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Vitis 
vinifera]
Length=307

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 131/238 (55%), Gaps = 6/238 (3%)
 Frame = +2

Query  155  LHLCSATIA----ADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQY-GFY  319
            L LC+  +A    A    P+Y  H C  +    PNSTY  NLN+LLSSLS+N  +  GFY
Sbjct  10   LFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSNATRANGFY  69

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N + GQ  + A    LCRGDV +  CR CV++ +  I Q C   K+A  WY+ C ++YS+
Sbjct  70   NATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAIIWYDQCMLHYSN  129

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
             SI   +   P ++ +++  V +PG FNQ +   ++     A N     K+A        
Sbjct  130  RSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESGKKFATKEENFTG  189

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            SQT+Y+ VQCTPDLS+ DC  CL+ A    +    +G  GAR L PSC  RYE+ PF+
Sbjct  190  SQTLYSLVQCTPDLSIADCSKCLEGAIGALSLC-CSGKQGARTLTPSCNARYELYPFY  246



>ref|XP_006388607.1| hypothetical protein POPTR_0138s00210g [Populus trichocarpa]
 gb|ERP47521.1| hypothetical protein POPTR_0138s00210g [Populus trichocarpa]
Length=526

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 130/228 (57%), Gaps = 3/228 (1%)
 Frame = +2

Query  176  IAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllssl-snnvnQYGFYNGSVGQDSER  349
            I  +   P   +H C G +GNYT +STY  NLN LL+S+ SN    YGFYN S G+ S++
Sbjct  4    IVPNTAQPEINFHLCVGENGNYTADSTYQANLNYLLNSVYSNTEIDYGFYNFSYGESSDK  63

Query  350  ASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTT  529
              A  LCRGDV+   CR C++ +++ +   CP QKEA    + C + Y+   I G     
Sbjct  64   VYAIGLCRGDVKPDACRDCLNYSSLALTSLCPTQKEAIIGLDNCILRYASRYIFGLNEVA  123

Query  530  PEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQC  709
            P    HS+T V +   FN+ L SL+D L+ +A  G    KYA    + P+ QTIYA  QC
Sbjct  124  PYFFVHSLTNVSDEKGFNRSLNSLLDSLQDEAAAGDSRRKYATRKISAPNFQTIYALSQC  183

Query  710  TPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            TPDLS  +C +CL++A A   +       G RV+ PSC FRYEI+ F+
Sbjct  184  TPDLSQTECSSCLRNASARVGQCCQERQ-GGRVIYPSCNFRYEINRFY  230



>emb|CBI23396.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 139/260 (53%), Gaps = 9/260 (3%)
 Frame = +2

Query  104  LE*VMDSQEWIIF--ILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlnt  274
            +E  MD    + F   +L  HL + T+A     P+  +H C  + G Y+ NSTY +NLNT
Sbjct  1    MEMRMDFPRLVFFAYTILIPHLVAVTVA----QPDLVYHNCSENVGTYSNNSTYQSNLNT  56

Query  275  llsslsn-nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQ  451
            LLS+L +     YGFYN SVGQ     +A  LCRGD+    C SC++D+ +++ Q CP Q
Sbjct  57   LLSTLFSYKEINYGFYNFSVGQSPNEVNAIALCRGDITQDKCHSCLNDSRLQLPQRCPYQ  116

Query  452  KEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVN  631
             EA   Y+ C + YS+ SI  +L   P     +   V N   FNQ L +L+D LR +A +
Sbjct  117  NEAIGGYDECMLRYSNRSIFRTLEILPSFYVPNPNNVSNEDVFNQALKTLLDSLRSKAAS  176

Query  632  GGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVL  811
            G   LK+A     G   + IY ++QCTPDL+   C +CL+ A        GN   G R+ 
Sbjct  177  GNSLLKFATGEATGTGDKRIYGFMQCTPDLNESSCSSCLEGAINDVPACCGNKE-GGRIF  235

Query  812  RPSCFFRYEISPFFGASLIN  871
            +PSC  R+E   F+  +  N
Sbjct  236  KPSCSLRFETFRFYDFTAAN  255



>gb|KEH40076.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=678

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 130/251 (52%), Gaps = 5/251 (2%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEW--HQCGTSGNYTPnst-ydnnlntllss  286
            +DS  + IF+L+ +   S    ADN   N+ +  +    +G YT NS    N  + L + 
Sbjct  15   LDSFHYSIFLLIIIFSSSQLAKADNTTQNFHYFCNPNNVTGTYTANSIYQTNLKSLLSTL  74

Query  287  lsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFR  466
             SN    YGFYN S G+++ + +A  LCRGDV+ + C SC++ ++  + Q CPNQKEA  
Sbjct  75   TSNTQINYGFYNFSNGENTNKVNAIGLCRGDVKTNECLSCLNGSSNNLTQLCPNQKEAIG  134

Query  467  WYN--ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGP  640
            WY    C + YS  SI   +   P    +++    +   FNQ +  L+D L  +A +G  
Sbjct  135  WYEDEKCMLRYSDRSIFRLMEIGPAYYANNMVNATDLNDFNQVVRDLLDNLTSRAASGDS  194

Query  641  FLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPS  820
             LKYA     GP+ Q+IY  VQCTPDLS  DC +CL  +             G RV+RPS
Sbjct  195  RLKYAVARARGPNDQSIYGLVQCTPDLSESDCNSCLVQSIDRIPIDCCKDKKGGRVVRPS  254

Query  821  CFFRYEISPFF  853
            C  R+E    F
Sbjct  255  CNMRFETDFLF  265



>ref|XP_010316620.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Solanum lycopersicum]
Length=673

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 106/187 (57%), Gaps = 2/187 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN +VGQD  R SA   CR DVEL  CRSC+++    I + CP++K AF  Y++C I 
Sbjct  61   GFYNATVGQDQNRVSAIAQCRADVELQTCRSCINNATRLILEKCPSKKSAFGIYDMCLIR  120

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQ-FNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
            YS+ES IG++ T P    +      +P   FNQ LT ++  LR +A  GG   K+AAN  
Sbjct  121  YSNESFIGTMSTDPRYTYYYNRDFSDPKLFFNQYLTPVLTSLRTRASAGGKH-KFAANVF  179

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              PD Q I+A VQCT DLS + C +CL + ++     +     G   L PSC  RYE   
Sbjct  180  DAPDFQEIHALVQCTSDLSAQGCYDCLSAVYSSLPDCECYAKRGNYHLMPSCVVRYEPYS  239

Query  848  FFGASLI  868
            FF  SL+
Sbjct  240  FFNESLL  246



>ref|XP_010316619.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Solanum lycopersicum]
Length=676

 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 106/187 (57%), Gaps = 2/187 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN +VGQD  R SA   CR DVEL  CRSC+++    I + CP++K AF  Y++C I 
Sbjct  61   GFYNATVGQDQNRVSAIAQCRADVELQTCRSCINNATRLILEKCPSKKSAFGIYDMCLIR  120

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQ-FNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
            YS+ES IG++ T P    +      +P   FNQ LT ++  LR +A  GG   K+AAN  
Sbjct  121  YSNESFIGTMSTDPRYTYYYNRDFSDPKLFFNQYLTPVLTSLRTRASAGGKH-KFAANVF  179

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              PD Q I+A VQCT DLS + C +CL + ++     +     G   L PSC  RYE   
Sbjct  180  DAPDFQEIHALVQCTSDLSAQGCYDCLSAVYSSLPDCECYAKRGNYHLMPSCVVRYEPYS  239

Query  848  FFGASLI  868
            FF  SL+
Sbjct  240  FFNESLL  246



>ref|XP_008371201.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=667

 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 112/191 (59%), Gaps = 6/191 (3%)
 Frame = +2

Query  308  YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
            YGFYN S  +   +E   A  LCRGDV +  CRSC++++   + Q CPNQKEAF  Y  C
Sbjct  62   YGFYNASYRLNSSNEHIYAIGLCRGDVTVGDCRSCLNNSRYDLLQRCPNQKEAFGSYEKC  121

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYA  655
             + YS+ SI G + T P    ++   V +     FNQ+L  L++ +R +A  GG   K+A
Sbjct  122  MLRYSNRSIYGVMETEPSPAYYNTNNVSSSDLDGFNQELRKLLESIRSEAAAGGSLRKFA  181

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              +T+ P  QTI+A  QCTPD+S + C +CL  AFA  + S   G +G  V +PSC FR+
Sbjct  182  FGNTSAPSFQTIFALAQCTPDISEQLCSDCLVGAFA--DISSIYGKVGGGVNKPSCXFRF  239

Query  836  EISPFFGASLI  868
            ++ PF+  + +
Sbjct  240  DLYPFYDPTTV  250



>ref|XP_009349606.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Pyrus x bretschneideri]
Length=301

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 106/190 (56%), Gaps = 4/190 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S+GQ S + +A  LCRGDV L+ C SC  ++   + Q C N+K+A  W   C+++
Sbjct  76   GFYNYSLGQGSAKVNAMALCRGDVPLNDCHSCFDESISILLQNCTNKKQAIIWAQRCTVH  135

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G +   P       T   N  QF   L  L++ L  +A  G    K+AA    
Sbjct  136  YSNVSIFGVVEDDPVKFVPGPTNASNAEQFKLVLNPLLEILSEKAAAGNSTTKFAAGHAL  195

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
             P S+TIYA VQCTPDL  +DC +CLK A +   K    G  G RVLRPSC  R+E + F
Sbjct  196  VPASKTIYAIVQCTPDLDRQDCSDCLKEATSDIRKC-CEGKEGGRVLRPSCNLRFESNLF  254

Query  851  FGA---SLIN  871
            + A   SL+N
Sbjct  255  YDAASDSLVN  264



>emb|CAN65760.1| hypothetical protein VITISV_001837 [Vitis vinifera]
Length=316

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 131/238 (55%), Gaps = 6/238 (3%)
 Frame = +2

Query  155  LHLCSATIA----ADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQY-GFY  319
            L LC+  +A    A    P+Y  H C  +    PNSTY  NLN+LLSSLS+N  +  GFY
Sbjct  10   LFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSNATRANGFY  69

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N + GQ  + A    LCRGDV +  CR CV++ +  I Q C   K+A  WY+ C ++YS+
Sbjct  70   NATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAIIWYDQCMLHYSN  129

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
             SI   +   P ++ +++  V +PG FNQ +   ++     A N     K+A        
Sbjct  130  RSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESGKKFATKEENFTG  189

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            SQT+Y+ VQCTPDLS+ DC  CL+ A    +    +G  GAR L PSC  RYE+ PF+
Sbjct  190  SQTLYSLVQCTPDLSIADCSKCLEGAIGALSLC-CSGKQGARTLTPSCNARYELYPFY  246



>ref|XP_006589611.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=664

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 106/187 (57%), Gaps = 2/187 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQD +R  A  LCRGD +   C  C++++ V + + CPNQK A  W   C +
Sbjct  59   YGFYNFSHGQDPDRVYAIGLCRGDQKPDDCLKCLNNSRVSLAKECPNQKHAIDWGIECML  118

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQ-NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI   + T P +E      V+ +  QFN+ L SL+  L R A +G   LKYA  S
Sbjct  119  RYSNRSIFSLMETQPMVELVYTLDVKGSVEQFNEALQSLMRNLTRTAASGDSRLKYATAS  178

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T  P  QTI+ Y QCTPDLS  DC  CL+ A +   +   +G  G  VL+PSC  R++  
Sbjct  179  TPAPSFQTIFGYTQCTPDLSSEDCTKCLEEAISKIPEC-CSGKAGGNVLKPSCRIRFDPY  237

Query  845  PFFGASL  865
             F+G +L
Sbjct  238  VFYGPTL  244



>ref|XP_009349605.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Pyrus x bretschneideri]
Length=305

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 106/190 (56%), Gaps = 4/190 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S+GQ S + +A  LCRGDV L+ C SC  ++   + Q C N+K+A  W   C+++
Sbjct  76   GFYNYSLGQGSAKVNAMALCRGDVPLNDCHSCFDESISILLQNCTNKKQAIIWAQRCTVH  135

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G +   P       T   N  QF   L  L++ L  +A  G    K+AA    
Sbjct  136  YSNVSIFGVVEDDPVKFVPGPTNASNAEQFKLVLNPLLEILSEKAAAGNSTTKFAAGHAL  195

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
             P S+TIYA VQCTPDL  +DC +CLK A +   K    G  G RVLRPSC  R+E + F
Sbjct  196  VPASKTIYAIVQCTPDLDRQDCSDCLKEATSDIRKC-CEGKEGGRVLRPSCNLRFESNLF  254

Query  851  FGA---SLIN  871
            + A   SL+N
Sbjct  255  YDAASDSLVN  264



>ref|XP_010052449.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW76443.1| hypothetical protein EUGRSUZ_D00833 [Eucalyptus grandis]
Length=671

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 123/227 (54%), Gaps = 7/227 (3%)
 Frame = +2

Query  194  DPNYEWHQCGTSGNYTPnst--ydnnlntllsslsnnvnQYGFYNGSVGQDS-ERASAAV  364
            DP Y  H CGT+GN+T N T   + N        +   + YGFYN S G  S +  +A  
Sbjct  26   DPLY--HVCGTNGNFTANGTYGDNLNALLTSVVAAAAADDYGFYNLSAGGGSADSVNAIA  83

Query  365  LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQ  544
            LCRGDV  + CRSC++D+A  I   CP QKEA  WY+ C + YS+ SI  +    P    
Sbjct  84   LCRGDVGAADCRSCLNDSAAEIAGRCPVQKEAIIWYDNCMLRYSNRSIFRTKEDLPGYYM  143

Query  545  HSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDL  721
             ++  V  N  QFNQ L +L+D LR +A NG    K+A  +   P+ QT++  VQCTPDL
Sbjct  144  WNLNNVTNNVDQFNQVLRNLMDDLRDRAANGNSTRKFAVGNATAPNFQTLFGLVQCTPDL  203

Query  722  SVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            S + C++CL        +   N   G RV+ PSC  R+E+  FF  S
Sbjct  204  SQQQCDDCLVGTIGQIPQC-CNQKQGGRVIIPSCNIRFEVGRFFDPS  249



>ref|XP_004172020.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 26-like [Cucumis sativus]
Length=668

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 118/224 (53%), Gaps = 22/224 (10%)
 Frame = +2

Query  212  HQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVEL  388
            H C  +GNYT NS    N  N L S  SN    YGFYN S GQD +R +A  LC  D+ +
Sbjct  30   HSCSNTGNYTTNSVYKQNLDNLLSSIASNTEIDYGFYNFSAGQDPDRVNAIALCLADLTV  89

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESI--IGSLRTTPEIEQHSITPV  562
              CR C+ ++  RI + CPNQKEA  WY +C + YS+ SI  +G+ R         + PV
Sbjct  90   DECRRCIQNSTRRILEDCPNQKEAIGWYTVCMVRYSNRSIFRVGNDRV--------LGPV  141

Query  563  QNPGQ-------FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDL  721
               GQ       + + L +L+ RLR +A +G    KYA       +   I+ +VQCTPDL
Sbjct  142  FVSGQTASDIDGYTRSLRTLLQRLRNEASSGDSRHKYAVGEVEATNLDNIFGFVQCTPDL  201

Query  722  SVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            S  DC NCL  A     ++  NG +G R+   SCF RYE +  F
Sbjct  202  SSVDCNNCLMKA----AENVRNGSMGTRIFSTSCFLRYETNDIF  241



>ref|XP_006387886.1| hypothetical protein POPTR_0499s002001g, partial [Populus trichocarpa]
 gb|ERP46800.1| hypothetical protein POPTR_0499s002001g, partial [Populus trichocarpa]
Length=445

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 136/252 (54%), Gaps = 15/252 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIA-ADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntllsslsnnv  301
              IF  + LHL S TIA  D +D N     C    GNYT NS    N  + L S  SN  
Sbjct  2    LFIFSCILLHLTSLTIAQTDLVDQN-----CSNDVGNYTTNSNFQRNLNSVLSSLDSNTQ  56

Query  302  nQYGFYNGSVGQDS-ERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
              YGFYN SVGQ   ++A+   LCRGD+ +  C++C+ +++ +I Q CPNQKEAF   + 
Sbjct  57   IDYGFYNLSVGQPGPDQANVIALCRGDIGVDECQNCIRNSSGKILQVCPNQKEAFGIADT  116

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-  655
            C + YS++SI G +   P     +     +  QFNQ L +L+  LR  A +G    K+A 
Sbjct  117  CFLRYSNKSIFGVMEDDPVSILVNTGNATDVNQFNQALQTLMSGLRSTAASGNSLRKFAT  176

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSA---FALWNKSKGNGMIGARVLRPSCF  826
             N TAG D  TI+  VQCTPDLS   C++C+  A    A     +  G  GAR+ RP C 
Sbjct  177  GNETAGFD--TIFGLVQCTPDLSEPQCDDCIAGAIRVIATCCDGQLVGRQGARITRPICN  234

Query  827  FRYEISPFFGAS  862
             RYE+  FFG +
Sbjct  235  LRYEVYRFFGVT  246



>gb|KEH43970.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=265

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 128/244 (52%), Gaps = 7/244 (3%)
 Frame = +2

Query  140  FILLSLHLCSATIAADNIDPNYEW--HQCGTSGNY-TPnstydnnlntllsslsnnvnQY  310
            F+ L + L ++   ADN D  + +   Q    GNY T ++  +N    ++    N+   Y
Sbjct  11   FLFLIIILFTSKAKADNNDQKFHYFCDQNNDRGNYITGSAYDNNLKFAIMHLTYNSKIDY  70

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NICS  484
            GFYN + GQ+++  +A  +CRGD+    CR C+  +   + Q CPN+KEA  WY    C 
Sbjct  71   GFYNTNYGQNNDTVNAIGICRGDINPQDCRKCLIGSKFNLTQACPNKKEAIGWYEDEKCM  130

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS  SI+G     P     ++       QFN  +  L++ LR +A+NG    KY    
Sbjct  131  LRYSDRSIMGLNEIGPAYFAWNLNNATMADQFNILVKQLLNDLRSKAINGDSHRKYVVGK  190

Query  665  TAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
              GP S QTIY  VQCTPDLS   C++CL  + A  ++   N  IGAR++RPSC  R+E 
Sbjct  191  MPGPSSDQTIYGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSN-RIGARIIRPSCNLRFET  249

Query  842  SPFF  853
            S  F
Sbjct  250  SYQF  253



>ref|XP_003638010.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=449

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 139/248 (56%), Gaps = 15/248 (6%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F   S  +    ++     P++ ++ C   +GNYT NST  +N    L +  S     
Sbjct  8    LLFSFYSFLILITFVSQAKAQPDFLYNFCINDNGNYTANSTYQNNLNTLLSNLTSKTQIN  67

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  +CRS ++D+ V + + CPNQKEA  WY    +
Sbjct  68   YGFYNFSYGQNTDKVNAIGLCRGDVKPDLCRSRLNDSRVLLTKLCPNQKEAIGWYEDYML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS++SI G L  +P+    +   V     FN+ L +L+ +LR  A +    LK+AA+  
Sbjct  128  RYSNQSIFGILEWSPKFYMSNPNNVTEVDPFNRVLGNLMRKLREIAASSDSRLKFAADNA  187

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA-----LWNKSKGNGMIGARVLRPSCF  826
            +    + QTIY  VQCTPDLS +DC +CL+ A +      +NK      IG RV++PSC 
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNDCLEFAISEIPIYCYNK------IGCRVVKPSCN  241

Query  827  FRYEISPF  850
             RYE+  F
Sbjct  242  IRYEVYRF  249



>gb|KHN15831.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=1343

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/246 (37%), Positives = 137/246 (56%), Gaps = 8/246 (3%)
 Frame = +2

Query  122  SQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsn  295
            S+  ++F++L +++  AT       PN+  + C   +GNYT NST + N    L +  SN
Sbjct  686  SKTLLLFVILLVNMSLATA-----QPNFVKYYCIDKNGNYTANSTFHANLNTLLSNLSSN  740

Query  296  nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
                YGFYN S GQ+S++ +   +CRGD++   CRSC+ ++ + + Q CPNQKEA  WY+
Sbjct  741  TEIDYGFYNFSNGQNSDKVNVIGMCRGDLKPESCRSCLKNSRILLTQLCPNQKEAIGWYD  800

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA  655
             C + YS  SI G + + P     +     N  Q+N+ +  L+  L   A  G    KYA
Sbjct  801  QCMLRYSTRSIFGIMESDPWYLIWNNRNATNEDQYNEVVGDLLRSLGNGAEAGDSHRKYA  860

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              +  GP+ QT+YA+VQCTPDLS  +C  CL  A  L+  +   G +  R+  PSC  R+
Sbjct  861  QANKTGPNFQTVYAHVQCTPDLSELECNQCLFIAI-LYIPNYCAGKVRCRIFEPSCNLRF  919

Query  836  EISPFF  853
            + +P+F
Sbjct  920  DTTPYF  925


 Score =   128 bits (321),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 123/223 (55%), Gaps = 5/223 (2%)
 Frame = +2

Query  197  PNYEWHQCGTSG-NYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLC  370
            P Y +  C T G +Y PNST   N    L   +S   N YGFYN S GQ+ +R  A  LC
Sbjct  24   PEYPYAVCITEGGDYAPNSTYQTNLNTVLSRIISTTQNDYGFYNSSYGQEPDRVYANGLC  83

Query  371  RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHS  550
            RGDV    C +C++++ + + + CP+QK A   Y  C ++YS+ S++G   +   +   S
Sbjct  84   RGDVTPHACLTCLNNSHLLLLKQCPHQKRAIGGYAECMLHYSYRSVLGYYDSDFRVYLQS  143

Query  551  ITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFL--KYAANSTAGPDSQTIYAYVQCTPDLS  724
             T V++  Q++  L  L+ RL+ +A     +L  KYA+ +   P SQTI+A VQC PDL+
Sbjct  144  KTNVKDWDQYSYVLMKLLSRLKVKAATTDSYLNRKYASGNATIPGSQTIFAVVQCAPDLT  203

Query  725  VRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            V  C +CL  A +   K   N M G  V++  C FRYE S F+
Sbjct  204  VAQCNDCLDGAISEIPKC-CNHMSGGVVIKFRCNFRYESSRFY  245



>ref|XP_007025927.1| Receptor protein kinase isoform 1 [Theobroma cacao]
 gb|EOY28549.1| Receptor protein kinase isoform 1 [Theobroma cacao]
Length=343

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 111/221 (50%), Gaps = 2/221 (1%)
 Frame = +2

Query  194  DPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLC  370
            DP +E       GNYT NS+   N    +    S     YGF+N S G+  +   A  LC
Sbjct  25   DPYFECGFVEDRGNYTANSSYQANLNRIVSQLSSLTEFNYGFFNLSAGESPDEVKAIALC  84

Query  371  RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHS  550
             GD     C SC+   A  + Q CP  KEA  W   C + Y++  I G L + P     +
Sbjct  85   TGDRTQDECNSCLHRTATELIQRCPWHKEATAWSEFCLVRYANRDIFGQLESEPRTCAFN  144

Query  551  ITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVR  730
                 NP QFN  L+ L++ L   A  GGP  KYAA +    + QTIYA VQCTPD+  +
Sbjct  145  TRKASNPVQFNDGLSELLNNLSNIAAAGGPLRKYAAGNATAGNLQTIYAAVQCTPDMDKQ  204

Query  731  DCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            +C +CL    A +  +   G IG RVLRP+C  R+E +PF+
Sbjct  205  NCTHCLDDGKAEF-LNCCYGRIGCRVLRPTCILRFESNPFY  244



>ref|XP_008345852.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=671

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 6/186 (3%)
 Frame = +2

Query  308  YGFYNGS--VGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
            YGFYN S  +   +E   A  LCRGDV +  CRSC++++   + Q CPNQKEAF  Y  C
Sbjct  59   YGFYNASYRLNSSNEHIYAIGLCRGDVTVGDCRSCLNNSRYDLLQRCPNQKEAFGSYXXC  118

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYA  655
             + YS+ SI G + T P    ++   V +     FNQ+L  L++ +R +A  GG   K+A
Sbjct  119  MLRYSNRSIYGVMETEPSPAYYNXNNVSSSDLDGFNQZLRKLLESIRSEAAAGGSLRKFA  178

Query  656  ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              +T+ P  QTI+A  QCTPD+S + C +CL  AFA  + S   G +G  V +PSC FR+
Sbjct  179  FGNTSAPSFQTIFALAQCTPDISEQLCSDCLVGAFA--DISSIYGKVGGGVNKPSCXFRF  236

Query  836  EISPFF  853
            ++ PF+
Sbjct  237  DLYPFY  242



>gb|KEH43969.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=282

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 128/244 (52%), Gaps = 7/244 (3%)
 Frame = +2

Query  140  FILLSLHLCSATIAADNIDPNYEW--HQCGTSGNY-TPnstydnnlntllsslsnnvnQY  310
            F+ L + L ++   ADN D  + +   Q    GNY T ++  +N    ++    N+   Y
Sbjct  28   FLFLIIILFTSKAKADNNDQKFHYFCDQNNDRGNYITGSAYDNNLKFAIMHLTYNSKIDY  87

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NICS  484
            GFYN + GQ+++  +A  +CRGD+    CR C+  +   + Q CPN+KEA  WY    C 
Sbjct  88   GFYNTNYGQNNDTVNAIGICRGDINPQDCRKCLIGSKFNLTQACPNKKEAIGWYEDEKCM  147

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS  SI+G     P     ++       QFN  +  L++ LR +A+NG    KY    
Sbjct  148  LRYSDRSIMGLNEIGPAYFAWNLNNATMADQFNILVKQLLNDLRSKAINGDSHRKYVVGK  207

Query  665  TAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
              GP S QTIY  VQCTPDLS   C++CL  + A  ++   N  IGAR++RPSC  R+E 
Sbjct  208  MPGPSSDQTIYGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSN-RIGARIIRPSCNLRFET  266

Query  842  SPFF  853
            S  F
Sbjct  267  SYQF  270



>gb|KGN49146.1| hypothetical protein Csa_6G516540 [Cucumis sativus]
Length=286

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 132/244 (54%), Gaps = 9/244 (4%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnv--nQ  307
            + FIL + H    T +     P++ +  C  + NYT NST+  NL+ +L S+S+N   N 
Sbjct  10   LFFILAAAHFIFPTTS----QPDFLFRTCSNNSNYTKNSTFSKNLSNVLLSISSNTRFNN  65

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            Y FYN + G + +RA+A  LCRG V L  CRSCV ++ +RI Q CP QKEA  WY  C I
Sbjct  66   YSFYNATSGHNPDRATALALCRGGVPLEQCRSCVYNSTLRITQDCPYQKEAAGWYQDCQI  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK--YAAN  661
             YS+ SI G   ++P++   ++    +P  FN  L +L+D LR++A  G   LK  +   
Sbjct  126  RYSNNSIYGMEDSSPQVFFWNLRTADDPVGFNDALWNLLDGLRKEAALGSSVLKSAWGGE  185

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                P   T+Y  V C PDLS   C +CL++   +   S  N  IG R++  SC   YE 
Sbjct  186  KIRSPSMDTVYGLVDCYPDLSYLGCFDCLRNLQTII-PSCCNASIGVRLIATSCQLNYEF  244

Query  842  SPFF  853
             P +
Sbjct  245  HPIY  248



>ref|XP_010054433.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Eucalyptus 
grandis]
Length=634

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 129/220 (59%), Gaps = 8/220 (4%)
 Frame = +2

Query  218  CGTSGNYTPnstydnnlntllsslsnnvnQ--YGFYNGSVGQDSERASAAVLCRGDVELS  391
            CGT+GN+T N TY  NLN LL+S+        +GFYN S G  +   +A  LCRGDV  +
Sbjct  32   CGTTGNFTANGTYQANLNALLASVVATAAADGHGFYNLSAGGSTNAVNAIALCRGDVGAT  91

Query  392  VCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPV-QN  568
             C+SC++D+A ++ + CP QKEA  WY+ C + YS++SI  ++  +P     ++  V  N
Sbjct  92   DCQSCLNDSAPQVARQCPVQKEAIIWYDNCMLRYSNQSIFRAMEDSPVFSWWNLNNVTNN  151

Query  569  PGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCL  748
              QFNQ L +L+D LR +A +G    K+A  +   P+  T++  VQCTPDLS   C++CL
Sbjct  152  VDQFNQVLRNLMDSLRERAASGNSTRKFAVGNATAPNFLTLFGLVQCTPDLSQPQCDDCL  211

Query  749  KSAFAL--WNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
             SA     W  ++     G  V+ PSC  R+E+ PFF  S
Sbjct  212  VSAIGQIPWFSNQKQ---GETVVTPSCNIRFEVYPFFDPS  248



>gb|KHN23189.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=821

 Score =   142 bits (359),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 107/185 (58%), Gaps = 2/185 (1%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN--I  478
            +YGFYN S G+++++  A  LC GD++   CR+C++ +   + + CPNQKEA  WY    
Sbjct  207  EYGFYNSSQGENTDKVYAIGLCTGDIKPDECRNCLNGSRANLTELCPNQKEAIGWYEDEK  266

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + YS  SI+  + T P    +++    +  QFN+D+ +L+  L+ +A  G   LKYA 
Sbjct  267  CMLRYSDRSILDLMETGPAFYANNMDNATDLDQFNKDVNTLLGNLKNEAALGDSRLKYAV  326

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
             +T+GPD++ IY  VQCTPDLS  +C +CL  +             G RV+RPSC  R+E
Sbjct  327  GNTSGPDNKLIYGLVQCTPDLSGSECFDCLSQSIERIPIDCCKDRKGGRVVRPSCNMRFE  386

Query  839  ISPFF  853
             S  F
Sbjct  387  TSFLF  391


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +2

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS  SI       P     S+       QFN+ +  L+D L+ +A +G    KYA  S
Sbjct  2    LRYSDRSIFNLNEIGPAYFMWSMLNATQVDQFNKVVKDLLDGLKTKAKSGDSQSKYATAS  61

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
             +GPD++TIY  VQCTP+LS   C++CL  +    +    N  +G R++RPSC  R+E +
Sbjct  62   VSGPDNRTIYGLVQCTPNLSGPQCDDCLVQSIKEVSHC-CNSRLGVRIVRPSCNLRFETA  120

Query  845  PFF  853
              F
Sbjct  121  SLF  123



>gb|KHN02669.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=582

 Score =   140 bits (353),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 1/166 (1%)
 Frame = +2

Query  365  LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQ  544
            +CRGDV+   CRSC++D+ V + Q CPNQKEA  WY+ C + YS+ SI  ++   P    
Sbjct  1    MCRGDVKPDACRSCLNDSRVLLTQRCPNQKEAIGWYDDCMLRYSNRSIFETMEPNPTYFL  60

Query  545  HSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLS  724
             + +   +  QFN+ L  LVD LR +A +G    KYAA S AGP  QTI+A +QCTPDLS
Sbjct  61   WTQSNATDMDQFNEALRGLVDGLRSKAASGDSLKKYAAGSAAGPSFQTIFALLQCTPDLS  120

Query  725  VRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
             + C NCL  A    + S   G    R+ +PSC  R++ SPF+ ++
Sbjct  121  EQQCNNCLVRAITDIS-SCCAGRTSGRIGKPSCNLRFDTSPFYDSA  165



>ref|XP_007025923.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY28545.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
Length=669

 Score =   141 bits (356),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 101/187 (54%), Gaps = 1/187 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGF+N S G+  ++ +A  LC GD     C SC++  A  + Q CP  KEA  WY+ C +
Sbjct  62   YGFFNLSAGESPDKVNAIALCSGDRTQDECNSCLNHTATVLLQRCPWYKEATAWYDFCLV  121

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             Y++  I G L   P    ++     NP QFN  L+ L++ L   A  GGP  KY A + 
Sbjct  122  RYANRDIFGQLENEPRTCAYNERNASNPEQFNNGLSELLNNLSSIAAAGGPLRKYEAGNA  181

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               + QT+YA VQCTPD+  ++C  CL      + K    G IG RVLRP+C  RYE  P
Sbjct  182  PAGNLQTVYAAVQCTPDMDEQNCTACLNHGKQEFLKC-CYGRIGCRVLRPTCILRYESDP  240

Query  848  FFGASLI  868
            F+  +L+
Sbjct  241  FYNQTLV  247



>gb|KGN49148.1| hypothetical protein Csa_6G516560 [Cucumis sativus]
Length=261

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 101/185 (55%), Gaps = 3/185 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YG+YNG+ GQD +RA+A  LCRG VEL  CR CV ++ +RI Q CPNQKEA   Y  C I
Sbjct  49   YGYYNGTSGQDPDRATALALCRGGVELEQCRRCVYNSTLRITQDCPNQKEAEGLYQDCQI  108

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA--AN  661
             YS+ SI G    + ++   ++  V++   FN+ L SL DRL+ +A +G    K A    
Sbjct  109  RYSNNSIYGVKDNSVQLFLFNLVKVEDWVGFNEALRSLFDRLKMEASSGSSIQKSAWGGE  168

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                P   T+Y  V C PDLS  DC +CL    A    S  N  IG R+   SC   YE+
Sbjct  169  KVRSPSMDTVYGLVDCFPDLSYLDCFDCLNQLQASL-PSCCNASIGVRLAATSCQLAYEL  227

Query  842  SPFFG  856
             P + 
Sbjct  228  HPVYA  232



>ref|XP_010052402.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=664

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 126/221 (57%), Gaps = 12/221 (5%)
 Frame = +2

Query  212  HQCGTSGNYTPnsty-dnnlntllsslsnnvnQYGFYNGSVGQDSERASAAV-LCRGDVE  385
            H CGT+GN+T N TY DN    L S ++     YGFYN S G  S  A  A+ LCRGDV 
Sbjct  30   HLCGTNGNFTANGTYGDNLKALLTSVVAAAAADYGFYNLSTGGGSADAVNAIALCRGDVG  89

Query  386  LSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEI---EQHSIT  556
             + CRSC++D+A  I + CP QKEA  WY+ C + YS+ SI  +   +P +    ++++T
Sbjct  90   AADCRSCLNDSAPEITRRCPVQKEAIIWYDNCMLRYSNRSIFRTTDDSPSLYMWNRNNVT  149

Query  557  PVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDC  736
               N  QFNQ L +L+D LR  A +G    K+A  +   P+  +++  VQCTPDLS   C
Sbjct  150  --NNVDQFNQVLRNLIDSLREGAASGNSTRKFAVGNATTPNFLSLFGLVQCTPDLSQPQC  207

Query  737  ENCLKSAFAL--WNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            +NCL  A     W   +     G RV+ PSC  R+E+ PFF
Sbjct  208  DNCLVGAIGEIPWFSYQKQ---GGRVIFPSCSIRFEVYPFF  245



>ref|XP_007143158.1| hypothetical protein PHAVU_007G048700g [Phaseolus vulgaris]
 gb|ESW15152.1| hypothetical protein PHAVU_007G048700g [Phaseolus vulgaris]
Length=666

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 105/187 (56%), Gaps = 2/187 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ +++A A  +CRGD     C  C++D+   + + CPNQKEA  W   CS+
Sbjct  55   YGFYNFSHGQGTDKAYAIGVCRGDRTRDQCLKCLNDSRAALSKECPNQKEAIDWGGECSL  114

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQ-NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI G +   P +E      V+ +  QFN  L SL+  L + A +G    KYA  S
Sbjct  115  RYSNRSIFGLMENQPTLELLYTLEVRGSVEQFNAALQSLMRNLIQTAASGDSRRKYATGS  174

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
             + PD QTI+ Y QCTPDLS  DC  CL  A +   +   NG  G  VL+PSC  R++  
Sbjct  175  ASAPDFQTIFGYTQCTPDLSSEDCSKCLNEAISKIPEC-CNGKAGGNVLKPSCRIRFDPY  233

Query  845  PFFGASL  865
             F+G +L
Sbjct  234  IFYGPTL  240



>gb|KDO37599.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=451

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 137/250 (55%), Gaps = 14/250 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQ-  307
            ++  I LS+   S+  AA   DP Y +H C  S N+T NSTY  N N LLSSL  N ++ 
Sbjct  15   FLFVIYLSISFQSSFTAA--ADPTYAYHVC--SANFTGNSTYQTNRNLLLSSLPTNASRG  70

Query  308  ----YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
                 GFYN + GQD  +     LCRGD   S C+ CV+     + Q CP+ K+   WY+
Sbjct  71   NGYSSGFYNETTGQDPNKVYGLFLCRGDQTASSCQDCVTFATRDLVQRCPDGKQTIIWYD  130

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGG-PFLKY  652
             C + YS+ SI  ++ T P +   +   V + G+FNQ L SL+ ++  QAVN    F   
Sbjct  131  QCLLRYSNRSIFSTMDTVPYVSLLNTQNVTDRGRFNQILASLMSQVVNQAVNNSRKFATR  190

Query  653  AANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFR  832
             AN TA    QT+Y+  QCTPDLS  DC  CL++A A    +  +G  GA+VL PSC  R
Sbjct  191  TANFTA---LQTLYSLAQCTPDLSSSDCNVCLQAAIAEL-PNCCSGKTGAQVLIPSCIVR  246

Query  833  YEISPFFGAS  862
            YE  PF+  S
Sbjct  247  YEFYPFYNLS  256



>gb|AFK43013.1| unknown [Medicago truncatula]
Length=265

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/244 (36%), Positives = 128/244 (52%), Gaps = 7/244 (3%)
 Frame = +2

Query  140  FILLSLHLCSATIAADNIDPNYEW--HQCGTSGNY-TPnstydnnlntllsslsnnvnQY  310
            F+ L + L ++   ADN D  + +   Q    GNY T ++  +N    ++    N+   Y
Sbjct  11   FLFLIIILFTSKAKADNNDQKFHYFCDQNNDRGNYITGSAYDNNLKFAIMHLTYNSKIDY  70

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NICS  484
            GFYN + GQ+++  +A  +CRGD+    CR C+  +   + Q CPN+KEA  WY    C 
Sbjct  71   GFYNTNYGQNNDTVNAIGICRGDINPQDCRKCLIGSKFNLTQACPNKKEAIGWYEDEKCM  130

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            ++YS  SI+G     P     ++       QFN  +  L++ LR +A+NG    KY    
Sbjct  131  LHYSDRSIMGLNEIGPAYFAWNLNNATMADQFNILVKQLLNDLRSKAINGDSHRKYVVGK  190

Query  665  TAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
              GP S QTIY  VQCTPDLS   C++CL  + A  ++   N  I AR++RPSC  R+E 
Sbjct  191  MPGPSSDQTIYGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSN-RIDARIIRPSCNLRFET  249

Query  842  SPFF  853
            S  F
Sbjct  250  SYQF  253



>ref|XP_007143162.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris]
 gb|ESW15156.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris]
Length=673

 Score =   140 bits (354),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 110/187 (59%), Gaps = 2/187 (1%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            +YGFYN S GQ+++   A  LCRGD +   CRSC++++ V + + CPNQK+A  W + C 
Sbjct  61   EYGFYNFSYGQNTDTVYAIGLCRGDQQPEECRSCLNNSRVDLTERCPNQKKAIMWSDQCM  120

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS+ +I   + T+P     +     +  QFN+ L +L+  L+  A +G    KYA A 
Sbjct  121  LRYSNYTIFHQMETSPRYYMWNTANATDATQFNEVLGNLMKSLKDTAASGDSRRKYATAE  180

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +  G + QTIY  VQCTPDLS ++C  CL    +    +  NG +G RVLRPSC  R+E 
Sbjct  181  NATGLNFQTIYGLVQCTPDLSQQECTQCLDGVISEI-PTCCNGKVGGRVLRPSCNIRFET  239

Query  842  SPFFGAS  862
              F+GA+
Sbjct  240  YSFYGAT  246



>ref|XP_008225008.1| PREDICTED: uncharacterized protein LOC103324687 [Prunus mume]
Length=1397

 Score =   142 bits (359),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 143/252 (57%), Gaps = 8/252 (3%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnstydnnlntllss--  286
            M S  ++ F++ ++ L    I      P + +H C    GNYT NSTY  NLNTLLSS  
Sbjct  709  MASSRFLFFLIYAILLL-IMITQAFAQPAFLYHFCINNIGNYTNNSTYHKNLNTLLSSLP  767

Query  287  lsnnvnQYGFYNGSVGQDSERASAAV-LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
               N N YGFYN S GQ+S+    A+ LCRGDV+   CRSC++++   + Q CPNQKEA 
Sbjct  768  SDENGNGYGFYNSSYGQNSDDQVYAIGLCRGDVKAEDCRSCLNNSRYALTQLCPNQKEAI  827

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPG--QFNQDLTSLVDRLRRQAVNGG  637
             WY+ C + YS+ S+ G + T P   + +   V + G   FNQ+L  L++ +R +A  GG
Sbjct  828  GWYDNCMLRYSNSSMYGVVATMPSFYKRNSQNVSSSGVDGFNQELRKLLESVRSEAAAGG  887

Query  638  PFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRP  817
               K+A  +   P  QTI+A  QCTP++S + C +CL  AF    +      +G RV+ P
Sbjct  888  SLRKFAYGNATAPTFQTIFAIAQCTPEISEQACSDCLVGAFGKIPQCCLEK-VGGRVVGP  946

Query  818  SCFFRYEISPFF  853
            SC FR+E+  F 
Sbjct  947  SCNFRFEVYRFI  958


 Score =   131 bits (330),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 105/192 (55%), Gaps = 8/192 (4%)
 Frame = +2

Query  308  YGFYNGSVGQ--DSERASAAVLC-RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
            YGFYN S GQ  D  +  A  LC   +++   CR+C++ +   + + CPNQKEA  + + 
Sbjct  69   YGFYNSSYGQSSDDNQVYAIALCYMVNIDDPGCRNCLNVSRYALIELCPNQKEAVFFTHG  128

Query  479  CSIYYSHESIIGSLRTTPEI--EQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKY  652
            C + YS+  I G++ TTP +        P     +F Q L  L+  LR +    G   K+
Sbjct  129  CMLRYSNSLIYGTMETTPSLCMSNTQDVPSSTVNEFFQKLRELLGSLRSETAAAGSLRKF  188

Query  653  AANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFR  832
            A  +T+G + QTIY   QCTPDLS ++C +CL  AF        NG IG RV+RPSC+F 
Sbjct  189  AYGNTSGENIQTIYGLTQCTPDLSEQECNDCLIGAFG---NLCSNGKIGGRVIRPSCYFM  245

Query  833  YEISPFFGASLI  868
            YE+ P+   S +
Sbjct  246  YEVYPYINISAV  257



>gb|KGN49149.1| hypothetical protein Csa_6G516570 [Cucumis sativus]
Length=316

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 134/246 (54%), Gaps = 6/246 (2%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQ-  307
            +++F +L L +  +     N  P++ +H C  + NYT NS +  NL+ +L S+S+   Q 
Sbjct  11   FMVFFILVLVVQHSMFPTTNSQPDFTYHSCSNNANYTNNSPFKKNLHNVLLSISSKTTQL  70

Query  308  -YG-FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
             YG FYN + G+  +RA+A  LCRG V L  CRSCV ++ +RI + CP Q+EA  WY+ C
Sbjct  71   DYGLFYNATSGEYPDRATALALCRGGVSLKQCRSCVYNSTLRITKDCPKQREAEGWYSDC  130

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             I YS+ SI G L TT +  + +     NP  FN+ L SL D L R+A +G    K A  
Sbjct  131  QIRYSNNSIYGVLDTTIKYVRWNTQKALNPRGFNKVLRSLFDGLGREAASGSSVQKSAWG  190

Query  662  STAGPDSQT--IYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
                P S    +Y  V C PDLS  DC +CL +    + ++  N  +G R+   SC   Y
Sbjct  191  DKKVPSSNVDIVYGLVDCFPDLSYLDCLDCL-NRLQNFLRTCCNDSMGVRIFGISCQLNY  249

Query  836  EISPFF  853
            + +P +
Sbjct  250  DNTPIY  255



>gb|AES98412.2| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=553

 Score =   139 bits (350),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 103/182 (57%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G+D+ +  A  LCRGDV  + CRSC++++ V + Q CPN+KEA    N C +
Sbjct  69   YGFYNFSFGEDNNKVYAIGLCRGDVNPNDCRSCLNNSRVLLTQNCPNKKEAIGRINKCML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I G + T P+    +     + G++NQ +  L+  L+ +A  G    KYA  + 
Sbjct  129  RYSNRLIFGLMETFPDFSIPNPFNATDVGKYNQVVGKLLYDLKTEAATGDSMKKYATRNV  188

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
             GP+ Q IY+ +QCTPDLS  DC  CL  A A       N  +G R +RPSC  RYE   
Sbjct  189  TGPNFQDIYSLMQCTPDLSYLDCNQCLDQAIASLPSCCVNK-VGGRAIRPSCNLRYENYR  247

Query  848  FF  853
            F+
Sbjct  248  FY  249



>ref|XP_010108868.1| Cysteine-rich receptor-like protein kinase 26 [Morus notabilis]
 gb|EXC20508.1| Cysteine-rich receptor-like protein kinase 26 [Morus notabilis]
Length=827

 Score =   141 bits (356),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 106/182 (58%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++S   +A  LCRGD+   +CRSCV +++ R+   C N++EA  W  +C +
Sbjct  304  YGFYNSSSGENSNIVNAIALCRGDLSPEICRSCVYNSSERLLGRCQNRREAILWDELCMV  363

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             +S++SI    +  P +   S     +P  F   L  L+D L  +A +G    KYA+  +
Sbjct  364  RFSNKSIFSLRQDDPRMYVPSPNAAWDPNLFRITLKPLLDNLISKAASGDSLKKYASGES  423

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              P  +TIYA  QCTPDL  + C  CL+ A +L+   + +G  GAR+L+PSC  RYE+S 
Sbjct  424  TIPGYETIYATTQCTPDLDTQQCNGCLQEA-SLFIPQQFSGKQGARILKPSCNLRYEVSQ  482

Query  848  FF  853
            FF
Sbjct  483  FF  484


 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 140/256 (55%), Gaps = 12/256 (5%)
 Frame = +2

Query  116  MDSQEWIIFIL-LSLHLCSATIAADNID----PNYEWHQCGTSGNYTPnstydnnlntll  280
            M S   ++F+L + +HL +    A   D      + W+ C  SGNY+ NSTY  NL  LL
Sbjct  1    MSSSALLVFVLPIFIHLLTTPNLAQLQDCTGSAEFCWN-CSGSGNYSRNSTYKKNLQKLL  59

Query  281  sslsnn---vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQ  451
             S+S++      Y FYN S+GQD ++ +A  LCRG +EL+ C+ C+++ +  + + CPN+
Sbjct  60   LSISSSIPDQADYSFYNASLGQDPDKVNAIGLCRGGLELNDCQKCLNETSYMLLESCPNR  119

Query  452  KEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVN  631
            KEA  W   C + YS  SI    +  P     S     +  +F + L  L+D L  +A +
Sbjct  120  KEAILWGERCMVRYSSNSIFSIRKDEPIKLLSSPNEAADAEKFKEALKPLLDDLITKAAS  179

Query  632  GGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVL  811
                 KYA  S    +S+ IYA VQCTPDLS ++C +CL+ + +L      +G  G R+L
Sbjct  180  A--VQKYAKGSAKVSNSEPIYALVQCTPDLSQKECNDCLQDS-SLKIPECCDGKNGGRIL  236

Query  812  RPSCFFRYEISPFFGA  859
            +PSC  RYE S F+ +
Sbjct  237  KPSCNLRYESSRFYDS  252



>ref|XP_010054430.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Eucalyptus 
grandis]
Length=327

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 124/225 (55%), Gaps = 8/225 (4%)
 Frame = +2

Query  194  DPNYEWHQCGTSGNYTPnst---ydnnlntllsslsnnvnQYGFYNGSVGQDS-ERASAA  361
            DP Y  H CGT+GN+T N T     N L T +   +   + YGFYN S G  S +  +A 
Sbjct  26   DPLY--HVCGTNGNFTANGTYGDNLNVLLTSVVVAAAAADDYGFYNLSAGGGSADSVNAI  83

Query  362  VLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIE  541
             LCRG+V  + CRSC+ D+   I   CP QKEA   Y+ C + YS+ SI  +   +P   
Sbjct  84   TLCRGNVGAANCRSCLKDSTAEIAGRCPVQKEAIILYDNCMLRYSNRSIFRTKEDSPGYY  143

Query  542  QHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPD  718
              ++  V  N  QFNQ L +L+D LR +AV+G    K+A  +   P+ QT++  VQCTPD
Sbjct  144  MWNLNNVTNNVDQFNQVLRNLMDDLRDRAVSGNSTRKFAVGNATAPNFQTLFGLVQCTPD  203

Query  719  LSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            LS + C++CL        + + N   G RV+ PSC  R+E+  FF
Sbjct  204  LSQQQCDDCLVGTIGQIPR-RCNQKQGGRVIIPSCNIRFEVGRFF  247



>ref|XP_009352870.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Pyrus x bretschneideri]
Length=260

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 1/184 (1%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S+GQ S + +A  LCRGDV L+ C SC  ++   + Q C N+K+A  W   C+++
Sbjct  76   GFYNYSLGQGSAKVNAMALCRGDVPLNDCHSCFDESISILLQNCTNKKQAIIWAQRCTVH  135

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS+ SI G +   P       T   N  QF   L  L++ L  +A  G    K+AA    
Sbjct  136  YSNVSIFGVVEDDPVKFVPGPTNASNAEQFKLVLNPLLEILSEKAAAGNSTTKFAAGHAL  195

Query  671  GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPF  850
             P S+TIYA VQCTPDL  ++C +CLK A +   K    G  G RVLRPSC  R+E + F
Sbjct  196  VPASKTIYAIVQCTPDLDRQNCSDCLKEATSDIPKC-CEGKEGGRVLRPSCNLRFESNLF  254

Query  851  FGAS  862
            + A+
Sbjct  255  YDAA  258



>gb|KEH43956.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=654

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 113/188 (60%), Gaps = 13/188 (7%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRS ++D+ V + + CPNQKEA  WY    +
Sbjct  69   YGFYNFSYGQNTDKVNAIGLCRGDVKPDVCRSRLNDSRVLLTKLCPNQKEAIGWYEDYML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS++SI G L  +P+    +   V     FN+ L +L+ +LR  A +    LK+AA+  
Sbjct  129  RYSNQSIFGILEWSPKFYMSNPNNVTEVDPFNRVLGNLMRKLREIAASSDSRLKFAADNA  188

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA-----LWNKSKGNGMIGARVLRPSCF  826
            +    + QTIY  VQCTPDLS +DC +CL+ A +      +NK      IG RV++PSC 
Sbjct  189  TDVNLNFQTIYGLVQCTPDLSEQDCNDCLEFAISEIPIYCYNK------IGCRVVKPSCN  242

Query  827  FRYEISPF  850
             RYE+  F
Sbjct  243  IRYEVYRF  250



>ref|XP_003615454.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=585

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 103/182 (57%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G+D+ +  A  LCRGDV  + CRSC++++ V + Q CPN+KEA    N C +
Sbjct  101  YGFYNFSFGEDNNKVYAIGLCRGDVNPNDCRSCLNNSRVLLTQNCPNKKEAIGRINKCML  160

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I G + T P+    +     + G++NQ +  L+  L+ +A  G    KYA  + 
Sbjct  161  RYSNRLIFGLMETFPDFSIPNPFNATDVGKYNQVVGKLLYDLKTEAATGDSMKKYATRNV  220

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
             GP+ Q IY+ +QCTPDLS  DC  CL  A A       N  +G R +RPSC  RYE   
Sbjct  221  TGPNFQDIYSLMQCTPDLSYLDCNQCLDQAIASLPSCCVNK-VGGRAIRPSCNLRYENYR  279

Query  848  FF  853
            F+
Sbjct  280  FY  281



>gb|KCW76451.1| hypothetical protein EUGRSUZ_D00843 [Eucalyptus grandis]
Length=669

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 125/228 (55%), Gaps = 10/228 (4%)
 Frame = +2

Query  194  DPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAV-L  367
            DP Y +  CGT+GN+T N T  DN    L S ++     YGFYN S G  S  A  A+ L
Sbjct  26   DPLYYF--CGTNGNFTANGTYGDNLNALLTSVITATAADYGFYNLSAGSGSADAINAIAL  83

Query  368  CRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQH  547
            CRGDV  + CRSC++D+A  I   CP QKEA  WY+ C + YS+ SI  ++   P     
Sbjct  84   CRGDVGAADCRSCLNDSAPAIAGRCPVQKEAIIWYDNCMLRYSNRSIFRAMEDLPAFGLA  143

Query  548  SITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLS  724
            +   V  N  QFNQ L +L D LR +A NG    K+A  +   P+ QT++  VQCTPDLS
Sbjct  144  NPNNVTNNVDQFNQVLRNLTDGLRDRAANGNSTRKFAVGNATAPNFQTLFGLVQCTPDLS  203

Query  725  VRDCENCLKSAFAL--WNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
             + C+NCL +A     W   +     G R + PSC  R+E+  FF  S
Sbjct  204  QQQCDNCLVNAIGKIPWCCDQKQ---GGRYVTPSCNIRFEVYRFFDPS  248



>ref|XP_010247023.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=240

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 134/246 (54%), Gaps = 9/246 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHL-CSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllssls  292
            M S  +    LL++ L     I+AD +     +H C  SGN++  S Y+ NLN L+SSLS
Sbjct  1    MYSLRFTPLCLLTISLLVHGVISADPL-----FHFCSKSGNFSAKSPYEINLNKLMSSLS  55

Query  293  nnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY  472
              V   GF  GSVGQ  +RA+   LCRGDV  + C++CVS+    I Q CPN KE   WY
Sbjct  56   YKVVPSGFGLGSVGQAPDRANGLALCRGDVSSTDCKTCVSEAKTEILQRCPNDKEGIIWY  115

Query  473  NICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKY  652
            + C + YS++   G++    +    ++  V NP  FNQ    L+  L  +A +  P L +
Sbjct  116  DNCLLKYSNKDFFGNIDYKYKFYMWNVQNVSNPASFNQKTKELLSHLTNEAYH-SPKL-F  173

Query  653  AANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFR  832
            A       ++QT+Y  VQCT DLS   C+ CL  A +  + S  +G IG RV+  SC FR
Sbjct  174  ATGEQKLGEAQTLYGLVQCTRDLSTTGCKKCLDEAISEIS-SCCDGKIGGRVVGGSCNFR  232

Query  833  YEISPF  850
            YE+ PF
Sbjct  233  YELYPF  238



>ref|XP_006388054.1| hypothetical protein POPTR_0379s00230g, partial [Populus trichocarpa]
 gb|ERP46968.1| hypothetical protein POPTR_0379s00230g, partial [Populus trichocarpa]
Length=222

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 104/187 (56%), Gaps = 7/187 (4%)
 Frame = +2

Query  308  YGFYNGSVGQ-DSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YG+YN S GQ   ++  A  LCRGD+ L+ CR CVS++  +I Q CPNQKEA   Y+ C 
Sbjct  13   YGYYNFSAGQIGPDQVHAIALCRGDILLNECRGCVSNSGRKILQVCPNQKEAIGIYDFCI  72

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS+ S  G L     +   +     +   F+Q L +L  RLR  A +G   LK+A  N
Sbjct  73   LRYSNRSSFGVLDEEFIVYTWNTENASHVNLFSQALGNLTSRLRTAAASGTSVLKFATGN  132

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNK---SKGNGMIGARVLRPSCFFR  832
             TAG    TI+  VQC PDLS +DC++CL   F         +  G IG R++R SC+ R
Sbjct  133  QTAGI--ITIFGLVQCMPDLSAQDCDDCLAGTFQQIRSCCDGQIEGKIGGRIVRGSCYLR  190

Query  833  YEISPFF  853
            +E  PF+
Sbjct  191  FETYPFY  197



>ref|XP_003637940.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=678

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 113/188 (60%), Gaps = 13/188 (7%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  VCRS ++D+ V + + CPNQKEA  WY    +
Sbjct  69   YGFYNFSYGQNTDKVNAIGLCRGDVKPDVCRSRLNDSRVLLTKLCPNQKEAIGWYEDYML  128

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--  661
             YS++SI G L  +P+    +   V     FN+ L +L+ +LR  A +    LK+AA+  
Sbjct  129  RYSNQSIFGILEWSPKFYMSNPNNVTEVDPFNRVLGNLMRKLREIAASSDSRLKFAADNA  188

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA-----LWNKSKGNGMIGARVLRPSCF  826
            +    + QTIY  VQCTPDLS +DC +CL+ A +      +NK      IG RV++PSC 
Sbjct  189  TDVNLNFQTIYGLVQCTPDLSEQDCNDCLEFAISEIPIYCYNK------IGCRVVKPSCN  242

Query  827  FRYEISPF  850
             RYE+  F
Sbjct  243  IRYEVYRF  250



>ref|XP_002518561.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43948.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 127/222 (57%), Gaps = 6/222 (3%)
 Frame = +2

Query  197  PNYEWHQCGTS-GNYTPns-tydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLC  370
            PN+    C  S GNYT N+    N  N L S  S+    YGFYN S+G+   + +A  LC
Sbjct  25   PNFIQQSCDNSRGNYTANTPYKANLDNILSSLASDTEIDYGFYNLSIGESPNQVNAIALC  84

Query  371  RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHS  550
            RGDV +  CR C+S++  +I + CPNQ +AF  Y+ C++ YS+ SI+G +  +P +   +
Sbjct  85   RGDVGVDNCRGCISNSTRKITEVCPNQIDAFGIYDFCTLRYSNRSILGVVEGSPILYLIN  144

Query  551  ITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-ANSTAGPDSQTIYAYVQCTPDLSV  727
            +    +  Q+ Q LT+L+DRLR +  +G    K+A  N TAG   + +YA +QCTPDL+ 
Sbjct  145  VNNASDVSQYTQALTALLDRLRSETTSGDSVRKFATGNETAG--FERVYALMQCTPDLTE  202

Query  728  RDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             +C+ CL  A +    S   G  GA V +PSC  R+E   F+
Sbjct  203  EECDVCLGQAISEIG-SCCAGRTGAAVFKPSCHVRFEEYLFY  243



>gb|KCW76449.1| hypothetical protein EUGRSUZ_D00841 [Eucalyptus grandis]
Length=654

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 121/219 (55%), Gaps = 6/219 (3%)
 Frame = +2

Query  218  CGTSGNYTPnst--ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAV-LCRGDVEL  388
            CGT GN+T N T   +          +   +  GFYN SVG  S  A  A+ LCRGDV  
Sbjct  32   CGTKGNFTANGTYGDNLKALLTSVVAAATADGGGFYNLSVGGGSPDAVNAIALCRGDVGA  91

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPV-Q  565
            + CRSC++D+A  I + CP QKEA  +Y+ C + YS+ SI G +  +P     ++  +  
Sbjct  92   ADCRSCLNDSAAEIARQCPMQKEAIIYYDKCMLRYSNRSIFGVVEISPYWHVWNVNKITN  151

Query  566  NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENC  745
            N  QFNQ L +L+D LR +A +G    K+A  +   P+ QT++  VQCT DL+   C+NC
Sbjct  152  NVDQFNQVLRNLMDGLRDRAASGNSTRKFAVGNATAPNFQTLFGLVQCTEDLTWLQCDNC  211

Query  746  LKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            L +A         +  IG R L PSC  R+++SPFF  S
Sbjct  212  LVNAIG--KIPCCDQTIGRRYLTPSCNIRFQVSPFFDTS  248



>ref|XP_007011084.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
 gb|EOY19894.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
Length=655

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 105/190 (55%), Gaps = 0/190 (0%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            +GFYN S G++ ++  A  LCRGDVE  +CRSC+SD        CPNQKEA   Y+ C +
Sbjct  63   HGFYNASFGENPDQVFARALCRGDVEPDICRSCISDARNARASVCPNQKEALLGYDECMV  122

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
            +Y++ SI G L+T+P +   +     +P  F+  L +L++  R+QA  G    K+A N T
Sbjct  123  FYTNHSIFGVLQTSPGMVLWNRANASDPEGFSATLRTLLETSRKQAAAGDTLQKFAVNDT  182

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
               D   +Y   +CTPDLS + C +CL              MIG R++ PSC FR+E   
Sbjct  183  MTTDFSRVYVLTECTPDLSEQQCLDCLDLVIRNQPDCCTGTMIGGRLIVPSCNFRFENYR  242

Query  848  FFGASLINGS  877
            F+  + ++ S
Sbjct  243  FYNITHVSSS  252



>ref|XP_010052450.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=670

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 121/219 (55%), Gaps = 6/219 (3%)
 Frame = +2

Query  218  CGTSGNYTPnst--ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAV-LCRGDVEL  388
            CGT GN+T N T   +          +   +  GFYN SVG  S  A  A+ LCRGDV  
Sbjct  32   CGTKGNFTANGTYGDNLKALLTSVVAAATADGGGFYNLSVGGGSPDAVNAIALCRGDVGA  91

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPV-Q  565
            + CRSC++D+A  I + CP QKEA  +Y+ C + YS+ SI G +  +P     ++  +  
Sbjct  92   ADCRSCLNDSAAEIARQCPMQKEAIIYYDKCMLRYSNRSIFGVVEISPYWHVWNVNKITN  151

Query  566  NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENC  745
            N  QFNQ L +L+D LR +A +G    K+A  +   P+ QT++  VQCT DL+   C+NC
Sbjct  152  NVDQFNQVLRNLMDGLRDRAASGNSTRKFAVGNATAPNFQTLFGLVQCTEDLTWLQCDNC  211

Query  746  LKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
            L +A         +  IG R L PSC  R+++SPFF  S
Sbjct  212  LVNAIG--KIPCCDQTIGRRYLTPSCNIRFQVSPFFDTS  248



>gb|KDO37598.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=573

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 137/251 (55%), Gaps = 16/251 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQ-  307
            ++  I LS+   S+  AA   DP Y +H C  S N+T NSTY  N N LLSSL  N ++ 
Sbjct  15   FLFVIYLSISFQSSFTAA--ADPTYAYHVC--SANFTGNSTYQTNRNLLLSSLPTNASRG  70

Query  308  ----YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN  475
                 GFYN + GQD  +     LCRGD   S C+ CV+     + Q CP+ K+   WY+
Sbjct  71   NGYSSGFYNETTGQDPNKVYGLFLCRGDQTASSCQDCVTFATRDLVQRCPDGKQTIIWYD  130

Query  476  ICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGG-PFLKY  652
             C + YS+ SI  ++ T P +   +   V + G+FNQ L SL+ ++  QAVN    F   
Sbjct  131  QCLLRYSNRSIFSTMDTVPYVSLLNTQNVTDRGRFNQILASLMSQVVNQAVNNSRKFATR  190

Query  653  AANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA-LWNKSKGNGMIGARVLRPSCFF  829
             AN TA    QT+Y+  QCTPDLS  DC  CL++A A L N   G    GA+VL PSC  
Sbjct  191  TANFTA---LQTLYSLAQCTPDLSSSDCNVCLQAAIAELPNCCSGK--TGAQVLIPSCIV  245

Query  830  RYEISPFFGAS  862
            RYE  PF+  S
Sbjct  246  RYEFYPFYNLS  256



>ref|XP_006373163.1| hypothetical protein POPTR_0017s09260g, partial [Populus trichocarpa]
 gb|ERP50960.1| hypothetical protein POPTR_0017s09260g, partial [Populus trichocarpa]
Length=611

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 136/254 (54%), Gaps = 14/254 (6%)
 Frame = +2

Query  116  MDSQEWIIFILLS-LHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllss  286
            MDS   I+    S + L S +IA     P++ +  C  T  NYT NST   N  + L S 
Sbjct  1    MDSLRLIVLFSFSCILLASLSIA----QPDFLYQSCRNTENNYTANSTFQKNLDSLLSSL  56

Query  287  lsnnvnQYGFYNGSVGQ-DSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
             SN    YG+YN S GQ   ++  A VLCRGD+ L+ CR CVS++  +I Q CPNQKEA 
Sbjct  57   ASNTQIDYGYYNFSAGQIGPDQVHAIVLCRGDILLNECRGCVSNSVRKILQICPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
              Y+ C + YS+ S  G L     +   +     +   F+Q L +L+ RLR  A +G   
Sbjct  117  GIYDFCILRYSNRSSFGVLDEEFIVYTWNRENASHVNLFSQALGNLIIRLRTAAASGTSL  176

Query  644  LKYA-ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWN---KSKGNGMIGARVL  811
            LK+A  N TAG    TI+  VQC PDLS +DC++CL   F         +  G IG R++
Sbjct  177  LKFATGNQTAGI--ITIFGLVQCMPDLSAQDCDDCLAGTFQQIRSCCDGQIEGKIGGRIV  234

Query  812  RPSCFFRYEISPFF  853
            R SC+ R+E  PF+
Sbjct  235  RGSCYLRFETYPFY  248



>ref|XP_006383968.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
 gb|ERP61765.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
Length=621

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 134/248 (54%), Gaps = 14/248 (6%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQ  307
              IF  + LHL S TIA      N         GNYT NS    N  + L S  SN    
Sbjct  2    LFIFSCILLHLASLTIAQTQFCSN-------DVGNYTTNSNFRRNLNSVLSSLDSNTQID  54

Query  308  YGFYNGSVGQDS-ERASAAVLCRGD-VELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
            YGFYN SVGQ   ++A+   LCRGD + +  C++C+ +++  I Q+CPNQKEAF   + C
Sbjct  55   YGFYNLSVGQPGPDQANVIALCRGDNIGIDECQNCIGNSSGNILQFCPNQKEAFGIADTC  114

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-A  658
             + YS++SI G +   P     +     +  QFNQ L +L+ RLR  A +G    K+A  
Sbjct  115  ILRYSNKSIFGVMEDNPVSILVNTVNATDVNQFNQALQTLMSRLRSTAASGNSLRKFATG  174

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
            N TAG D  TI+  VQCTPDLS   C++C+  A  +   +  +G  GAR+  PSC  RYE
Sbjct  175  NETAGFD--TIFGLVQCTPDLSEPQCDDCIAGAIRVI-ATCCDGRQGARITSPSCNLRYE  231

Query  839  ISPFFGAS  862
            +  FFG +
Sbjct  232  VYRFFGVT  239



>ref|XP_007226376.1| hypothetical protein PRUPE_ppa022854mg [Prunus persica]
 gb|EMJ27575.1| hypothetical protein PRUPE_ppa022854mg [Prunus persica]
Length=653

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 146/256 (57%), Gaps = 13/256 (5%)
 Frame = +2

Query  131  WIIF---ILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlntllsslsnn  298
            W +F   +++++++  A I    I   +    C +S GNYT +STY  NLN LLSSL +N
Sbjct  12   WTLFALHVIININITHARIQPPGIPATF----CVSSKGNYTNDSTYQQNLNDLLSSLLSN  67

Query  299  vnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI  478
             N YGFYN S GQ+SE   A  LCRGD +  VC  C+SD A  + + CPNQKEA  +Y  
Sbjct  68   SNGYGFYNSSRGQNSETVYAIGLCRGDAKSDVCGKCLSDAAYVLPEACPNQKEAIGFYRR  127

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQ--NPGQFNQDLTSLVDRLRRQAVNGGPFLKY  652
            C + YS+ S+ G +   P      +  V   N   FN+++++L++ L  +A   G  LK+
Sbjct  128  CMLRYSNRSMFGLVEVNPAFSVRKVKNVSSTNLDAFNREVSALLNALTSEAAGRGDLLKF  187

Query  653  AA-NSTAGPDSQ-TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCF  826
            A  N++ G +S  TIY   QCTP+LS  +C NC   +     ++  +G +GARV  PSC 
Sbjct  188  AVGNASVGANSNVTIYGLAQCTPELSEIECTNCFNVSLGAI-RTCCSGSMGARVATPSCT  246

Query  827  FRYEISPFFGASLING  874
             RYE  PFF ++  +G
Sbjct  247  IRYESHPFFYSTTYHG  262



>gb|KHN01549.1| Cysteine-rich receptor-like protein kinase 26 [Glycine soja]
Length=249

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 104/181 (57%), Gaps = 4/181 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQ---KEAFRWYNI  478
            YGFYN S GQ+ ++ +A  LCRGD++   CRSC++D    +   CPNQ   KE     + 
Sbjct  33   YGFYNFSYGQNEDKVNAIGLCRGDLKPDECRSCLNDARSNLTVNCPNQEEEKEGILHLDK  92

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + YS+ SI G + T+P +   + T   +  QFNQ L +L+  L  +A +G    KYA 
Sbjct  93   CMLRYSNRSIFGVMETSPTLYMWNSTNATDVDQFNQVLQNLMRTLTERAASGDSRRKYAE  152

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMI-GARVLRPSCFFRY  835
             S++ P+ QTI+  VQCTPDLS +DC+ CL         S  NG I G +VL PSC  R+
Sbjct  153  GSSSAPNFQTIHGLVQCTPDLSQQDCKQCLDRVAISQIPSCCNGKIMGGKVLTPSCNARF  212

Query  836  E  838
            E
Sbjct  213  E  213



>ref|XP_003637938.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=538

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 134/247 (54%), Gaps = 22/247 (9%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllsslsnnvnQ  307
            ++F   S  +    ++     P++ ++ C   +GNYT NST  +N    L +  S     
Sbjct  8    LLFSFYSFLILITFVSQAKAQPDFLYNFCINDNGNYTANSTYQNNLNTLLSNLTSKTQIN  67

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ++++ +A  LCRGDV+  +CRSC++D+ V + + CPNQKEA  WY  C +
Sbjct  68   YGFYNFSYGQNTDKVNAIGLCRGDVKPDLCRSCLNDSRVLLTKLCPNQKEAIGWYEDCML  127

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I G                    QFNQ L +L+ +LR  A       K+A  + 
Sbjct  128  RYSNRWIFG------------------VDQFNQVLGNLMRKLREIAALSDSRRKFAT-AN  168

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            A  +  TIY  VQCTPDLS +DC +CL+ A +    S  N  IGAR++ PSC  RYE +P
Sbjct  169  ATLNFGTIYGLVQCTPDLSGQDCNDCLERAISDI-PSCCNNKIGARIINPSCKIRYESNP  227

Query  848  FFGASLI  868
            F+G + +
Sbjct  228  FYGPTTV  234



>ref|XP_007143157.1| hypothetical protein PHAVU_007G048600g [Phaseolus vulgaris]
 gb|ESW15151.1| hypothetical protein PHAVU_007G048600g [Phaseolus vulgaris]
Length=683

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 108/188 (57%), Gaps = 5/188 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI--C  481
            YGFYN + G+ +++  A  LCRGD++ + CR C++ +   + + CPN+KE   WY    C
Sbjct  71   YGFYNFTNGESTDKVYAIGLCRGDIKPNECRRCLNGSRANLTELCPNRKEVIGWYEDERC  130

Query  482  SIYYSHESIIGSLRT-TPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
             + YS  SI G + T  P     ++       +FN+ L  L+D +R +A +G    KYA 
Sbjct  131  MLRYSDRSIFGLMETGKPAYFAWNLGNATQAEEFNKVLRDLLDGMRSRAASGDSQSKYAT  190

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
             +  GPD +TI+   QCTPDLS +DC NCL  +   +     +  IGARV+RPSC  RYE
Sbjct  191  ANATGPDDKTIFGLAQCTPDLSEQDCNNCLIQSMEEFGNC-CDSKIGARVVRPSCNLRYE  249

Query  839  IS-PFFGA  859
             S PF+GA
Sbjct  250  TSFPFYGA  257



>ref|XP_008234279.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Prunus 
mume]
Length=367

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 110/191 (58%), Gaps = 8/191 (4%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++     LCRGDV++ +CR C+S+    + Q CPNQKEAF  ++ C++
Sbjct  71   YGFYNSSYGENPDQVHTIGLCRGDVKVDICRGCLSNATQLLTQVCPNQKEAFGIFDQCTL  130

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             Y++ SI G++ T P +  +++  V  +   F Q+L +L++ LR QA   G   K+A  +
Sbjct  131  RYANRSIYGAMETFPTLMWYNVQNVSSDVDGFFQELRTLLEDLRGQAAGNGSLRKFAVGT  190

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA---LWNKSKGNGMIGARVLRPSCFFRY  835
               P+ QTIY   QC PDL+ ++C  CL S+ A    +   K  G+I     +PSC  RY
Sbjct  191  AIAPNFQTIYGLAQCRPDLTEQNCSYCLGSSMADIPEYFPGKEGGLIS----KPSCDVRY  246

Query  836  EISPFFGASLI  868
            E   FF  + +
Sbjct  247  ETYRFFDPTTV  257



>ref|XP_008234232.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=510

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 106/190 (56%), Gaps = 5/190 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++++   A  LCRGDV    CR C+S++  ++ Q CPNQKEAF +Y+ C +
Sbjct  71   YGFYNSSYGENADEVHAIALCRGDVMGDTCRGCLSNSTQKLTQLCPNQKEAFGFYDECML  130

Query  488  YYSHESIIGSLRTTPEI---EQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
             Y++ S+ G++   P        +++     G F Q+L  L++ L  QA   G   K+A 
Sbjct  131  RYANRSVYGAMEAAPAFWLWNPQNVSSSDVDG-FFQELRRLLEDLSGQAAANGSLRKFAV  189

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYE  838
             +   P+ QTIY   QCTPDL+ + C +CL  A     K    G  G RV+ PSC  RYE
Sbjct  190  GTATAPNFQTIYGLAQCTPDLAEQACSDCLVGALEDIPKC-CEGKQGGRVVNPSCNVRYE  248

Query  839  ISPFFGASLI  868
            IS F+  + +
Sbjct  249  ISRFYDPTTV  258



>ref|XP_008370332.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=338

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 4/184 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S+GQD ++ +A  LCRGDV L+ C +CV+ ++  +   C NQ EA  W   C + 
Sbjct  73   GFYNSSMGQDPDKVNAIALCRGDVSLNNCHTCVNQSSPFLFTNCSNQDEAIVWAERCMVR  132

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            YS + I G     P     S+T   +P +F+  L   +D L  +A +G    KYAA  T 
Sbjct  133  YSSKLIFGIQEDEPIKXVPSLTDAIDPQKFDLVLNLFLDTLTEKAASGDSLKKYAAGHTI  192

Query  671  GPDS---QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
              +S   QTIYA VQCTPDL  ++C +CLK A +      G G  G RVL+PSC  R+E 
Sbjct  193  MQESTTNQTIYALVQCTPDLDKQNCSDCLKGAISKIPDCCG-GKQGGRVLKPSCNLRFEA  251

Query  842  SPFF  853
            + F+
Sbjct  252  TLFY  255



>ref|XP_008219910.1| PREDICTED: uncharacterized protein LOC103320073 [Prunus mume]
Length=1309

 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 108/189 (57%), Gaps = 5/189 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+S+   A  LCRGDV+   C  C+SD    + + CP+QKEA  W   C +
Sbjct  72   YGFYNSSRGQNSDTVFAIGLCRGDVKSDACGKCLSDATYALPEACPDQKEAIGWSPNCML  131

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPG--QFNQDLTSLVDRLRRQAVNGGPFLKYAA-  658
             Y++ S+ G L   P     +   V +     FNQ+LT+L  RL  +A  GG   K+A  
Sbjct  132  RYANRSMYGLLEVNPAYSARNTENVSSASLDAFNQELTALFKRLGSEAAGGGDLRKFAVG  191

Query  659  NSTAGPDSQ-TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
            N++ G +S  TIY   QCTPD+S  +C  C+  AF +   S  +G IG R++ PSC  RY
Sbjct  192  NASVGSNSNITIYGLAQCTPDVSEGECATCIDGAFGVV-PSCCSGSIGVRIVTPSCNIRY  250

Query  836  EISPFFGAS  862
            EISPFF ++
Sbjct  251  EISPFFDST  259


 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 125/214 (58%), Gaps = 5/214 (2%)
 Frame = +2

Query  224  TSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRS  403
            + GNYT NSTY  NL  LLSSL +N N YGFYN S GQ+SE   A  LCRGD +  VC  
Sbjct  686  SKGNYTTNSTYQQNLTDLLSSLLSNSNGYGFYNSSRGQNSETVYAIGLCRGDAKSDVCGK  745

Query  404  CVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQ--NPGQ  577
            C+SD A  + + CPNQKEA  +Y  C + YS+ S+ G +   P      +  V   N   
Sbjct  746  CLSDAAYVLPEACPNQKEAIGFYRRCMLRYSNRSMFGLVEVNPAFSVRKVKKVSSTNLDA  805

Query  578  FNQDLTSLVDRLRRQAVNGGPFLKYAA-NSTAGPDSQ-TIYAYVQCTPDLSVRDCENCLK  751
            FN+++++L++ L  +A   G  LK+A  N++ G +S  TI+   QCTP+LS  +C NC  
Sbjct  806  FNREVSALLNALTSEAAGRGDLLKFAVGNASVGANSNVTIHGLAQCTPELSEIECTNCFN  865

Query  752  SAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             +     ++  +G +GARV  PSC  RYE  PFF
Sbjct  866  VSLGAI-RTCCSGSMGARVATPSCTIRYESHPFF  898



>ref|XP_008441095.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Cucumis 
melo]
Length=1039

 Score =   140 bits (354),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 135/244 (55%), Gaps = 9/244 (4%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnv--nQ  307
            + FIL + HL   T +     P++ +  C  + NYT NST++ NLN +L S+S+N   N 
Sbjct  371  LFFILAAAHLIFPTTSQ----PDFLYRTCSNNSNYTQNSTFNKNLNNVLLSISSNTRFNN  426

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            Y FYN + G D +RA+A  LCRG V L  CR+CV ++ +RI Q CPNQKEA  WY  C I
Sbjct  427  YSFYNATSGHDPDRATALALCRGGVPLEQCRTCVYNSTLRILQDCPNQKEAAVWYQDCQI  486

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK--YAAN  661
             YS+ SI G   +TP+I   +    ++P  FN  L +L+DRLR++A  G   LK  +   
Sbjct  487  RYSNNSIYGVEDSTPQIFFWNFRTAEDPVGFNDALWNLLDRLRKEAALGTSVLKSAWGGE  546

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                     +Y  V C PDLS   C +CL++   +   S  N  IG R++  SC   YE+
Sbjct  547  KIRNRSVDILYGLVDCYPDLSYLGCFDCLRNLQTVI-PSCCNASIGVRLIATSCQLNYEL  605

Query  842  SPFF  853
             P +
Sbjct  606  HPIY  609



>gb|KCW76450.1| hypothetical protein EUGRSUZ_D00842 [Eucalyptus grandis]
Length=631

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 104/187 (56%), Gaps = 3/187 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAV-LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YGFYN S G  S  A  A+ LCRGDV    CRSC++D+A  I + CP QKEA  WY+ C 
Sbjct  66   YGFYNLSAGGGSPDAVNAIGLCRGDVGAVDCRSCLNDSAAEIARQCPVQKEAIIWYDNCV  125

Query  485  IYYSHESIIGSLRTTPEIE-QHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
            + YS+ SI  +   +P    Q+      N  QFNQ L  L+D LR +A NG    K+A  
Sbjct  126  LRYSNRSIFRTEEDSPTFYWQNRKNLTNNVDQFNQILRDLMDGLRDRAANGNSTRKFAVG  185

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +   P+ QT++  VQCTPDLS + C +CL        +   N   G RV+ PSC  R+++
Sbjct  186  NATAPNFQTLFGLVQCTPDLSQQQCSDCLVGTIGKIPQC-CNQKQGGRVITPSCNIRFQV  244

Query  842  SPFFGAS  862
             PFF  S
Sbjct  245  YPFFDPS  251



>ref|XP_007025932.1| Receptor protein kinase isoform 1 [Theobroma cacao]
 ref|XP_007025933.1| Receptor protein kinase isoform 1 [Theobroma cacao]
 gb|EOY28554.1| Receptor protein kinase isoform 1 [Theobroma cacao]
 gb|EOY28555.1| Receptor protein kinase isoform 1 [Theobroma cacao]
Length=279

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 95/186 (51%), Gaps = 6/186 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ  +  +A  LC GD     C SC++  A  + Q CP  KEA  W   C +
Sbjct  66   YGFYNLSAGQSPDEVNAIALCTGDRTQVECNSCLNRTATELMQRCPWYKEATAWSQFCLV  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             Y++  I G L   P     +     NP QFN  L  L++ L   A  GGP  KYAA + 
Sbjct  126  RYANRDIFGQLENEPRTCAFNPKNASNPEQFNDGLIELLNNLSNIAAAGGPLRKYAAGNL  185

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                 QTIYA VQCTPD+  ++C  CL       +K    G +G RVLRP+C  RYE  P
Sbjct  186  -----QTIYAAVQCTPDMDEQNCTACLNYGREELSKC-CKGRLGCRVLRPTCILRYESGP  239

Query  848  FFGASL  865
            F+  ++
Sbjct  240  FYQTAV  245



>ref|XP_007025950.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY28572.1| ATP binding protein, putative [Theobroma cacao]
Length=280

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 131/255 (51%), Gaps = 11/255 (4%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnst--ydnnlntllsslsnnvn  304
            ++IF+LL   L  ++ A     P Y  H C  S ++TPNST   +        S +   +
Sbjct  7    YLIFMLLFTLLSFSSEAT----PTYSAHYCDNSTSFTPNSTYQANIKTLLSSLSSNTRSS  62

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            + GFYN + GQD        LCRGDV  ++C+ CV++    I Q C  +K    WY+ C+
Sbjct  63   KNGFYNTTAGQDPNLVYGTFLCRGDVSANLCQHCVANAINEIAQRCRMEKTGVIWYDECT  122

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLR-RQAVNGGPFLKYAAN  661
            + YS ++I    R  P ++  +   + +  +FNQ L S++  L  R A       ++AA 
Sbjct  123  VQYSDQNIFSISRQVPGMDNSTSASITDKDRFNQLLVSVMKILENRAAYEDKSGKRFAAG  182

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                  SQT+Y+ VQCTPDL+   C  CL+SA A       +G  G RVL PSC  RYE+
Sbjct  183  EANFTSSQTLYSLVQCTPDLTNELCFRCLQSAIATLPMC-CDGKQGGRVLLPSCNIRYEM  241

Query  842  SPFFGASLINGSHST  886
             PF+    +NG+ ST
Sbjct  242  FPFYN---LNGTGST  253



>emb|CBI29181.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   137 bits (344),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 131/238 (55%), Gaps = 6/238 (3%)
 Frame = +2

Query  155  LHLCSATIA----ADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQY-GFY  319
            L LC+  +A    A    P+Y  H C  +    PNSTY  NLN+LLSSLS+N  +  GFY
Sbjct  172  LFLCALGLAISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSNATRANGFY  231

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N + GQ  + A    LCRGDV +  CR CV++ +  I Q C   K+A  WY+ C ++YS+
Sbjct  232  NATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAIIWYDQCMLHYSN  291

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
             SI   +   P ++ +++  V +PG FNQ +   ++     A N     K+A        
Sbjct  292  RSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESGKKFATKEENFTG  351

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            SQT+Y+ VQCTPDLS+ DC  CL+ A    +    +G  GAR L PSC  RYE+ PF+
Sbjct  352  SQTLYSLVQCTPDLSIADCSKCLEGAIGALSLC-CSGKQGARTLTPSCNARYELYPFY  408



>ref|XP_008234245.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=354

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 106/180 (59%), Gaps = 2/180 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++  A  LCRGDV +  CR C+S+   +I Q CPNQKEAF     C++
Sbjct  65   YGFYNLSYGENPDQVYAIGLCRGDVTVDFCRGCLSNATQQITQGCPNQKEAFGVIEQCTL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI G++ T P +  ++   V  +   F+Q+L +L++ LR QA   G   K+A  +
Sbjct  125  RYSNRSIYGAMETFPPLMWYNAQNVPSDVDGFSQELNTLLEDLRGQAAGNGSLRKFAVGT  184

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P+ Q +Y   QCTPDL+ + C +CL S+ A   K    G  GA + +PSC  RYE++
Sbjct  185  ATFPNFQNVYGLAQCTPDLTEQVCSDCLGSSLADIPKIF-EGKQGALISKPSCNVRYEVN  243



>ref|XP_007143156.1| hypothetical protein PHAVU_007G048500g [Phaseolus vulgaris]
 gb|ESW15150.1| hypothetical protein PHAVU_007G048500g [Phaseolus vulgaris]
Length=677

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 109/192 (57%), Gaps = 11/192 (6%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN--IC  481
            YGFYN + G+++++  A  LCRGD++   CR C++D+   + + CPN+KE   WY    C
Sbjct  71   YGFYNFTNGENTDKVYAIGLCRGDIKPDECRRCLNDSRANLTELCPNRKEVIGWYEDEKC  130

Query  482  SIYYSHESIIGSLRT-TPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
             + YS+ SI G + T  P     +        +FN+ L  L+D +R +A +G    KYA 
Sbjct  131  MLRYSNRSIFGLMETGKPAYFVWNSDHATQAEEFNKVLRDLLDGMRSRAASGDSQSKYAT  190

Query  659  NSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGN---GMIGARVLRPSCFF  829
                GPD +TI+   QCTPDLS +DC NCL  +   +    GN     IGARV+RPSC  
Sbjct  191  AKATGPDDKTIFGLAQCTPDLSEQDCNNCLIQSMEEF----GNCCDSKIGARVVRPSCNL  246

Query  830  RYEIS-PFFGAS  862
            RYE S  F+GA+
Sbjct  247  RYETSLQFYGAA  258



>ref|XP_007025964.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28586.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=700

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 99/182 (54%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ SE A+A  LCRGDV    C  C+++ A  ++  C N+KEA  WY  C +
Sbjct  64   YGFYNISSGQGSEGANAIALCRGDVNSGGCLDCINNAATDLRNLCSNEKEAIIWYENCLL  123

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             Y++ SI G   T P     ++  V +   FNQ L +L+D L   A +G    K+A  S 
Sbjct  124  RYTNRSIFGVAETNPSFYMWNVNNVTDLDAFNQALIALMDNLSTNASSGTSLRKFATGSA  183

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
                +QTIYA VQCTPDL+   C +CL  A AL   S  N   G  V  PSC  R++I  
Sbjct  184  EVTAAQTIYALVQCTPDLTRPACSSCLSQAIALL-PSCCNSKQGGMVFGPSCNLRFDIKR  242

Query  848  FF  853
            F+
Sbjct  243  FY  244



>gb|KHN01561.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=650

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 102/184 (55%), Gaps = 2/184 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN--IC  481
            YGFYN S G+++++  A  LCRGDV+   C SC++ +     + CPN+KEA  WY    C
Sbjct  70   YGFYNSSYGENTDKVYAIGLCRGDVKPDECSSCLNVSRTIHTELCPNRKEAIGWYEDEKC  129

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS +SI   +   PE   H++    +  QFN+ L  L+  L+ +A +G   LKYA  
Sbjct  130  MLRYSDQSIFDHMEMGPEFYGHNMDNATDLVQFNKSLNILLGNLKSEAASGDSRLKYAVG  189

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            + +GP ++ IY  VQCTPDL   +C  CLK +     +      IG R +RPSC  R+E 
Sbjct  190  NISGPHNKVIYGLVQCTPDLLQSECAQCLKLSIESIPRDCCKDKIGGRAVRPSCNMRFET  249

Query  842  SPFF  853
            +  F
Sbjct  250  ASLF  253



>ref|XP_003635308.1| PREDICTED: cysteine-rich receptor-like protein kinase 15 [Vitis 
vinifera]
Length=678

 Score =   138 bits (347),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 135/254 (53%), Gaps = 9/254 (4%)
 Frame = +2

Query  104  LE*VMDSQEWIIF--ILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlnt  274
            +E  MD    + F   +L  HL + T+A     P+  +H C  + G Y+ NSTY +NLNT
Sbjct  1    MEMRMDFPRLVFFAYTILIPHLVAVTVA----QPDLVYHNCSENVGTYSNNSTYQSNLNT  56

Query  275  llsslsn-nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQ  451
            LLS+L +     YGFYN S GQ     +A  LCRGD+    C SC++D+ +++ Q CP Q
Sbjct  57   LLSTLFSYKEINYGFYNFSFGQSPNEVNAIALCRGDITQDKCHSCLNDSRLQLPQRCPYQ  116

Query  452  KEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVN  631
             EA   Y+ C + YS+ SI  +L   P     +   V N   FNQ L +L+D LR +A +
Sbjct  117  NEAIGGYDECMLRYSNRSIFRTLEILPSFYVSNPNNVSNEDVFNQALKTLLDSLRSKAAS  176

Query  632  GGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVL  811
            G   LK+A     G   + IY ++QCTPDL+   C  CL+ A        GN   G R+ 
Sbjct  177  GNSLLKFATGEATGTGDKRIYGFMQCTPDLNESSCSICLEGAINDVPACCGNKE-GGRIF  235

Query  812  RPSCFFRYEISPFF  853
            +PSC  R+E   F+
Sbjct  236  KPSCSLRFETFRFY  249



>ref|XP_008387503.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=312

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 137/243 (56%), Gaps = 8/243 (3%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYG  313
            I+ ++++++   A +   ++     +H     GNYT  STY  NLN LL  L +  N YG
Sbjct  16   ILLLIINVNFTQALLGPRDVPI---FHCSNNKGNYTTGSTYQTNLNGLLFDLHSYNNGYG  72

Query  314  FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYY  493
            F+N S G++ +R  A VLCRG ++  +C  C++D A  +++ C NQKEA  W N C + Y
Sbjct  73   FFNSSRGENIDRVYAIVLCRGLIKEDICSKCLTDXANYLREHCTNQKEATGWQNDCMLRY  132

Query  494  SHESIIGSLRTTPEI---EQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            S+ S  G + T P++   +  +++       F+Q+ + L++RL ++A  GG   K+A  +
Sbjct  133  SNRSJYGMMETNPDLYLKDVETLSVSTGLDAFSQESSHLLNRLGQKAATGGDLRKFATGN  192

Query  665  TAGPDSQ-TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
             + P S   IY  VQCTP+LS + C +CL   F ++  S  +  +  R+++P C  RYEI
Sbjct  193  ASLPSSDIXIYGLVQCTPELSEQSCIDCLNYTFXMFG-SCCSVSVXVRIVKPXCGSRYEI  251

Query  842  SPF  850
             PF
Sbjct  252  YPF  254



>emb|CBI41018.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   138 bits (347),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 135/254 (53%), Gaps = 9/254 (4%)
 Frame = +2

Query  104  LE*VMDSQEWIIF--ILLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnstydnnlnt  274
            +E  MD    + F   +L  HL + T+A     P+  +H C  + G Y+ NSTY +NLNT
Sbjct  1    MEMRMDFPRLVFFAYTILIPHLVAVTVA----QPDLVYHNCSENVGTYSNNSTYQSNLNT  56

Query  275  llsslsn-nvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQ  451
            LLS+L +     YGFYN S GQ     +A  LCRGD+    C SC++D+ +++ Q CP Q
Sbjct  57   LLSTLFSYKEINYGFYNFSFGQSPNEVNAIALCRGDITQDKCHSCLNDSRLQLPQRCPYQ  116

Query  452  KEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVN  631
             EA   Y+ C + YS+ SI  +L   P     +   V N   FNQ L +L+D LR +A +
Sbjct  117  NEAIGGYDECMLRYSNRSIFRTLEILPSFYVSNPNNVSNEDVFNQALKTLLDSLRSKAAS  176

Query  632  GGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVL  811
            G   LK+A     G   + IY ++QCTPDL+   C  CL+ A        GN   G R+ 
Sbjct  177  GNSLLKFATGEATGTGDKRIYGFMQCTPDLNESSCSICLEGAINDVPACCGNKE-GGRIF  235

Query  812  RPSCFFRYEISPFF  853
            +PSC  R+E   F+
Sbjct  236  KPSCSLRFETFRFY  249



>ref|XP_003637950.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003638019.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=553

 Score =   136 bits (343),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 128/244 (52%), Gaps = 7/244 (3%)
 Frame = +2

Query  140  FILLSLHLCSATIAADNIDPNYEW--HQCGTSGNY-TPnstydnnlntllsslsnnvnQY  310
            F+ L + L ++   ADN D  + +   Q    GNY T ++  +N    ++    N+   Y
Sbjct  299  FLFLIIILFTSKAKADNNDQKFHYFCDQNNDRGNYITGSAYDNNLKFAIMHLTYNSKIDY  358

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NICS  484
            GFYN + GQ+++  +A  +CRGD+    CR C+  +   + Q CPN+KEA  WY    C 
Sbjct  359  GFYNTNYGQNNDTVNAIGICRGDINPQDCRKCLIGSKFNLTQACPNKKEAIGWYEDEKCM  418

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS  SI+G     P     ++       QFN  +  L++ LR +A+NG    KY    
Sbjct  419  LRYSDRSIMGLNEIGPAYFAWNLNNATMADQFNILVKQLLNDLRSKAINGDSHRKYVVGK  478

Query  665  TAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
              GP S QTIY  VQCTPDLS   C++CL  + A  ++   N  IGAR++RPSC  R+E 
Sbjct  479  MPGPSSDQTIYGLVQCTPDLSGPQCDDCLLQSIAEVSRCCSN-RIGARIIRPSCNLRFET  537

Query  842  SPFF  853
            S  F
Sbjct  538  SYQF  541


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 101/194 (52%), Gaps = 14/194 (7%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWY--NIC  481
            YGFYN + GQ++++ +   +CRGD+    CR C+  +   + Q CPN+KEA  WY    C
Sbjct  70   YGFYNTNYGQNNDKVNVIGICRGDINPQDCRKCLIGSRFNLTQACPNKKEAIGWYEDEKC  129

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS  SI+G     P     +        Q +  +T L++ LR +A+NG    KY   
Sbjct  130  MLRYSDRSILGLNEIGPAYTMWNSNNATMADQLSILVTQLLNDLRSKAINGDSHSKYVVG  189

Query  662  STAGPDS----------QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVL  811
            ++ GP +          +TIY  VQCTPDLS   C++CL  + A    S+ +    AR++
Sbjct  190  TSPGPSNNQSPSQQSSGETIYGLVQCTPDLSGPQCDDCLLQSIA--GISRFSNRSSARMI  247

Query  812  RPSCFFRYEISPFF  853
            RPSC+ R+  S  F
Sbjct  248  RPSCYLRFATSYQF  261



>ref|XP_007208249.1| hypothetical protein PRUPE_ppa016784mg [Prunus persica]
 gb|EMJ09448.1| hypothetical protein PRUPE_ppa016784mg [Prunus persica]
Length=651

 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 109/188 (58%), Gaps = 2/188 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++  A  LCRGDV +  CR C+S+   ++ Q CPNQKEAF     C++
Sbjct  65   YGFYNSSYGENPDQVYAIGLCRGDVTVDNCRGCLSNATQQLTQGCPNQKEAFGVIEQCTL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI G++ T P +  ++   V  +   F Q+L +L++ LR QA   G   K+AA +
Sbjct  125  RYSNRSIYGAMETFPALMWYNPQNVTSDVDGFFQELKTLLEDLRGQAAGNGSLRKFAAAT  184

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
               P+ QTI+   QCTPDL+ + C +CL S+ A   K    GM GA + +PSC  RYE  
Sbjct  185  ATAPNFQTIHGLAQCTPDLTEQVCSDCLGSSLADIPK-YFQGMQGALISKPSCNVRYETY  243

Query  845  PFFGASLI  868
             F   + I
Sbjct  244  RFVDPTTI  251



>ref|XP_003589298.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=319

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 124/243 (51%), Gaps = 5/243 (2%)
 Frame = +2

Query  137  IFILLSLHLCSATIAADNIDP-NYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQY  310
            + I++      A +  D I+  +Y   Q    GNYT NST   N    L +  SN    Y
Sbjct  10   LLIIIFTSQTKADVVYDEINLYHYVCDQDNNRGNYTTNSTYDKNLNTLLSTLTSNTEINY  69

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN--ICS  484
            GFYN S G++S++  A  LCRGD+  + CRSC+S     + + CPN+KEA  W     C 
Sbjct  70   GFYNFSHGENSDKVYAIGLCRGDIMPNSCRSCLSSARTNLTRNCPNRKEAIFWSEDEKCM  129

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
            + YS   I+G +   P     +     +    N+ +T+L++ L  +AV G   +KYAA S
Sbjct  130  LRYSDRLILGVMEDVPMFSSKNENNSSDVDLSNEVVTTLLNNLTSRAVKGDSMIKYAAGS  189

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
              GP  + IY  VQCTPDLS  DC +CL         S  N  IG RV+RPSC  R+E S
Sbjct  190  QPGPQYEVIYGLVQCTPDLSETDCNSCLVENLQQI-PSCCNNKIGGRVVRPSCNMRFETS  248

Query  845  PFF  853
              F
Sbjct  249  YLF  251



>ref|XP_003635160.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
 emb|CBI23446.3| unnamed protein product [Vitis vinifera]
Length=661

 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 132/214 (62%), Gaps = 18/214 (8%)
 Frame = +2

Query  230  GNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCV  409
            GNYT NSTY  +LN+LL+S SNN  +YGFYN SVG+     +   LCRGD+    CRSC+
Sbjct  38   GNYTDNSTYQADLNSLLTSFSNNQVEYGFYNSSVGE----VNGIGLCRGDLTPDTCRSCI  93

Query  410  SDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFN--  583
            + ++  I++ CPN KEA  +Y++C + YS+  I G+ +T+P+   +++   QN    +  
Sbjct  94   NSSSQDIRRLCPNYKEAVLYYDLCMLRYSYRPIFGTAQTSPD---YALVNTQNFSDIDHS  150

Query  584  -QDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKS--  754
             Q+  +L+  L+ +A +GGP  KYA N T+   S+TIYA  QCTPDL  R+C NCL S  
Sbjct  151  TQERDNLLLDLQEKAASGGPLRKYATNETSA-SSETIYALAQCTPDLEDRECSNCLASLI  209

Query  755  -AFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
              +A + K +     G R + PSC +RYEI  F+
Sbjct  210  NTYASFFKYRQ----GGRAMAPSCNYRYEIYSFY  239



>ref|XP_010054432.1| PREDICTED: uncharacterized protein LOC104442733 [Eucalyptus grandis]
Length=1358

 Score =   139 bits (351),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 125/228 (55%), Gaps = 10/228 (4%)
 Frame = +2

Query  194  DPNYEWHQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAV-L  367
            DP Y +  CGT+GN+T N T  DN    L S ++     YGFYN S G  S  A  A+ L
Sbjct  26   DPLYYF--CGTNGNFTANGTYGDNLNALLTSVITATAADYGFYNLSAGSGSADAINAIAL  83

Query  368  CRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQH  547
            CRGDV  + CRSC++D+A  I   CP QKEA  WY+ C + YS+ SI  ++   P     
Sbjct  84   CRGDVGAADCRSCLNDSAPAIAGRCPVQKEAIIWYDNCMLRYSNRSIFRAMEDLPAFGLA  143

Query  548  SITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLS  724
            +   V  N  QFNQ L +L D LR +A NG    K+A  +   P+ QT++  VQCTPDLS
Sbjct  144  NPNNVTNNVDQFNQVLRNLTDGLRDRAANGNSTRKFAVGNATAPNFQTLFGLVQCTPDLS  203

Query  725  VRDCENCLKSAFAL--WNKSKGNGMIGARVLRPSCFFRYEISPFFGAS  862
             + C+NCL +A     W   +     G R + PSC  R+E+  FF  S
Sbjct  204  QQQCDNCLVNAIGKIPWCCDQKQ---GGRYVTPSCNIRFEVYRFFDPS  248


 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 104/187 (56%), Gaps = 3/187 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAV-LCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            YGFYN S G  S  A  A+ LCRGDV    CRSC++D+A  I + CP QKEA  WY+ C 
Sbjct  751  YGFYNLSAGGGSPDAVNAIGLCRGDVGAVDCRSCLNDSAAEIARQCPVQKEAIIWYDNCV  810

Query  485  IYYSHESIIGSLRTTPEIE-QHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
            + YS+ SI  +   +P    Q+      N  QFNQ L  L+D LR +A NG    K+A  
Sbjct  811  LRYSNRSIFRTEEDSPTFYWQNRKNLTNNVDQFNQILRDLMDGLRDRAANGNSTRKFAVG  870

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +   P+ QT++  VQCTPDLS + C +CL        +   N   G RV+ PSC  R+++
Sbjct  871  NATAPNFQTLFGLVQCTPDLSQQQCSDCLVGTIGKIPQC-CNQKQGGRVITPSCNIRFQV  929

Query  842  SPFFGAS  862
             PFF  S
Sbjct  930  YPFFDPS  936



>gb|KHN02662.1| Cysteine-rich receptor-like protein kinase 26 [Glycine soja]
Length=664

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 104/187 (56%), Gaps = 2/187 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ  +R  A  LCRGD +   C  C++++ V + + CPNQK A  W   C +
Sbjct  59   YGFYNFSHGQHPDRVYAIGLCRGDQKPDDCLKCLNNSRVSLAKECPNQKHAIDWGIECML  118

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQ-NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI   + T P +E      V+ +  QFN+ L SL+  L R A +    LKYA  S
Sbjct  119  RYSNRSIFSLMETQPMVELVYTLDVKGSVEQFNEALQSLMRNLTRTAASSDSRLKYATAS  178

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T  P  QTI+ Y QCTPDLS  DC  CL+ A +   +   +G  G  VL+PSC  R++  
Sbjct  179  TPAPSFQTIFGYTQCTPDLSSEDCTKCLEEAISKIPEC-CSGKAGGNVLKPSCRIRFDPY  237

Query  845  PFFGASL  865
             F+G +L
Sbjct  238  VFYGPTL  244



>ref|XP_008245043.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=498

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 138/260 (53%), Gaps = 25/260 (10%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAADNIDPNYEWHQCG-TSGNYTPnstydnnlntllssls  292
            M S  ++ F+   L L S+   A    P +  H C    GNYT  STY  NLNTLLSSLS
Sbjct  1    MASSRFVFFLSPILLLISSQSLAQ---PEFPSHSCFYEKGNYTTGSTYRTNLNTLLSSLS  57

Query  293  nnvnQ---YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
            +  N    YGFYN S G++++   A  LCRGDV    CR C+S++  ++ Q CPNQKEA 
Sbjct  58   SPSNNGNGYGFYNSSFGENADEVHAIALCRGDVRTDTCRGCLSNSTQKLTQVCPNQKEAI  117

Query  464  RWYNICSIYYSHESIIGSLRTTP------EIEQHSITPVQNPGQFNQDLTSLVDRLRRQA  625
             +Y+ C + Y++ SI G++ T P       I+  S + V     F Q++  L+  L  QA
Sbjct  118  GFYDECMLRYANRSIYGAMETAPVFPLWWNIKNLSSSDVDG---FFQEMRKLLKDLIGQA  174

Query  626  VNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAF----ALWNKSKGNGM  793
               G   K+A   T  P+ Q IY   QCTPDL+ + C  CL SA     A   + +    
Sbjct  175  AANGSLRKFAVGKTTAPNLQPIYGLAQCTPDLAEQTCSECLDSAMGNIPAYCERKQ----  230

Query  794  IGARVLRPSCFFRYEISPFF  853
             G RV  PSC  RYE++PF+
Sbjct  231  -GCRVSNPSCTVRYEVNPFY  249



>ref|XP_008377950.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
 ref|XP_008347598.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=306

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 140/260 (54%), Gaps = 17/260 (7%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNID-------PNYEWHQCGTSGNYTPnstydnnlntllssl  289
            +I+ I+L LH   A   AD++D        +Y W   GT+  +   S Y+ NL+T+LSS 
Sbjct  10   FILPIILGLH---APAIADDVDNGVCTTTADYCWSCSGTNETFNNGSNYERNLHTILSSF  66

Query  290  snnvnQY--GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
            S+N  +   GFYN S+GQ  E+ +A  LCRGDV L+ C +C +++   ++Q C NQK+A 
Sbjct  67   SSNKTEINSGFYNSSLGQGPEKVNAMALCRGDVPLNDCHTCFNESISILRQNCTNQKQAT  126

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
             W   C+++YS+ SI G     P       T   N  QF Q L  LV  L   A  G   
Sbjct  127  IWAQRCTVHYSNVSIFGVAEDDPVKFVPGPTNAPNAEQFKQVLNPLVVNLSGTAAAGDSM  186

Query  644  LKYAANSTAGP-DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPS  820
             K+AA     P  +QTIYA VQCTPDL  ++C  CL  A +   +    G  G RVLRPS
Sbjct  187  KKFAAGHALVPATNQTIYAIVQCTPDLDRQNCSECLDEAISDIPQC-CEGKEGGRVLRPS  245

Query  821  CFFRYEISPFFGA---SLIN  871
            C  R+E + F+ A   SL+N
Sbjct  246  CNLRFESNLFYDAASDSLVN  265



>ref|XP_007143160.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris]
 gb|ESW15154.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris]
Length=671

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 109/185 (59%), Gaps = 2/185 (1%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
            +YGFYN S GQ+++   A  LCRGD +   CRSC++++ V I + CPNQK+A  W + C 
Sbjct  61   EYGFYNFSYGQNTDTVYAIGLCRGDQQPEECRSCLNNSRVDITERCPNQKKAILWSDQCM  120

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS+++I   +  +P     +     +  QFN+ L +L+  L   A +G    KYA A 
Sbjct  121  LRYSNDTIFNQMEISPTYYMWNQPNATDANQFNEVLGNLMKSLIDTAASGDSRRKYATAE  180

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +  G + QTIY  VQCTPDLS + C  CL +A +    +  NG IG RVLRPSC  R++ 
Sbjct  181  NATGLNFQTIYGLVQCTPDLSQQRCTQCLDTAISEI-PNCCNGKIGGRVLRPSCNIRFQT  239

Query  842  SPFFG  856
            + F+G
Sbjct  240  NSFYG  244



>gb|EYU27840.1| hypothetical protein MIMGU_mgv1a023015mg, partial [Erythranthe 
guttata]
Length=664

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 101/184 (55%), Gaps = 7/184 (4%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFY+ S GQ  ++ +A VLCR DV  S C  C+ +    + Q CPNQK+A  W+ +C + 
Sbjct  83   GFYSTSAGQTPDKVNALVLCRSDVHYSTCVECIRNATDELLQTCPNQKQAICWHEVCMLR  142

Query  491  YSHESIIGSLRTTPE---IEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
            YS + I G+L        + Q+    V +P  F Q L +L+D L+ QA NGG   K AA 
Sbjct  143  YSDKDIYGTLEAGFGYYWVTQY--VNVTSPVSFKQSLGTLLDGLQYQAANGGSLRKIAAG  200

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +   PD QTIY+ VQCTPDLS  DC  CL     L  +S  NG  G  V  PSC  RYE 
Sbjct  201  NATAPDFQTIYSLVQCTPDLSAYDCITCLIRLRDL--QSYFNGFKGVGVAFPSCTVRYET  258

Query  842  SPFF  853
            +  F
Sbjct  259  NYHF  262



>ref|XP_008441594.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X3 [Cucumis melo]
Length=349

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 98/182 (54%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G    RA    LCRGD+    CR C++D+   +   CP Q EA  WY  C +
Sbjct  88   YGFYNLSSGIPENRAYVIGLCRGDISADSCRRCLNDSRDLLPLRCPTQNEAIGWYVTCML  147

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I+GS+  +P +   +     +   F +   +L+  L   A +G   LK+A  +T
Sbjct  148  RYSNRPILGSMEVSPFVSLSNSVAAPDQAGFTKAARNLIANLIGPASDGDSRLKFAMGNT  207

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              P+  TIY   QCTPDLS + C  CL  A  +  ++  +G +G+RVLRPSC FRYEI  
Sbjct  208  TLPNLPTIYGLAQCTPDLSRQQCNECLVGALPII-RNCCDGKLGSRVLRPSCNFRYEIYS  266

Query  848  FF  853
            F 
Sbjct  267  FI  268



>ref|XP_003555314.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=675

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 100/184 (54%), Gaps = 2/184 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYN--IC  481
            YGFYN S G+++++  A  LCRGDV+   C SC++       + CPN+KEA  WY    C
Sbjct  70   YGFYNSSYGENTDKVYAIGLCRGDVKPDECSSCLNVYRTIRTELCPNRKEAIGWYEDEKC  129

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             + YS  SI   +   P    H++    +  QFN+ L +L+  L+ +A +G   LKYA  
Sbjct  130  MLRYSDHSIFDHMEMGPAFFYHNMYNATDLDQFNKSLNTLLGNLKSEAASGDSRLKYAVG  189

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            +  GPD++ IY  VQCTPDL   +C  CLK +     +      IG R +RPSC  R+E 
Sbjct  190  NIPGPDNKVIYGLVQCTPDLLQSECAQCLKLSIESIPRDCCKDKIGGRAVRPSCNMRFET  249

Query  842  SPFF  853
            +  F
Sbjct  250  ASLF  253



>ref|XP_008347602.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=227

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 119/195 (61%), Gaps = 7/195 (4%)
 Frame = +2

Query  197  PNYEWHQC-GTSGNYTPnstydnnlntllss--lsnnvnQYGFYNGS--VGQDSERASAA  361
            P + +H C   SGNYT NSTY  NLN LLSS   + + N YGFYN S  +   +E   A 
Sbjct  26   PGFLYHFCINESGNYTTNSTYQTNLNRLLSSLPSNESGNGYGFYNASYRLNSSNEHIYAT  85

Query  362  VLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIE  541
             LCRGDV+   CRSC++++   + Q+CPNQKEA  WY+ C + YS+ S+ G + T+P   
Sbjct  86   GLCRGDVKDEDCRSCLNNSRYALPQFCPNQKEAIGWYDNCMLRYSNRSLYGVMETSPSFY  145

Query  542  QHSITPVQNPGQ--FNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTP  715
              ++  + + G   FNQ+L  L+D +R +A  GG   K+A  +T+ P  QTI+A  QCTP
Sbjct  146  MWNMNNISSSGLDGFNQELNKLLDSIRSEAAAGGSLRKFAFRNTSAPTFQTIFALSQCTP  205

Query  716  DLSVRDCENCLKSAF  760
            D+S ++C +CL   F
Sbjct  206  DISEQECSDCLGWGF  220



>ref|XP_007207895.1| hypothetical protein PRUPE_ppa021055mg, partial [Prunus persica]
 gb|EMJ09094.1| hypothetical protein PRUPE_ppa021055mg, partial [Prunus persica]
Length=233

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 103/176 (59%), Gaps = 2/176 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++  A  LCRGDV +  CR C+S+   R+ Q CPNQKEAF     C++
Sbjct  16   YGFYNSSYGENPDQVYAIGLCRGDVTVDNCRGCLSNATQRLTQDCPNQKEAFGVIEQCTL  75

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+ SI G++ T P +  ++   V  +   F Q+L +L++ LR QA   G   K+AA +
Sbjct  76   RYSNRSIYGAMETFPALMWYNPQNVTSDVDGFFQELKTLLEDLRGQAAGNGSLRKFAAET  135

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFR  832
                + QTIY   QCTPDL+ + C +CL S+ A   K    GM GA + +PSC  R
Sbjct  136  ATAINFQTIYGLAQCTPDLTEQVCSDCLGSSLADIPKYF-QGMQGAVISKPSCNVR  190



>ref|XP_008446476.1| PREDICTED: cysteine-rich receptor-like protein kinase 28 [Cucumis 
melo]
Length=1303

 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 94/176 (53%), Gaps = 1/176 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G    RA+   LCRGD+    CR C++D+   +   CP QKEA  WY  C +
Sbjct  729  YGFYNFSYGAGENRANLIGLCRGDISPETCRKCLNDSRDLLPVRCPTQKEAIGWYQDCML  788

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS   I+GS+  +P I         +P +F Q  T L+  L  +A  G   +K++  +T
Sbjct  789  RYSDRPILGSMELSPTIPTGYPFNASDPERFTQAATKLIASLITKASAGDSHVKFSTGNT  848

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
              PD  TIYA+ QCTPDLS R C  CL  A A+       G +  RVL PSC FRY
Sbjct  849  TLPDLPTIYAFAQCTPDLSQRQCNECLTEALAIIQDC-CVGTLWGRVLTPSCLFRY  903


 Score =   125 bits (313),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 117/218 (54%), Gaps = 7/218 (3%)
 Frame = +2

Query  209  WHQCGTSGNYTPnstydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVEL  388
            W      GNYT NS Y  NLN LLS+ + N   YGFYN S G D  +A A  LCRGDV  
Sbjct  39   WFCDNAEGNYTTNSPYKANLNHLLSTFTTNQIDYGFYNLSYGHD-HKAYAIGLCRGDVRP  97

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQN  568
              CRSC++++   +   CP Q  A  WY  C   YS  S+ G+L  +P   +  + PV N
Sbjct  98   DTCRSCLTNSITLLTNNCPTQTNAIVWYEDCFFRYSDRSLFGTLDLSP--TRFVVLPVTN  155

Query  569  ---PGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCE  739
                 +F Q  T L+ +L  +A +G   LKYAA   A P+   +   VQCTPDL+  DC 
Sbjct  156  NVSDARFTQLATDLLQQLTPRAASGDSRLKYAAGRIAVPNFPVLSGAVQCTPDLNSDDCS  215

Query  740  NCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
            NCL ++ A   +   + +   R+++PSC  R++I+  F
Sbjct  216  NCLDASIA-QVRDAYDTVPRVRIMKPSCNIRFDINRLF  252



>ref|XP_008441577.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X1 [Cucumis melo]
Length=374

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 98/182 (54%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G    RA    LCRGD+    CR C++D+   +   CP Q EA  WY  C +
Sbjct  88   YGFYNLSSGIPENRAYVIGLCRGDISADSCRRCLNDSRDLLPLRCPTQNEAIGWYVTCML  147

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I+GS+  +P +   +     +   F +   +L+  L   A +G   LK+A  +T
Sbjct  148  RYSNRPILGSMEVSPFVSLSNSVAAPDQAGFTKAARNLIANLIGPASDGDSRLKFAMGNT  207

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              P+  TIY   QCTPDLS + C  CL  A  +  ++  +G +G+RVLRPSC FRYEI  
Sbjct  208  TLPNLPTIYGLAQCTPDLSRQQCNECLVGALPII-RNCCDGKLGSRVLRPSCNFRYEIYS  266

Query  848  FF  853
            F 
Sbjct  267  FI  268



>ref|XP_008441587.1| PREDICTED: cysteine-rich repeat secretory protein 38-like isoform 
X2 [Cucumis melo]
Length=372

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 98/182 (54%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G    RA    LCRGD+    CR C++D+   +   CP Q EA  WY  C +
Sbjct  88   YGFYNLSSGIPENRAYVIGLCRGDISADSCRRCLNDSRDLLPLRCPTQNEAIGWYVTCML  147

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+  I+GS+  +P +   +     +   F +   +L+  L   A +G   LK+A  +T
Sbjct  148  RYSNRPILGSMEVSPFVSLSNSVAAPDQAGFTKAARNLIANLIGPASDGDSRLKFAMGNT  207

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
              P+  TIY   QCTPDLS + C  CL  A  +  ++  +G +G+RVLRPSC FRYEI  
Sbjct  208  TLPNLPTIYGLAQCTPDLSRQQCNECLVGALPII-RNCCDGKLGSRVLRPSCNFRYEIYS  266

Query  848  FF  853
            F 
Sbjct  267  FI  268



>gb|ACU20179.1| unknown [Glycine max]
Length=225

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G++ ++ +A  LCRGD++   CRSC++D    + Q CPNQKEA  +Y+ C +
Sbjct  65   YGFYNLSYGENEDKVNAIGLCRGDLKPDECRSCLNDARGNLTQRCPNQKEAIIYYDECLL  124

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS  SI G + T+P+    +I    N GQFNQ L +L+  L   A +G    KYAA S 
Sbjct  125  RYSDRSIFGVMETSPDYVLFNIQNATNVGQFNQVLRNLMRMLTGIAASGDSRRKYAAASA  184

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFA  763
               + Q IY  VQCTPDLS  +C++CL  A +
Sbjct  185  TATNIQAIYGLVQCTPDLSQPECKHCLIGAIS  216



>ref|XP_006383966.1| hypothetical protein POPTR_0004s02550g [Populus trichocarpa]
 gb|ERP61763.1| hypothetical protein POPTR_0004s02550g [Populus trichocarpa]
Length=651

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 105/182 (58%), Gaps = 1/182 (1%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S G+ S++  A  LCRGDV+   CR C++ ++  +   CP +KEA   ++ C +
Sbjct  64   YGFYNFSYGESSDKVYAIGLCRGDVKPDACRDCLNYSSRVLTARCPTEKEAIIGFDSCIL  123

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             Y+  SI G     P    +S+T V +   FN+ L SL+D L+ +A  G    KYA    
Sbjct  124  RYASRSIFGLNEVAPYFFVYSLTNVSDEKGFNRSLNSLLDSLQDEAAAGDSRRKYATRKI  183

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
            + P+ QTIYA  QCTPDLS  +C +CL++A A   +       G RV+ PSC FRYEI+ 
Sbjct  184  SAPNFQTIYALSQCTPDLSQTECSSCLRNASARVGQCCQERQ-GGRVIYPSCNFRYEINQ  242

Query  848  FF  853
            F+
Sbjct  243  FY  244



>ref|XP_008439946.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 isoform 
X2 [Cucumis melo]
Length=269

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 130/230 (57%), Gaps = 7/230 (3%)
 Frame = +2

Query  197  PNYEWHQCG-TSGNYTPnstydnnlntllsslsnn-vnQYGFYNGSVGQDSERASAAVLC  370
            PN+  H C   +GN+ PNST+  NL+ +LSS++ N   + GFY  S GQ+S+RA+A  LC
Sbjct  20   PNFISHLCLYKTGNFIPNSTFKANLDHVLSSVTTNGKLENGFYRFSYGQNSDRANAVGLC  79

Query  371  RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHS  550
            R +++L  C+SC++D+   + + CPNQKEA  WY  C ++YS  S+   +  +P     S
Sbjct  80   RPEIKLDACQSCLNDSVRLLTKRCPNQKEAIGWYENCFLHYSSSSLSNQMHISPMFRTQS  139

Query  551  ITPVQNPGQFNQDLTSLVDRLRRQAVNG--GPFLKYAANSTAGPDSQTIYAYVQCTPDLS  724
                 N  QF ++L  L++ L+ +A  G  G   KYAA + +  + +T YA VQC PDL+
Sbjct  140  TKNATNTDQFIRNLRILLNSLKNKASLGDHGSLHKYAAGNMSSSELETTYALVQCLPDLT  199

Query  725  VRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLING  874
             + C++CL S F    K        A +  PSC   Y+ + FF +   +G
Sbjct  200  PQQCDDCLSSIF---KKLPSCCSQSAGIFTPSCLVNYKPTRFFDSVTDDG  246



>ref|XP_010999622.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 [Populus 
euphratica]
Length=674

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 132/254 (52%), Gaps = 14/254 (6%)
 Frame = +2

Query  116  MDSQEWIIFILLS-LHLCSATIAADNIDPNYEWHQC-GTSGNYTPnst-ydnnlntllss  286
            MDS   I+    S + L S +IA     P++ +  C     NYT NST   N  + L S 
Sbjct  1    MDSLRLIVLFSFSCILLASLSIA----QPDFLYQSCRNIENNYTANSTFQKNLDSLLSSL  56

Query  287  lsnnvnQYGFYNGSVGQ-DSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
             SN    YG+YN S GQ   ++  A  LCRGD+ L+ CR CVS++  +I Q CPNQKEA 
Sbjct  57   ASNTQIDYGYYNFSAGQIGPDQVHAIALCRGDILLNECRGCVSNSVRKILQVCPNQKEAI  116

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPF  643
              Y+ C + YS+ S  G L     +   +     +   F+Q L +L  RLR  A +G   
Sbjct  117  GIYDFCILRYSNRSSFGVLDEEFIVYTWNTENASHVNLFSQALVNLTSRLRTAAASGTSL  176

Query  644  LKYA-ANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWN---KSKGNGMIGARVL  811
            LK+A  N TAG    TI+  VQC PDLS  DC++CL   F         +  G IG R++
Sbjct  177  LKFATGNQTAGI--ITIFGLVQCMPDLSAHDCDDCLAGTFQQIRSCCDGQIEGKIGGRIV  234

Query  812  RPSCFFRYEISPFF  853
            R SC+ R+E  PF+
Sbjct  235  RGSCYLRFETYPFY  248



>ref|XP_007143161.1| hypothetical protein PHAVU_007G049000g [Phaseolus vulgaris]
 gb|ESW15155.1| hypothetical protein PHAVU_007G049000g [Phaseolus vulgaris]
Length=685

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 124/218 (57%), Gaps = 5/218 (2%)
 Frame = +2

Query  212  HQCGTSGNYTPnst-ydnnlntllsslsnnvnQYGFYNGSVGQDSERASAAVLCRGDVEL  388
            + C   GNYT NST   N    L +  SN   +YGFYN S GQ+++   A  LCRGD + 
Sbjct  26   YVCDKGGNYTANSTYSTNLNTLLSTLSSNTQIEYGFYNFSYGQNTDTVYAIGLCRGDQQP  85

Query  389  SVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQ-  565
              CRSC++++ V + Q CPNQK+A  W + C + YS+++I     T P     +   V+ 
Sbjct  86   EQCRSCLNNSRVDLTQRCPNQKKAIMWSSECMLRYSNDTIFNQKETFPRYYWWNTAKVRE  145

Query  566  -NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-NSTAGPDSQTIYAYVQCTPDLSVRDCE  739
             +  QFN+ L +L+  LR  A +G    KYAA  +T G + Q IY  VQCTPDLS +DC 
Sbjct  146  VDVDQFNEVLGNLMKSLRDIAASGDSRRKYAAGKNTTGLNFQNIYGVVQCTPDLSQQDCY  205

Query  740  NCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFF  853
             CL  A +    +  NG IG RVL+PSC  R+E + F+
Sbjct  206  QCLDGAISEI-PNCCNGKIGGRVLKPSCNLRFESNSFY  242



>ref|XP_003637954.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003637993.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43974.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=252

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 100/186 (54%), Gaps = 5/186 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNI---  478
            YGFYN + GQ+ ++ +   +CRGD+    CR C+  +   + + CPN+KEA  WY     
Sbjct  66   YGFYNTNYGQNEDKVNLIGICRGDINPEDCRKCLVSSKSYLTEACPNKKEAIGWYEADQK  125

Query  479  CSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA  658
            C + YS  SI+G     P I   ++       QFN  +  L++ L+ +A+NG    KYA 
Sbjct  126  CMLRYSDRSILGLSEMWPAIIWWNVNNATLADQFNSVIKQLLNDLKNKAINGDSHRKYAV  185

Query  659  NSTAGPDS-QTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
             +  GP S QTI   VQCTPDLSV  C++CL  + A   K   N  IG RV R SC  R+
Sbjct  186  GTLPGPSSDQTINGLVQCTPDLSVSQCDDCLNESIAEVPKYCTNK-IGCRVFRASCNLRF  244

Query  836  EISPFF  853
            E   F+
Sbjct  245  ETYQFY  250



>ref|XP_004155666.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Cucumis sativus]
Length=1320

 Score =   137 bits (345),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 135/246 (55%), Gaps = 6/246 (2%)
 Frame = +2

Query  131  WIIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQ-  307
            +++F +L L +  +     N  P++ +H C ++ NYT NS +  NL+ +L S+S+   Q 
Sbjct  11   FMVFFILVLVVQHSMFPTTNSQPDFTYHSCSSNANYTNNSPFKKNLHNVLLSISSKTTQL  70

Query  308  -YG-FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNIC  481
             YG FYN + G+  +RA+A  LCRG V L  CRSCV ++ +RI + CP Q+EA  WY+ C
Sbjct  71   DYGLFYNATSGEYPDRATALALCRGGVSLKQCRSCVYNSTLRITKDCPKQREAEGWYSDC  130

Query  482  SIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             I YS+ SI G L TT +  + +     NP  FN+ L SL D L R+A +G    K A  
Sbjct  131  QIRYSNNSIYGVLDTTIKYVRWNTQKAVNPRGFNKVLRSLFDGLGREAASGSSVQKSAWG  190

Query  662  STAGPDSQT--IYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
                P S    +Y  V C PDLS  DC +CL +    + ++  N  +G R+   SC   Y
Sbjct  191  DKKVPSSNVDIVYGLVDCFPDLSYLDCLDCL-NRLQNFLRTCCNDSMGVRIFGISCQLNY  249

Query  836  EISPFF  853
            + +P +
Sbjct  250  DNTPIY  255


 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 100/187 (53%), Gaps = 7/187 (4%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN + G+D + A+A VLCR    L  CR+C +++  RI+Q CPNQKE   WY  C I
Sbjct  708  YGFYNATSGEDPDTANAKVLCRKGCPLEQCRTCANNSVHRIRQNCPNQKEGAGWYGDCQI  767

Query  488  YYSHESIIGS--LRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN  661
             YS+ S+     L     +    + P QN   FN++L  L+D LR +A +G    K A+ 
Sbjct  768  LYSNNSVHDETDLSAFQILYNTRVAPDQNG--FNEELRDLLDGLRVEAASGTSIRKSASG  825

Query  662  STA--GPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
                  P++ TIY  V C PD+S   C+ CL S       S  +G IGAR++  SC   Y
Sbjct  826  DVKLQNPNTYTIYGLVDCFPDMSFFSCDVCL-SRLQSNLASCCSGSIGARLIATSCQIGY  884

Query  836  EISPFFG  856
            EI P + 
Sbjct  885  EIHPLYA  891



>gb|EYU27838.1| hypothetical protein MIMGU_mgv1a002249mg [Erythranthe guttata]
Length=695

 Score =   135 bits (340),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 136/252 (54%), Gaps = 12/252 (5%)
 Frame = +2

Query  116  MDSQEWII----FILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntlls  283
            M  + W I     +LL   +           P Y    C  +GNYT NSTY  NLNTLLS
Sbjct  1    MSFKSWKITLSKILLLVFFITKIAFVGAQDQPPY---VCLNNGNYTVNSTYSTNLNTLLS  57

Query  284  slsnnvnQYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAF  463
            SLS+N+   GFYN SVG++ + A+A VLCR D  L  CR+CV + AV + + CPN+++A 
Sbjct  58   SLSSNIADNGFYNASVGRNPDTANALVLCRTDRTLDQCRTCVQNAAVGVLEVCPNRRQAV  117

Query  464  RWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNP--GQFNQDLTSLVDRLRRQAVNGG  637
             WY  C + YS+E I  +    P +   +   V +    QF ++ T LV  LR +A NG 
Sbjct  118  IWYEFCMLRYSNEPIFRTPTFDPGLILRNTADVSSSVVDQFRENRTRLVADLRVRAANGS  177

Query  638  PFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRP  817
              +K  A S    +S+T++  VQCTPDLS  DC +CL  A      S   GM   R+L P
Sbjct  178  SAVKGGAGSRNTSNSETLHMLVQCTPDLSSEDCNDCLNRAAQPIGSSSARGM---RLLFP  234

Query  818  SCFFRYEISPFF  853
            SC  RYE+  F+
Sbjct  235  SCNIRYELYSFY  246



>ref|XP_008439945.1| PREDICTED: cysteine-rich receptor-like protein kinase 26 isoform 
X1 [Cucumis melo]
Length=304

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 130/230 (57%), Gaps = 7/230 (3%)
 Frame = +2

Query  197  PNYEWHQCG-TSGNYTPnstydnnlntllsslsnn-vnQYGFYNGSVGQDSERASAAVLC  370
            PN+  H C   +GN+ PNST+  NL+ +LSS++ N   + GFY  S GQ+S+RA+A  LC
Sbjct  20   PNFISHLCLYKTGNFIPNSTFKANLDHVLSSVTTNGKLENGFYRFSYGQNSDRANAVGLC  79

Query  371  RGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSHESIIGSLRTTPEIEQHS  550
            R +++L  C+SC++D+   + + CPNQKEA  WY  C ++YS  S+   +  +P     S
Sbjct  80   RPEIKLDACQSCLNDSVRLLTKRCPNQKEAIGWYENCFLHYSSSSLSNQMHISPMFRTQS  139

Query  551  ITPVQNPGQFNQDLTSLVDRLRRQAVNG--GPFLKYAANSTAGPDSQTIYAYVQCTPDLS  724
                 N  QF ++L  L++ L+ +A  G  G   KYAA + +  + +T YA VQC PDL+
Sbjct  140  TKNATNTDQFIRNLRILLNSLKNKASLGDHGSLHKYAAGNMSSSELETTYALVQCLPDLT  199

Query  725  VRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGASLING  874
             + C++CL S F    K        A +  PSC   Y+ + FF +   +G
Sbjct  200  PQQCDDCLSSIF---KKLPSCCSQSAGIFTPSCLVNYKPTRFFDSVTDDG  246



>ref|XP_007143203.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
 gb|ESW15197.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
Length=682

 Score =   135 bits (339),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 92/243 (38%), Positives = 129/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  146  LLSLHLCSATIAADNIDPNYEWHQCGTS-GNYTPnst-ydnnlntllsslsnnvnQYGFY  319
            +L   LC     A+     Y +  C  S GNYT NST   N +  L +  SN    YGFY
Sbjct  24   MLLFFLCGVLSQAN---AQYLFQSCDNSNGNYTANSTYNTNLITLLSNLSSNTEINYGFY  80

Query  320  NGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYYSH  499
            N S GQ++++ +A  LCRGDVE + CRSC+ D    I Q CPNQKEA  +Y+ C + YS+
Sbjct  81   NFSHGQNADKVNAIGLCRGDVEPNECRSCLKDAGGNITQLCPNQKEATIYYDNCLLRYSN  140

Query  500  ESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTAGPD  679
             SI G L  +P+    +        +FN+ L  L+  L+ +A +G    KYA ++    +
Sbjct  141  HSIFGVLDISPDFYMANPNNATEVVEFNRVLDDLLKELKGKAASGDSRRKYATDNDTTMN  200

Query  680  SQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISPFFGA  859
             QTIY  +QC+PDL+  DC +CL  A      +  +   G RV+ PSC  RYE   F+  
Sbjct  201  FQTIYGLLQCSPDLTQTDCNDCLDEAITRI-PTCCDDRRGGRVVGPSCNIRYENYRFYEQ  259

Query  860  SLI  868
            + I
Sbjct  260  TTI  262



>ref|XP_008224869.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=311

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 110/192 (57%), Gaps = 7/192 (4%)
 Frame = +2

Query  314  FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWC--PNQKEAFRWYNICSI  487
            FYN S+GQ     +A  +CRGDVEL  C +C +D+   + Q C   N++EA  W   C++
Sbjct  79   FYNFSLGQAPNTGNAIAVCRGDVELKDCLTCFNDSVSILLQNCTSTNEQEAIIWAERCTV  138

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANST  667
             YS+ SI+G L   P +   S   V N   +NQ L  L   L  +A  G    K+AA   
Sbjct  139  RYSNVSILGVLEDEPFLYLTSPHNVSNTELYNQVLNPLFKNLSEKAAAGDSLSKFAAGHA  198

Query  668  AGP-DSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
              P  +QTIYA VQC+PDL  ++C  CL+ + +   K  G G+ GARVL+PSC+ R+E +
Sbjct  199  LVPVTNQTIYATVQCSPDLDKQNCSTCLEESISDIRKCCG-GVEGARVLKPSCYLRFESN  257

Query  845  PFF--GA-SLIN  871
            PF+  GA +LIN
Sbjct  258  PFYEPGADTLIN  269



>ref|XP_004155667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208125 
[Cucumis sativus]
Length=1324

 Score =   137 bits (344),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 132/244 (54%), Gaps = 9/244 (4%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnv--nQ  307
            + FIL + H    T +     P++ +  C  + NYT NST+  NL+ +L S+S+N   N 
Sbjct  10   LFFILAAAHFIFPTTS----QPDFLFRTCSNNSNYTKNSTFSKNLSNVLLSISSNTRFNN  65

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            Y FYN + G + +RA+A  LCRG V L  CRSCV ++ +RI Q CP QKEA  WY  C I
Sbjct  66   YSFYNATSGHNPDRATALALCRGGVPLEQCRSCVYNSTLRITQDCPYQKEAAGWYQDCQI  125

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK--YAAN  661
             YS+ SI G   ++P++   ++    +P  FN  L +L+D LR++A  G   LK  +   
Sbjct  126  RYSNNSIYGMEDSSPQVFFWNLRTADDPVGFNDALWNLLDGLRKEAALGSSVLKSAWGGE  185

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                P   T+Y  V C PDLS   C +CL++   +   S  N  IG R++  SC   YE 
Sbjct  186  KIRSPSMDTVYGLVDCYPDLSYLGCFDCLRNLQTII-PSCCNASIGVRLIATSCQLNYEF  244

Query  842  SPFF  853
             P +
Sbjct  245  HPIY  248


 Score =   135 bits (341),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 101/185 (55%), Gaps = 3/185 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YG+YNG+ GQD +RA+A  LCRG VEL  CR CV ++ +RI Q CPNQKEA   Y  C I
Sbjct  707  YGYYNGTSGQDPDRATALALCRGGVELEQCRRCVYNSTLRITQDCPNQKEAEGLYQDCQI  766

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLK--YAAN  661
             YS+ SI G    + ++   ++  V++   FN+ L SL DRL+ +A +G    K  +   
Sbjct  767  RYSNNSIYGVKDNSVQLFLFNLVKVEDWVGFNEALRSLFDRLKMEASSGSSIQKSAWGGE  826

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
                P   T+Y  V C PDLS  DC +CL    A    S  N  IG R+   SC   YE+
Sbjct  827  KVRSPSMDTVYGLVDCFPDLSYLDCFDCLNQLQASL-PSCCNASIGVRLAATSCQLAYEL  885

Query  842  SPFFG  856
             P + 
Sbjct  886  HPVYA  890



>ref|XP_007143169.1| hypothetical protein PHAVU_007G0495001g, partial [Phaseolus vulgaris]
 gb|ESW15163.1| hypothetical protein PHAVU_007G0495001g, partial [Phaseolus vulgaris]
Length=502

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 109/185 (59%), Gaps = 2/185 (1%)
 Frame = +2

Query  305  QYGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICS  484
             YGFYN S GQ+++   A  LC+GDVE   CRSC++++ + +   CPNQK+A  W   C 
Sbjct  58   HYGFYNFSYGQNTDTVYAIGLCKGDVEPEECRSCLNNSRIYLSHRCPNQKKAIMWSGDCM  117

Query  485  IYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-AN  661
            + YS+++I   + T+P     ++  V    QFN+ L +L+  LR  A +G    K A   
Sbjct  118  LRYSNDTIFLKMETSPTYYWWNVGNVTEVDQFNEVLGNLMTSLRDIAASGDSRRKCAGGK  177

Query  662  STAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEI  841
            + +G + QTIY  VQCTP+LS ++C  CL  A +    +  +G IG RVL+PSC  R+EI
Sbjct  178  NISGLNFQTIYGVVQCTPNLSQQECYQCLDVAISEI-PNCCSGKIGGRVLKPSCNIRFEI  236

Query  842  SPFFG  856
              F+G
Sbjct  237  YSFYG  241



>ref|XP_007025946.1| Cysteine-rich protein, putative [Theobroma cacao]
 gb|EOY28568.1| Cysteine-rich protein, putative [Theobroma cacao]
Length=664

 Score =   135 bits (339),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 136/254 (54%), Gaps = 11/254 (4%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntl--lsslsnnvnQ  307
            ++F+LL   L  ++ AA    P Y  H C  S ++TPNSTY  N+  L    S + +  +
Sbjct  8    LVFMLLFTLLSFSSEAA----PTYSSHYCDNSTSFTPNSTYQANIKALLFSLSSNISSGK  63

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
             GFYN + GQD        LCRGDV  ++C+ CV+  +  I + C  +K    WY+ C++
Sbjct  64   NGFYNTTAGQDPNLVYGTFLCRGDVSANLCQDCVASASSEITRRCLMEKMGVIWYDECTV  123

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLR-RQAVNGGPFLKYAANS  664
             YS ++I  ++R  P +++ S   + +  +FNQ L S++  L  R A       K+AA  
Sbjct  124  RYSDQNIFSTVREVPGMDKSSSASITDKDRFNQLLVSVMKILENRAAYEDKSGKKFAAGE  183

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
                 SQT+Y+ VQCTPDL+   C  CL+SA A       +G  G RVL PSC  RYE  
Sbjct  184  ANFTSSQTLYSLVQCTPDLTDALCFRCLQSAIATLPMC-CDGKQGGRVLLPSCNIRYETF  242

Query  845  PFFGASLINGSHST  886
            PF+    +NG+ +T
Sbjct  243  PFYH---LNGTGNT  253



>gb|KHG01974.1| Cysteine-rich receptor-like protein kinase 26 [Gossypium arboreum]
Length=559

 Score =   134 bits (336),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 3/182 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GFYN S GQ SE A+A  LCRGD   S C +C++     ++  CPNQ+EA  WY+ C   
Sbjct  69   GFYNFSSGQGSEMANAIALCRGDASSSDCFNCINSANAELRDRCPNQREAIIWYDYCMFR  128

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYA-ANST  667
            Y++ SI+G++   P     +   V+N   F+Q L SL++ L   A +G    K+A  N+ 
Sbjct  129  YTNHSILGNMEINPIFYMWNENNVRNVAAFSQALGSLLNNLTNTASSGTSLGKFATGNTR  188

Query  668  AGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
             GP SQTIYA +QCTPD+   DC +CL  A  L  K   NG  G RV    C  R++I  
Sbjct  189  VGP-SQTIYALLQCTPDVKQIDCSSCLSQAIGLIPKC-CNGKQGGRVGMAGCNIRFDIER  246

Query  848  FF  853
            F+
Sbjct  247  FY  248



>gb|KDO37425.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=418

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 97/256 (38%), Positives = 136/256 (53%), Gaps = 11/256 (4%)
 Frame = +2

Query  116  MDSQEWIIFILLSLHLCSATIAAD-NIDPNYEWHQCGTSGNYTPnstydnnlntllssls  292
            M   ++ +F L  ++L S   +    +D  Y  H C T+ N+T NSTY+ NLN LLSS+ 
Sbjct  1    MPPLKFFMFSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIP  60

Query  293  nnvnQ-----YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKE  457
             N ++      GF+N + GQD  R     LCRGD   S C+ CV+  A  + Q CP  KE
Sbjct  61   TNASRGNGFSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKE  120

Query  458  AFRWYNICSIYYSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAV-NG  634
               WY  C + YS +SI  ++ T+P +   +   V + G+ N+ + + + ++  QAV N 
Sbjct  121  TILWYAECLLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNT  180

Query  635  GPFLKYAANSTAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLR  814
              F    AN T     QT+Y+  QCTPDLS  DC  CL+ A A    S  +G  G RVL 
Sbjct  181  KRFATRKANFTT---FQTLYSLAQCTPDLSSSDCNTCLRGAVARL-PSCCSGKQGGRVLF  236

Query  815  PSCFFRYEISPFFGAS  862
            PSC  RYE+ PF+  S
Sbjct  237  PSCNVRYELYPFYNES  252



>ref|XP_007224869.1| hypothetical protein PRUPE_ppa022744mg [Prunus persica]
 gb|EMJ26068.1| hypothetical protein PRUPE_ppa022744mg [Prunus persica]
Length=645

 Score =   134 bits (338),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 107/189 (57%), Gaps = 5/189 (3%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+SE   A  LCRGD +  VC  C+SD A  + + CPNQKEA  +Y  C +
Sbjct  51   YGFYNSSRGQNSEIVYAIGLCRGDAKSDVCGKCLSDAAYVLPEACPNQKEAIGFYRRCML  110

Query  488  YYSHESIIGSLRTTPEIEQHSITPVQ--NPGQFNQDLTSLVDRLRRQAVNGGPFLKYAA-  658
             YS+ S+ G +   P      +  V   N   FN+++++L++ L R+A   G  LK+A  
Sbjct  111  RYSNRSMFGLVEVNPAFSVRKVKNVSSTNLDAFNREVSALLNGLTREAAGRGDILKFAVG  170

Query  659  NSTAGPDSQ-TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRY  835
            N+    +S  TIY   QCTP+LS  +C NC   +     ++  +G +GARV  PSC  RY
Sbjct  171  NANVSANSNVTIYGLAQCTPELSEIECTNCFNVSLGAI-RTCCSGSMGARVSTPSCTIRY  229

Query  836  EISPFFGAS  862
            E  PFF ++
Sbjct  230  ESHPFFHST  238



>gb|KGN64567.1| hypothetical protein Csa_1G065380 [Cucumis sativus]
Length=553

 Score =   133 bits (335),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 104/183 (57%), Gaps = 3/183 (2%)
 Frame = +2

Query  311  GFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIY  490
            GF N S G+ S R +A  LCRGD+   VCRSC  D+ + +   CPN+KEA  WY  C   
Sbjct  64   GFLNISYGKGSNRVNAIALCRGDLPQEVCRSCFGDSVLELPTRCPNEKEAVIWYPNCMFR  123

Query  491  YSHESIIGSLRTTPEIEQHSITPVQNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAAN--S  664
            YS+  I G ++  P     +I   Q+   F++ +  L+ ++  +A  G   LK+AA   S
Sbjct  124  YSNRWIFGVVQDAPSFWIWNIEDAQDLQGFSKAVQGLLTQVAEEAALGDSKLKFAAGNVS  183

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
                D  ++Y  VQCTPD+S  +C +CL++  A   +++  G IGAR++RP+C  RYEI 
Sbjct  184  IENEDYSSVYGLVQCTPDISQSECFDCLQT-LAGVVQTRCPGKIGARMMRPNCILRYEIQ  242

Query  845  PFF  853
             FF
Sbjct  243  SFF  245



>gb|KDO75602.1| hypothetical protein CISIN_1g006155mg [Citrus sinensis]
Length=658

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 101/183 (55%), Gaps = 3/183 (2%)
 Frame = +2

Query  308  YGFYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSI  487
            YGFYN S GQ+ ++ +   LCRGD+   VCR C+ +    I + CPNQK+A  W   C +
Sbjct  59   YGFYNESAGQEPDKVNVFALCRGDIATDVCRGCLENATQEILRVCPNQKQAIIWSAECML  118

Query  488  YYSHESIIGSLRTTPEIEQHSITPV-QNPGQFNQDLTSLVDRLRRQAVNGGPFLKYAANS  664
             YS+++I G L T P     ++  V  +   FNQ L  L+ RLR  A +G    K+A   
Sbjct  119  RYSNKTIFGVLETGPTYYMWNVNNVTDDVSLFNQALQDLLRRLRGTAASGNSQKKFATGD  178

Query  665  TAGPDSQTIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEIS  844
            T     +TIYA  QCTPDLS   C +CL  A      +  +G IG RVL+PSC FR+E  
Sbjct  179  TTAS-FRTIYALEQCTPDLSELQCSDCLDRAIGEI-PNCCSGKIGGRVLKPSCNFRFETE  236

Query  845  PFF  853
             F+
Sbjct  237  RFY  239



>ref|XP_008350333.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=683

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 133/243 (55%), Gaps = 6/243 (2%)
 Frame = +2

Query  134  IIFILLSLHLCSATIAADNIDPNYEWHQCGTSGNYTPnstydnnlntllsslsnnvnQYG  313
            I+ ++++++   A +    I   Y ++     GNYT  S Y  NLN+LLS+L +  N YG
Sbjct  43   ILLLIINVNFTQAQLGPHEIPAAYCFN---GKGNYTTGSIYQTNLNSLLSNLFDANNGYG  99

Query  314  FYNGSVGQDSERASAAVLCRGDVELSVCRSCVSDNAVRIKQWCPNQKEAFRWYNICSIYY  493
            FYN S+G++++R  A  LCRGD+    C +C+SD A  + + CP Q+EA  W   C + Y
Sbjct  100  FYNSSLGENNDRVYAIGLCRGDITKEACGTCLSDTANGLTKNCPKQREAIGWLPNCMLRY  159

Query  494  SHESIIGSLRTTPEIEQHSITPVQNP-GQFNQDLTSLVDRLRRQAVNGGPFLKYAANSTA  670
            S+ SI G + T P     ++  V      FNQ+L+ L + L  +A  GG   K A+    
Sbjct  160  SNRSIYGIMETDPAYNAFNVYNVSTGFDAFNQELSRLFNGLGGKAATGGDLRKVASGXAT  219

Query  671  GPDSQ-TIYAYVQCTPDLSVRDCENCLKSAFALWNKSKGNGMIGARVLRPSCFFRYEISP  847
             P S  TIY   Q TPDLS + C +CL+ A      S  NG +G RV+ PSC  RYE+ P
Sbjct  220  IPSSNITIYGLAQXTPDLSEQSCIDCLEYASGGLG-SCCNGSLGVRVVTPSCSLRYELFP  278

Query  848  FFG  856
            F G
Sbjct  279  FVG  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3404794646940