BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24813_g3_i2 len=1935 path=[3103:0-666 12837:667-667 10196:668-750
3769:751-783 849:784-856 3874:857-867 12905:868-877 12915:878-906
3922:907-921 12958:922-930 3946:931-983 3999:984-1149 4165:1150-1254
4270:1255-1278 4294:1279-1493 4509:1494-1521 4536:1522-1606
13448:1607-1631 377:1632-1717 13239:1718-1751 13273:1752-1753
13275:1754-1754 4765:1755-1934]

Length=1935
                                                                      Score     E

ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               728   0.0      
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    727   0.0      
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          725   0.0      
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          719   0.0      
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    712   0.0      
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          711   0.0      
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    711   0.0      
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      708   0.0      
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    704   0.0      
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          704   0.0      
gb|ABC69422.1|  CYP72A58                                                703   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          702   0.0      
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          699   0.0      
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          694   0.0      
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               694   0.0      
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               693   0.0      
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      691   0.0      
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          686   0.0      
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               681   0.0      
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               681   0.0      
emb|CDP19599.1|  unnamed protein product                                680   0.0      
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               678   0.0      
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          676   0.0      
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    674   0.0      
emb|CDP15988.1|  unnamed protein product                                674   0.0      
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    674   0.0      
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               673   0.0      
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      673   0.0      
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    671   0.0      
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          670   0.0      
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          669   0.0      
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          669   0.0      
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               665   0.0      
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               663   0.0      
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          663   0.0      
emb|CDP15976.1|  unnamed protein product                                663   0.0      
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          660   0.0      
gb|ABC69393.1|  CYP72A55v2                                              660   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          660   0.0      
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          660   0.0      
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               659   0.0      
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          659   0.0      
gb|ABC69419.1|  CYP72A56                                                659   0.0      Nicotiana tabacum [American tobacco]
emb|CDP15978.1|  unnamed protein product                                658   0.0      
gb|ABC69392.1|  CYP72A55v1                                              656   0.0      Nicotiana tabacum [American tobacco]
emb|CDP19600.1|  unnamed protein product                                656   0.0      
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    654   0.0      
emb|CDP19609.1|  unnamed protein product                                652   0.0      
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          650   0.0      
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          650   0.0      
emb|CDP15983.1|  unnamed protein product                                649   0.0      
gb|KHN44056.1|  Secologanin synthase                                    649   0.0      
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               648   0.0      Vitis vinifera
emb|CDP15975.1|  unnamed protein product                                647   0.0      
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                646   0.0      
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          645   0.0      
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                645   0.0      
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     643   0.0      
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          643   0.0      
gb|ABC69417.1|  CYP72A54                                                641   0.0      Nicotiana tabacum [American tobacco]
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          640   0.0      
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               640   0.0      
gb|KEH38478.1|  cytochrome P450 family 72 protein                       639   0.0      
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    639   0.0      
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          637   0.0      Vitis vinifera
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    634   0.0      
gb|KHN44057.1|  Secologanin synthase                                    637   0.0      
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    635   0.0      
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          634   0.0      
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          634   0.0      Vitis vinifera
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          634   0.0      
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          633   0.0      Vitis vinifera
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             633   0.0      
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               633   0.0      
ref|XP_010092742.1|  Secologanin synthase                               633   0.0      
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             632   0.0      
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               632   0.0      Vitis vinifera
emb|CDP19601.1|  unnamed protein product                                632   0.0      
emb|CBI22134.3|  unnamed protein product                                632   0.0      
gb|KEH38475.1|  cytochrome P450 family 72 protein                       630   0.0      
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          630   0.0      
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      629   0.0      
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          629   0.0      
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          629   0.0      
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          629   0.0      
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               629   0.0      
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          629   0.0      
gb|ABC69390.1|  CYP72A53v1                                              628   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               627   0.0      
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    626   0.0      
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          626   0.0      
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          626   0.0      
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               626   0.0      
gb|ABC69389.1|  CYP72A52v1                                              625   0.0      Nicotiana tabacum [American tobacco]
dbj|BAF98466.1|  cytochrome P450                                        625   0.0      Coptis japonica var. dissecta
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    626   0.0      
gb|AJD25171.1|  cytochrome P450 CYP72A330                               624   0.0      
emb|CDP11335.1|  unnamed protein product                                624   0.0      
ref|XP_002882888.1|  CYP72A15                                           623   0.0      
emb|CDP15982.1|  unnamed protein product                                623   0.0      
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    623   0.0      
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  623   0.0      Medicago truncatula
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    622   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDP15981.1|  unnamed protein product                                622   0.0      
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               622   0.0      Vitis vinifera
gb|KHN47456.1|  Secologanin synthase                                    623   0.0      
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      622   0.0      
gb|KHN36820.1|  Secologanin synthase                                    620   0.0      
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          621   0.0      
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    617   0.0      
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               621   0.0      
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               620   0.0      Vitis vinifera
gb|AJD25172.1|  cytochrome P450 CYP72A331                               620   0.0      
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             620   0.0      
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               620   0.0      
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          620   0.0      
emb|CAN67740.1|  hypothetical protein VITISV_015554                     620   0.0      Vitis vinifera
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             619   0.0      
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          619   0.0      
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                619   0.0      
gb|AIA82924.1|  SLS1                                                    618   0.0      
emb|CBI39886.3|  unnamed protein product                                619   0.0      
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              618   0.0      
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          617   0.0      
emb|CDP15973.1|  unnamed protein product                                617   0.0      
emb|CDX98484.1|  BnaC05g38910D                                          616   0.0      
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          615   0.0      
emb|CDX97593.1|  BnaA05g24860D                                          615   0.0      
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               615   0.0      Vitis vinifera
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    615   0.0      
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               615   0.0      
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             615   0.0      
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   614   0.0      
gb|KEH38469.1|  cytochrome P450 family 709 protein                      614   0.0      
gb|AJD25168.1|  cytochrome P450 CYP72A327                               614   0.0      
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    614   0.0      
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              613   0.0      
emb|CDX98485.1|  BnaC05g38900D                                          613   0.0      
emb|CDX97592.1|  BnaA05g24870D                                          613   0.0      
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    613   0.0      
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    613   0.0      
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              614   0.0      
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    612   0.0      
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          612   0.0      
gb|AJD25170.1|  cytochrome P450 CYP72A329                               611   0.0      
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          611   0.0      
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              611   0.0      
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          611   0.0      
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             611   0.0      
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               612   0.0      
gb|KHN14193.1|  Secologanin synthase                                    610   0.0      
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        610   0.0      
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    610   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDP15980.1|  unnamed protein product                                610   0.0      
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          609   0.0      
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              609   0.0      
gb|KHG14489.1|  Secologanin synthase                                    609   0.0      
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             609   0.0      
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   608   0.0      
emb|CDX98486.1|  BnaC05g38890D                                          608   0.0      
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              608   0.0      
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    607   0.0      
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              607   0.0      
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                607   0.0      
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    607   0.0      
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    607   0.0      
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          606   0.0      
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    606   0.0      
emb|CDY32348.1|  BnaC01g36670D                                          605   0.0      
emb|CDX97591.1|  BnaA05g24880D                                          605   0.0      
gb|AHK60841.1|  CYP72A225                                               606   0.0      
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    605   0.0      
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             604   0.0      
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        604   0.0      
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              604   0.0      
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    602   0.0      
emb|CDP15979.1|  unnamed protein product                                604   0.0      
ref|XP_010092744.1|  Secologanin synthase                               605   0.0      
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          603   0.0      
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          603   0.0      Vitis vinifera
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                602   0.0      
emb|CDP15985.1|  unnamed protein product                                602   0.0      
emb|CDX82468.1|  BnaA03g33530D                                          603   0.0      
emb|CDY20078.1|  BnaA01g29240D                                          602   0.0      
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              602   0.0      
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              602   0.0      
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             600   0.0      
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               600   0.0      
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    600   0.0      
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              599   0.0      
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          599   0.0      
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    599   0.0      
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          598   0.0      
gb|AJD25169.1|  cytochrome P450 CYP72A328                               598   0.0      
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          598   0.0      
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    598   0.0      
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             598   0.0      
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          597   0.0      
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    597   0.0      
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          596   0.0      
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               596   0.0      
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              596   0.0      
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              596   0.0      
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               597   0.0      
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               596   0.0      
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          595   0.0      
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          595   0.0      
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              595   0.0      
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              594   0.0      
emb|CDY28093.1|  BnaC06g02740D                                          593   0.0      
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          594   0.0      
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              593   0.0      
emb|CDY51036.1|  BnaA06g02990D                                          593   0.0      
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          591   0.0      
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             593   0.0      
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              592   0.0      
gb|KHG18227.1|  Secologanin synthase                                    592   0.0      
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          592   0.0      
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              592   0.0      
emb|CDY51038.1|  BnaA06g03010D                                          592   0.0      
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             592   0.0      
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          592   0.0      
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          592   0.0      
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     591   0.0      
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          591   0.0      
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    593   0.0      
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  590   0.0      Medicago truncatula
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    589   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          589   0.0      
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          589   0.0      
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             589   0.0      
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          589   0.0      
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          589   0.0      
emb|CDX82471.1|  BnaA03g33500D                                          588   0.0      
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          588   0.0      
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    588   0.0      
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    588   0.0      
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          587   0.0      
gb|AEI59772.1|  cytochrome P450                                         588   0.0      
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               588   0.0      
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              587   0.0      
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          587   0.0      
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      587   0.0      
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             586   0.0      
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             587   0.0      
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              586   0.0      
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          586   0.0      
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              586   0.0      
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    586   0.0      
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               586   0.0      
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          586   0.0      
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              586   0.0      
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    582   0.0      
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    585   0.0      
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          585   0.0      
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              584   0.0      
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              583   0.0      
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              584   0.0      
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          583   0.0      
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          583   0.0      
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    584   0.0      
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    583   0.0      
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               583   0.0      
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          583   0.0      
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          582   0.0      
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    583   0.0      
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              582   0.0      
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    582   0.0      
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    582   0.0      
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             582   0.0      
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    582   0.0      
emb|CDY32349.1|  BnaC01g36680D                                          581   0.0      
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like               581   0.0      
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               580   0.0      
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    580   0.0      
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          580   0.0      
gb|KEH38476.1|  cytochrome P450 family 72 protein                       579   0.0      
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  580   0.0      
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          580   0.0      
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          580   0.0      
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      579   0.0      
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    579   0.0      
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          578   0.0      
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like               578   0.0      
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    578   0.0      
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          577   0.0      
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               577   0.0      
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    577   0.0      
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              576   0.0      
emb|CBI39929.3|  unnamed protein product                                573   0.0      
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              576   0.0      
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     575   0.0      
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          575   0.0      
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          575   0.0      
gb|AGX93046.1|  secologanin synthase-like protein                       575   0.0      
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          573   0.0      
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              575   0.0      
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    575   0.0      
gb|KEH37983.1|  cytochrome P450 family 72 protein                       575   0.0      
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          574   0.0      
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    575   0.0      
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    575   0.0      
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          574   0.0      
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              574   0.0      
gb|AGX93044.1|  secologanin synthase-like protein                       574   0.0      
gb|AAA17732.1|  cytochrome P450                                         574   0.0      
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               573   0.0      
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          573   0.0      
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      573   0.0      
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               574   0.0      
gb|KHN44046.1|  Secologanin synthase                                    573   0.0      
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              572   0.0      
emb|CBI39917.3|  unnamed protein product                                570   0.0      
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    572   0.0      
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             571   0.0      
emb|CDP19607.1|  unnamed protein product                                570   0.0      
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    570   0.0      
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                570   0.0      
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          570   0.0      
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          570   0.0      
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          569   0.0      
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    570   0.0      
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              569   0.0      
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              569   0.0      
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              569   0.0      
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    568   0.0      
gb|AJD25167.1|  cytochrome P450 CYP72A326                               569   0.0      
dbj|BAB02396.1|  cytochrome P450                                        568   0.0      
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             569   0.0      
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    569   0.0      
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          569   0.0      
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          567   0.0      
gb|EPS69403.1|  hypothetical protein M569_05363                         567   0.0      
emb|CDP15974.1|  unnamed protein product                                565   0.0      
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    568   0.0      
gb|AGX93064.1|  secologanin synthase                                    568   0.0      
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              567   0.0      
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             566   0.0      
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    567   0.0      
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              568   0.0      
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    566   0.0      
emb|CDX97588.1|  BnaA05g24910D                                          566   0.0      
gb|AGX93049.1|  secologanin synthase-like protein                       566   0.0      
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              566   0.0      
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          566   0.0      
gb|EPS61172.1|  hypothetical protein M569_13627                         565   0.0      
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      565   0.0      
emb|CAN72865.1|  hypothetical protein VITISV_029731                     565   0.0      
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      565   0.0      
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    565   0.0      
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    562   0.0      
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      564   0.0      
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    563   0.0      
emb|CBI39923.3|  unnamed protein product                                561   0.0      
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             563   0.0      
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      563   0.0      
gb|AAA17746.1|  cytochrome P450                                         563   0.0      
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          563   0.0      
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              563   0.0      
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             562   0.0      
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          562   0.0      
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   563   0.0      
gb|AGX93045.1|  secologanin synthase-like protein                       562   0.0      
emb|CBI39916.3|  unnamed protein product                                561   0.0      
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          561   0.0      
gb|ADU19849.1|  putative secologanin synthase                           561   0.0      
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              560   0.0      
gb|AGX93047.1|  secologanin synthase-like protein                       561   0.0      
emb|CDP14360.1|  unnamed protein product                                556   0.0      
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          560   0.0      
emb|CBI39937.3|  unnamed protein product                                558   0.0      
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    560   0.0      
gb|KHN47459.1|  Secologanin synthase                                    560   0.0      
dbj|BAP90521.1|  secologanin synthase                                   560   0.0      
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              560   0.0      
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              560   0.0      
ref|XP_006407056.1|  hypothetical protein EUTSA_v10022214mg             559   0.0      
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           559   0.0      
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          559   0.0      
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    558   0.0      
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          558   0.0      
gb|KFK38818.1|  hypothetical protein AALP_AA3G164500                    558   0.0      
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               557   0.0      
emb|CBI39938.3|  unnamed protein product                                555   0.0      
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          557   0.0      
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               557   0.0      
emb|CDY20075.1|  BnaA01g29270D                                          556   0.0      
gb|EPS65653.1|  hypothetical protein M569_09124                         556   0.0      
emb|CDP15986.1|  unnamed protein product                                555   0.0      
gb|AGX93048.1|  secologanin synthase-like protein                       556   0.0      
gb|EPS70870.1|  hypothetical protein M569_03891                         556   0.0      
ref|XP_006598138.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    551   0.0      
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             555   0.0      
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               555   0.0      
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    553   0.0      
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    554   0.0      
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          553   0.0      
emb|CDX97590.1|  BnaA05g24890D                                          553   0.0      
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    554   0.0      
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          552   0.0      
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          552   0.0      
ref|NP_001043632.1|  Os01g0627500                                       551   0.0      
emb|CDP06076.1|  unnamed protein product                                551   0.0      
ref|XP_010273926.1|  PREDICTED: cytochrome P450 72A15-like              551   0.0      
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               551   0.0      
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          551   0.0      
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    550   0.0      
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       550   0.0      
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          550   0.0      
emb|CDY20076.1|  BnaA01g29260D                                          549   0.0      
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             550   0.0      
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          550   0.0      
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              549   0.0      
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          550   0.0      
gb|EMT23021.1|  Secologanin synthase                                    549   0.0      
ref|XP_009146336.1|  PREDICTED: cytochrome P450 72A15                   548   0.0      
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             548   0.0      
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        548   0.0      
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          548   0.0      
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              548   0.0      
ref|XP_002882887.1|  CYP72A7                                            547   0.0      
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             547   0.0      
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          547   0.0      
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     547   0.0      
ref|XP_010678723.1|  PREDICTED: cytochrome P450 CYP72A219-like          545   0.0      
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               546   0.0      
gb|AFK42047.1|  unknown                                                 545   0.0      
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    546   0.0      
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          544   0.0      
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             544   0.0      
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    544   0.0      
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             543   0.0      
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            545   0.0      
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    543   0.0      
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               543   0.0      
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             543   0.0      
emb|CDX75784.1|  BnaC03g38670D                                          543   0.0      
ref|XP_002458200.1|  hypothetical protein SORBIDRAFT_03g028610          542   0.0      
gb|EAY75042.1|  hypothetical protein OsI_02938                          542   0.0      
ref|XP_010502025.1|  PREDICTED: cytochrome P450 72A13-like isofor...    538   0.0      
ref|XP_004969230.1|  PREDICTED: secologanin synthase-like               541   0.0      
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          541   0.0      
emb|CBI22133.3|  unnamed protein product                                545   0.0      
sp|H1A981.1|C7263_MEDTR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    540   0.0      
ref|NP_001043635.1|  Os01g0627900                                       540   0.0      
ref|XP_009116734.1|  PREDICTED: cytochrome P450 72A13-like isofor...    539   0.0      
gb|AAK38091.1|  putative cytochrome P450                                539   0.0      
gb|AAK38094.1|  putative cytochrome P450                                539   0.0      
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               539   0.0      
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              539   0.0      
emb|CDY65331.1|  BnaC03g73770D                                          535   0.0      
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              539   0.0      
ref|XP_009135391.1|  PREDICTED: cytochrome P450 72A15-like              537   0.0      
ref|XP_004969239.1|  PREDICTED: secologanin synthase-like               537   0.0      
emb|CDX97589.1|  BnaA05g24900D                                          537   0.0      
gb|AAK38092.1|  putative cytochrome P450                                537   0.0      
dbj|BAB87118.1|  cytochrome P450                                        537   0.0      
gb|EYU44092.1|  hypothetical protein MIMGU_mgv1a0044501mg               532   0.0      
ref|XP_006407059.1|  hypothetical protein EUTSA_v10021962mg             536   0.0      
gb|AAQ13549.1|AF123610_5  cytochrome P450                               537   0.0      
ref|XP_010465356.1|  PREDICTED: cytochrome P450 72A13-like              536   0.0      
ref|XP_003628067.1|  Cytochrome P450 monooxygenase CYP72A65             536   0.0      
gb|AAK38090.1|  putative cytochrome P450                                536   0.0      
gb|AAK38093.1|  putative cytochrome P450                                536   0.0      
dbj|BAL45201.1|  cytochrome P450 monooxygenase                          536   0.0      
dbj|BAN19916.1|  cytochrome P450                                        536   0.0      
dbj|BAN19928.1|  cytochrome P450                                        536   0.0      
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg                534   1e-180   
dbj|BAJ99602.1|  predicted protein                                      535   1e-180   
gb|AAQ13551.1|AF123610_7  cytochrome P450                               535   1e-180   
ref|XP_010501999.1|  PREDICTED: cytochrome P450 72A13-like              535   1e-180   
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   534   2e-180   
emb|CDY32351.1|  BnaC01g36700D                                          533   3e-180   
gb|KHG20902.1|  Secologanin synthase                                    532   4e-180   
dbj|BAL45208.1|  cytochrome P450 monooxygenase                          533   6e-180   
gb|ABC59079.1|  cytochrome P450 monooxygenase CYP72A65                  533   6e-180   
ref|XP_009116727.1|  PREDICTED: cytochrome P450 72A13-like isofor...    533   6e-180   
dbj|BAL45202.1|  cytochrome P450 monooxygenase                          533   7e-180   
ref|XP_002455994.1|  hypothetical protein SORBIDRAFT_03g028650          533   8e-180   
ref|XP_006407057.1|  hypothetical protein EUTSA_v10020855mg             528   8e-180   
ref|XP_002456001.1|  hypothetical protein SORBIDRAFT_03g028720          532   1e-179   
ref|XP_003628060.1|  Cytochrome P450 monooxygenase CYP72A65             532   1e-179   
dbj|BAL45205.1|  cytochrome P450 monooxygenase                          532   2e-179   
ref|XP_003527236.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    532   2e-179   
ref|XP_010487265.1|  PREDICTED: cytochrome P450 72A13-like              530   2e-179   
gb|AAQ13548.1|AF123610_4  cytochrome P450                               532   2e-179   
emb|CDP19603.1|  unnamed protein product                                528   2e-179   
ref|XP_007035043.1|  Cytochrome P450, putative                          531   2e-179   
ref|XP_006299368.1|  hypothetical protein CARUB_v10015526mg             531   3e-179   
gb|EAZ12776.1|  hypothetical protein OsJ_02693                          531   4e-179   
ref|XP_006598146.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      529   4e-179   
gb|KHN18291.1|  Secologanin synthase                                    530   8e-179   
gb|EAY75040.1|  hypothetical protein OsI_02936                          530   1e-178   



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/545 (63%), Positives = 420/545 (77%), Gaps = 29/545 (5%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             +++++ T+    I+V L    W VL+WVWF+PKKLEK L++QGLKGN YRIL GDMK+ +
Sbjct  3     KIQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFS  62

Query  354   KMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
              M  +A SKPM +S D+++PR++PF+++ + KYGK C+ WMGPRP++LI DPELIKEVL+
Sbjct  63    GMIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEVLS  122

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K Y YQK   NPLG    +G+  YEKDKWAKHR+IINPAF+ EKLK              
Sbjct  123   KTYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKH-------------  169

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF LSC EMLSKWE +V  +GS E DVWP LQ LTCDVISRT
Sbjct  170   ---------------MLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRT  214

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG++IFELQ+EQ  HF+EV+R VY+PGWRF+PTKRNRRM  I+K+V+SSIRGI
Sbjct  215   AFGSSYEEGRKIFELQQEQTQHFLEVTRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGI  274

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR+KAM+ G  +N+DLLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETT
Sbjct  275   IDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGTETT  334

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV ++WT++LLSR  DWQARAREEVLQV G ++PDF+GLN LKV+TMILYESLRLY PIT
Sbjct  335   SVWILWTLVLLSRCPDWQARAREEVLQVLGSRKPDFDGLNHLKVVTMILYESLRLYSPIT  394

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + RR  E+  LGE+ LP G L+ LP +L+H D +IWGEDA +F P+RFREGI  ATKG+
Sbjct  395   VLTRRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKFNPERFREGISSATKGQ  454

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPF  GPRIC+GQNFA++EAKM + MILQ FSFELSPSY HAP S+VTTQPQ+GAPL
Sbjct  455   VTYFPFAWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQSLVTTQPQYGAPL  514

Query  1791  IIHKL  1805
             I HKL
Sbjct  515   IFHKL  519



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/545 (63%), Positives = 420/545 (77%), Gaps = 29/545 (5%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ++E+I T+     ++ L    W VL+WVWF PKKLEK L++QGL GN YR+L GDMK+L+
Sbjct  3     KIEMIVTICCCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDLS  62

Query  354   KMTTDALSKPMTLSD-NIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
              M  +A SKPM +SD N+APR++PF+++ + KYGK  ++WMGPRP++LI DPELIKEVL+
Sbjct  63    GMIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEVLS  122

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             KNY YQK   NPLG    +G+ +YEKDKWAKHR+IINPAF+ EKLK              
Sbjct  123   KNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKH-------------  169

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF LSC EMLSKWE +V  +GS E DVWP LQ LTCDVISRT
Sbjct  170   ---------------MLPAFYLSCSEMLSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRT  214

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG++IFELQ+EQ  HF+EV R VY+PGWRF+PTKRNRRM  I+K+V+SSIRGI
Sbjct  215   AFGSSYEEGRKIFELQQEQAQHFLEVIRSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGI  274

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR+KAM+ G  +N+DLLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETT
Sbjct  275   IDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETT  334

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV ++WT++LLSR+ DWQARAREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY PIT
Sbjct  335   SVWILWTLVLLSRYPDWQARAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPIT  394

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + RR  E+  LGE+ LP G L+ LP +L+H D +IWGEDA +F P+RFREGI  ATKG+
Sbjct  395   VLARRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGEDANKFNPERFREGISSATKGQ  454

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPF  GPRIC+GQNFA++EAKM + MILQ F FELSPSY HAP S+VTTQPQ+GAPL
Sbjct  455   VTYFPFAWGPRICIGQNFAMLEAKMTVCMILQSFFFELSPSYTHAPQSLVTTQPQYGAPL  514

Query  1791  IIHKL  1805
             I HKL
Sbjct  515   IFHKL  519



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/543 (63%), Positives = 422/543 (78%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +++  T     I + L+   W VL+WVWF+PKKLEK L++QGLKGN YRIL GDMKEL+ 
Sbjct  4     VQITVTASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKELSG  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LSD+IAPR++PF++  + KYGK  +VW+GP+P V + DPELIKEV +KN
Sbjct  64    MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFSKN  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y YQK  +NPL + +A+G+ + E+DKWAKHR+I+ PAF+ EKLK                
Sbjct  124   YLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKH---------------  168

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE IV+ +GS E D+WP LQ LT DVISRTAF
Sbjct  169   -------------MLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPGLQQLTSDVISRTAF  215

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYE G+RIFELQKEQ    +E  R VY+PGWRF+PTKRNRRM  IEK+V++ +RGIID
Sbjct  216   GSSYEAGRRIFELQKEQAQFLMEAIRSVYIPGWRFLPTKRNRRMKEIEKDVQALVRGIID  275

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR+K+M+ GE NN+DLLGILLESN +EI Q G K+FGMSIE+VI+ECK+FYFAGQETTSV
Sbjct  276   KRVKSMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIQECKLFYFAGQETTSV  335

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLSR QDWQA AREEVLQVFG+Q+PDF+GLN LK++TMILYESLRLYPP+  +
Sbjct  336   LLVWTLILLSRHQDWQALAREEVLQVFGNQKPDFDGLNRLKIVTMILYESLRLYPPVVTL  395

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+T LG++ LP G L+ LP +L+H D EIWG+DAK+FKP+RFR+G+  ATKG+  
Sbjct  396   TRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPERFRDGVSSATKGQVT  455

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             FFPF  GPRIC+GQNFA++EAK  +AMILQRFSFELSPSYAHAP S++T QPQ+GAPLI+
Sbjct  456   FFPFTWGPRICIGQNFAMLEAKTTLAMILQRFSFELSPSYAHAPQSIITLQPQYGAPLIL  515

Query  1797  HKL  1805
             HK+
Sbjct  516   HKI  518



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/542 (63%), Positives = 412/542 (76%), Gaps = 29/542 (5%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             +I T+    I++ L    W VL+WVWF+PKKLEK L++QGL GN YR L GDMK+ +KM 
Sbjct  1     MIVTIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMI  60

Query  363   TDALSKPMTLSD-NIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNY  539
              +A SKPM + D ++APR++PF+++ + KYGK C+ WMGPRP++LI DPELIKEVL+K Y
Sbjct  61    KEANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTY  120

Query  540   QYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGAS  719
              YQK   NPLG    +G+ +YEKDKWAKHR+IINPAF+ EKLK                 
Sbjct  121   VYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKH----------------  164

Query  720   LEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFG  899
                         M PAF LSC EMLSKWE +V  +GS E DVWP LQ LTCDVISRTAFG
Sbjct  165   ------------MLPAFYLSCSEMLSKWEDVVRVEGSHEIDVWPHLQQLTCDVISRTAFG  212

Query  900   SSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDK  1079
             SSYEEG++IFELQKEQ  HF+EV R VY+PGWRF+PTKRNRRM  ++ +V+SSIRGIIDK
Sbjct  213   SSYEEGRKIFELQKEQAQHFLEVIRSVYIPGWRFLPTKRNRRMKELKNDVRSSIRGIIDK  272

Query  1080  RMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVM  1259
             R+KAM+ G  +N+DLLGILLESN +EI   G K+FGMSIE+VIEECK+FYFAG ETTSV 
Sbjct  273   RLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVW  332

Query  1260  LVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMD  1439
             ++WT++LLSR  DWQ RAREEVLQV G ++PDF+GLN LKV+TMILYESLRLY PIT + 
Sbjct  333   ILWTLVLLSRHPDWQERAREEVLQVLGSRKPDFDGLNHLKVVTMILYESLRLYSPITVLT  392

Query  1440  RRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVF  1619
             RR  E+  LGE+ LP G L+ LP +L+H D +IWGEDA +F P+RF EGI  ATKG+  +
Sbjct  393   RRVYEDITLGEVSLPTGVLVSLPMILLHHDKDIWGEDATKFNPERFSEGISSATKGQVTY  452

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             FPF  GPRIC+GQNFA++EAKM + MILQ FSFELSPSY HAP S+VTTQPQ+GAPLI H
Sbjct  453   FPFAWGPRICIGQNFAILEAKMTLCMILQSFSFELSPSYTHAPQSLVTTQPQYGAPLIFH  512

Query  1800  KL  1805
             KL
Sbjct  513   KL  514



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/543 (62%), Positives = 418/543 (77%), Gaps = 30/543 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +++  T     I + L+   W VL+WVWF+PKKLEK  ++QGLKGN YRIL GDMKEL+ 
Sbjct  4     VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LSD+IAPR++PF++  + KYGK  +VW+GP+P V I DPELIKEV +KN
Sbjct  64    MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y Y+K  +NPL + +A+G+ + E DKWAKHR+II PAF+ EKLK                
Sbjct  124   YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKH---------------  168

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE IV+ +GS E D+WP LQ L+ DVISRTAF
Sbjct  169   -------------MLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPGLQQLSSDVISRTAF  215

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+RIFELQKEQ  HF++  R +Y+PGWRF+PTKRNRRM  IEK+V++SI GIID
Sbjct  216   GSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNRRMKEIEKDVQASITGIID  275

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR  AM+ GE NN+DLLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV
Sbjct  276   KR--AMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSV  333

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLSR QDWQA+AREEVLQVFG Q+PDF+GLN LK++  +LYESLRLYPP+  +
Sbjct  334   LLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKIVRELLYESLRLYPPVVSL  393

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+T LG++ LP G L+ LP +L+H D EIWG+DAK+FKP+RFR+G+  A KG+  
Sbjct  394   TRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPERFRDGVSSAAKGQVT  453

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPF  GPRIC+G NFA++EAK A+AMILQRFSFELSPSYAHAP S++T QPQ+GAPLI+
Sbjct  454   YFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAHAPQSIITLQPQYGAPLIL  513

Query  1797  HKL  1805
             HK+
Sbjct  514   HKI  516



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/543 (62%), Positives = 416/543 (77%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +++I T     I + L+   W VL+WVWF+PKKLEK L++QGLKGN Y+IL GDMKEL+ 
Sbjct  4     VQIIITASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKELSG  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LSD+IAPR++PF++  + KYGK  +VW+GP+P VLI DPELIKE+ +K 
Sbjct  64    MIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFSKY  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y YQK   NP+ + + +G+ + E+DKWAKHR+IINPAF+ EKLK                
Sbjct  124   YLYQKPHGNPVTKLLVQGLVSLEEDKWAKHRKIINPAFHLEKLKH---------------  168

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EML KWE IVS KGS E DVWP L+ L+ DVISRTAF
Sbjct  169   -------------MLPAFCLSCTEMLCKWEDIVSIKGSHEIDVWPHLEQLSSDVISRTAF  215

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS++EEGKRIFELQKEQ  +F+E  R VY+PGWRF+PTKRNRRM  +EK+V++SIRGIID
Sbjct  216   GSNFEEGKRIFELQKEQAQYFVEAIRSVYIPGWRFLPTKRNRRMKEVEKDVRASIRGIID  275

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR+KAM+ GE +N+DLLGILLESN  E  Q   K+  MSIE+VI+ECK+FY AGQETTSV
Sbjct  276   KRVKAMKAGEASNEDLLGILLESNFTEAEQHRHKDSAMSIEEVIQECKLFYVAGQETTSV  335

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLSR QDWQ+RAREEV QVFG+Q+PDF+GLN LKV+TMILYESLRLY P+  +
Sbjct  336   LLVWTLILLSRHQDWQSRAREEVFQVFGNQKPDFDGLNRLKVVTMILYESLRLYSPVVSL  395

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+  LG + LP G LL LP +L+H D EIWG+DAK+F P+RFR+G+  ATKG+  
Sbjct  396   IRRPNEDAILGNVSLPEGVLLSLPVILLHHDEEIWGKDAKKFNPERFRDGVSSATKGQVT  455

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             FFPF  GPRIC+GQNFA++EAK A+AMILQRFSFELSPSYAHAP S++T QPQHGAPLI+
Sbjct  456   FFPFTWGPRICIGQNFAMLEAKTALAMILQRFSFELSPSYAHAPQSILTMQPQHGAPLIL  515

Query  1797  HKL  1805
             HK+
Sbjct  516   HKI  518



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/543 (62%), Positives = 417/543 (77%), Gaps = 30/543 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +++  T     I + L+   W VL+WVWF+PKKLEK  ++QGLKGN YRIL GDMKEL+ 
Sbjct  4     VQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKELSG  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LSD+IAPR++PF++  + KYGK  +VW+GP+P V I DPELIKEV +KN
Sbjct  64    MIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFSKN  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y Y+K  +NPL + +A+G+ + E DKWAKHR+II PAF+ EKLK                
Sbjct  124   YLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKH---------------  168

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE IV+ +GS E D+WP LQ L+ DVISRTAF
Sbjct  169   -------------MLPAFCLSCTEMLSKWEDIVAVEGSHEIDIWPGLQQLSSDVISRTAF  215

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+RIFELQKEQ  HF++  R +Y+PGWRF+PTKRNRRM  IEK+  S + GIID
Sbjct  216   GSSYEEGRRIFELQKEQAQHFMKAIRSIYIPGWRFLPTKRNRRMKEIEKD--SKVTGIID  273

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR+KAM+ GE NN+DLLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV
Sbjct  274   KRVKAMKAGEVNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSV  333

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLSR QDWQA+AREEVLQVFG Q+PDF+GLN LK++  +LYESLRLYPP+  +
Sbjct  334   LLVWTLILLSRHQDWQAQAREEVLQVFGSQKPDFDGLNRLKIVRELLYESLRLYPPVVSL  393

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+T LG++ LP G L+ LP +L+H D EIWG+DAK+FKP+RFR+G+  A KG+  
Sbjct  394   TRRPKEDTVLGDVSLPAGVLISLPVILLHHDEEIWGKDAKKFKPERFRDGVSSAAKGQVT  453

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPF  GPRIC+G NFA++EAK A+AMILQRFSFELSPSYAHAP S++T QPQ+GAPLI+
Sbjct  454   YFPFTWGPRICIGLNFAMLEAKTALAMILQRFSFELSPSYAHAPQSIITLQPQYGAPLIL  513

Query  1797  HKL  1805
             HK+
Sbjct  514   HKI  516



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/541 (61%), Positives = 421/541 (78%), Gaps = 30/541 (6%)
 Frame = +3

Query  189   YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTD  368
             Y L+   +++  + YAW +LDW WF P+KLEK L+QQGLKGN Y+++ GD+KEL+K   D
Sbjct  6     YFLVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELSKSIED  65

Query  369   ALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             A SKP+ +SD+ + PR++P++VQ + KYGK+C++W+GP+P V++ DPE+I++V NK+  Y
Sbjct  66    AESKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFNKHALY  125

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK ++ PL + +A+G+ +YE+DKWAKHR+I+NPAF+ EK+K+                  
Sbjct  126   QKPKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKD------------------  167

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVISRTAFGS  902
                       M  A LLSC EM+++WE  VS K  S E D+WP LQ LT DVISRTAFGS
Sbjct  168   ----------MLQAVLLSCSEMVNQWEEAVSMKESSTELDIWPYLQRLTSDVISRTAFGS  217

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             +YEEG++IFELQKEQ  H IEVSR +Y+PGWRF+PTKRNRRM  IE+EV+++IRGIIDKR
Sbjct  218   NYEEGRKIFELQKEQAEHVIEVSRTLYIPGWRFLPTKRNRRMKEIEREVQATIRGIIDKR  277

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             +K M+ GE N DDLLGILLESN +EI Q G K FGM+I++VIEECK+FYFAGQETTSV L
Sbjct  278   VKGMKAGEANTDDLLGILLESNFKEIEQHGNKNFGMTIKEVIEECKLFYFAGQETTSVWL  337

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTMILLSR  DWQ RAREEVLQVFGD  P F+GLN LKV+TMIL+ESLRLYPP++ + R
Sbjct  338   VWTMILLSRHPDWQVRAREEVLQVFGDGMPGFDGLNRLKVVTMILHESLRLYPPVSALGR  397

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
             R   +TKLGE+ LP G +L LPT+L+H D EIWGEDA EFKP+RF EGI KATKG+  FF
Sbjct  398   RITTKTKLGELNLPAGVMLSLPTILVHHDKEIWGEDATEFKPERFSEGISKATKGQMTFF  457

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRIC+G NFA++EAKM MAMILQRF+FELSPSY HAP S++T QP++GAPL++H+
Sbjct  458   PFGAGPRICIGLNFAMIEAKMTMAMILQRFAFELSPSYTHAPQSVITMQPKYGAPLVLHR  517

Query  1803  L  1805
             L
Sbjct  518   L  518



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/544 (62%), Positives = 413/544 (76%), Gaps = 31/544 (6%)
 Frame = +3

Query  183   VIYTLLGVC--ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             V + ++  C  I++ LL   W VL+W+WF+PKKLEK LK+QG+KGN Y IL GD KEL+ 
Sbjct  4     VQFIVISSCSAIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSL  63

Query  357   MTTDALSKPMTL-SDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
                +  SK M+L  D+IA R +PF++  + KYGK  ++W+GP+P V I DP+LIKEV  K
Sbjct  64    RIKEVTSKSMSLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTK  123

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y YQK +TNPL + +A+G+   E DKWAKHR+IINPAF+ EKLK               
Sbjct  124   TYIYQKTKTNPLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKH--------------  169

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF LSC EMLSKWE IVS + + E DVWP LQ LT DVISRTA
Sbjct  170   --------------MLPAFCLSCTEMLSKWEDIVSVERAYEIDVWPHLQQLTSDVISRTA  215

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG+RIFELQ EQ  +FIE  R VY+PGW F+PTKRNRRM  IE+ V+++IRGII
Sbjct  216   FGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIERHVQATIRGII  275

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             DKR+KAM+GGE NN+DLLGILLESN +EI Q G K FG+SIE+VIEECK+FYFAGQETTS
Sbjct  276   DKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFGLSIEEVIEECKLFYFAGQETTS  335

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWT+ILL R  DWQ RAREEVLQVFG+++PDF+GLN LKV+TMILYESLRLYPP+  
Sbjct  336   ALLVWTLILLCRHHDWQTRAREEVLQVFGNRKPDFDGLNHLKVVTMILYESLRLYPPVMT  395

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + RR  E+T LG++ LP G LL LP +L+H D EIWGEDAK+F P+RFREG+  ATKG+ 
Sbjct  396   VTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHDEEIWGEDAKKFNPERFREGVSSATKGQV  455

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPF  GPRIC+GQNFA++EAKM +AMILQRFSF+LS SYAHAP+S++TTQPQ+GAPLI
Sbjct  456   TFFPFTWGPRICIGQNFAMLEAKMVLAMILQRFSFDLSSSYAHAPHSVITTQPQYGAPLI  515

Query  1794  IHKL  1805
             +H+L
Sbjct  516   LHRL  519



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/543 (63%), Positives = 425/543 (78%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +++  T     I + LL   W VL+W+WF+PKKLE  L++QGL+GN Y++L GDMKE + 
Sbjct  5     LQMTVTASCAAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSG  64

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM+LSD++APR++PF+++ + KYGK  ++W GPRP VLI DPELIKEVL+K 
Sbjct  65    MIKEAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKI  124

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             + YQK   NPL   + +G+A YE+DKWAKHR+IINPAF+ EKLK                
Sbjct  125   HLYQKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLK----------------  168

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         LM PAF LSC EMLSKWE IVS   S E DVW  L+ LTCDVISRTAF
Sbjct  169   ------------LMLPAFRLSCSEMLSKWEDIVSADSSHEIDVWSHLEQLTCDVISRTAF  216

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG++IFELQKEQ  + +EV R VY+PG RF+PTKRNRRM  I+K+V++SI+GIID
Sbjct  217   GSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNRRMKEIKKDVRASIKGIID  276

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR+KAM+ G+TNN+DLLGILLESN++EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV
Sbjct  277   KRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSV  336

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +L+W+++LLSR+QDWQARAREE+LQVFG ++PDF+GLN LK++TMILYESLRLYP +  +
Sbjct  337   LLLWSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKIVTMILYESLRLYPSLITL  396

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+  LGE+ LP G L+ LP +L+H D EIWGEDAKEFKP+RFREGI  ATKG+  
Sbjct  397   TRRCNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEFKPERFREGISSATKGQLT  456

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPF  GPRIC+GQNFA++EAKMA++MILQRFSFELSPSYAHAP S++T QPQ+GAPLI 
Sbjct  457   YFPFSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAHAPRSIITVQPQYGAPLIF  516

Query  1797  HKL  1805
             HKL
Sbjct  517   HKL  519



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/540 (63%), Positives = 424/540 (79%), Gaps = 30/540 (6%)
 Frame = +3

Query  192   TLLGVC--ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             T+   C  I + LL   W VL+W+WF+PKKLE  L++QGL+GN Y++L GDMKE + M  
Sbjct  2     TVTASCAAIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIK  61

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A SKPM+LSD++APR++PF+++ + KYGK  ++W GPRP VLI DPELIKEVL+K + Y
Sbjct  62    EAYSKPMSLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLY  121

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK   NPL   + +G+A YE+DKWAKHR+IINPAF+ EKLK                   
Sbjct  122   QKPGGNPLATLLVQGIATYEEDKWAKHRKIINPAFHLEKLK-------------------  162

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                      LM PAF LSC EMLSKWE IVS   S E DVW  L+ LTCDVISRTAFGSS
Sbjct  163   ---------LMLPAFRLSCSEMLSKWEDIVSADSSHEIDVWSHLEQLTCDVISRTAFGSS  213

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG++IFELQKEQ  + +EV R VY+PG RF+PTKRNRRM  I+K+V++SI+GIIDKR+
Sbjct  214   YEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPTKRNRRMKEIKKDVRASIKGIIDKRL  273

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLV  1265
             KAM+ G+TNN+DLLGILLESN++EI Q G K+FGMSIE+VIEECK+FYFAGQETTSV+L+
Sbjct  274   KAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLL  333

Query  1266  WTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRR  1445
             W+++LLSR+QDWQARAREE+LQVFG ++PDF+GLN LK++TMILYESLRLYP +  + RR
Sbjct  334   WSLVLLSRYQDWQARAREEILQVFGSRKPDFDGLNHLKIVTMILYESLRLYPSLITLTRR  393

Query  1446  TVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFP  1625
               E+  LGE+ LP G L+ LP +L+H D EIWGEDAKEFKP+RFREGI  ATKG+  +FP
Sbjct  394   CNEDIVLGELSLPAGVLVSLPLILLHHDEEIWGEDAKEFKPERFREGISSATKGQLTYFP  453

Query  1626  FGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F  GPRIC+GQNFA++EAKMA++MILQRFSFELSPSYAHAP S++T QPQ+GAPLI HKL
Sbjct  454   FSWGPRICIGQNFAMLEAKMALSMILQRFSFELSPSYAHAPRSIITVQPQYGAPLIFHKL  513



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 419/544 (77%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME+ Y ++    +V  + Y W +L+W WF+P+KL++ L+QQGLKGN Y+++ GD+KEL+K
Sbjct  1     MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  357   MTTDALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
                +A SKP+ +SD+ I PR++P++++ + KYGK+ ++W+GP P V +RDP+++K+VL K
Sbjct  61    SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
             +  YQK ++ PL R +A+G+ +YE+DKWAKHR+I+NPAF+ EK+K               
Sbjct  121   HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PA  LSC EM+S+W+   S KGSCE D+WP LQ L+ D ISRTA
Sbjct  167   --------------MLPAIQLSCSEMVSQWKEAASVKGSCELDIWPYLQRLSSDAISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGS+YEEG++IFELQKEQ  H I +S  +Y+PGWRF+PTKRNRRM  IEKEV++++RGII
Sbjct  213   FGSNYEEGRKIFELQKEQAEHVIAISSTLYIPGWRFMPTKRNRRMKEIEKEVQATVRGII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             DKR+K M+ GE N DDLLGILL+SN +EI Q G K FGMS ++VIEECK+FYFAGQETTS
Sbjct  273   DKRVKTMKAGEANADDLLGILLDSNFKEIEQHGSKNFGMSTQEVIEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTM+LLSR  +WQARAREEVLQVFGD   +F+GLN LK++TMIL+ESLRLYPP+  
Sbjct  333   VLLVWTMVLLSRHPEWQARAREEVLQVFGDGMLEFDGLNRLKIVTMILHESLRLYPPVGA  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + RR   +TKLGE+ LP G +L LP LL+H D EIWGEDAKEFKP+RF EG+ KATKG+ 
Sbjct  393   LGRRITTKTKLGELNLPAGVMLSLPMLLVHHDEEIWGEDAKEFKPERFSEGVSKATKGQM  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPRIC+G NFA++EAKMAMAMILQRFSFELSPSY HAP S++T QPQ+GAPLI
Sbjct  453   TFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFSFELSPSYTHAPQSVITMQPQYGAPLI  512

Query  1794  IHKL  1805
             +HKL
Sbjct  513   LHKL  516



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/534 (62%), Positives = 402/534 (75%), Gaps = 29/534 (5%)
 Frame = +3

Query  207   CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPM  386
              I++ LL   W VL+W+WF+PKKLEK LK+QG+KGN Y IL GD KEL+    +  SK M
Sbjct  14    VIAITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSM  73

Query  387   TL-SDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             ++  D+IAPR +PF++  + KYGK  ++W+GP+P V I DP+LIKEV  K Y YQK +TN
Sbjct  74    SVYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTN  133

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL + +A+G+   E DKWAKHR+IINPAF+ EKLK                         
Sbjct  134   PLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKH------------------------  169

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                 M PAF LSC EMLSKWE +VS + S E DVWP LQ LT DVISRTAFGSSYEEG+R
Sbjct  170   ----MLPAFYLSCTEMLSKWEDVVSVERSHEIDVWPHLQQLTSDVISRTAFGSSYEEGRR  225

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IFELQ EQ  +FIE  R VY+PGW F+PTKRNRRM  IEK V+++IRGIIDKR+KAM GG
Sbjct  226   IFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIEKHVQATIRGIIDKRVKAMTGG  285

Query  1104  ETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILL  1283
             E NN DLLGILLESN +EI+Q G K+FG+SIE+VIEECK+FYFAGQETTS +LVWT+ILL
Sbjct  286   EANNKDLLGILLESNFKEIKQHGDKDFGLSIEEVIEECKLFYFAGQETTSALLVWTLILL  345

Query  1284  SRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETK  1463
              R  DWQ RAR EVLQVFG ++PDF+GL  LKV+TMILYESLRLYPP+T + RR  E+  
Sbjct  346   CRHHDWQTRARTEVLQVFGSRKPDFDGLTHLKVVTMILYESLRLYPPVTTVTRRLNEDAV  405

Query  1464  LGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPR  1643
             LG+I LP   LL LP +L+H D EIWGEDAK+F P+RFREG+  ATKG+  FFPF  GPR
Sbjct  406   LGDISLPADVLLSLPAVLLHHDEEIWGEDAKKFNPERFREGVSSATKGQVTFFPFTWGPR  465

Query  1644  ICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             IC+GQNFA++EAKM +AMILQRFS +LS SY HA +S++TTQPQ+GAPLI+HKL
Sbjct  466   ICIGQNFAMLEAKMVLAMILQRFSLDLSTSYTHALHSVITTQPQYGAPLILHKL  519



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/546 (60%), Positives = 421/546 (77%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVI-YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++ Y L+   +++  + YAW +LDW WF+P+KL+K L+QQGLKGN Y+++ GD+KEL+
Sbjct  1     MEIVAYFLVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELS  60

Query  354   KMTTDALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   DA SKP+ +SD+ + PR++P++VQ + KYGK+C++W+G +P V++ DPE+I++V N
Sbjct  61    KSIEDAESKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFN  120

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K+  YQK ++ PL + +A+G+ +YE+ KWAKHR+I+NPAF+ EK+K+             
Sbjct  121   KHALYQKPKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKD-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVISR  887
                            M  A  LSC EM+S+WE  VS K  S E D+WP LQ LT DVIS 
Sbjct  168   ---------------MLQAVHLSCSEMVSQWEEAVSMKESSTELDIWPYLQRLTSDVISH  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+YEEG++IFELQKEQ  H I VSR +Y+PGWRF+PTKRNRRM  IE +V+++IRG
Sbjct  213   TAFGSNYEEGRKIFELQKEQAEHVIAVSRTLYIPGWRFLPTKRNRRMKEIEGKVQTTIRG  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR+K ++ GE N DDLLGILLESN +EI Q G K+FGM+I++VIEECK+FYFAGQET
Sbjct  273   IIDKRVKGIKAGEANTDDLLGILLESNFKEIEQHGNKDFGMTIKEVIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTMILLSR  DWQ RAREEVLQVFGD  P F+GLN LKV+TMIL+ESLRLYPP+
Sbjct  333   TSVLLVWTMILLSRHPDWQVRAREEVLQVFGDGMPGFDGLNRLKVVTMILHESLRLYPPV  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + RR   +TKLGE+ LP G +L LPT+L+H D EIWGEDA EFKP+RF EGI KATKG
Sbjct  393   GALGRRITTKTKLGELNLPAGVMLSLPTILVHHDKEIWGEDATEFKPERFNEGISKATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFG GPRIC+G NFA++EAKMAMAMILQRF+FELSP Y HAP S++T QP++GAP
Sbjct  453   QMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAFELSPLYTHAPQSVITMQPKYGAP  512

Query  1788  LIIHKL  1805
             L++HKL
Sbjct  513   LVLHKL  518



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/545 (62%), Positives = 418/545 (77%), Gaps = 33/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME I  ++ +C     +   W VL+WVWF PKKLE  L++QGLKGN YR+L GDMK++ +
Sbjct  1     METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTR  60

Query  357   MTTDALSKPMTLSD-NIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             M  +A SKPM +SD ++APR++PF+++ +NKYGK C+ WMGP+P+VLI DPELIKEVL+K
Sbjct  61    MIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y YQK   NPLG    +G+ +YEKDKWAK+R+IINPAF+ EKLK               
Sbjct  121   TYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF LSC EMLSKWE +   +GS E DVWP LQ LT DVISRTA
Sbjct  167   --------------MLPAFYLSCSEMLSKWEDV---EGSHEIDVWPHLQQLTSDVISRTA  209

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG++IFELQ EQ  HFIE  R VY+PGWRF+PTKRNRRM  I+K+V+S IRGII
Sbjct  210   FGSSYEEGRKIFELQNEQVPHFIEAMRSVYIPGWRFLPTKRNRRMKEIKKDVRSLIRGII  269

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETT  1250
             DKR+KAM+ G+ +N+DLLGILLESN +EI QQGG K+FGMSI+++IEECK+FYFAG ETT
Sbjct  270   DKRLKAMEAGDADNEDLLGILLESNFKEIEQQGGNKDFGMSIDEIIEECKLFYFAGSETT  329

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV L+WT++LLSR+QDWQA+AREEVLQVFG ++PDF GLN LKV+TMILYESLRLY P+T
Sbjct  330   SVWLLWTLVLLSRYQDWQAQAREEVLQVFGSRKPDFNGLNRLKVVTMILYESLRLYSPVT  389

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R  +E+  LGE+ LP G L+ LPT+++H D EIWGEDA +F P+RFREGI  ATKG+
Sbjct  390   TLTRLAIEDITLGEVSLPAGVLVSLPTVILHHDKEIWGEDANKFNPERFREGISSATKGQ  449

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPF  GPRIC+GQNFA++EAKMA++MILQ FSFELSPSY HAP   VT QPQ+GAPL
Sbjct  450   VTYFPFSWGPRICIGQNFAMLEAKMALSMILQTFSFELSPSYTHAPQYSVTVQPQYGAPL  509

Query  1791  IIHKL  1805
             I HKL
Sbjct  510   IFHKL  514



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/546 (59%), Positives = 416/546 (76%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVI-YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++ Y L+   +++  + YAW +LDW WF+P+KLEK L++QGLKGN Y+++ GD+KELA
Sbjct  1     MEIVAYYLVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  354   KMTTDALSKPMTL-SDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   D  SKP+ +  D+I PR++P++V  + K+GK+C++W+GP+P VL+ D E+I++V N
Sbjct  61    KSFEDVKSKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFN  120

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K   YQK +  PL + +A+G+A+YE+DKWA HR+I+NPAF+ EK+K              
Sbjct  121   KYVLYQKPKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKN-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISR  887
                            M PA  LSC EM+S+WE  +S KG SCE D+WP LQ L+ DVISR
Sbjct  168   ---------------MVPAIHLSCTEMVSQWEESISTKGTSCEIDIWPYLQKLSSDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+YEEG+ IFELQKEQ  HFIE +R +Y+ G RF+PTK+NRRM  I+K V++ IRG
Sbjct  213   TAFGSNYEEGRMIFELQKEQAQHFIEATRTLYILGSRFLPTKKNRRMKEIDKNVQAMIRG  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR+KA++ GE N DDLLG+LLESN ++I Q G K+FGMS  ++IEECK+FYFAGQET
Sbjct  273   IIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHGNKDFGMSTREIIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTMILLSR  DWQ RAREEVLQVFGD + +F+GLN LK++TMIL ESLRLYPP 
Sbjct  333   TSVLLVWTMILLSRHLDWQTRAREEVLQVFGDSKLEFDGLNRLKIVTMILNESLRLYPPA  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               ++R+T   TKLGE+ LP G +L+LP +L+H D EIWGEDA EFKP+RF EG+ KATKG
Sbjct  393   DSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHDKEIWGEDATEFKPERFSEGVSKATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFGGGPRIC+G NF ++EAKMA+AMILQ FSFELSPSY HAP S++T QPQ+GAP
Sbjct  453   QMTFFPFGGGPRICIGLNFTMIEAKMALAMILQHFSFELSPSYTHAPQSVITIQPQYGAP  512

Query  1788  LIIHKL  1805
             LI+HKL
Sbjct  513   LILHKL  518



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/547 (60%), Positives = 419/547 (77%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVI-YTLLGV-CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME++ Y  L +  +++  + YAW +LDW WF+P+KLEK L++QGLKGN Y+++ GD+KEL
Sbjct  1     MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  60

Query  351   AKMTTDALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             +K   DA SKP+  SD+ + PR++P++VQ + KYGK+C++W+GP+P V++ DPE+I++V 
Sbjct  61    SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVF  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             NK+  YQK +  P  + +A+G+ +YE DKWAKHRRI+NPAF+ EK+K+ L +        
Sbjct  121   NKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVH------  174

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVIS  884
                                   LSC EM+S+WE  VS K  S E D+WP LQ LT DVIS
Sbjct  175   ----------------------LSCSEMVSQWEEAVSMKESSTELDIWPYLQRLTSDVIS  212

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGS+YEEG++IFELQKEQ  H IEVSR +Y+ GWRF+PTKRNRRM  IE+EV+++IR
Sbjct  213   RTAFGSNYEEGRKIFELQKEQAKHVIEVSRTLYILGWRFLPTKRNRRMKEIEREVQATIR  272

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             GIIDKR+K M+ GE N DDLLGILLESN +EI Q G K FGM+I+DVIEECK+F+FAGQE
Sbjct  273   GIIDKRVKGMKAGEANTDDLLGILLESNFKEIEQHGNKNFGMTIKDVIEECKLFFFAGQE  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV LVWTMILLSR  DWQ RAREEVLQ+FGD  P+F+GLN LKV+TMIL+ESLRLYPP
Sbjct  333   TTSVWLVWTMILLSRHPDWQVRAREEVLQLFGDGMPEFDGLNRLKVVTMILHESLRLYPP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                + RR   + KLG++ LP G +L LPT+L+H D EIWGEDA +FKP++F EGI KATK
Sbjct  393   TAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHDKEIWGEDATKFKPEKFSEGISKATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+  FFPFG GPRIC+G NFA++EAKMAMAMILQRF+FELSPSY HAP S++T QP++GA
Sbjct  453   GQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQRFAFELSPSYTHAPQSVITMQPKYGA  512

Query  1785  PLIIHKL  1805
             PL++HKL
Sbjct  513   PLMLHKL  519



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/547 (62%), Positives = 413/547 (76%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVC---ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             M+ I  L+ VC   I++ L    W VL+WVW  PKKLE  L++QGL GN Y+IL GD+ +
Sbjct  1     MDEIQILVRVCCSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
                M  +A SKPM LSD+IAPR++PF+++   KYGK C++W+GP+P+V+I DPELIKEVL
Sbjct  61    FIGMIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEVL  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             +K Y YQK   NP    + +G+A YE+DKWAKHR+IINPAF+ EKLK             
Sbjct  121   SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF LSC EMLSKWE  V    S E DVWP LQ LTCDVISR
Sbjct  169   ----------------MLPAFHLSCTEMLSKWEDAVPLGSSREIDVWPHLQQLTCDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG++IFELQ EQ  +FI+  R+VY+PG RF+PTKRNRRM  I+ EV++S++G
Sbjct  213   TAFGSSYEEGRKIFELQTEQAQNFIDAVREVYIPGRRFLPTKRNRRMKEIKNEVRTSVKG  272

Query  1068  IIDKRMKAMQGGET-NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             IIDKRMKAM+ G   NN+DLLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQE
Sbjct  273   IIDKRMKAMKAGNADNNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQE  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWT++LLSR+QDWQ +AREEVLQVF  ++PDF+GLN LKV+TMILYESLRLYPP
Sbjct  333   TTSVLLVWTLVLLSRYQDWQTQAREEVLQVFESRKPDFDGLNHLKVVTMILYESLRLYPP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +  ++R+  E+  LGE+ LP G L+ LP +L+H D +IWGEDA EF P+RFREGI  ATK
Sbjct  393   LITLNRQVNEDIVLGELCLPAGVLVSLPMILLHHDKDIWGEDANEFNPERFREGISSATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             GK  +FPF  GPRIC+GQNFA++EAKMA+ MILQ FSFELSPSY HAP S+VT QPQ+GA
Sbjct  453   GKVTYFPFSWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTHAPKSLVTMQPQYGA  512

Query  1785  PLIIHKL  1805
             PLI+HKL
Sbjct  513   PLILHKL  519



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/546 (61%), Positives = 412/546 (75%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVIYTLLGVC---ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             M+ I  L+ VC   I++ L    W VL+WVWF PKKLE  L++QGL GN Y+IL GD+ +
Sbjct  1     MDKIQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLND  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
                M  +A SKPM LSD+IAPR++PF+++ + KYGK C++W+GP+P+V+I DP+LIKEVL
Sbjct  61    FIGMIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEVL  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             +K Y YQK   NP    + +G+A YE+DKWAKHR+IINPAF+ EKLK             
Sbjct  121   SKTYLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF L C EML K E  +    S E DVWP LQ LTCDVISR
Sbjct  169   ----------------MLPAFHLCCTEMLGKLEDAIPVGSSHEIDVWPHLQQLTCDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG++IFELQKEQ  +FI+  R+VYVPG RF+PTKRNRRM  I+ EV++S++G
Sbjct  213   TAFGSSYEEGRKIFELQKEQAQNFIDAVREVYVPGRRFLPTKRNRRMKEIKNEVRTSVKG  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKRMKAM+ G  +N+DLLGILLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQET
Sbjct  273   IIDKRMKAMKAGNADNEDLLGILLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWT++LLSR QDWQ +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLYPP+
Sbjct  333   TSVLLVWTLVLLSRNQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYPPL  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               ++R+  E+  LGE+ LP G L+ LP +L+H D E+WGEDA +F P+RFREG+  ATKG
Sbjct  393   ITLNRQVNEDIVLGELSLPAGVLVSLPVILLHHDEEVWGEDANKFNPERFREGLSSATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  +FPF  GPRIC+GQNFA++EAKMA+ MILQ FSFELSPSY HAP ++VT QPQ GAP
Sbjct  453   QVTYFPFSWGPRICIGQNFAMLEAKMALCMILQSFSFELSPSYTHAPKAIVTMQPQFGAP  512

Query  1788  LIIHKL  1805
             LI+HKL
Sbjct  513   LILHKL  518



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/546 (59%), Positives = 415/546 (76%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYT--LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y   +  +C+++ LL Y W VL+W WFKPKKLEK+L++ GLKGNPY++L GD KEL
Sbjct  1     MEISYNRIIAAICVAI-LLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKEL  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  +D+IA R+IPF++  +NK GK+ +VW+GP P VLI DPE +K +  
Sbjct  60    TNKLNEARSKPINFNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK A  NP  + +A G+A  E+DKWAKHR+IINPAF+ EKLK             
Sbjct  120   KNYGYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EM+SKWE IV  + S E DVWPDLQ +T +VISR
Sbjct  168   ----------------MLPAFYQSCSEMISKWEDIVPKETSVELDVWPDLQLMTGEVISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+ +FELQKEQ  + I+++R VY+PG RF+PTKRN+RM AIEK+V+++IR 
Sbjct  212   TAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFLPTKRNKRMLAIEKQVQTTIRR  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR++AM+ GET+ +DLLGILLESN++EI Q G KEFGM+  ++IEECK+FYFAGQE 
Sbjct  272   IIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKEFGMTTIELIEECKLFYFAGQEA  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTMILLS   +WQ RAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+
Sbjct  332   TSVLLVWTMILLSLHPEWQVRAREEVLQVFGNEKPNLEGLSRLKIMTMILHETLRLFPPV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR   E KLGE+ LP G LL +PT+L+H D E+WGEDAKEFKP+RF EG+ KATKG
Sbjct  392   PTYRRRNKHEVKLGELSLPSGVLLFIPTVLIHYDKELWGEDAKEFKPERFSEGVSKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  F PFG GPRIC+GQNFA++EAKMA+AMILQ+FSF+LSPSY HAP +++TTQPQ+GAP
Sbjct  452   QVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFKLSPSYTHAPVAIITTQPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/543 (59%), Positives = 410/543 (76%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             MEV+Y+L+ V  +  L+  +W +L+W WFKPKK EK L+QQGL+GN Y ++ GDMKE  +
Sbjct  1     MEVLYSLVAVLSASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVR  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             MT +A SKP+  +++I  RV+PF  + +  YG++ Y W GP P VL+ DPE IKEV+NK+
Sbjct  61    MTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNKS  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             + Y K   NPL + +A G+ +YE DKW+KHR++INPAF+ EK+K                
Sbjct  121   FNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         LM PAF LSC EM+SKWE ++S KGSCE DVWP+LQ LT DVISRTAF
Sbjct  165   ------------LMLPAFRLSCFEMVSKWEQLISEKGSCELDVWPELQALTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEG++IFELQKEQ    +  +R  YVPGWRFVPTKRN+RM  I KEV+S +  +I+
Sbjct  213   GSNYEEGQKIFELQKEQAELILLAARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
              R+KAM+ GE  NDDLL ILLESN +EI++   K+FGM++++VIEECK+FYFAGQETTS 
Sbjct  273   NRVKAMKAGEAKNDDLLAILLESNFKEIQEHEDKKFGMTLDEVIEECKLFYFAGQETTSS  332

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLS+ QDWQ RAR+EV QVFG ++P+FE LN LKV+TMIL E LRLYPP+  +
Sbjct  333   LLVWTLILLSKHQDWQDRARDEVQQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPVVML  392

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R T E TKLGE+ LP G  L+LP +L+H DS+IWG+DAKEFKP+RF EGI+KATKG+  
Sbjct  393   GRMTPETTKLGELTLPAGVQLLLPAILLHHDSKIWGDDAKEFKPERFSEGILKATKGQLT  452

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPFG GPRIC+GQNFA+VE+K+A+AMILQRFSFELSP YAHAP++++T QPQHGA LI+
Sbjct  453   YFPFGWGPRICIGQNFAMVESKLALAMILQRFSFELSPLYAHAPHTIITLQPQHGAQLIL  512

Query  1797  HKL  1805
              KL
Sbjct  513   RKL  515



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/544 (58%), Positives = 410/544 (75%), Gaps = 30/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVG-LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++Y  +   I V  LL Y W VL+W WF+PKKLE +L+Q+GLKGNPY++L GD+ EL 
Sbjct  1     MEILYNTIIAIICVAILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELT  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K   +A SK + +SD+I  R+IPF++  +NK GKS ++W+GP P VLI +PE +KE+L K
Sbjct  61    KSIVEAKSKSINISDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILTK  120

Query  534   NYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             NY Y K    NP  + +A+G+   E+DKWAKHR+IINPAF+ EKLK              
Sbjct  121   NYVYLKQTHPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKH-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF +SC EM+SKWE IVS + S E DVWPDLQ +T +VISRT
Sbjct  168   ---------------MLPAFYMSCSEMISKWEDIVSKETSYELDVWPDLQIMTSEVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG+ +FELQ+EQ  H +++SR +Y+PG RF+PTKRN+RM  IEK+++++IR I
Sbjct  213   AFGSSYEEGRIVFELQQEQAEHIMDISRSIYIPGSRFLPTKRNKRMLEIEKQIQTTIRHI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR++AM+ GET+ DDLLGILLESN++EI Q G K+FG++  +VIEECK+FYFAGQETT
Sbjct  273   IDKRLRAMEAGETSKDDLLGILLESNMKEIEQHGNKDFGLTTTEVIEECKLFYFAGQETT  332

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LL    +WQ RAREEVLQVFG+++PD EGL+ LK++TMILYE+LRL+PP+ 
Sbjct  333   SVLLVWTMVLLCLHPEWQVRAREEVLQVFGNEKPDLEGLSHLKIVTMILYETLRLFPPLP  392

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
                RR  EE KLGE+ LP   +L++P + +H D EIWGEDAKEFKP+RF EG+ KATKG+
Sbjct  393   VFSRRNKEEVKLGELQLPAEVILIIPAIFIHYDKEIWGEDAKEFKPERFSEGVSKATKGQ  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               F PFG GPRIC+GQNFA++EAKMA+AMILQ+FSFELSPSY HAP++ +T  PQ+GAPL
Sbjct  453   VSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPFATITIHPQYGAPL  512

Query  1791  IIHK  1802
             ++ K
Sbjct  513   LLRK  516



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/545 (59%), Positives = 410/545 (75%), Gaps = 31/545 (6%)
 Frame = +3

Query  177   MEVIYTLLG-VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++  ++  +C+++ LL   W VL+W WF+PKKLEK+  Q GLKG PY++L GD+ EL 
Sbjct  1     MEMLSKIIATICVAI-LLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELT  59

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K   +A SKP+  SD+IA R+IPF++  +NK GKS ++W+GP P +LI DPE +KE+  K
Sbjct  60    KSIVEAKSKPINFSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTK  119

Query  534   NYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             NY Y K    NP+ + +A+G+AN E DKWAKHR+IINP F+ EKLK              
Sbjct  120   NYVYLKQTHPNPMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKH-------------  166

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF +SC EMLSKWE IV    S E DVWPDLQ +T +VISRT
Sbjct  167   ---------------MLPAFYMSCSEMLSKWEEIVPTGTSFELDVWPDLQIMTSEVISRT  211

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG+ +FELQKEQ  + IE  + +Y+PG RF+PTKRN+RM  IEKE++++IR I
Sbjct  212   AFGSSYEEGRTVFELQKEQAEYVIEKGQSIYIPGSRFLPTKRNKRMLEIEKEIQTTIRCI  271

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR++AM+ G+T+ DDLLGILLESNL+EI   G K+FGM+I DV++ECK+FYFAGQETT
Sbjct  272   IDKRLRAMEAGDTSKDDLLGILLESNLKEIELHGKKDFGMTISDVVDECKLFYFAGQETT  331

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTMILL    +WQ RAREEVLQ+FG+ +PD EGLN LK++TMILYE+LRL+PP+ 
Sbjct  332   SVLLVWTMILLCLHPEWQVRAREEVLQIFGNNKPDLEGLNRLKIVTMILYETLRLFPPLP  391

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
                RRT EE KL E+ LP G LL++PT+L+H D EIWGEDAKEFKP+RF EG+ KATKG+
Sbjct  392   IFGRRTEEEVKLRELNLPAGVLLIIPTILVHYDKEIWGEDAKEFKPERFSEGVSKATKGQ  451

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               F PF  GPR+C+GQNFA++EAKMA+AMILQRFSFELSPSY HAP+++VT  PQ+GAPL
Sbjct  452   VSFIPFSWGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYTHAPFAVVTIHPQYGAPL  511

Query  1791  IIHKL  1805
             ++HKL
Sbjct  512   LMHKL  516



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/544 (60%), Positives = 411/544 (76%), Gaps = 32/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++ T     I++ L    W VL+WVWF+PKKLEK L++QGL GN YR+L GDMK+ +K
Sbjct  1     MELV-TACCCAITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LS++I PR++PF+++ + KYGK  ++W+ P+P+VLI DPELIKEV +KN
Sbjct  60    MIKEANSKPMNLSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKN  119

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y YQK   NP    + +G+A YE+DKWAKHR+IINPAF+ EKLK                
Sbjct  120   YFYQKPHGNPFAALLVQGLAAYEEDKWAKHRKIINPAFHLEKLKH---------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE  V  +GSCE DVWP LQ LTCDVISRTAF
Sbjct  165   -------------MLPAFHLSCSEMLSKWEDAV--EGSCEIDVWPHLQQLTCDVISRTAF  209

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG++IFELQ+EQ  HFI+  R V +P WRF+PTKRNRRM  I+ EV++S++GIID
Sbjct  210   GSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLPTKRNRRMKEIKNEVRTSMKGIID  269

Query  1077  KRMKAMQGG-ETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KRMKAM+ G + +N+DLLG+LLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQET +
Sbjct  270   KRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETIA  329

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWT++LLSR+QDWQ +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY P+  
Sbjct  330   VLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPLFT  389

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
              +R+  E+T L E+ LP   L+ LPT+++H D +IWGEDA +F P+RFREGI  AT GK 
Sbjct  390   HNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWGEDANKFNPERFREGISSATMGKV  449

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              +FPF  GPRIC+GQNFA++EAKM + MILQ FSFELSPSY HAP  ++T  PQ+GAPLI
Sbjct  450   TYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQPLLTIHPQYGAPLI  509

Query  1794  IHKL  1805
              HKL
Sbjct  510   FHKL  513



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/543 (59%), Positives = 407/543 (75%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++Y+L+ V  +  L+  +W +L+W WFKPKKLEK L+QQGL+GN Y ++ GDMKE  +
Sbjct  1     MEILYSLVAVLSASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVR  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             MT +A SKPM  +++I  RV+PF  + +  YG++ Y W GP P VL+  PE IKEV+NK+
Sbjct  61    MTQEAKSKPMNFTNDIVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNKS  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             + Y K   NPL + +A G+ANYE DKW+KHR++I+PAF+ EK+K                
Sbjct  121   FNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF  SC EM+SKWE +VS K SCE DVWP+LQ LT DVISRTAF
Sbjct  165   ------------FMLPAFRWSCFEMVSKWEQLVSEKESCELDVWPELQTLTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEG++IFELQKEQ    +  +R  YVPGWRFVPTKRN+RM  I KEV+S +  +I+
Sbjct  213   GSNYEEGQKIFELQKEQAELILLAARSPYVPGWRFVPTKRNKRMKGIAKEVRSLVMDMIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
              R+KAM+ GE  NDDLL ILLESN +EI+Q G K+FGM++++VIEECK+FYFAGQETTS 
Sbjct  273   NRVKAMKAGEAKNDDLLDILLESNFKEIQQHGDKKFGMTLDEVIEECKLFYFAGQETTSS  332

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLS+ QDWQ RAR+EV QVFG ++P+FE LN LKV+TMIL E LRLYPP   +
Sbjct  333   LLVWTLILLSKHQDWQDRARDEVQQVFGSKKPEFEDLNHLKVITMILNEVLRLYPPGVML  392

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R T E TKLGE+ LP G  L+LP +L+H DS+IWG+DAKEFKP+RF EGI+KATKG+  
Sbjct  393   GRMTTETTKLGELTLPAGVQLLLPAILLHHDSKIWGDDAKEFKPERFSEGILKATKGQLT  452

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPFG GPRIC+GQNFA VE+K+A+AMILQRFSFELSP YAHAP++++T QPQHGA LI+
Sbjct  453   YFPFGWGPRICIGQNFATVESKLALAMILQRFSFELSPLYAHAPHTIITLQPQHGAQLIL  512

Query  1797  HKL  1805
              KL
Sbjct  513   RKL  515



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 399/529 (75%), Gaps = 29/529 (5%)
 Frame = +3

Query  222   LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDN  401
             LL Y W VL+W WF PKKLE  L+Q+GLKGNPY++L GD+ EL K   +A SKP+  SD+
Sbjct  26    LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDD  85

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK-ARTNPLGRK  578
             IA R+IPF++  +NK GKS ++W+GP P VLI  PE +KE+  KNY Y K    NP  + 
Sbjct  86    IAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKL  145

Query  579   VARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLM  758
             +A+G+ + E+DKWAKHR+IINP F+ EKLK                             M
Sbjct  146   LAKGLVSLEEDKWAKHRKIINPTFHVEKLKH----------------------------M  177

Query  759   QPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQ  938
              PAF + C EM+SKWE IV    S E DVWPDL+ +T +VISRTAFGSSYEEG+ +FELQ
Sbjct  178   LPAFYVCCSEMISKWEEIVPKGTSTEIDVWPDLEKMTSEVISRTAFGSSYEEGRIVFELQ  237

Query  939   KEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNND  1118
             KEQ  H +EV+R +Y+PG RF+PTKRN+RM  IEKE++++IR IIDKR++AM+GGET+ D
Sbjct  238   KEQAEHVMEVARSIYIPGSRFLPTKRNKRMLEIEKEIQTTIRRIIDKRLRAMEGGETSKD  297

Query  1119  DLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  1298
             DLLGILLESN++EI Q G K+FGM+  +VIEECK+FYFAGQETTSV+LVWTMILL    +
Sbjct  298   DLLGILLESNMKEIEQHGSKDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPE  357

Query  1299  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  1478
             WQ RAREEVLQVFG+ +PD EGL  LK++TMILYE+LRL+PP+    R   EE KLGE+ 
Sbjct  358   WQVRAREEVLQVFGNDKPDLEGLGRLKIVTMILYETLRLFPPLPTFGRTNKEEVKLGELN  417

Query  1479  LPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQ  1658
             LP G +L++P +L+H D EIWGEDAKEFKP+RF EG+ KATKG+  F PFGGGPRIC+GQ
Sbjct  418   LPAGVILIVPAILVHYDKEIWGEDAKEFKPERFSEGVSKATKGQFSFIPFGGGPRICIGQ  477

Query  1659  NFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             NFA++EAKMA+AMILQRFSFELSPSY HAP+++VT  PQ+GAPL++ KL
Sbjct  478   NFAMMEAKMALAMILQRFSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  526



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/546 (58%), Positives = 407/546 (75%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVG-LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME +  ++   ISV  LL Y W VL+W WF+PKKLEK+L+QQGL GN YR+L GD+KE +
Sbjct  1     METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  354   KMTTDALSKPM-TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   +A SKP+  LS++IAPR+IP+++Q ++KYGK C+VW GP+P +LI + E I+E+  
Sbjct  61    KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK   +NP+   +ARG+ANYE+DKWAKHR+I+ PAF+ EKLK             
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC EML +WE IV  + S E D+WP  Q LT D+ISR
Sbjct  168   ---------------LMLPAFYLSCIEMLKEWEKIVPDERSKELDIWPQFQKLTSDMISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+RIFELQKEQ    ++    +Y+PG RF+PTK N++M   EKEV+ SIR 
Sbjct  213   TAFGSSYEEGRRIFELQKEQAEIIMKQFNSIYIPGSRFLPTKSNKKMKETEKEVQESIRR  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             +ID R+KA + G+   DDLLG LLESN  EI +QG KEFG++I++VI ECK+FYFAGQET
Sbjct  273   LIDNRLKAKEAGQEFGDDLLGTLLESNSNEIEEQGSKEFGLTIDEVIRECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV LVWTMILLSR QDWQA+AREEVLQ FG  +P F+ L+ LK++TMILYESLRLYPP+
Sbjct  333   TSVWLVWTMILLSRHQDWQAKAREEVLQAFGSDQPAFDELSRLKIVTMILYESLRLYPPL  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RRT EET+LG + LP G+L+ +PT+L+H D EIWGEDA+EFKP+RF+EG++KATKG
Sbjct  393   ATRIRRTNEETRLGNLYLPNGSLIFIPTILLHHDKEIWGEDAEEFKPERFKEGVLKATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             + +FFPFG GPRIC+G NFA++EAKMA+A+ILQRF FELSPSY H P+ +V  QP+ GAP
Sbjct  453   QMIFFPFGAGPRICIGHNFAMLEAKMAVALILQRFVFELSPSYTHVPHCIVALQPKFGAP  512

Query  1788  LIIHKL  1805
             L++ +L
Sbjct  513   LLLQRL  518



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/546 (58%), Positives = 420/546 (77%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVI-YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++ Y L+   +++ ++ YAW +LDW WF+P+KLEK L++QGLKGN Y+++ GD+KELA
Sbjct  1     MEIVAYYLVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  354   KMTTDALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   DA SKP+ +SD+ I PR++P++V  + K+GK+C++W+GP+P VL+R+PE+I++V N
Sbjct  61    KSFEDANSKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFN  120

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K   YQK ++ P+ + +A+GV++YE+DKW  HR+I+NPAF+ EK+K              
Sbjct  121   KYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKS-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISR  887
                            M PA  LSC EM+S+WE  +S KG SCE D+WP LQ LT DVISR
Sbjct  168   ---------------MVPAVHLSCTEMVSQWEESISTKGTSCEIDIWPYLQRLTSDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+YEEG++IFELQKE   H IE +R +Y+PG RF+PTK+NRRM  I+K+V++ IRG
Sbjct  213   TAFGSNYEEGRKIFELQKELAQHVIEATRTLYIPGSRFLPTKKNRRMKEIDKKVQAMIRG  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR+KA++ GE N DDLLG+LLESN ++I Q G K+FGM+  ++IEECK+FYFAGQET
Sbjct  273   IIDKRVKALKAGEANTDDLLGMLLESNFKQIEQHGNKDFGMTTREIIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+L W MILLS+  DWQA AREEVLQVFGD + +F+GLN LK++TMIL E+LRLYPP+
Sbjct  333   TSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGKLEFDGLNRLKIVTMILNETLRLYPPV  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 R+T   TKLGE+ LP G +L+LP +L+H D EIWGEDA EFKP+RF EG+ KATKG
Sbjct  393   DATSRKTTTNTKLGELSLPAGVMLLLPIILLHHDKEIWGEDATEFKPERFSEGVSKATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFGGGPRIC+G NFA++EAKMA+AMILQ FSFELSPSY HAP S++T QPQ+GAP
Sbjct  453   QMTFFPFGGGPRICIGLNFAMIEAKMALAMILQHFSFELSPSYTHAPQSVITIQPQYGAP  512

Query  1788  LIIHKL  1805
             LI+H+L
Sbjct  513   LILHRL  518



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/535 (60%), Positives = 403/535 (75%), Gaps = 30/535 (6%)
 Frame = +3

Query  207   CISVGL-LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
              +SV + L Y W VL+WVWF+PKKLEK L+Q+GLKGNPY++L GD+ EL K   +A SKP
Sbjct  8     VVSVAIFLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKP  67

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK-ART  560
             +  SD+IA R+IPF++  +NK GK+ +VW+GP P VLI  PE +KE+L K+Y Y K    
Sbjct  68    INFSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLKQTHP  127

Query  561   NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQG  740
             NPL + +A+ + N E++KWAKHR+IINPAF+ EKLK                        
Sbjct  128   NPLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKH-----------------------  164

Query  741   RTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGK  920
                  M PAF  SC EMLSKWE IV  + S E DVWPDLQ +T +VISRTAFGSSY+EG+
Sbjct  165   -----MLPAFYQSCSEMLSKWEEIVPKETSFEFDVWPDLQVMTSEVISRTAFGSSYQEGR  219

Query  921   RIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQG  1100
              +FELQKEQ  + +E  R +YVPG RF+PTK N+RM  IEKE++++IR IIDKR++AM+ 
Sbjct  220   IVFELQKEQAEYVMEKGRSIYVPGSRFLPTKTNKRMLEIEKEIQTTIRRIIDKRLRAMKA  279

Query  1101  GETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMIL  1280
             GETNN+DLLGILLESNL+EI   G KEFGM+  +VIEECK+FYFAGQETTSV+LVWTMIL
Sbjct  280   GETNNEDLLGILLESNLEEIELHGSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMIL  339

Query  1281  LSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEET  1460
             L    +WQ  AREEVLQVFG+ +PD EGLN LK++TMILYE+LRL+PP+    RRT EE 
Sbjct  340   LCLHPEWQVLAREEVLQVFGNDKPDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEV  399

Query  1461  KLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGP  1640
             KLGE+ LP G +L++P +L+H D EIWGEDAKEFKP+RF EG+ KAT G+  + PFGGGP
Sbjct  400   KLGELNLPDGVVLLIPAVLVHYDKEIWGEDAKEFKPERFSEGVSKATNGQVSYIPFGGGP  459

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             RIC+GQNFA++EAK A+ MILQRFSFELSPSY HAP+++VT  PQ+GAPL++ KL
Sbjct  460   RICIGQNFAMLEAKTAITMILQRFSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  514



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/546 (58%), Positives = 411/546 (75%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTLL--GVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y  +   +C+ V LL Y W VL+W WFKPKKLEK+L++ GLKGNPY++L GD KEL
Sbjct  1     MEISYNRIIEAICV-VTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKEL  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  SD+IA R++PF++  +NK GKS +VW+GP P VLI  PE +KE+  
Sbjct  60    TNKLNEARSKPINFSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KN  YQK A  NP  + +A G+A  E+DKWAKHR+IINPAF+ EKLK             
Sbjct  120   KNCAYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EMLSKWE I+  + S E DVWPDLQ +T +VISR
Sbjct  168   ----------------MLPAFYQSCTEMLSKWEEIIQKETSVELDVWPDLQLMTGEVISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+ +FELQKEQ  + I+++R VY+PG RF+PTK+N+RM  IEK+V+++IR 
Sbjct  212   TAFGSSYEEGRIVFELQKEQAEYVIDITRSVYIPGSRFLPTKKNKRMLEIEKQVQTTIRR  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR++AM+ GE + +DLLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE 
Sbjct  272   IIDKRLRAMEAGEPSKNDLLGILLESNMKEIEQHGSKDFGMTTIELIEECKLFYFAGQEA  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTMILLS   +WQ RAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+
Sbjct  332   TSVLLVWTMILLSVHPEWQVRAREEVLQVFGNEKPNLEGLSRLKIVTMILHETLRLFPPV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR + E KLGE+ LP G LL +PT+L+H D E+WGEDAKEFKP+RF EG+  ATKG
Sbjct  392   PTYRRRNIHEVKLGELSLPAGVLLFIPTVLIHYDKELWGEDAKEFKPERFSEGVSNATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  F PFG GPRIC+GQNFA++EAKMA+AMILQ+F FELSPSY+HAP +++TTQPQ+GAP
Sbjct  452   QVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQKFCFELSPSYSHAPVAIITTQPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 410/544 (75%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             MEV++ +L    +  +L Y+W V++W + +PK+LEK+L++QGL GN YR++ GD+KE+ K
Sbjct  1     MEVVWQILAASSAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLK  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  D  SKP+ L D+I PRV+ F  + V KYG   ++W+GPRP V I DPEL+KEV+NK 
Sbjct  61    MMEDGRSKPINLDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKY  120

Query  537   YQYQKART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
               YQK    NPL + +A+GV +YE DKWAKHR++INPAF+ EKLK               
Sbjct  121   DIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLK---------------  165

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                          LM PAF LSC E+L+KWE  +S +GSCE DVWP LQ LT D ISRTA
Sbjct  166   -------------LMIPAFYLSCDEVLNKWEKSLSPEGSCEVDVWPYLQNLTSDAISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSY+EG RIFELQ+EQ  H I+ S+ +Y+PGWRFVPTKRN+RM  IEKEV+SSIR II
Sbjct  213   FGSSYQEGTRIFELQREQAEHVIKASQSIYIPGWRFVPTKRNKRMKEIEKEVQSSIRSII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
              +R+KAM+ GE +++DLLGILLESN QEI+Q G K FGM+I++V+EECK+FYFAGQETTS
Sbjct  273   SRRIKAMKAGEASSEDLLGILLESNFQEIKQHGNKSFGMTIDEVVEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWT+ILLSRF DWQ RAREEVLQVFG Q PDF+ LN LK++TMIL E LRLYPP+ G
Sbjct  333   VLLVWTLILLSRFPDWQKRAREEVLQVFGSQTPDFDSLNHLKIVTMILNEVLRLYPPVVG  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R+  EETKLG++ LP G  + LP +L+H   EIWG+DA +F P+RF EG+ KA K + 
Sbjct  393   LGRKVTEETKLGKLTLPAGVQISLPIILLHHSREIWGDDAMDFNPERFSEGVAKAQKRQG  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
             +FFPFG GPRIC+GQ FA++EAK+A+AMILQRFSFELSPSY HAP +++T QPQHGA L+
Sbjct  453   IFFPFGWGPRICIGQMFAMMEAKVALAMILQRFSFELSPSYTHAPQTIITLQPQHGAHLL  512

Query  1794  IHKL  1805
             +HKL
Sbjct  513   LHKL  516



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/546 (58%), Positives = 406/546 (74%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVG-LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME +  ++   I V  LL + W VL+W WF+PKKLEK+ +QQGL GN YR+L GD+KE +
Sbjct  1     METLNNIIIATIFVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFS  60

Query  354   KMTTDALSKPMT-LSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   +A SKP+  LS++IAPR+IP+++Q ++KYGK+C+VW GP+P +LI + E I+E+  
Sbjct  61    KSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFA  120

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK   +NP+   +ARG+ANYE+DKWAKHR+I+ PAF+ EKLK             
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC EML +WE I+  +GS E D+WP  Q LT D+ISR
Sbjct  168   ---------------LMLPAFYLSCIEMLKEWEQIIPYEGSKELDIWPQFQKLTSDMISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+RIFELQKEQ    ++    +Y+PG RF+PTK N++M   EKEV+ SIR 
Sbjct  213   TAFGSSYEEGRRIFELQKEQAEIIMKQFNSIYIPGSRFLPTKSNKKMKETEKEVQESIRR  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             +ID R+KA + G+   DDLLG LLESN  EI +QG KEFG++I++VI ECK+FYFAGQET
Sbjct  273   LIDNRLKAKEAGQEFGDDLLGTLLESNSNEIEEQGSKEFGLTIDEVIRECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV LVWTMILLSR Q+WQA+AREEVLQ FG  +P F+ L+ LK++TMILYESLRLYPP+
Sbjct  333   TSVWLVWTMILLSRHQNWQAKAREEVLQAFGSDQPAFDELSRLKIVTMILYESLRLYPPL  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RRT EETKLG + LP G+LL +PT+L+H D EIWGEDA+EFKP+RF EG++ ATKG
Sbjct  393   ATRIRRTNEETKLGNMYLPNGSLLFIPTILLHHDKEIWGEDAEEFKPERFSEGVLNATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFG GPRIC+GQNFA++EAKMA+A+ILQRF FELSPSY H P+ +V  QP++GAP
Sbjct  453   QMTFFPFGAGPRICIGQNFAMLEAKMAIALILQRFEFELSPSYIHVPHCIVALQPKYGAP  512

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  513   LLLQKL  518



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/546 (57%), Positives = 407/546 (75%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTLL--GVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y  +   +C+++ LL Y W VL+W WFKPKKLEK+L++ GLKGNPY++  GD+ EL
Sbjct  1     MEISYNRIIEAICVAI-LLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEL  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  SD+IA R+IPF++  + K GKS +VW+GP P VLI DPE +KE+  
Sbjct  60    TNKLNEARSKPINFSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK A  NP  +  A+G+A  E+DKWAKHR+IINPAF+ E LK             
Sbjct  120   KNYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EM+SKWE IV  + S E DVWPDLQ +T +VISR
Sbjct  168   ----------------MLPAFYQSCSEMISKWEDIVPKETSVELDVWPDLQLMTGEVISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+++FELQKEQ  + ++++  VY+PG RF+PTKRN+RM  IEK+++++IR 
Sbjct  212   TAFGSSYEEGRKVFELQKEQAEYVMDMTHSVYIPGSRFLPTKRNKRMKEIEKQIQTTIRR  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             II+KR++AM+ GET+ +DLLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE 
Sbjct  272   IINKRLRAMEAGETSKNDLLGILLESNMKEIEQHGNKDFGMTTIELIEECKLFYFAGQEG  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
              SV+L+WTMILL    +WQ RAREEVLQVFG+++ + EGL+ L ++TMIL E+LRL+PP+
Sbjct  332   NSVLLIWTMILLCLHPEWQVRAREEVLQVFGNEKTNLEGLSRLNIVTMILNETLRLFPPV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR  EE KLG++ LP G  L +PT+L+H D E+WGEDAKEFKP+RF EG+ KATKG
Sbjct  392   ATFRRRIKEEVKLGDLSLPAGVQLFIPTVLIHYDKELWGEDAKEFKPERFSEGVSKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFG GPRIC+GQNFA++EAKMA+AMILQ FSFELSPSY HAP ++V+TQPQ+GAP
Sbjct  452   EASFFPFGRGPRICIGQNFAMMEAKMAIAMILQNFSFELSPSYTHAPLAIVSTQPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/545 (58%), Positives = 403/545 (74%), Gaps = 30/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVG-LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ Y  +   ISV  LL Y W VL+W WFKPKKLEK+L++ GLKGN Y++L GD+KEL 
Sbjct  1     MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
                 +A SKP+  S ++  R+IPF+   +NK GKS ++W+GP P VLI DPE +KE+L K
Sbjct  61    NKLNEAKSKPIHFSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTK  120

Query  534   NYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             NY YQ+    NP  +K+A G+A  E+DKWAKHR+II PAF  EKLK              
Sbjct  121   NYVYQRQTHPNPFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKH-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF  SC EM+SKWE I+  + S E DVWPDLQ +T +VISRT
Sbjct  168   ---------------MLPAFYQSCSEMISKWEEIIPKETSFELDVWPDLQLITAEVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG+ +FELQKEQ  + I + R VY+PG RF+PTKRN+RM  IEK+V+++IR I
Sbjct  213   AFGSSYEEGRIVFELQKEQAEYVINIIRSVYIPGTRFLPTKRNKRMLEIEKQVQTTIRRI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR++AM+ GET+ DDLLGILLESN++EI Q   K+FG++  ++IEECK+FYFAGQET 
Sbjct  273   IDKRLRAMEAGETSKDDLLGILLESNMREIEQHRSKDFGITTIEMIEECKLFYFAGQETA  332

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTMILLS   +WQARAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+P + 
Sbjct  333   SVLLVWTMILLSLHPEWQARAREEVLQVFGNEKPNSEGLSHLKIMTMILHETLRLFPSVP  392

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
                RR   E KLGE+ LP G LL++PT+L+H D E+WGEDAKEFKP+RF EG+ KATKG+
Sbjct  393   TYRRRNKHEVKLGELSLPAGVLLIIPTILIHYDKELWGEDAKEFKPERFSEGVSKATKGQ  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               F PFGGGPR+C+GQNFA++EAKMA+AMILQ+FSFELSPSY HAP   +   PQ+GAPL
Sbjct  453   VSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPLVTINIHPQYGAPL  512

Query  1791  IIHKL  1805
             ++ KL
Sbjct  513   LLRKL  517



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 402/546 (74%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTLL--GVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y  +   +C+++ LL Y   VL+W WFKPKKLEK+L++ GLKGNPY++  GD+ E+
Sbjct  1     MEISYNRIIEAICVAI-LLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEI  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  SD+IA R+IPF++  +NK GKS +VW GP P VLI DPE +KE+  
Sbjct  60    TNKLNEARSKPINFSDDIAQRLIPFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK    NP  + +A G+   E++KWAKHR+IINP F  EKLK             
Sbjct  120   KNYVYQKDTHPNPFSKFLAVGILKLEENKWAKHRKIINPVFQVEKLKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EM+SKWE IV  + S E DVWPDLQ +T ++ISR
Sbjct  168   ----------------MLPAFYQSCSEMISKWEDIVPKETSVELDVWPDLQLMTAEIISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSS+EEG+ +FELQKEQ  H +E+SR +Y+PG RF+PTKRN+RM  IEK+V+++IR 
Sbjct  212   TAFGSSFEEGRIVFELQKEQAEHVMEISRTIYIPGSRFLPTKRNKRMLEIEKQVQTTIRH  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR++AM+ GET+ +DLLGILLESN++EI Q G K+FGM+  +VI+ECK FYFAGQET
Sbjct  272   IIDKRLRAMEAGETSKNDLLGILLESNMKEIEQHGSKDFGMTTTEVIDECKFFYFAGQET  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             T+V+LVWTMILL    +WQARAREE LQVFG+++P+ EGL+ LK++T+IL+E+LRL+PP+
Sbjct  332   TAVLLVWTMILLCLHPEWQARAREEALQVFGNEKPNLEGLSRLKIVTIILHETLRLFPPV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR   E KLGE+ LP G LL +PT+L+H D E+WGEDA EFKP+RF EG+ KATKG
Sbjct  392   ATYRRRNKHEVKLGELSLPAGVLLFIPTVLIHYDKELWGEDANEFKPERFSEGVSKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
                F PF GGPR+C+GQNFA++EAK+A+AMILQ+FSFELSPSY HAP S +T  PQ+GAP
Sbjct  452   HFSFIPFSGGPRVCIGQNFAMMEAKLAIAMILQKFSFELSPSYTHAPSSTITIHPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/548 (57%), Positives = 398/548 (73%), Gaps = 31/548 (6%)
 Frame = +3

Query  177   MEVIYTLLGV---CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+ Y+ + V   CI + +   AW    W W  PKKLEK LK+QGL+GNPY++L GD KE
Sbjct  1     MEIAYSPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKE  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             +A    +A SKP+ +S++  PRVIP +   V KYG++ Y+W GP+P VLI +PE I+E+ 
Sbjct  61    IATHFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREIT  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              K Y +QKA  NPL + +A G+ +Y+ DKWAKHR++I PAF+ EKLK             
Sbjct  121   TKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M P+F  S  EML KWE IVS  GSCE DVWPD+Q LT D ISR
Sbjct  169   ----------------MVPSFYASASEMLDKWEAIVSTNGSCELDVWPDIQTLTSDAISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+Y+EGKRIFELQ+EQ  HF++    VY+PGWRF+PTK NRRM  I K+V+ SIR 
Sbjct  213   TAFGSNYQEGKRIFELQREQAEHFLKAVESVYIPGWRFLPTKLNRRMKQIAKDVQESIRE  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             II+ R+KAM+ GE   DDLLGILLESN +EI   G K+FGM+I DVIEECK+FYFAGQET
Sbjct  273   IINARLKAMKEGEACADDLLGILLESNSKEIDDHGNKDFGMTIGDVIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSVMLVWTM+LLSR  +WQARAREEVLQ FG+ +PDF+GLN LK++TMIL+E LRLYPP+
Sbjct  333   TSVMLVWTMVLLSRHPNWQARAREEVLQHFGNNKPDFKGLNHLKLVTMILHEVLRLYPPV  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + RRT E+ +LG + LP    + LP +L+H D EIWG+D +EFKP+RF +G+  ATKG
Sbjct  393   PAIPRRTDEDIQLGNLTLPAQVQVSLPAILLHYDPEIWGDDVEEFKPERFADGVSNATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  +FPFG GPRIC+GQNFA++EAK+A+AM+LQRFSFELSPSY HAP +++T QPQ+GA 
Sbjct  453   QTAYFPFGWGPRICIGQNFAMLEAKLAVAMLLQRFSFELSPSYTHAPRAVITIQPQYGAR  512

Query  1788  LIIHKL*Y  1811
             LI+HKL Y
Sbjct  513   LILHKLQY  520



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/544 (57%), Positives = 406/544 (75%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++Y+++       +L Y W VL+W WF PKK+EK L+Q+GLKGNPY++L GD+ EL K
Sbjct  1     MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
                +A SKP+  SD+IA R+IPF++  +NK GK+ +VW+GP P VLI DPE +KE+  KN
Sbjct  61    SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  537   YQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
             Y YQK    NP  + +A G+ + E+DKWAKHR+II+PAF+ EKLK               
Sbjct  121   YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF LSC EM+SKWE +V  + S E DVWPDLQ +T +VISRTA
Sbjct  167   --------------MLPAFYLSCSEMISKWEEVVPKETSFELDVWPDLQIMTSEVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG+ +FELQKEQ  + +++ R +Y+PG RF+PTKRN+RM  IEK+V+++IR II
Sbjct  213   FGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIRRII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             DKR+KAM+ GET+ DDLLGILLESNL+EI   G  +FG++  +VIEECK+FYFAGQETTS
Sbjct  273   DKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDFGITTSEVIEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTMILL    +WQ RAR+EVLQ+FG+ +PD EGL+ LK++TMILYE+LRL+PP+  
Sbjct  333   VLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPA  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
               RR  EE KLGE+ LP G LL++P +L+H D EIWGEDAKEFKP+RF EG+ KAT G+ 
Sbjct  393   FGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEFKPERFSEGVSKATNGQV  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              F PF  GPR+C+GQNFA++EAKMA+ MILQ+FSFELSPSY HAP+++VT  PQ+GAPL+
Sbjct  453   SFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTHAPFAIVTIHPQYGAPLL  512

Query  1794  IHKL  1805
             + +L
Sbjct  513   MRRL  516



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/541 (59%), Positives = 398/541 (74%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             +  +C+ + L+  AW +L W+W KPKKLE  L++QGLKGN YR+  GDMKEL+K   +  
Sbjct  9     IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  68

Query  375   SKPM-TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
             SKP+  LS+ +APR+IP+Y++ + KYGK C+VW GP P +LI +PELIKE+  KNY +QK
Sbjct  69    SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  552   ART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEG  728
                 NPL + +ARGV +YE++KWAKHR+I+NPAF+ EKLK                    
Sbjct  129   PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKH-------------------  169

Query  729   KSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSY  908
                      M PAF LSC EML+KWE I+  K S E D+WP LQ +T DVISR AFGSSY
Sbjct  170   ---------MLPAFYLSCSEMLNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSY  220

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             EEG+RIFELQ+EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+K
Sbjct  221   EEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLK  280

Query  1089  AMQ--GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             A +   G+  NDDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+L
Sbjct  281   AKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLL  340

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWT+ILL R  +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    R
Sbjct  341   VWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTR  400

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
             RT EETKLGE+ LP+GALL +PT+L+H+D EIWGEDA EF P+RF EG+ KATKGK  +F
Sbjct  401   RTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNPERFSEGVAKATKGKMTYF  460

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPR C+GQNFA++EAKMA+AMILQRFSFELSPSY H+PY++VT +P++GAPLI+H+
Sbjct  461   PFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHR  520

Query  1803  L  1805
             L
Sbjct  521   L  521



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/541 (59%), Positives = 398/541 (74%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             +  +C+ + L+  AW +L W+W KPKKLE  L++QGLKGN YR+  GDMKEL+K   +  
Sbjct  19    IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEIN  78

Query  375   SKPM-TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
             SKP+  LS+ +APR+IP+Y++ + KYGK C+VW GP P +LI +PELIKE+  KNY +QK
Sbjct  79    SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  138

Query  552   ART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEG  728
                 NPL + +ARGV +YE++KWAKHR+I+NPAF+ EKLK                    
Sbjct  139   PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKH-------------------  179

Query  729   KSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSY  908
                      M PAF LSC EML+KWE I+  K S E D+WP LQ +T DVISR AFGSSY
Sbjct  180   ---------MLPAFYLSCSEMLNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSY  230

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             EEG+RIFELQ+EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+K
Sbjct  231   EEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITRLIDNRLK  290

Query  1089  AMQ--GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             A +   G+  NDDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+L
Sbjct  291   AKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLL  350

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWT+ILL R  +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    R
Sbjct  351   VWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTR  410

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
             RT EETKLGE+ LP+GALL +PT+L+H+D EIWGEDA EF P+RF EG+ KATKGK  +F
Sbjct  411   RTNEETKLGELDLPKGALLFIPTILLHLDKEIWGEDADEFNPERFSEGVAKATKGKMTYF  470

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPR C+GQNFA++EAKMA+AMILQRFSFELSPSY H+PY++VT +P++GAPLI+H+
Sbjct  471   PFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHR  530

Query  1803  L  1805
             L
Sbjct  531   L  531



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/525 (59%), Positives = 398/525 (76%), Gaps = 29/525 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W VL+W WF+PKK+E  L+Q+GLKGNPY++L GD+ EL K   +A SKP+  SD+IA R
Sbjct  29    TWKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQR  88

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK-ARTNPLGRKVARG  590
             +IPF++  +NK GK+ +VW+GP P VLI DPE +KE+  KNY YQK    NP  + +A G
Sbjct  89    LIPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHG  148

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + + E+DKWAKHR+IINPAF+ +KLK                             M P+F
Sbjct  149   LISLEEDKWAKHRKIINPAFHVQKLKH----------------------------MLPSF  180

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
              LSC EM+SKWE +V  + S E D+WPDLQ +T +VISRTAFGSSYEEG+ +FELQKEQ 
Sbjct  181   YLSCSEMISKWEEVVPKETSFELDIWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQA  240

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
              + +E+ R +Y+PG RF+PTKRN+RM  IEK+V+++I+ IIDKR+KAM+ GET+ DDLLG
Sbjct  241   EYVMEIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIKRIIDKRLKAMEEGETSKDDLLG  300

Query  1131  ILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  1310
             ILLESNL+EI   G KEFG++  +VIEECK+FYFAGQETTSV+LVWTMILL    +WQ R
Sbjct  301   ILLESNLKEIELHGRKEFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVR  360

Query  1311  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  1490
             AREEVLQVFG+ +PD EGL+ LK++TMILYE+LRL+PP+    RR  EE KLG++ LP G
Sbjct  361   AREEVLQVFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGKLHLPAG  420

Query  1491  ALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFAL  1670
              LL++P +L+H D EIWGEDAKEFKP+RF+EG+ KAT G+  F PF  GPR+C+GQNFA+
Sbjct  421   VLLIIPAILVHYDKEIWGEDAKEFKPERFKEGVSKATNGQVSFIPFSWGPRVCIGQNFAM  480

Query  1671  VEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +EAKMA+AMILQ+FSFELSPSY HAP+++VT  PQ+GAPL++ +L
Sbjct  481   MEAKMAVAMILQKFSFELSPSYTHAPFAIVTIHPQYGAPLLMRRL  525



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/536 (57%), Positives = 400/536 (75%), Gaps = 30/536 (6%)
 Frame = +3

Query  201   GVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSK  380
              +C++V LL Y W VL+W W KPKKLEK+L++ GLKGNPY++  GD+KE      +A SK
Sbjct  11    AICVAV-LLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFTNKLNEAKSK  69

Query  381   PMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK-AR  557
             P+  SD+IA R+IPF+   +NK GKS +VW+GP P VLI DPE +KE+  KNY YQK   
Sbjct  70    PINFSDDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTKNYVYQKETH  129

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
              NP  + +A G+A  E+DKWAKHR+IINPAF +EKLK                       
Sbjct  130   PNPFSKLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKH----------------------  167

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                   M PAF  SC E++SKWE I+  + S E DVWPDLQ +T +VISRTAFGSSYEEG
Sbjct  168   ------MLPAFYQSCSEIISKWEEIIPKETSFELDVWPDLQLMTAEVISRTAFGSSYEEG  221

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             + +FELQ EQ  +  +++R +Y+PG RF+PTKR +RM  IEK+V+++I+ IIDKR++AM+
Sbjct  222   RIVFELQNEQAEYVTDINRSIYIPGSRFLPTKRYKRMLEIEKQVQTTIKRIIDKRLRAME  281

Query  1098  GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMI  1277
              GET+ +DLLGILLESN++EI Q G K+FGM+  +VI+ECK FYFAGQETT+V+LVWTMI
Sbjct  282   AGETSKNDLLGILLESNMKEIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMI  341

Query  1278  LLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEE  1457
             LL    +WQARAREE LQVFG+++P+ EGL+ LK++TMIL+E+LRL+PP+    RR   E
Sbjct  342   LLCLHPEWQARAREEALQVFGNEKPNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNKHE  401

Query  1458  TKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGG  1637
              KLGE+ LP G LL++P +L+H D E+WGEDAKEFKP+RF EG+ KATKG+  F PF GG
Sbjct  402   VKLGELSLPAGVLLVIPAILIHYDKELWGEDAKEFKPERFSEGVSKATKGRISFIPFTGG  461

Query  1638  PRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             PR+C+GQNFA++EAK+ +AMILQ+FSFELSPSYAHAP++ +T  PQ+GAPL++ KL
Sbjct  462   PRVCIGQNFAMMEAKIGIAMILQKFSFELSPSYAHAPFATITIHPQYGAPLLMRKL  517



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/546 (57%), Positives = 403/546 (74%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYT--LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y   L  +C+++ LL Y W VL+W WF+PKKLEK+L++ GLKGNPY++L GD+KEL
Sbjct  1     MEISYNTILTAICVAI-LLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKEL  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  SD IA R+ PF+   ++K GKS +VW+GP P VLI +PE +KE+L 
Sbjct  60    KNKLNEAKSKPINFSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQ+    NP  +K+A G+A  E+DKWAKHR+II PAF  EKLK             
Sbjct  120   KNYVYQRQTHANPFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EM+SKWE I+  +   E DVWPDLQ +T +VISR
Sbjct  168   ----------------MLPAFYQSCSEMISKWEEIIPKETPFELDVWPDLQLITAEVISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGSSYEEG+ +FELQKEQ  + I++ R VY+PG RF+PTKRN+RM  IE +V+++IR 
Sbjct  212   TAFGSSYEEGRIVFELQKEQAEYVIDIIRSVYIPGTRFLPTKRNKRMLEIENKVQTTIRS  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR++AM+ GE +  DLLGILLESN++EI+Q    +FG++  ++IEECK+FYFAGQET
Sbjct  272   IIDKRLRAMEAGEASKTDLLGILLESNMREIKQHRSNDFGITTAEMIEECKLFYFAGQET  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+L WTMILLS   +WQARAREEVLQVFG+++P+ EGL+ LK++TMIL+E+LRL+P +
Sbjct  332   TSVLLAWTMILLSLHPEWQARAREEVLQVFGNEKPNSEGLSRLKIVTMILHETLRLFPSV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR   E KLGE+ LP G  L++PT+L+H D E+WGEDAKEFKP+RF EG+ KATKG
Sbjct  392   PTYRRRNKHEVKLGELSLPAGVQLIIPTILIHYDKELWGEDAKEFKPERFSEGVSKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  F PFGGGPR+C+GQNFA++EAKMA+AMILQ+FSFELSPSY HAP   +T  PQ+GAP
Sbjct  452   QVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKFSFELSPSYTHAPVLTITIHPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/544 (57%), Positives = 405/544 (74%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++Y+++       +L Y W VL+W WF PKK+EK L+Q+GLKGNPY++L GD+ EL K
Sbjct  1     MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
                +A SKP+  SD+IA R+IPF++  +NK GK+ +VW+GP P VLI DPE +KE+  KN
Sbjct  61    SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  537   YQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
             Y YQK    NP  + +A G+ + E+DKWAKHR+II+PAF+ EKLK               
Sbjct  121   YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF LSC EM+SKWE +V  + S E DVWPDLQ +T +VISRTA
Sbjct  167   --------------MLPAFYLSCSEMISKWEEVVPKETSFELDVWPDLQIMTSEVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG+ +FELQKEQ  + +++ R +Y+PG RF+PTKRN+RM  IEK+V+++IR II
Sbjct  213   FGSSYEEGRIVFELQKEQAEYVMDIGRSIYIPGSRFLPTKRNKRMLEIEKQVQTTIRRII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             DKR+KAM+ GET+ DDLLGILLESNL+EI   G  + G++  +VIEECK+FYFAGQETTS
Sbjct  273   DKRLKAMEEGETSKDDLLGILLESNLKEIELHGRNDLGITTSEVIEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTMILL    +WQ RAR+EVLQ+FG+ +PD EGL+ LK++TMILYE+LRL+PP+  
Sbjct  333   VLLVWTMILLCLHPEWQVRARKEVLQIFGNDKPDLEGLSRLKIVTMILYETLRLFPPLPA  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
               RR  EE KLGE+ LP G LL++P +L+H D EIWGEDAKEFKP+RF EG+ KAT G+ 
Sbjct  393   FGRRNKEEVKLGELHLPAGVLLVIPAILVHYDKEIWGEDAKEFKPERFSEGVSKATNGQV  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              F PF  GPR+C+GQNFA++EAKMA+ MILQ+FSFELSPSY HAP+++VT  PQ+GAPL+
Sbjct  453   SFIPFSWGPRVCIGQNFAMMEAKMAVTMILQKFSFELSPSYTHAPFAIVTIHPQYGAPLL  512

Query  1794  IHKL  1805
             + +L
Sbjct  513   MRRL  516



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/546 (57%), Positives = 394/546 (72%), Gaps = 31/546 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLL---AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME++Y  + V  S  LL     AW V + VW  PKKLEK LK+QG +GNPY++L GD KE
Sbjct  1     MEIVYNPIAVLSSCILLLILVLAWKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKE  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             ++ +  +ALSKP+ L+D+  PRVIP +     KYGK  Y+W G    V+I DPE I+EV 
Sbjct  61    ISTLFKEALSKPINLTDDFVPRVIPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVT  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              K Y +Q+  +NPL + + +G+A+Y  DKW KHR++INPAF+ EKLK             
Sbjct  121   QKVYIFQRPHSNPLLKLLVQGLASYNGDKWTKHRKLINPAFHVEKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M P+F  S  EM+ KWE IVS  GS E DVWPDLQ LTCD ISR
Sbjct  169   ----------------MLPSFYTSASEMMCKWEDIVSSNGSSELDVWPDLQTLTCDAISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+Y+EG RIFELQ+EQ  HFIE +R +Y+PGWRF+PTKRN RM  I ++V+ SI+ 
Sbjct  213   TAFGSNYKEGSRIFELQREQTEHFIEAARSLYIPGWRFIPTKRNTRMKQIARDVQESIKD  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             II+ R+KAM+  +  +DDLLGILLESN +EI   G K FGM++ +VIEECK+FYFAGQET
Sbjct  273   IINARLKAMKAAKACDDDLLGILLESNSKEIDHHGNKNFGMTVLEVIEECKLFYFAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTMILLSR+ +WQ RAREEVLQ+FG  +PDF+GLN LK++TMIL+E LRLYPP+
Sbjct  333   TSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDKPDFDGLNHLKLITMILHEVLRLYPPV  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
             T + RR  EET+LG + LP G L+ LP +L+H D EIWG+D KEFKP+RF +G+ KATKG
Sbjct  393   TALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHDPEIWGDDVKEFKPERFADGVSKATKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPF  GPRIC+GQNFA++EAK+AM MILQRFSFELSPSY HAP +M T QPQ GA 
Sbjct  453   QFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQRFSFELSPSYTHAPRAMATLQPQFGAQ  512

Query  1788  LIIHKL  1805
             LI+H+L
Sbjct  513   LILHRL  518



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/541 (58%), Positives = 397/541 (73%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             +  +C+ + L+  AW +L W+W KPKKLE  L++QGLKGN Y +  GDMKEL+K   +  
Sbjct  9     IAAICLIIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEIN  68

Query  375   SKPM-TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
             SKP+  LS+ +APR+IP+Y++ + KYGK C+VW GP P +LI +PELIKE+  KNY +QK
Sbjct  69    SKPIINLSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQK  128

Query  552   ART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEG  728
                 NPL + +ARGV +YE++KWAKHR+I+NPAF+ EKLK                    
Sbjct  129   PNNPNPLTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKH-------------------  169

Query  729   KSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSY  908
                      M PAF LSC EML+KWE I+  K S E D+WP LQ +T DVISR AFGSSY
Sbjct  170   ---------MLPAFYLSCSEMLNKWEEIIPVKESNELDIWPHLQRMTSDVISRAAFGSSY  220

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             EEG+RIFELQ+EQ  +  +    VY+PG RF P K N+RM   EKEV+ +I  +ID R+K
Sbjct  221   EEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPNKMNKRMKECEKEVRETITCLIDNRLK  280

Query  1089  AMQ--GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             A +   G+  NDDLLGILLESN  EI + G K+FGMSI +VIEECK+FYFAGQETTSV+L
Sbjct  281   AKEEGNGKALNDDLLGILLESNSIEIEEHGNKKFGMSIPEVIEECKLFYFAGQETTSVLL  340

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWT+ILL R  +WQ RAREEV Q FG  +P F+ L  LK++TMILYESLRLYPPI    R
Sbjct  341   VWTLILLGRNPEWQERAREEVFQAFGSDKPTFDELYRLKIVTMILYESLRLYPPIATRTR  400

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
             RT EETKLGE+ LP+GALL +PT+L+H+D EIWGEDA EF P+RF EG+ KATKGK  +F
Sbjct  401   RTNEETKLGELDLPKGALLFIPTILLHLDREIWGEDADEFNPERFSEGVAKATKGKMTYF  460

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPR C+GQNFA++EAKMA+AMILQRFSFELSPSY H+PY++VT +P++GAPLI+H+
Sbjct  461   PFGAGPRKCIGQNFAILEAKMAIAMILQRFSFELSPSYTHSPYTVVTLKPKYGAPLIMHR  520

Query  1803  L  1805
             L
Sbjct  521   L  521



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/544 (57%), Positives = 401/544 (74%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M++ Y+++GV  SV L  +AW +L+WVWFKPKKLEK+L+QQGL G+ YR+L GDMKE A+
Sbjct  1     MDMFYSIIGVLCSVFLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQ  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M   A SKP+  +++I PR++PF  + +   G +   WMGP P +L+ DPEL+KEVL KN
Sbjct  61    MVKQAYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKN  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y YQK R NPLG+ +A G A Y+ DKWAK+RRII+PAF+ EKLK                
Sbjct  121   YVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKH---------------  165

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE      GS E DVWPD++ L  D+ISRTAF
Sbjct  166   -------------MVPAFCLSCSEMLSKWENGALADGSLELDVWPDIRTLAGDMISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEG++IFELQ +Q   F +  + +YVPGWRF+PTKRN++M  I K+V+S I GII+
Sbjct  213   GSNYEEGRKIFELQMQQSELFEQAIQSIYVPGWRFLPTKRNKKMKKIFKDVRSLILGIIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR++AMQ GE  + DLLG+LLESN +EI++ G + FGM+ E+VI+ECK+FYFAG ETT++
Sbjct  273   KRVRAMQEGEATHSDLLGLLLESNFKEIQEHGNERFGMTSEEVIQECKLFYFAGHETTAI  332

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLS+  DWQARAR+EVLQVFG+  PDFE LN LK++TMIL E LRLY P   +
Sbjct  333   LLVWTLILLSKHSDWQARARDEVLQVFGNNIPDFEELNRLKIVTMILNEVLRLYTPGVMI  392

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RR  E+TKLGE+ LP G  +++P++L+H D  +WG+DAKEF P+RF EG+ KATKG+  
Sbjct  393   SRRVNEDTKLGELSLPSGMFVLMPSILLHHDPSLWGDDAKEFNPERFSEGVAKATKGQPC  452

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVT-TQPQHGAPLI  1793
             F PFGGGPRIC+GQNFAL+EAKMA+A+ILQRFSFELSP Y HAPY  +T  QPQ+GA LI
Sbjct  453   FLPFGGGPRICIGQNFALLEAKMALALILQRFSFELSPLYTHAPYLFLTLLQPQYGAQLI  512

Query  1794  IHKL  1805
             + KL
Sbjct  513   MKKL  516



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/528 (58%), Positives = 400/528 (76%), Gaps = 33/528 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
             +W VL+W+W +PK+LEK L++QG +GNPY +  GD KE  KM  +A+SKPMTLSD+I PR
Sbjct  20    SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  414   VIPFYVQH-VNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             V   YVQH VNK+GK+ ++W GP P+V I DPE IK+V NKNY + K   NPL + +A G
Sbjct  80    VSA-YVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A YE +KW+KHRRIINPAF  EKLK                            +M P F
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLK----------------------------IMLPLF  170

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
             L SC +++SKWEG++S +GSCE D WP LQ LT DVI+R+AFGSSYEEG+RIF+LQ+EQ 
Sbjct  171   LQSCNDLVSKWEGMLSSEGSCEMDAWPFLQNLTSDVIARSAFGSSYEEGRRIFQLQREQT  230

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
              H ++V  ++ +PGWRF+PTK +RRM  I++E+K+S++ +I+KR KA++ GE   +DLLG
Sbjct  231   EHLMKVILKIQIPGWRFLPTKTHRRMKEIDREIKASLKNMINKREKALKSGEATKNDLLG  290

Query  1131  ILLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             ILLESN +EI++ G    K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  291   ILLESNHKEIQEHGNRNSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  350

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREE  QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM+R   ++ KLG + L
Sbjct  351   QARAREEAFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTL  410

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LPT+L+H DSE+WGEDAK+F P+RF EG++KAT G+  FFPFG GPRIC+GQN
Sbjct  411   PAGVQVFLPTVLIHHDSELWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQN  470

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+L+EAKMA++MILQ F FELSP+YAHAP   +TTQPQ+GA +I+ K+
Sbjct  471   FSLLEAKMALSMILQNFLFELSPAYAHAPTMSITTQPQYGAHIILRKV  518



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/544 (57%), Positives = 402/544 (74%), Gaps = 32/544 (6%)
 Frame = +3

Query  186   IYTLLGVCISVGLL-AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             ++T+   C+ + L+ A +W  L+WVWF+PKKLEK LK+Q  +GNPY++L GD KE++ + 
Sbjct  9     MFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMSTLY  68

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQ  542
             T+A SK + LSD+I PRVIP Y+  V KYGK+ Y+W GPRP ++I DP LIK V  K   
Sbjct  69    TEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQKVDV  128

Query  543   YQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASL  722
             +QK R NPLGR +A+G+ +YE +KWAK R+++NPAF+ EKLK                  
Sbjct  129   FQKPRVNPLGRLLAQGLVSYEGEKWAKQRKLLNPAFHVEKLK------------------  170

Query  723   EGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGS  902
                       LM PAF  S  EM++KWE +VS KG  E DVWP+LQ LT D ISRTAFGS
Sbjct  171   ----------LMLPAFYKSASEMVTKWENVVSPKGLAEVDVWPNLQALTSDAISRTAFGS  220

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYV--PGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             +YEEG+RIFELQ+EQ  H ++++R VY+  PG+RF+PTKRNRRM  I +EV  S+R +I+
Sbjct  221   NYEEGRRIFELQREQTEHLMQLARSVYINIPGFRFLPTKRNRRMKQIAREVNGSVREMIN  280

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
              R KAM+ GE  +DDLLG++L+SN QEI + G K+ GM+ E++++ECK+FYFAGQETTS 
Sbjct  281   TRRKAMRAGEAGSDDLLGLMLQSNSQEIEKHGNKDSGMTTEEIVDECKLFYFAGQETTSA  340

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWTM+LL R+ +WQARAREEVLQ FG ++PDF+GLN LK++TMIL+E LRLYPP+  M
Sbjct  341   LLVWTMVLLCRYPEWQARAREEVLQQFGTKDPDFDGLNHLKIVTMILHEVLRLYPPVATM  400

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              RRT+EETKLG + LP G  L LP LLMH D +IWGED KEFKP+RF EG+  ATKG   
Sbjct  401   SRRTIEETKLGNLTLPAGVQLTLPILLMHHDPDIWGEDVKEFKPERFAEGVSHATKGHVA  460

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAP-YSMVTTQPQHGAPLI  1793
             +FPFG GPRIC+GQNFA++EAK+AM+MILQRFSFELSPSY HAP  +    QPQ+GA LI
Sbjct  461   YFPFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYTHAPGTATALVQPQYGAHLI  520

Query  1794  IHKL  1805
             + K+
Sbjct  521   LQKI  524



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/546 (55%), Positives = 399/546 (73%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTLL--GVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             ME+ Y  +   +C+ V LL Y W VL+W WF+PKKLEK+L++ GLKGNPY++  GD+ E+
Sbjct  1     MEIPYNRIIEAICV-VTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEI  59

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
                  +A SKP+  SD+IA R+IPF++  +NK GK  +VW+GP P VLI DPE +KE+  
Sbjct  60    TNKVNEARSKPINFSDDIAQRLIPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFT  119

Query  531   KNYQYQK-ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             KNY YQK    NP     A+G+A  E+DKW KHR+IINPAF+ EK K             
Sbjct  120   KNYAYQKIPHPNPFANSFAKGLAFLEEDKWTKHRKIINPAFHFEKFKH------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M PAF  SC EM+SKW+ I     S E DVWPD+Q +T +VISR
Sbjct  168   ----------------MLPAFYQSCSEMISKWKEINPKGTSVELDVWPDIQLMTGEVISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             T+FGS YEEG+++FELQ+EQ  + ++++  VY+PG RF+PTKRN+RM  IEK+++++IR 
Sbjct  212   TSFGSCYEEGRKVFELQREQAEYVMDMTHSVYIPGSRFLPTKRNKRMLEIEKQIQTTIRH  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             IIDKR++AM+ GE + +DLLGILLESN++EI Q G K+FGM+  ++IEECK+FYFAGQE 
Sbjct  272   IIDKRLRAMEAGEASKNDLLGILLESNMKEIEQHGNKDFGMTTTELIEECKLFYFAGQEG  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
              SV+LVWTMILL    +WQ RAREEVLQV G++ P+ EGLN L ++TMIL E+LR++PP+
Sbjct  332   NSVLLVWTMILLCLHPEWQVRAREEVLQVLGNERPNLEGLNRLHIVTMILNETLRVFPPV  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 RR  +E KLGE+ LP G LL +PT+L+H D ++WGEDA EFKP+RF EG+ KATKG
Sbjct  392   AMFRRRIKDEVKLGELSLPAGVLLFIPTVLIHYDKKLWGEDANEFKPERFSEGVSKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFG GPRIC+G NFA++EAKMA+AMILQ FSFELSPSYAHAP+++V+TQPQ+GAP
Sbjct  452   QASFFPFGRGPRICIGLNFAMMEAKMALAMILQNFSFELSPSYAHAPFAVVSTQPQYGAP  511

Query  1788  LIIHKL  1805
             L++ KL
Sbjct  512   LLMRKL  517



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/536 (57%), Positives = 398/536 (74%), Gaps = 29/536 (5%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             +   I +  L + W  L+WVW +PKK+EK LK +G KG+ Y++L GDMKE+  M  +A +
Sbjct  10    VSFVIMIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKT  69

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KPM  +++   RV+P + + + +YGK+C++W+GP+P + I DPELI+E+L+K+Y YQK +
Sbjct  70    KPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQ  129

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
              NP+ + +A+G+A+YE +KWAKHRRIINPAF+ +KLK                       
Sbjct  130   GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKH----------------------  167

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                   M P+F LSCC+ML KWE IVS +GS E DVWP LQ LT D ISRTAFGS+YEEG
Sbjct  168   ------MLPSFYLSCCDMLRKWESIVSSEGS-EIDVWPFLQTLTSDAISRTAFGSNYEEG  220

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             ++IFELQKEQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + GII+KR++ M+
Sbjct  221   RQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMK  280

Query  1098  GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMI  1277
              GE   DDLLGILLESN +EI+    K FGM+I++VIEECK+FYFAGQETTSV+LVWT+I
Sbjct  281   AGEAAKDDLLGILLESNFKEIQMHRNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLI  340

Query  1278  LLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEE  1457
             LLS+  DWQ RAREEV QVFG  +PD+E L  LKV+TMI  E LRLYPP   + R   EE
Sbjct  341   LLSKHVDWQERAREEVRQVFGSNKPDYETLKQLKVVTMIFNEVLRLYPPGIMIGRTVHEE  400

Query  1458  TKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGG  1637
             TKLG + LP G LLMLP + +H D+EIWG+DAKEFKP+RF EG+ KATKGK  +FPF  G
Sbjct  401   TKLGNLSLPAGMLLMLPAIWLHHDNEIWGDDAKEFKPERFGEGVNKATKGKFAYFPFSWG  460

Query  1638  PRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             PRIC+G NFA++EAKMA+AMILQ ++FELSPSYAHAP++++T QPQHGAPLI+ KL
Sbjct  461   PRICIGLNFAMLEAKMAVAMILQHYAFELSPSYAHAPHTIITLQPQHGAPLILRKL  516



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/541 (56%), Positives = 396/541 (73%), Gaps = 30/541 (6%)
 Frame = +3

Query  189   YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTD  368
             YT+   C+ + ++  +W  L+WVWF+P+KLEK LK+QG +GNPY++L GD+KE++ +  +
Sbjct  9     YTVYSSCLLLVVVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHKE  68

Query  369   ALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQ  548
             A SK + LSD+I PRVIP Y+  V KYGK  Y+W+GP+P ++I DPE +KE+  K Y +Q
Sbjct  69    AQSKNLNLSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVFQ  128

Query  549   KARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEG  728
             K   NPL R +  G+  YE DKW +HR+++NPAF+ EKLK                    
Sbjct  129   KPHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFHIEKLK--------------------  168

Query  729   KSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSY  908
                     LM PAF  S  E+++KWE +VS KGS E DVWP+LQ LT D ISRTAFGS+Y
Sbjct  169   --------LMLPAFHKSASEVVNKWEKVVSPKGSAEVDVWPNLQALTSDAISRTAFGSNY  220

Query  909   EEGKRIFELQKEQGMHFIEV--SRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             EEG+RIFELQ+EQ  H +E   S  +Y+PG+RF+PTKR+RRM  I KEV  SIR +ID R
Sbjct  221   EEGRRIFELQREQAEHIVEAGGSVYIYIPGFRFLPTKRHRRMKQITKEVNDSIREMIDTR  280

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
              KAM+ GE   D+LLG++L+SN QEI + G K++GM+ E++I+ECK+FY AGQETTS +L
Sbjct  281   KKAMRAGEARTDNLLGLMLQSNSQEIEKHGNKDYGMTTEEIIDECKLFYLAGQETTSALL  340

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTMI LSR+ DWQARAREEVLQ FG  +P+F+GLN LK++ MIL+E LRL PPIT   R
Sbjct  341   VWTMIYLSRYPDWQARAREEVLQHFGANDPEFDGLNQLKIVNMILHEVLRLCPPITATAR  400

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
             R  EETKLG + +P G LL+LP +LMH D +IWGED KEFKP+RF EG+  ATKG+  F+
Sbjct  401   RIAEETKLGNLTIPVGVLLVLPIMLMHHDPDIWGEDVKEFKPERFAEGVSHATKGRLAFW  460

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRIC+GQNFA++EAK+AM+MILQRFSFELSPSYAH+P   VT +PQ+GA LI+ K
Sbjct  461   PFGWGPRICIGQNFAMLEAKLAMSMILQRFSFELSPSYAHSPRVAVTLRPQYGAHLILRK  520

Query  1803  L  1805
             +
Sbjct  521   V  521



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/528 (58%), Positives = 399/528 (76%), Gaps = 33/528 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
             +W VL+W+W +PK+LEK L++QG +GNPY +  GD KE  KM  +A+SKPMTLSD+I PR
Sbjct  20    SWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVPR  79

Query  414   VIPFYVQH-VNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             V   YVQH VNK+GK+ ++W GP P+V I DPE IK+V NKNY + K   NPL + +A G
Sbjct  80    VSA-YVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A YE +KW+KHRRIINPAF  EKLK                            +M P F
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLK----------------------------IMLPLF  170

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
             L SC +++SKWEG++S +GSCE D WP LQ LT DVI+R+AFGSSYEEG+RIF+LQ+EQ 
Sbjct  171   LQSCNDLVSKWEGMLSSEGSCEMDAWPFLQNLTSDVIARSAFGSSYEEGRRIFQLQREQT  230

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                ++V  ++ +PGWRF+PTK +RRM  I++E+K+S++ +I+KR KA++ GE   +DLLG
Sbjct  231   ELLMKVILKIQIPGWRFLPTKTHRRMKEIDREIKASLKNMINKREKALKSGEATKNDLLG  290

Query  1131  ILLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             ILLESN +EI++ G    K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  291   ILLESNHKEIQEHGNRNSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  350

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREE  QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM+R   ++ KLG + L
Sbjct  351   QARAREEAFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTL  410

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LPT+L+H DSE+WGEDAK+F P+RF EG++KAT G+  FFPFG GPRIC+GQN
Sbjct  411   PAGVQVFLPTVLIHHDSELWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQN  470

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+L+EAKMA++MILQ F FELSP+YAHAP   +TTQPQ+GA +I+ K+
Sbjct  471   FSLLEAKMALSMILQNFLFELSPAYAHAPTMSITTQPQYGAHIILRKV  518



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/541 (57%), Positives = 405/541 (75%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             L  V IS   + LL YAW +L+ VW KPKK+E++L+QQGL GN YR+L GD +E+++M  
Sbjct  3     LSSVAISFAFITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMID  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A S+P++LSD+I  RV+PF+   + KYGK+C++WMGP+P V I +PELI++VL K+  +
Sbjct  63    EANSRPISLSDDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK   +PLG+ +A GV   E ++W K R+IINPAF+ EKLK                   
Sbjct  123   QKPPVHPLGKLLATGVIALEGEQWTKRRKIINPAFHLEKLKH------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF LSC EM++KWE  +S  GSCE D+WPDL+ L  DVISRTAFGSS
Sbjct  165   ----------MVPAFQLSCSEMVNKWEKKLSKDGSCELDIWPDLENLAGDVISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+LQKEQ    ++VS+ +Y+PGWRFVPTK N+RM  I  EV + ++GII++R 
Sbjct  215   YEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFVPTKTNKRMRQISNEVNALLKGIIERRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             KAM+ GET NDDLLG+L+ESN +E+++ G  K  GMS +DVIEECK+FYFAGQETTSV+L
Sbjct  275   KAMKVGETANDDLLGLLMESNYKEMQEHGERKNVGMSNKDVIEECKLFYFAGQETTSVLL  334

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             +WTM+LLS+  +WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R
Sbjct  335   LWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIR  394

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                 +T++G + LP G  + LP LL+H D EIWG+DAK+F P+RF EG+ KATKG+  FF
Sbjct  395   SVYADTEVGGMYLPDGVQVSLPILLLHHDHEIWGDDAKDFNPERFSEGVSKATKGQFAFF  454

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPR+C+GQNFA++EAKMA+AMILQRFSFELSPSYAHAP S++T QPQ+GA LI+H 
Sbjct  455   PFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISVITIQPQYGAHLILHG  514

Query  1803  L  1805
             L
Sbjct  515   L  515



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/544 (57%), Positives = 397/544 (73%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVG-LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ Y  +    S   +L  AW VL+W W +PKKLEK LK+QGLKGNPYR+L GD KE++
Sbjct  1     MEIGYIRIAAISSCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEIS  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              +  +A SKP+ LSD+I PR++P +   + KYGKS YVW+GP P V I +PELI+EV+ K
Sbjct  61    TLIREAQSKPINLSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK R NPL   +  G+ NY+ DKWAK R++INPAF+ EKLK               
Sbjct  121   IYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M P+F  S  ++L+KW+ +V+  GS E DVWPDL+ LT D ISRTA
Sbjct  167   --------------MLPSFYTSASDILNKWKEVVAPNGSSELDVWPDLETLTSDAISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGS+YEEG+RIFELQ+EQ  ++++V + V +PGWRFVPTKRNRRM  I K V+ +I  II
Sbjct  213   FGSNYEEGRRIFELQREQSEYWLKVVQSVDIPGWRFVPTKRNRRMKQIAKAVQDTILEII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             + R+KA++ G+   DDLLGILLESN +EI   G    GM+I +VIEECK+FYFAGQETTS
Sbjct  273   NSRIKAVREGKAYGDDLLGILLESNFKEINNHGQDGAGMTIREVIEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTMILLSR+ DWQARAREEVLQ+FG ++PDF+GLN L ++TMIL+E LRLY P+  
Sbjct  333   VLLVWTMILLSRYPDWQARAREEVLQLFGTRKPDFDGLNRLNLVTMILHEVLRLYAPVPA  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + RR  EETKLG + LP   LL LP +++H D+EIWG+DAKEFKP+RF EG+  ATKG+ 
Sbjct  393   LSRRVAEETKLGSMRLPADVLLSLPVMVLHHDTEIWGDDAKEFKPERFAEGVPHATKGQV  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPR+C+GQ+FA++EAK+ + MIL+ FSFELSPSY+HAP +++T QPQHGA LI
Sbjct  453   AFFPFGWGPRVCIGQHFAMLEAKLVLVMILRSFSFELSPSYSHAPRAIITLQPQHGAHLI  512

Query  1794  IHKL  1805
             +HKL
Sbjct  513   LHKL  516



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/547 (57%), Positives = 410/547 (75%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVI---YTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             MEVI   Y ++G C++  +L Y W +L+W + +PK+LEK L++QGL GN Y  L GD+KE
Sbjct  1     MEVILILYKIIGACLAFVVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKE  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             +  M   A S P+ L D+I PRV+ F  +   KYGK  ++W+GPRP V+I +PELIKEV+
Sbjct  61    MLNMINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVM  120

Query  528   NKNYQYQKAR-TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
              K   YQK + +NPL + +A+GV  YE DKWAKHR+IINPAF+ EKLK            
Sbjct  121   TKINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLK------------  168

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                             LM PAF LSC E+L+KWE  +SGKGS E DVWP LQ L+ D IS
Sbjct  169   ----------------LMIPAFYLSCDEVLNKWEKSLSGKGSGEVDVWPYLQNLSSDAIS  212

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSY+EG+++FELQ+EQ  + I+ S+ +Y+PGWRF+PTK N RM  IEKEV+SSIR
Sbjct  213   RTAFGSSYKEGRKVFELQREQAEYIIKASQTIYIPGWRFMPTKGNNRMKEIEKEVQSSIR  272

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             G+I+KR+KAM+ GE +N+DLLG+LLESN +EI Q G K FGM+I++V+EECK+FYFAGQE
Sbjct  273   GMINKRVKAMKAGEASNEDLLGLLLESNYKEIEQYGNKSFGMTIDEVVEECKLFYFAGQE  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVW ++LLS++ +WQ +AREEVLQ FG+Q P+F+GLN LK++ MILYE LRLYPP
Sbjct  333   TTSVLLVWALVLLSQYPEWQTKAREEVLQSFGNQIPEFDGLNHLKIVNMILYEVLRLYPP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +  + R   EETKLG++ LP G  + LP + +H + EIWG+DA EFKP+RF EG+ KA K
Sbjct  393   VVALGRIVSEETKLGKLTLPAGVQVSLPIIFLHHNREIWGDDAMEFKPERFSEGVSKAQK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+ +FFPFG GPRICVGQ FA++EAK+A++MILQRFSFELSPSYAHAP++++T QPQHGA
Sbjct  453   GQGIFFPFGWGPRICVGQTFAMLEAKVALSMILQRFSFELSPSYAHAPHTVITLQPQHGA  512

Query  1785  PLIIHKL  1805
              L++HKL
Sbjct  513   HLLLHKL  519



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/544 (56%), Positives = 398/544 (73%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME ++ ++   +   +L +AW V+ W + +PK++EK L++QG  G+ YR+++ ++KE  K
Sbjct  1     MEGVWQIIAASLGFVVLIWAWRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLK  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A S P+ L D+I PR++PFY + +  YG   ++W+G  P V+I DPELIKEV+ K 
Sbjct  61    MVKEAKSNPINLDDDIKPRILPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTKT  120

Query  537   YQYQKART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
             + Y+K +  NPL R +A+G+ +Y+ DKWAKH++IINPAF+ EKLK               
Sbjct  121   HIYKKIKNANPLTRLLAQGLFSYDLDKWAKHKKIINPAFHMEKLK---------------  165

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                          LM PAF LSC E+L+KWE  +S +GSCE DVWP LQ L+ D ISRTA
Sbjct  166   -------------LMIPAFYLSCDEVLNKWEKSLSPEGSCEVDVWPFLQNLSSDAISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSY+EG+RIFELQ+EQ  HF   SR +Y+PGWRFVPTKRN+RM  I +EV+S IRGII
Sbjct  213   FGSSYQEGRRIFELQREQAGHFFIASRSMYIPGWRFVPTKRNKRMKEIAEEVQSLIRGII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
              +R++AM+ GE NN+DLLGILLESN +EI Q G K FGM+I++V+EECK+FYFAGQETTS
Sbjct  273   SRRVEAMKAGEANNEDLLGILLESNAREIEQHGNKTFGMTIDEVVEECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWT++LLSR+ DWQ RAREEVLQVFG Q P F+GLN LK++TMILYE LR YPP+  
Sbjct  333   SLLVWTLVLLSRYPDWQKRAREEVLQVFGRQTPAFDGLNYLKIVTMILYEVLRFYPPVVT  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + RR  EETKLG + LP G  + LP + +H + +IWG+DA EFKP+RF +G+ KA K + 
Sbjct  393   LGRRVTEETKLGNLTLPAGVQISLPLISLHHNRDIWGDDAMEFKPERFSQGVAKAQKRQG  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
             +FFPFG G RIC+GQ FA++EAK+ +AMILQRFSFELSPSY HAP  +V  QPQHGA L+
Sbjct  453   IFFPFGWGSRICIGQVFAMMEAKVVLAMILQRFSFELSPSYQHAPQRVVALQPQHGAHLL  512

Query  1794  IHKL  1805
             +HKL
Sbjct  513   LHKL  516



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/532 (59%), Positives = 400/532 (75%), Gaps = 35/532 (7%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT-LSDN  401
             + YAW VL+WVWF+P+ LEKWL+Q G +GN YR+L GD KE++ M  +A SKP++  S++
Sbjct  17    IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKV  581
             I  RVIP     V+ YG+ C +W GP+P VL+ D ELI+E+L+K+Y +QK  +NPLGR++
Sbjct  77    IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQK-NSNPLGRQL  135

Query  582   ARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQ  761
             ARGVA YE DKWAKHRR+INPAF  +K+K+                            M 
Sbjct  136   ARGVATYETDKWAKHRRLINPAFQPDKIKQ----------------------------ML  167

Query  762   PAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
             P+F LSCC+MLSKWE  ++ +GS E DVWP LQ LT D ISRTAFGSSYEEG++IFELQK
Sbjct  168   PSFYLSCCDMLSKWEEKLAKEGSSEVDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQK  227

Query  942   EQGMHFIEVSRQV--YVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQG--GET  1109
             EQ    ++  + +   +PGWRF+PTK N RM  I KEV+SSIRGIIDKRMK M+   G  
Sbjct  228   EQAELIMQAVQSINFQIPGWRFLPTKMNIRMKQIVKEVESSIRGIIDKRMKEMEAREGSY  287

Query  1110  NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSR  1289
             ++DDLLGILL+SN +EI+Q G K FGMS+++VIEECK+FYFAGQETTS +LVWTMILLS+
Sbjct  288   SSDDLLGILLDSNFREIKQNGNK-FGMSLDEVIEECKLFYFAGQETTSSLLVWTMILLSK  346

Query  1290  FQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLG  1469
               DWQ+RARE+VLQ FG ++PDF+ LN LK++TMIL+E LRLYP    + R T +ET LG
Sbjct  347   HSDWQSRAREDVLQTFGTRKPDFQELNHLKIVTMILHEVLRLYPAGVNLGRTTRKETPLG  406

Query  1470  EIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRIC  1649
             +  LP G  L+LP LL+H DS++WG+DAKEF P+RF EG+ KAT GK  +FPFG GPRIC
Sbjct  407   KSTLPAGVQLILPVLLLHHDSKMWGDDAKEFDPNRFSEGVSKATNGKLSYFPFGWGPRIC  466

Query  1650  VGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +GQ+FA++EAKMA+AMILQR+SF+LSPSY+HAPY+++T QPQHGA LI+ KL
Sbjct  467   LGQSFAILEAKMALAMILQRYSFQLSPSYSHAPYTVITLQPQHGAHLILTKL  518



>ref|NP_001291324.1| cytochrome P450 CYP72A219-like [Sesamum indicum]
 gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/543 (57%), Positives = 404/543 (74%), Gaps = 29/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME + + L +      L YAW +L+WVWF+P+KLEK L+QQG KGN Y++  GD  EL  
Sbjct  1     METLLSSLALISCAVALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKA  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             MT +A SKPM+ S  I PRV P  ++ V  YG+  ++W GPRP V++ DPE+++E+L+K+
Sbjct  61    MTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKS  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +Q    NP  R +ARG+A+YE DKWAKHRR+INPAF+ EKLK                
Sbjct  121   YVFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKH---------------  165

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC +MLSKWE IV  +G CE DVWP LQ LT D ISRTAF
Sbjct  166   -------------MVPAFYLSCADMLSKWEKIVPREGLCELDVWPYLQTLTSDAISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+RIFELQKEQ    +E  R V +PG RF+PTK N+RMN I +EV+SS+ GII+
Sbjct  213   GSSYEEGRRIFELQKEQAELIMEALRTVCIPGSRFLPTKNNKRMNKIVREVESSVLGIIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KRMKA++ GET  DDLLG+LLESNL+EI Q G K FGMS+++VIEECK+FYFAGQETTS 
Sbjct  273   KRMKAIKAGETAGDDLLGLLLESNLKEIEQHGNK-FGMSLKEVIEECKLFYFAGQETTST  331

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWTMILLS+ +DWQ RAR+EVLQ+FG  +PD++ LN LK+++MI +E LRLYPP   +
Sbjct  332   LLVWTMILLSKHKDWQERARDEVLQLFGRDKPDYQELNHLKIVSMIFHEVLRLYPPGVML  391

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
             +R +++E+ LG++ LP G  L++P +L+H D +IWG+DA+EFKP+RF EG+ KAT+G+ V
Sbjct  392   NRISMKESTLGKVTLPAGVQLLMPAVLLHHDRKIWGDDAEEFKPERFSEGVSKATQGQLV  451

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPFG GPRIC+GQ+FA++EAK+AMAMILQ +SFELSPSY+HAP +++T QPQHGA LI+
Sbjct  452   YFPFGWGPRICIGQSFAMLEAKLAMAMILQHYSFELSPSYSHAPATVITLQPQHGAHLIL  511

Query  1797  HKL  1805
              KL
Sbjct  512   RKL  514



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 402/546 (74%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTL---LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME ++ +   + + I +  L + W  L+WVW +PKK+EK LK +G KG+ Y++L GDMKE
Sbjct  1     METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             +  M  +A +KPM  +++   RV+P + + + +YGK+ ++W+GP+P + I DPELI+E+L
Sbjct  61    INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             +K+Y YQK + NP+ + +A+G+ +YE +KWAKHR+IINPAF+ +KLK             
Sbjct  121   SKSYIYQKIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M P+F LSCC+ML KWE I S +GS E DVWP L+ LT D ISR
Sbjct  169   ----------------MLPSFYLSCCDMLRKWESIASSEGS-EIDVWPFLETLTSDAISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+YE+G++IFELQKEQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + G
Sbjct  212   TAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLG  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             II+KR++ M+ GE   DDLLGILLESN +EI+  G K FGM+I++VIEECK+FYFAGQET
Sbjct  272   IINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTIDEVIEECKLFYFAGQET  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWT+ILLS+  DWQ RAREEV QVFG  +PD++ LN LKV+TMI  E LRLYPP 
Sbjct  332   TSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQLKVVTMIFNEVLRLYPPG  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + R   E+TKLG + LP G  L+LP + +H D+EIWG+DAKEFKP+RF EG+ KATKG
Sbjct  392   ITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAKEFKPERFSEGVNKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             K  +FPF  GPRICVG NFA++EAKMA+A+ILQ ++FELSPSYAHAP++++T QPQHGAP
Sbjct  452   KFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSYAHAPHTIITLQPQHGAP  511

Query  1788  LIIHKL  1805
             LI+ KL
Sbjct  512   LILRKL  517



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/546 (55%), Positives = 402/546 (74%), Gaps = 32/546 (6%)
 Frame = +3

Query  177   MEVIYTL---LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME ++ +   + + I +  L + W  L+WVW +PKK+EK LK +G KG+ Y++L GDMKE
Sbjct  1     METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             +  M  +A +KPM  +++   RV+P + + + +YGK+ ++W+GP+P + I DPELI+E+L
Sbjct  61    INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             +K+Y YQ+ + NP+ + +A+G+ +YE +KWAKHR+IINPAF+ +KLK             
Sbjct  121   SKSYIYQEIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKH------------  168

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                             M P+F LSCC+ML KWE I S +GS E DVWP L+ LT D ISR
Sbjct  169   ----------------MLPSFYLSCCDMLRKWESIASSEGS-EIDVWPFLETLTSDAISR  211

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             TAFGS+YE+G++IFELQKEQ    ++ +R +Y+PGWRFVPTKRN+RM  I KEV+S + G
Sbjct  212   TAFGSNYEDGRQIFELQKEQAELILQAARWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLG  271

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQET  1247
             II+KR++ M+ GE   DDLLGILLESN +EI+  G K FGM+I++VIEECK+FYFAGQET
Sbjct  272   IINKRIREMKAGEAAKDDLLGILLESNFKEIQMHGNKNFGMTIDEVIEECKLFYFAGQET  331

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWT+ILLS+  DWQ RAREEV QVFG  +PD++ LN LKV+TMI  E LRLYPP 
Sbjct  332   TSVLLVWTLILLSKHVDWQERAREEVHQVFGSNKPDYDALNQLKVVTMIFNEVLRLYPPG  391

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + R   E+TKLG + LP G  L+LP + +H D+EIWG+DAKEFKP+RF EG+ KATKG
Sbjct  392   ITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHDNEIWGDDAKEFKPERFSEGVNKATKG  451

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             K  +FPF  GPRICVG NFA++EAKMA+A+ILQ ++FELSPSYAHAP++++T QPQHGAP
Sbjct  452   KFAYFPFSWGPRICVGLNFAMLEAKMALALILQHYAFELSPSYAHAPHTIITLQPQHGAP  511

Query  1788  LIIHKL  1805
             LI+ KL
Sbjct  512   LILRKL  517



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/545 (56%), Positives = 402/545 (74%), Gaps = 32/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++Y+L+ V   V +   AW  L+WVW +P+K+EK L++QG  GN YR L GD KE++ 
Sbjct  1     MEILYSLVAVIFGVFVSVNAWRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSS  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKP+  S++I  RV+PF    ++KYG++C++W GP+P  LI DPE+IKE+++KN
Sbjct  61    MGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSKN  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +QK  +NPL + +A+GVA YE DKW KHRR+INPAF+ EKLK                
Sbjct  121   YVFQKI-SNPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKH---------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKW-EGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                          M P+F LSC +MLSKW E IV+ +GSCE DVWP LQ ++ DVISRTA
Sbjct  165   -------------MVPSFYLSCADMLSKWDEKIVAKEGSCEVDVWPYLQSMSSDVISRTA  211

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGS+YEEG++IFELQ+EQ  H ++  + +Y+PGWRF+PTKRNRRM  I KEV+S+I GII
Sbjct  212   FGSNYEEGRKIFELQREQEEHLLQALQTLYIPGWRFLPTKRNRRMKEIVKEVESTILGII  271

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
              KRM+ ++ GE+N+DDLLGILLESN +EI QQ G + GMS+++VI+ECK+FY AGQETTS
Sbjct  272   KKRMQMIEAGESNSDDLLGILLESNFREI-QQNGTQSGMSMKEVIDECKLFYIAGQETTS  330

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQ-EPDFEGLNSLKVLTMILYESLRLYPPIT  1430
              ++ WTMILLS+   WQARAR+EVLQV G   +PDF+ LN LK++ MI +E +RLYPP  
Sbjct  331   SLITWTMILLSKHSGWQARARDEVLQVLGTAGKPDFQHLNRLKIVNMIFHEVMRLYPPAV  390

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +ET LG + LP G  L+LPT+ +H D +IWG+DAKEFKP+RF +G+ KAT  +
Sbjct  391   MLGRAIHKETPLGNVTLPAGLQLLLPTVAVHHDPKIWGDDAKEFKPERFSDGVAKATNVQ  450

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPFGGGPRIC+GQNFA++EAKMA+AMILQR+SFELSPSYAHAP  +VT QPQ GA L
Sbjct  451   FSYFPFGGGPRICIGQNFAMLEAKMALAMILQRYSFELSPSYAHAPNMIVTLQPQFGAHL  510

Query  1791  IIHKL  1805
             I+ KL
Sbjct  511   ILRKL  515



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 395/537 (74%), Gaps = 30/537 (6%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             + + I +  L + W  LDWVW  PKK+EK LK +G KG+ Y+ L GDMKE+  M  +A S
Sbjct  10    ISLVIVIIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKS  69

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KP+  +++   RV P + + + +YGK+CY+W+GP+P +LI +PE I+E+L+K+Y YQK +
Sbjct  70    KPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQ  129

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
              NP+ + +A+G+A+YE +KWAKHRRIINPAF+ +KLK                       
Sbjct  130   GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKH----------------------  167

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                   M P+F LSCC+M++KW+ IVS KGS E DVWP LQ LT D ISRTAFGS+YEEG
Sbjct  168   ------MLPSFYLSCCDMINKWDNIVSSKGS-EVDVWPFLQTLTSDAISRTAFGSNYEEG  220

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             ++IFELQKEQ    I+ +R +Y+PGWRFVPTKRN+R+  I  EV+S + GII+ R+K M+
Sbjct  221   RQIFELQKEQADLIIQAARWIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMK  280

Query  1098  GGETNNDDLLGILLESNLQEIR-QQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
              GE   DDLLGILLESN +EI+     K FGM+I++VIEECK+FYFAGQETTSV+LVWT+
Sbjct  281   EGEATKDDLLGILLESNFKEIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTL  340

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             ILLS+  DWQ RAR+EV QVFG  +PD++ LN LKV+TMI  E LRLYPP   + RR  +
Sbjct  341   ILLSKHLDWQERARQEVHQVFGSNKPDYDMLNQLKVVTMIFNEVLRLYPPGAMIGRRVQK  400

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             ETKLG + LP G LL+LPT+ +  D+EIWG+DAKEF P RF EG+ KATKGK  +FPF  
Sbjct  401   ETKLGNLSLPAGMLLLLPTIYLQHDNEIWGDDAKEFNPKRFSEGVNKATKGKFAYFPFSW  460

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPRIC+GQNFA++EAKMA+AMILQ ++ ELSPSY+HAP++++T QPQHGAPLI+ KL
Sbjct  461   GPRICIGQNFAMLEAKMALAMILQHYALELSPSYSHAPHTIITLQPQHGAPLILRKL  517



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/528 (57%), Positives = 389/528 (74%), Gaps = 29/528 (5%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L +AW +L+W+W KPKKLEK+L++QGLKGN YR+L GD+++L KM  +  SKPM LSD+I
Sbjct  17    LIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLKMRKETTSKPMNLSDDI  76

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
             APRV  ++   V KYGK+ ++W GP P+V I DPELIK VLNK Y +QK   +PL R +A
Sbjct  77    APRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKIYDFQKPNASPLVRLLA  136

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ N E +KW+KHR++INPAF  EKLK                            +M P
Sbjct  137   NGLVNLEGEKWSKHRKLINPAFNIEKLK----------------------------IMLP  168

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
              F  SC ++++KWE ++S  GSCE DVWP LQ L  DVISRTAFGSSYEEGKRIF+LQ E
Sbjct  169   IFFKSCDDLITKWERMLSSDGSCELDVWPFLQNLASDVISRTAFGSSYEEGKRIFQLQIE  228

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
             Q     +V  QV++PGWRF+PT  +RRM  I++E+K+S+  +I+KR  A++ GE   DDL
Sbjct  229   QAELTKKVMIQVFIPGWRFLPTSTHRRMKEIDREIKASLTDMINKREIALKAGEATKDDL  288

Query  1125  LGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LGILLE N +E+ +    K+ GMS++DVIEECK+FYFAGQETTSV+LVW M+LLSR+ DW
Sbjct  289   LGILLELNHKEMEEHDNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDW  348

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEVLQVFG+++PDF+GLN LK++TMILYE LRLYPP     R T ++ KLG + L
Sbjct  349   QARAREEVLQVFGNKKPDFDGLNQLKIVTMILYEVLRLYPPAIATSRSTHKDVKLGNLTL  408

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LP +L+H DSE+WGEDAK F P+RF  GI KAT G+  FFPFGGGPRIC+GQN
Sbjct  409   PAGVQITLPIVLVHHDSELWGEDAKVFNPERFSGGISKATNGRFSFFPFGGGPRICIGQN  468

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+++EAKMAMAMIL++FSFELSPSYAHAP  ++T QP++G  LI+ K+
Sbjct  469   FSMLEAKMAMAMILKKFSFELSPSYAHAPTQVITLQPKYGVHLILRKV  516



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/527 (57%), Positives = 393/527 (75%), Gaps = 31/527 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
             AW VL W+W +PK+LEK L++QGL+GNPY +  GD KE  KM  +ALSKPM LSD+I PR
Sbjct  20    AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             V  +    VNK+GK+ ++W+GP P+V I DPE IK+V NK Y + K   NPL + +A G+
Sbjct  80    VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
             A YE +KW+KHRRIINPAF  EKLK                            +M P F 
Sbjct  140   AGYEGEKWSKHRRIINPAFNLEKLK----------------------------IMLPLFF  171

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC +++SKWEG++S +GSCE D WP LQ L  DVI+R+AFGSSYEEG+RIF+LQ+EQ  
Sbjct  172   KSCNDLVSKWEGMLSSEGSCEMDAWPFLQNLASDVIARSAFGSSYEEGRRIFQLQREQAE  231

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGI  1133
               I+V  ++ +PGWRF+PT  +RRM  I++++K+S++ +I+KR KA++ GE   +DLLGI
Sbjct  232   LLIKVLLKIQIPGWRFLPTNTHRRMKEIDRDIKASLKDMINKREKALKAGEATKNDLLGI  291

Query  1134  LLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LLESN +EI++ G    K  GMS+E+VIEECK+FYFAGQETTSV+LVWTM+LLSR+ DWQ
Sbjct  292   LLESNHKEIQEHGNRNNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQ  351

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             ARAREEV QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM R   ++ KLG + LP
Sbjct  352   ARAREEVFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLP  411

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  ++LPT+L+H D + WGEDAK+F P+RF EG++KAT G+  FFPFG GPRIC+GQNF
Sbjct  412   AGVHVLLPTILIHHDRKFWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNF  471

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +L+EAKMA++MILQ FSFELSP+YAHAP +++T QPQ+GA +I+ K+
Sbjct  472   SLLEAKMALSMILQHFSFELSPAYAHAPTALITIQPQYGAHIILRKV  518



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/541 (57%), Positives = 397/541 (73%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             L  V IS   + LL YAW +L+WVW +PKKLE+ L+QQGL GN YR+L GD +E+++M  
Sbjct  3     LSSVAISFVFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMIN  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A S+P++ SD+I  RV+PF+   + KYGK+ ++W+GP+P V I  PELI++VL K+  +
Sbjct  63    EANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK   +PLG+ +A GVA+ E ++W K R+IINPAF+ EKLK                   
Sbjct  123   QKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFHLEKLKH------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M  AF LSC +M++KWE  +S  GSCE D+WP LQ LT DVISRTAFGSS
Sbjct  165   ----------MVSAFQLSCSDMVNKWEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+LQKEQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR 
Sbjct  215   YEEGRRIFQLQKEQALLTVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             KAMQ GET NDDLLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTS +L
Sbjct  275   KAMQAGETANDDLLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSALL  334

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             +WTM+LLS+  +WQARAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP   + R
Sbjct  335   LWTMVLLSKHSNWQARAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTR  394

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                 ++++G + LP G  + LP LL+H D +IWG+DAKEF P RF EG+ KA K +  FF
Sbjct  395   AVFADSQVGGLYLPDGVQIALPILLIHHDDKIWGDDAKEFNPGRFSEGVSKAAKSQVSFF  454

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRICVGQNFA++EAKMA+AMILQRFSFELSPSYAHAP S++T QPQHGA LI+H 
Sbjct  455   PFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHG  514

Query  1803  L  1805
             L
Sbjct  515   L  515



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/463 (64%), Positives = 360/463 (78%), Gaps = 28/463 (6%)
 Frame = +3

Query  417   IPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVA  596
             +PF++  +NKYGK  ++W+GP+P V I DP+LIKEV  K Y YQK +TNPL + +A+G+ 
Sbjct  1     MPFFLDTINKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLV  60

Query  597   NYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLL  776
               E DKWAKHR+IINPAF+ EKLK                             M PAF L
Sbjct  61    REEGDKWAKHRKIINPAFHLEKLKH----------------------------MLPAFCL  92

Query  777   SCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMH  956
             SC EMLSKWE IVS + + E DVWP LQ LT DVISRTAFGSSYEEG+RIFELQ EQ  +
Sbjct  93    SCTEMLSKWEDIVSVERAYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQY  152

Query  957   FIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGIL  1136
             FIE  R VY+PGW F+PTKRNRRM  IE+ V+++IRGIIDKR+KAM+GGE NN+DLLGIL
Sbjct  153   FIEAVRSVYIPGWSFLPTKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNEDLLGIL  212

Query  1137  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  1316
             LESN +EI Q G K FG+SIE+VIEECK+FYFAGQETTS +LVWT+ILL R  DWQ RAR
Sbjct  213   LESNFKEIEQHGDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAR  272

Query  1317  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  1496
             EEVLQVFG+++PDF+GLN LKV+TMILYESLRLYPP+  + RR  E+T LG++ LP G L
Sbjct  273   EEVLQVFGNRKPDFDGLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVL  332

Query  1497  LMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVE  1676
             L LP +L+H D EIWGEDAK+F P+RFREG+  ATKG+  FFPF  GPRIC+GQNFA++E
Sbjct  333   LSLPAVLLHHDEEIWGEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLE  392

Query  1677  AKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             AKM +AMILQRFSF+LS SYAHAP+S++TTQPQ+GAPLI+H+L
Sbjct  393   AKMVLAMILQRFSFDLSSSYAHAPHSVITTQPQYGAPLILHRL  435



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/527 (57%), Positives = 392/527 (74%), Gaps = 31/527 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
             AW VL W+W +PK+LEK L++QGL+GNPY +  GD KE  KM  +ALSKPM LSD+I PR
Sbjct  20    AWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIPR  79

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             V  +    VNK+GK+ ++W+GP P+V I DPE IK+V NK Y + K   NPL + +A G+
Sbjct  80    VSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATGL  139

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
             A YE +KW+KHRRIINPAF  EKLK                            +M P F 
Sbjct  140   AGYEGEKWSKHRRIINPAFNLEKLK----------------------------IMLPLFF  171

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC +++SKWEG++S +GSCE D WP LQ L  DVI+R+AFGSSYEEG+RIF+LQ+EQ  
Sbjct  172   KSCNDLVSKWEGMLSSEGSCEMDAWPFLQNLASDVIARSAFGSSYEEGRRIFQLQREQAE  231

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGI  1133
               I+V  ++ +PGWRF+PT  +RRM  I++++K+S++ +I+KR KA++ GE   +DLLGI
Sbjct  232   LLIKVLLKIQIPGWRFLPTNTHRRMKEIDRDIKASLKDMINKREKALKAGEATKNDLLGI  291

Query  1134  LLESNLQEIRQQGG---KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LL SN +EI++ G    K  GMS+E+VIEECK+FYFAGQETTSV+LVWTM+LLSR+ DWQ
Sbjct  292   LLASNHKEIQEHGNRNNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQ  351

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             ARAREEV QVFG Q+PDF+GL+ LK++TMILYE LRLYPP+ GM R   ++ KLG + LP
Sbjct  352   ARAREEVFQVFGYQKPDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLP  411

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  ++LPT+L+H D + WGEDAK+F P+RF EG++KAT G+  FFPFG GPRIC+GQNF
Sbjct  412   AGVHVLLPTILIHHDRKFWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNF  471

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +L+EAKMA++MILQ FSFELSP+YAHAP +++T QPQ+GA +I+ K+
Sbjct  472   SLLEAKMALSMILQHFSFELSPAYAHAPIALITIQPQYGAHIILRKV  518



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/545 (56%), Positives = 404/545 (74%), Gaps = 30/545 (6%)
 Frame = +3

Query  177   MEVIYTLLG-VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME++  L+   C  V ++   W + +WVW +P+KLEK+L+ QG  GN YR+  GD+KE+ 
Sbjct  1     MELVLKLISSFCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMI  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  +A SKP+ L D+I PR+IP   + +  YGK+ ++W+GP+P V I +P+ IK+VL+K
Sbjct  61    VMLKEAKSKPINLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              YQ+QK R NPL + +A GVA+ E D+WAKHR++INPAF+ EKLK               
Sbjct  121   FYQFQKPRHNPLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PA  LS  E+++KWE +VS KG  E DV P L+ LT DVISRTA
Sbjct  167   --------------MLPAIYLSSSEIVTKWEEMVSTKGQFELDVLPYLETLTSDVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG++IF+LQ+EQ    I+ S+ +Y+PG RF+PTKRN+RM  I KEVK +++ II
Sbjct  213   FGSSYEEGRKIFQLQREQAELIIQASQTIYLPGMRFLPTKRNKRMKEIAKEVKIALKSII  272

Query  1074  DKRMKAMQGGE-TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             +KR+KAM+ GE +++DDLLGILLESN +EI+Q G   FG+++++VIEECK+F+FAGQETT
Sbjct  273   NKRLKAMEAGERSSHDDLLGILLESNSKEIKQHGNTNFGLTVDEVIEECKLFFFAGQETT  332

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             S +LVWTMILLS+ QDWQ RA+EEVL+ FG+ +PDF+GLN LKV+ MIL E LRLYPPI 
Sbjct  333   SNLLVWTMILLSQHQDWQKRAKEEVLRTFGNNKPDFDGLNHLKVVNMILLEVLRLYPPIL  392

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              +DR   EE KLGEI LP G +L+LP +L+H D EIWG+DAKEF P+RF EG++KATKG+
Sbjct  393   SLDRTIYEEIKLGEISLPAGVILLLPIILLHYDQEIWGDDAKEFNPERFSEGVLKATKGR  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPF  GPRIC+GQNFA++EAKMAMAMILQRFSF LSPSYAHAP++++T QPQ+GA L
Sbjct  453   VTYFPFSWGPRICIGQNFAMLEAKMAMAMILQRFSFVLSPSYAHAPHAIITLQPQYGAHL  512

Query  1791  IIHKL  1805
             I+H L
Sbjct  513   ILHSL  517



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 394/537 (73%), Gaps = 30/537 (6%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             +   I +  L + W  LDWVW  PKKLEK LK +GLKG+ Y+ L GDMKE+  M  +A S
Sbjct  10    ISFVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVEEAKS  69

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KP+  +++   RV P + + + +YGK+CY W+GP+P +LI +PE ++E+L+K+Y YQK +
Sbjct  70    KPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIYQKIQ  129

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
              NP+ + +A+G+A+YE DKWAKHRRIINPAF+ +KLK                       
Sbjct  130   GNPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKH----------------------  167

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                   M P+F LSCC+M++K + IVS KGS E DVWP LQ LT D ISRTAFGS+YEEG
Sbjct  168   ------MLPSFYLSCCDMINKLDNIVSSKGS-EIDVWPFLQTLTSDAISRTAFGSNYEEG  220

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             ++IFELQKEQ    I+ +R +Y+PGWRFVPTKRN+R+  I  EV+S + GII+ R+K M+
Sbjct  221   RQIFELQKEQADLIIQAARWIYIPGWRFVPTKRNKRIKQIANEVRSLVLGIINNRIKEMK  280

Query  1098  GGETNNDDLLGILLESNLQEIR-QQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
              GE   DDLLGILLESN +EI+     K FGM+I++VIEECK+FYFAGQETTSV+LVWT+
Sbjct  281   EGEATKDDLLGILLESNFKEIQIHHENKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTL  340

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             ILLS+  DWQ +AR+EV QVFG  +P+++ LN LKV+TMI  E LRLYPP T + RR  +
Sbjct  341   ILLSKHLDWQEKARQEVHQVFGSNKPNYDMLNQLKVVTMIFNEVLRLYPPGTMIGRRVQK  400

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             ETKLG + LP G LL+LPT+ +  D+EIWG+DAKEF P RF EG+ KATKGK  +FPF  
Sbjct  401   ETKLGHLSLPAGMLLLLPTIYLQHDNEIWGDDAKEFNPMRFSEGVNKATKGKFAYFPFSW  460

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPRIC+GQNFA++EAKMA+AMILQ ++ ELSPSY+HAP++++T QPQHGAPLI+ KL
Sbjct  461   GPRICIGQNFAMLEAKMALAMILQHYALELSPSYSHAPHTIITLQPQHGAPLILRKL  517



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/533 (57%), Positives = 393/533 (74%), Gaps = 29/533 (5%)
 Frame = +3

Query  210   ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT  389
             + + LL YAW +L+WVW +PKKLE+ L+QQGL GN YR+L GD +E+++M  +A S+P++
Sbjct  22    VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  390   LSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPL  569
              SD+I  RV+PF+   + KYGK+ ++W+GP+P V I  PELI +VL K+  +QKA  +PL
Sbjct  82    FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAFQKAPRHPL  141

Query  570   GRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTS  749
              + +A G+A+ E ++W K R+IINPAF+ EKLK                           
Sbjct  142   RKLLASGIASLEGEQWTKRRKIINPAFHLEKLKH--------------------------  175

Query  750   VLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIF  929
               M  AF LSC +M++KWE  +S  GSCE D+WP LQ LT DVISRTAFGSSYEEG+RIF
Sbjct  176   --MVSAFQLSCSDMVNKWEKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIF  233

Query  930   ELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET  1109
             +LQKEQ +  ++V+R VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAMQ GET
Sbjct  234   QLQKEQALLAVQVTRSVYVPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGET  293

Query  1110  NNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLS  1286
              NDDLLG+L+ESN +E+++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS
Sbjct  294   ANDDLLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLS  353

Query  1287  RFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKL  1466
             +  +WQA AREEVL+VFG+++PD + LN LK++TMI +E LRLYPP+  + R    ++++
Sbjct  354   KHSNWQACAREEVLRVFGNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQV  413

Query  1467  GEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRI  1646
             G + LP G  + LP LL+H D +IWGEDAKEF P RF EG+ KA K +  FFPFG GPRI
Sbjct  414   GGLYLPDGVQIALPILLIHHDDKIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRI  473

Query  1647  CVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             CVGQNFA++EAKMA+AMILQRFSFELSPSYAHAP S++T QPQHGA LI+H L
Sbjct  474   CVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  526



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/548 (57%), Positives = 397/548 (72%), Gaps = 36/548 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + IS    + +L +AW +L+WVWFKPK+LEK L+QQG KGN YR L GD+ 
Sbjct  1     MEISYYSLKIAISSFVVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVN  60

Query  345   ELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEV  524
             E+ KM  +ALSKP+  S NI PRV+PF+ + +  YGK+C  W GPRP ++I DPELI+EV
Sbjct  61    EMMKMGKEALSKPIDFSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREV  120

Query  525   LNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
             L KNY +QK    PL +  A G+A YE DKWAKHRR+INPAF+ +KLK            
Sbjct  121   LTKNYIFQKPPGTPLTKLAANGLAGYEADKWAKHRRLINPAFHLDKLKH-----------  169

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                              M PAFLL+  EMLSKWE +VS  GS E DVWP LQ LT D IS
Sbjct  170   -----------------MLPAFLLTASEMLSKWEKVVSTGGS-EIDVWPYLQTLTSDAIS  211

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSYEEG++IFELQKEQ    ++++R +Y+PGWRF+PTK NRRM  I  EV+  I 
Sbjct  212   RTAFGSSYEEGRKIFELQKEQMELLLQIARSLYIPGWRFIPTKTNRRMKQIFNEVRVLIL  271

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQ  1241
             GII KRM  ++ GE   DDLLG LL SNL+EI+Q G  K+FGMSI++VIEECK+FY AGQ
Sbjct  272   GIIKKRMSMIENGEA-PDDLLGTLLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYLAGQ  330

Query  1242  ETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYP  1421
             ETTS +LVWTMILL ++  WQ +AREEVLQVFG+ + D++ LN LK++TMIL E +RLYP
Sbjct  331   ETTSALLVWTMILLCKYPIWQEQAREEVLQVFGNDDLDYDKLNQLKIVTMILNEVMRLYP  390

Query  1422  PITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKAT  1601
                 ++R  ++ETKLG + LP G  L+L T+L+H D+EIWG+DA EF P+RF EG+ KAT
Sbjct  391   SGYFINRMVIKETKLGNLYLPAGVQLLLATILLHHDTEIWGDDAMEFNPERFSEGVAKAT  450

Query  1602  KGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHG  1781
             KG+ VFFPF  GPRIC+GQNFA++EAKM +AMIL+ ++FELSPSYAHAP+ ++  QPQ+G
Sbjct  451   KGQLVFFPFSWGPRICIGQNFAMLEAKMTIAMILKHYAFELSPSYAHAPHPLL-LQPQYG  509

Query  1782  APLIIHKL  1805
             A LI+HKL
Sbjct  510   AHLILHKL  517



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 399/541 (74%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             L  V IS   + LL YAW +L+WVW +PKKLE+ L+QQGL GN YR+L GD +E+ +M +
Sbjct  3     LSSVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMIS  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A S+ ++LSD+I  RV+PF+   + KYGK+ ++WMGP+P V I DPELI++V  K   +
Sbjct  63    EANSRSISLSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             +K   +PLG+ +A G+   E ++W K R+IINPAF+ EKLK                   
Sbjct  123   RKPPPHPLGKLLATGLVTLEGEQWTKRRKIINPAFHLEKLKH------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF LSC +M++KWE  +S  GSCE D+WPDL+ L  D ISRTAFGSS
Sbjct  165   ----------MVPAFQLSCSDMVNKWEKKLSKDGSCELDIWPDLENLAGDAISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+LQKEQ    ++V R VY+PGWRFVPTK N+RM  I  EV + ++GII++R 
Sbjct  215   YEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRMRQISNEVHALLKGIIERRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             KAM+ GET NDDLL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L
Sbjct  275   KAMKVGETANDDLLSLLMESNFREMQEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLL  334

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             +WTM+LLS+  +WQARAREEVLQVFG+++PD +GLN LK++T+I +E LRLYPP++ + R
Sbjct  335   LWTMVLLSKHSNWQARAREEVLQVFGNKKPDGDGLNHLKIVTIIFHEVLRLYPPVSMLIR  394

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
               V ++++G    P GAL+ LP LL+H D EIWGEDAKEF P+RF EG+ KATKG+  F+
Sbjct  395   TVVADSQVGGWYFPDGALITLPILLIHHDHEIWGEDAKEFNPERFSEGVSKATKGQFAFY  454

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPR+C+GQNFA++EAKMA+AMILQRFSFELSPSYAHAP +++T QPQ+GA LI+H 
Sbjct  455   PFGYGPRVCIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPSNIITIQPQYGAYLILHG  514

Query  1803  L  1805
             L
Sbjct  515   L  515



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/528 (56%), Positives = 392/528 (74%), Gaps = 31/528 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             +AW +L+W+WF PK+LEK L++QG +GNPY++L GD KE  KM  +ALSKPM LSD+I P
Sbjct  19    WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV  +    V  +GK+ ++W+GP P+V I DPE IK++ NK Y + K   NPL + +A G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATG  138

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A+YE +KW+KHRR+INPAF  EKLK                             M P F
Sbjct  139   LADYEGEKWSKHRRLINPAFNLEKLKA----------------------------MLPLF  170

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
               SC ++++KWE ++S  GSCE D WP LQ +T DVI+R+AFGSS+EEG+RIF+LQ+EQ 
Sbjct  171   FESCNDLVNKWERMLSSDGSCEIDAWPFLQNMTSDVIARSAFGSSFEEGRRIFQLQREQA  230

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                ++V  ++ +PGWRF+PTK +RRM  I++++K+S++ +I KR KA++ GE  NDDLLG
Sbjct  231   KLALQVILKIQIPGWRFLPTKSHRRMKEIDRDIKASLKDMIYKREKALKKGEAINDDLLG  290

Query  1131  ILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             ILLESN +EI++      K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  291   ILLESNHKEIQEHAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  350

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             Q RAREEVLQVFG+Q+P F+GLN LK++TMIL E LRLYPP  GM+R    + KLG I+L
Sbjct  351   QERAREEVLQVFGNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGNIIL  410

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LPT+L+H + E WGEDAK+F P+RF EG++KATKG+  FFPFG GPRIC+GQN
Sbjct  411   PAGVQIFLPTVLVHHNCEFWGEDAKQFNPERFSEGVLKATKGRVSFFPFGWGPRICIGQN  470

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+L+EAKMA++MILQ FSFELSP+YAHAP  ++T QPQ+GA +I+HK+
Sbjct  471   FSLLEAKMALSMILQHFSFELSPAYAHAPAMLITLQPQYGAHIILHKV  518



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/550 (58%), Positives = 399/550 (73%), Gaps = 38/550 (7%)
 Frame = +3

Query  177   MEVIYT------LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGD  338
             ME+ Y       +L  C  + +L +AW +L+WVWFKPKKLEK L+QQG KGN Y+ L GD
Sbjct  1     MEIPYNYYNLNLVLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGD  60

Query  339   MKELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELI  515
             +KE+ KM  +ALSKP+  S D I PRV+PF+ + +N YGK+C+ W GPRP V+I DPELI
Sbjct  61    VKEMMKMGKEALSKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELI  120

Query  516   KEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLC  695
             +EVL KNY YQK   NPL R  A G+A YE DKWAKHRRI+NPAF+ +KLK         
Sbjct  121   REVLTKNYIYQKPPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKH--------  172

Query  696   SAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCD  875
                                 M PAF L+  E+L KW+ I+S +GS E DVWP LQ LT D
Sbjct  173   --------------------MLPAFQLTSSELLKKWKEIISKEGS-EIDVWPYLQTLTSD  211

Query  876   VISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKS  1055
              ISRTAFGSSYEEGK+IFELQKEQ    ++V+R +Y+PGWRFVPTK NRRM  I  EV +
Sbjct  212   AISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLYIPGWRFVPTKTNRRMKQIFNEVGA  271

Query  1056  SIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFA  1235
              I GII KR+K ++ GE  +DDLL ILL SNLQEI+Q G K+FGMSI++VIEECK+FY A
Sbjct  272   LILGIIKKRIKMIEDGEI-HDDLLSILLTSNLQEIQQHGHKKFGMSIDEVIEECKLFYLA  330

Query  1236  GQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRL  1415
             GQETTS +LVWTMILLS++  WQ RAREEVLQVF   E D++ LN LK +TMIL E LRL
Sbjct  331   GQETTSALLVWTMILLSKYPIWQERAREEVLQVFESDEFDYDKLNHLKSVTMILNEVLRL  390

Query  1416  YPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMK  1595
             YP    ++R   ++TKLG + LP G  L+L T+L+H D+EIWG+DA EF P+RF +G+ K
Sbjct  391   YPSGYFINRVVTKDTKLGNVCLPSGVQLLLGTILLHHDTEIWGDDAMEFNPERFSDGVAK  450

Query  1596  ATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQ  1775
             ATKG+ VFFPF  GPRIC+GQNFA++EAKMA+AMIL+ +SFELSPSYAHAP+ ++  QPQ
Sbjct  451   ATKGQLVFFPFSWGPRICIGQNFAMLEAKMAIAMILKHYSFELSPSYAHAPHPLL-LQPQ  509

Query  1776  HGAPLIIHKL  1805
             +GA LI++KL
Sbjct  510   YGAHLILYKL  519



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/545 (56%), Positives = 397/545 (73%), Gaps = 31/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLL--AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             MEV +  L   +   LL   +AW VL+WVW +PK+LE  L++QGLKGN YR+ SGD+KE 
Sbjct  1     MEVSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKES  60

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             + M  +A SKP+ LS++I  R+ PF +  VN YGK  ++W+GP P+V I +PE IK++ N
Sbjct  61    SLMIKEASSKPINLSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFN  120

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K   + K ++ PL + +A GVA YE +KW +HR+IINPAF+ EKLK              
Sbjct  121   KLGDFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKR-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            + PAF LSC EML+KWE +++ +GSCE DVW  LQ +T DVISRT
Sbjct  168   ---------------LVPAFYLSCSEMLNKWERLLNSEGSCELDVWSYLQNMTGDVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG+RIF+LQKEQG   I+  + VY+PGWRFVPTK NRRM  I  E+++ ++ I
Sbjct  213   AFGSSYEEGRRIFQLQKEQGELAIKSLQTVYIPGWRFVPTKLNRRMKKIYNEIEALVKNI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQET  1247
             I KR  AM+ GE  NDDLLGIL+ESNL+EI++ G  K  G+SI DVIEECK+FY AGQET
Sbjct  273   IHKREGAMRAGEAPNDDLLGILMESNLKEIQEHGNNKNMGISIRDVIEECKLFYIAGQET  332

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TS +LVWTM+LLSRF  WQ RAREEVLQ+FG+ +P F+GL  LKV+TMI YE LRLYPP+
Sbjct  333   TSTLLVWTMVLLSRFPSWQDRAREEVLQIFGNNKPGFDGLTQLKVVTMIFYEVLRLYPPL  392

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
                 R+  ++T+LG + LP G  + +PT+L+H D+E+WGEDAK+FKP+RF EG+ K TKG
Sbjct  393   ILFTRKVEKKTQLGNLSLPAGVEVSIPTILVHRDTELWGEDAKDFKPERFAEGMSKVTKG  452

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  FFPFG GPRICVGQNFA+VEAKMA+A+ILQRF+FELSPSYAHAP +++T QPQ+GA 
Sbjct  453   QVSFFPFGWGPRICVGQNFAMVEAKMALALILQRFTFELSPSYAHAPLTILTLQPQYGAH  512

Query  1788  LIIHK  1802
             +I+HK
Sbjct  513   IILHK  517



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/528 (56%), Positives = 390/528 (74%), Gaps = 31/528 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             +AW +L+W+WF PK+LEK L++QG +GNPY++L GD KE  KM  +ALSKPM LSD+I P
Sbjct  19    WAWKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVP  78

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV  +    V  +GK+ ++W+GP P+V I DPE IK++ NK Y + K   NPL + +A G
Sbjct  79    RVSSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATG  138

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A YE +KW+KHRR+INPAF  EKLK                             M P F
Sbjct  139   LAGYEGEKWSKHRRLINPAFNLEKLKA----------------------------MLPLF  170

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
               SC ++++KWE ++S  GSCE D WP LQ +T DVI+R+AFGSS+EEG+RIF+LQ+EQ 
Sbjct  171   FESCNDLVNKWERMLSSDGSCEIDAWPFLQNMTSDVIARSAFGSSFEEGRRIFQLQREQT  230

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                ++V  +V +PGWRF+PTK +RRM  I++++K+S++ +I KR KA++ GE  NDDLLG
Sbjct  231   KLALQVILKVQIPGWRFLPTKSHRRMKEIDRDIKASLKDMIYKREKALKKGEAINDDLLG  290

Query  1131  ILLESNLQEIRQQG---GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             ILLESN +EI++      K  GMS+EDVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  291   ILLESNHKEIQEHAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  350

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             Q RAREEVLQVFG+Q+P F+GLN LK++TMIL E LRLYPP  GM+R    + KLG I L
Sbjct  351   QERAREEVLQVFGNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGNITL  410

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LPT+L+H D E WGEDAK+F P+RF EG++KATKG+  FFPFG GPRIC+GQN
Sbjct  411   PAGVQIFLPTVLVHHDCEFWGEDAKQFNPERFSEGVLKATKGRVSFFPFGWGPRICIGQN  470

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+L+EAKMA++MILQ FSFELSP+YAHAP  ++T QPQ+GA +I+HK+
Sbjct  471   FSLLEAKMALSMILQHFSFELSPAYAHAPAMLITLQPQYGAHIILHKV  518



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/542 (56%), Positives = 398/542 (73%), Gaps = 33/542 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             L+ V IS   + LL YAW +L+WVW +PKKLE+ L+QQG+ GN YR+L GD++E+ +M +
Sbjct  3     LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A S+P++LSD I  RV+PF+   + KYGK+ ++WMGP+P V I DPELI++V  +   +
Sbjct  63    EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
              K   +PLG+ +A G+   E ++W KHR+IINPAF+ EKLK                   
Sbjct  123   HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKH------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF LSC +M++KWE  +S  GSCE D+WPDL+ LT D ISRTAFGSS
Sbjct  165   ----------MVPAFQLSCGDMVNKWEKKLSKDGSCELDIWPDLENLTGDAISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+LQKEQ    ++V R VY+PGWRFVPTK N+R+  I  E+ + ++GII+KR 
Sbjct  215   YEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             KAM  GET NDDLL +L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTS +L
Sbjct  275   KAMLVGETANDDLLSLLMESNFREMQEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLL  334

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             +WTMILLS+  +WQARAREE+LQVFG+++PD  GLN LK++TMI +E LRLYPP++ + R
Sbjct  335   LWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIR  394

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ-VF  1619
                 ++++G    P G+ + LP LL+H D EIWGEDAKEF P+RF EG+ KATKG Q  F
Sbjct  395   TVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPERFSEGVSKATKGGQFAF  454

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             FPFG GPR C+GQNFA++EAKMA+AMILQRFSFELSPSYAHAP++++T QPQ+GA LI+H
Sbjct  455   FPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPFNVITVQPQYGAHLILH  514

Query  1800  KL  1805
              L
Sbjct  515   GL  516



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/543 (56%), Positives = 392/543 (72%), Gaps = 29/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M+  Y+L+GV   + LL  AW  L+W W  PKK+EK L++QGL+GN YR L GD +++ +
Sbjct  1     MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKP++L+D+I PR++P   + +   GK+ + W+GPRP ++I DPE +KEV  KN
Sbjct  61    MLEEAKSKPISLTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKN  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             + YQK R NP+ + +A G+A+ + +KWAKHRR++NPAF+ EKLK                
Sbjct  121   FTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE +   +GS E DVWP LQ  T DVISRTAF
Sbjct  165   ------------YMVPAFYLSCNEMLSKWENLAPAEGSFELDVWPYLQIFTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YE+G+RIFELQ EQ ++F +V + +Y+PGW FVPTKRN+RM  I KEV S + GII+
Sbjct  213   GSNYEKGRRIFELQSEQALYFEQVMQSIYLPGWSFVPTKRNKRMQKIFKEVNSLVMGIIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             +R+K +Q GE  +DDLLGILLESNL EIRQ G K  G+S+E+VIEECK+FY AGQETTS 
Sbjct  273   ERLKEIQTGEATSDDLLGILLESNLNEIRQHGNKN-GLSLEEVIEECKLFYLAGQETTSG  331

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLS+  DWQARAR+EVLQVF + EPD   LN LK++TMIL E LRLYPP    
Sbjct  332   LLVWTLILLSQHFDWQARARDEVLQVFDNNEPDISKLNHLKIVTMILNEVLRLYPPAANF  391

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R   EETKLG++ LP G  + +  +L+  D ++WG+DAKEFKP+RF EG+ KATKG   
Sbjct  392   FRMNPEETKLGDLSLPEGMFIFVAPILLQQDKDLWGDDAKEFKPERFSEGVSKATKGNLS  451

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             FFPFG GPR C+GQNFA++EAKMA+A+IL+RFS+ELSPSYAHAP  ++T QPQ+GA LI+
Sbjct  452   FFPFGWGPRTCIGQNFAMLEAKMALALILRRFSWELSPSYAHAPQVVLTLQPQYGAQLIL  511

Query  1797  HKL  1805
              KL
Sbjct  512   KKL  514



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/556 (55%), Positives = 404/556 (73%), Gaps = 33/556 (6%)
 Frame = +3

Query  153   TFPIASPEMEVIYTLLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYR  323
             T  + S +++    L+ V IS   + LL YAW +L+WVW +PKKLE+ L+QQG+ GN YR
Sbjct  2     TCVLISRKLKTYRLLISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYR  61

Query  324   ILSGDMKELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRD  503
             +L GD++E+ +M ++A S+P++LSD I  RV+PF+   + KYGK+ ++WMGP+P V I D
Sbjct  62    LLHGDVREMLRMISEANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMD  121

Query  504   PELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMS  683
             PELI++V  +   + K   +PLG+ +A G+   E ++W KHR+IINPAF+ EKLK     
Sbjct  122   PELIRDVFLRYNAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKH----  177

Query  684   STLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQG  863
                                     M PAF LSC +M++KWE  +S  GSCE D+WPDL+ 
Sbjct  178   ------------------------MVPAFQLSCGDMVNKWEKKLSKDGSCELDIWPDLEN  213

Query  864   LTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEK  1043
             LT D ISRTAFGSSYEEG+RIF+LQKEQ    ++V R VY+PGWRFVPTK N+R+  I  
Sbjct  214   LTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTNKRIRQIRN  273

Query  1044  EVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECK  1220
             E+ + ++GII+KR KAM  GET NDDLL +L+ESN +E+++    K  GMSI+DVIEECK
Sbjct  274   ELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQEHDERKNVGMSIDDVIEECK  333

Query  1221  VFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILY  1400
             +FYFAGQETTS +L+WTMILLS+  +WQARAREE+LQVFG+++PD  GLN LK++TMI +
Sbjct  334   LFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVFGNKKPDGNGLNHLKIVTMIFH  393

Query  1401  ESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFR  1580
             E LRLYPP++ + R    ++++G    P G+ + LP LL+H D EIWGEDAKEF P+RF 
Sbjct  394   EVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILLIHHDHEIWGEDAKEFNPERFS  453

Query  1581  EGIMKATKGKQ-VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSM  1757
             EG+ KATKG Q  FFPFG GPR C+GQNFA++EAKMA+AMILQRFSFELSPSYAHAP+++
Sbjct  454   EGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALAMILQRFSFELSPSYAHAPFNV  513

Query  1758  VTTQPQHGAPLIIHKL  1805
             +T QPQ+GA LI+H L
Sbjct  514   ITVQPQYGAHLILHGL  529



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/549 (54%), Positives = 397/549 (72%), Gaps = 34/549 (6%)
 Frame = +3

Query  162   IASPEMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDM  341
             +A+    +++TL+ +      L +AW +L+W+W KPKKLEK L++QGLKGN YR+L GD+
Sbjct  1     MATTTAIILFTLMTLS-----LIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDI  55

Query  342   KELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             K+L K+  +A SKPM LSD+I PRV  F  Q V K+GK+ ++W GP P+V I DPE IK+
Sbjct  56    KDLLKIRKEATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKD  115

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             V+NK Y +QK   NPL R +  G+   E ++W+KHR+IINPAF+ EKLK           
Sbjct  116   VINKIYDFQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLK-----------  164

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                              ++ P F  SC +++SKWE ++S  GSCE DVWP LQ L  D+I
Sbjct  165   -----------------IILPIFHKSCDDLISKWEKMLSSDGSCEMDVWPFLQNLASDLI  207

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SR AFGSSYEEGKRIF+LQ EQ     ++  +VY+PGWRF+PT   RRM  IE++V++S+
Sbjct  208   SRAAFGSSYEEGKRIFQLQTEQAELTTKIIEKVYIPGWRFLPTTTPRRMKEIERDVRASL  267

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAG  1238
               +I+ R +A+  GE   DDLLGILLESN +E+ +    K  GMS++DVIEECK+FYFAG
Sbjct  268   TDMINTRERALMAGEATKDDLLGILLESNHKEMEEHDNNKNVGMSLDDVIEECKLFYFAG  327

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
              ETTSV+LVWT++LLSR+ DWQARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLY
Sbjct  328   AETTSVLLVWTIVLLSRYPDWQARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLY  387

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
             PP+  + R   ++ KLG + LP G  + LP +L+H DSE+WG+DAK F P+RF EG++KA
Sbjct  388   PPVIELARSVHKDVKLGNLTLPAGVQITLPIVLVHHDSELWGDDAKVFNPERFSEGVLKA  447

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             T G+  F PFGGGPRIC+GQNF+++EAKMA+AMILQRFSFELSPSYAHAP +++T QPQ+
Sbjct  448   TNGRNSFVPFGGGPRICIGQNFSMLEAKMAIAMILQRFSFELSPSYAHAPTALITLQPQY  507

Query  1779  GAPLIIHKL  1805
             GA +I+ K+
Sbjct  508   GAHIILRKV  516



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/537 (55%), Positives = 399/537 (74%), Gaps = 30/537 (6%)
 Frame = +3

Query  201   GVCISVGL-LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             G+ + + L + +AW +L+W+W +PKKLE+ L++QGL+GNPYR++ GD+K+L KM  +A S
Sbjct  12    GITLVIVLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKS  71

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KPM LSD+I PRV P+  Q V K+GK+ ++W GP P+V + DPE IK+VLNK Y + K+ 
Sbjct  72    KPMNLSDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSD  131

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
              + L + +A G+ +YE +KW+KHRRIINPAF  EKLK                       
Sbjct  132   GDRLVKLLATGLVSYEGEKWSKHRRIINPAFNLEKLK-----------------------  168

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                  +M P F  SC ++++KWEG++S  GSCE D+WP LQ L  DVI+R AFGSSYEEG
Sbjct  169   -----IMLPIFFQSCNDLITKWEGMLSSDGSCEMDIWPFLQNLASDVIARAAFGSSYEEG  223

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             +RIF+LQKEQ  H + V  +VY+PGWRF+PT  +RRM  I++E+K+S++ +I+KR +A++
Sbjct  224   RRIFQLQKEQVEHTMSVLVKVYIPGWRFLPTTTHRRMKKIDREIKASLKEMINKRERALK  283

Query  1098  GGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
              GE   ++LL ILLESN +E+ + G  +  GMS+EDVIEECK+FYFAGQETTS +LVWTM
Sbjct  284   AGEATKNNLLDILLESNHKEVEEHGNNRNVGMSLEDVIEECKLFYFAGQETTSGLLVWTM  343

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             +LLSR+ DWQARAREEVLQVFG+++PDF+GL+ LK++TMILYE LRLYPP+  + R   +
Sbjct  344   VLLSRYPDWQARAREEVLQVFGNKKPDFDGLSHLKIVTMILYEVLRLYPPVIALARTVHK  403

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             + KLG   LP G  L LP +L H D E+WG+DA+ F P+RF EG++KAT GK  FFPFG 
Sbjct  404   DVKLGNRTLPAGVQLYLPIVLFHHDRELWGDDAEVFNPERFSEGVLKATNGKVSFFPFGW  463

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPRICVGQNF+L+EAKMA++MILQ FSFELSP+YAHAP +++T +PQ+GA +I+ K+
Sbjct  464   GPRICVGQNFSLLEAKMAVSMILQHFSFELSPAYAHAPTTVITLRPQYGAHIILRKV  520



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/539 (55%), Positives = 394/539 (73%), Gaps = 29/539 (5%)
 Frame = +3

Query  192   TLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
             +++ V + + L ++AW +L+W+W +PK+LE+ L++QGL+GNPYRIL GD+KE+ K+  +A
Sbjct  11    SIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEA  70

Query  372   LSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
              SKPM LS +I PRV     Q V K+GK+ ++W GP+P+V + DPELIK+VLNK   ++K
Sbjct  71    RSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRK  130

Query  552   ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGK  731
                NPL + +A G+ NY+ +KW KHRR+INPAF  EKLK                     
Sbjct  131   PEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLK---------------------  169

Query  732   SQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYE  911
                    +M P F  SC +++ KWEG++S  GSCE DVWP LQ L  DVI+RTAFGSS+E
Sbjct  170   -------IMLPIFFKSCNDLIIKWEGMLSYDGSCEMDVWPFLQNLASDVIARTAFGSSFE  222

Query  912   EGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKA  1091
             EGKRIF+LQKE     ++V  +VY+PGWRFVPT  NRRM  I++ +K+S+  +I KR KA
Sbjct  223   EGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDRYIKASLTDMIKKREKA  282

Query  1092  MQGGETNNDDLLGILLESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVW  1268
              + GE   DDLLGILLESN +EI++    E  GM++ DVIEECK+FYFAGQETTSV+LVW
Sbjct  283   PKTGEATRDDLLGILLESNHKEIQEHRNNENVGMNLNDVIEECKLFYFAGQETTSVLLVW  342

Query  1269  TMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRT  1448
             TM+LLSR+ DWQ+RAREEVLQVFG Q P+F+GL+ LK++TMILYE LRLYPP  G+ R  
Sbjct  343   TMVLLSRYPDWQSRAREEVLQVFGKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSV  402

Query  1449  VEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPF  1628
               + KLG + LP G  + LP +++H D E+WG+DAKEF P+RF EG+ KAT G+  FFPF
Sbjct  403   HRDMKLGNLTLPAGVQVSLPIIMVHHDRELWGDDAKEFNPERFSEGVSKATNGRVSFFPF  462

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             G GPRIC+GQNF+L+EAKMA++MILQ FSFELSP+Y HAP++++T QPQ+GA +I+ K+
Sbjct  463   GWGPRICIGQNFSLLEAKMALSMILQHFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  521



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/549 (58%), Positives = 400/549 (73%), Gaps = 37/549 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + IS    + +L +AW +L++VW KPK+LEK+L+QQG KGN Y+ L GDMK
Sbjct  1     MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E+ KM  +A+SKP+  S D I PRV+PF  + +  YGK+C VW GPRP VLI DPEL+KE
Sbjct  61    EMKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KN+ YQK   NPL +  A G+A YE DKWA HRR++NPAF+ +KLK           
Sbjct  121   VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKH----------  170

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF  +  EMLSK E +VS  G+ E DVWP LQ LT D I
Sbjct  171   ------------------MLPAFQFTASEMLSKLEKVVSPNGT-EIDVWPYLQTLTSDAI  211

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGSSYEEG++IF+LQKEQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ +
Sbjct  212   SRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALV  271

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAG  1238
              GII KRM  ++ GE   DDLLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAG
Sbjct  272   FGIIKKRMSMIENGEA-PDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAG  330

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
             QETTS +LVWTMILL ++ +WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLY
Sbjct  331   QETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLY  390

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
             P    ++R   +ETKLG + LP G  L+LPT+L+  D+EIWG+DA EF P+RF +GI KA
Sbjct  391   PAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAMEFNPERFSDGISKA  450

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             TKGK VFFPF  GPRIC+GQNFA++EAKMAMAMIL+ ++FELSPSYAHAP+ ++  QPQ+
Sbjct  451   TKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYAHAPHPLL-LQPQY  509

Query  1779  GAPLIIHKL  1805
             GA LI++KL
Sbjct  510   GAQLILYKL  518



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/534 (59%), Positives = 394/534 (74%), Gaps = 32/534 (6%)
 Frame = +3

Query  207   CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPM  386
             C  + +L +AW +L+WVWFKPK LEK L+QQG KGN Y+ L GD+KE+ KM  +ALSKP+
Sbjct  19    CAIILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSKPI  78

Query  387   TLSDNIA-PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
               S ++  PRV+PF+ + +N YGK+C+ W GPRP V+I DPELI+EVL+KNY YQK   N
Sbjct  79    DFSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPPGN  138

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL R  A G+A YE DKWAKHRRIINP F+ +KLK                         
Sbjct  139   PLTRLAANGLAGYEADKWAKHRRIINPGFHLDKLKH------------------------  174

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                 M PAF L+  EML+KW+ I+S +GS E DVWP LQ LT D ISRTAFGSSYEEGK+
Sbjct  175   ----MLPAFQLTSSEMLNKWKEIISKEGS-EIDVWPYLQTLTSDAISRTAFGSSYEEGKK  229

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IFELQKEQ    ++V+R +Y+PGWRFVPTK NRRM  I  EV + I GII+KR+K ++ G
Sbjct  230   IFELQKEQMELLLQVARSLYIPGWRFVPTKTNRRMKQIFNEVGALILGIINKRIKMIEDG  289

Query  1104  ETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILL  1283
             E  +DDLL ILL SNLQEI+Q G K+FGMSI++VIEECK+FY AGQETTS +LVWTMILL
Sbjct  290   EI-HDDLLSILLASNLQEIQQHGHKKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILL  348

Query  1284  SRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETK  1463
             S++  WQ RAR+EVLQVF   E D++ LN LKV+TMIL E LRLYP    ++R   ++TK
Sbjct  349   SKYPIWQQRARQEVLQVFESDEFDYDKLNHLKVVTMILNEVLRLYPSAYFINRVVTKDTK  408

Query  1464  LGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPR  1643
             LG + LP G  L+L T+L+H D+EIWG+DA EF P+RF +G+ KATKG+ VFFPF  GPR
Sbjct  409   LGNLCLPSGVQLLLGTILLHHDTEIWGDDAMEFNPERFSDGVAKATKGQLVFFPFSWGPR  468

Query  1644  ICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             IC+GQNFA++EAKMA+AMIL+ +SFELS SYAHAP+ ++  QPQ+GA LI++KL
Sbjct  469   ICIGQNFAMLEAKMAIAMILKHYSFELSSSYAHAPHPLL-LQPQYGAHLILYKL  521



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/544 (55%), Positives = 389/544 (72%), Gaps = 30/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME   +   + ++   +   + + +W+WFKPKK+EK+L++QGL G  Y+ + GD+KEL +
Sbjct  1     MESPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQ  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M+ +A SKPM+L+ +IA RV+PFY   ++ +GK+C+ W+G +P V + +P +I+EVLN  
Sbjct  61    MSNEAKSKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNY  120

Query  537   YQYQKART-NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              QYQK R  NPL + +ARGVA+ E D+W KHR+IINPAF+ EKLK               
Sbjct  121   NQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF +SC EML KW   V+ + S E DVW  L   + DVISRTA
Sbjct  167   --------------MVPAFYVSCSEMLDKWGETVTKESSGEVDVWTYLSTFSADVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG++IFELQ+EQ +  I+ S+ VY+PG RF+PTK N+RM  I++E+K+SI+ II
Sbjct  213   FGSSYEEGRKIFELQREQAVLIIKASQSVYIPGLRFLPTKSNKRMKEIDREIKASIKNII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             DKR+ AM+  ET+NDDLLGILL+SN +EI+Q G K +G+SIEDVIEECK+FYFAGQETT 
Sbjct  273   DKRVVAMKAKETSNDDLLGILLDSNDKEIKQHGSK-YGLSIEDVIEECKLFYFAGQETTG  331

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              MLVWTMILL    DWQ RAREEVL VFGD+ PD +GL+ LKV+ +I +E LRLYPP   
Sbjct  332   TMLVWTMILLGHHTDWQRRAREEVLHVFGDKTPDIDGLSHLKVINIIFHEVLRLYPPAQL  391

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   EETKLG + LP G L+ L  LL H D + WGED  EF P+RF EG+ KATKG+ 
Sbjct  392   LRRMIHEETKLGNLTLPAGTLVQLNILLSHHDKDTWGEDVHEFNPERFSEGVSKATKGRA  451

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              + PFGGGPRIC+GQNFA++EAKMA+AMILQRFSFE+SPSY HAP+S+ T QPQ GA LI
Sbjct  452   TYLPFGGGPRICMGQNFAMLEAKMALAMILQRFSFEVSPSYTHAPHSIFTLQPQFGAHLI  511

Query  1794  IHKL  1805
             +HK+
Sbjct  512   LHKV  515



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/551 (55%), Positives = 399/551 (72%), Gaps = 36/551 (7%)
 Frame = +3

Query  165   ASPEMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             A+    V  +L+ V I   ++ +AW +LDWVWFKPKKLE+ L+QQG +GN YR+  GDMK
Sbjct  3     AAVATSVALSLVFVSI---IVRWAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMK  59

Query  345   ELAKMTTDALSKPMTLS--DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIK  518
             E A M  +A SKPM LS   +I+PRVIP   Q V  YGK+ +VW+GP P+V I +PE +K
Sbjct  60    ENAIMVKEAKSKPMNLSTSHDISPRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLK  119

Query  519   EVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCS  698
             +V  K   + K  +NPL + ++ G+ANYE +KWAKHRRIINP F+SEK+K          
Sbjct  120   DVFAKPSDFPKPVSNPLIKLLSTGLANYEGEKWAKHRRIINPTFHSEKVKR---------  170

Query  699   AALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS-CERDVWPDLQGLTCD  875
                                M PAF  SC +M+ +WE +VS +GS CE DVWP LQ LT D
Sbjct  171   -------------------MLPAFYQSCNDMIKEWETVVSKEGSSCEIDVWPSLQNLTAD  211

Query  876   VISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKS  1055
             VISRTAFGSSY+EG++IFEL KEQ ++ ++  ++VY+PGWRFVPTK N+RM  I +E++ 
Sbjct  212   VISRTAFGSSYQEGQKIFELLKEQAVYAMKTVQRVYIPGWRFVPTKMNKRMKQIHEEIRG  271

Query  1056  SIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG--GKEFGMSIEDVIEECKVFY  1229
              + GII+KR +A++ GE   DDLLG LLESN+++I+  G   K  GMSIEDVIEECK+FY
Sbjct  272   LVEGIINKREQAIKAGEATKDDLLGALLESNMKDIQDHGKNNKNVGMSIEDVIEECKLFY  331

Query  1230  FAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESL  1409
             FAGQETTSV+LVWTM+LL + Q+WQ +AREEVLQVFG  +PDF+GL  LK +TM+L E L
Sbjct  332   FAGQETTSVLLVWTMVLLCQNQNWQDQAREEVLQVFGMNKPDFDGLTHLKAVTMVLLEVL  391

Query  1410  RLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGI  1589
             RLYP +  + R T ++T+ G+  LP G  + LP LL+H D E+WG+DAKEFKP+RF EG+
Sbjct  392   RLYPALVVVSRTTRKKTQFGKFSLPAGVQVGLPALLIHHDKELWGDDAKEFKPERFSEGV  451

Query  1590  MKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQ  1769
              KATKG+  FFPFG GPRIC+GQNFA+ EAK+A+A+ILQ F+FELSPSYAHAP +++T Q
Sbjct  452   SKATKGQLSFFPFGAGPRICIGQNFAMTEAKLALALILQHFTFELSPSYAHAPSALITLQ  511

Query  1770  PQHGAPLIIHK  1802
             PQ+GAP+++HK
Sbjct  512   PQYGAPVMLHK  522



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/550 (56%), Positives = 407/550 (74%), Gaps = 33/550 (6%)
 Frame = +3

Query  168   SPEMEVIYTLLGVCIS-VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             S +M VI T + V I  V +L +AW VL+WVWF+PKK+E+ L+QQG  G PYR+L GD K
Sbjct  27    SVKMTVIVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLLGDWK  86

Query  345   ELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEV  524
             E + M  +A +KP+ LS+ + PRV+PF  Q V  YGK+ ++W+GP+P+V I +P+ I++V
Sbjct  87    ESSDMLKEARTKPLGLSEALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDV  146

Query  525   LNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
               K  +YQKA ++PL + +A G+A++E +KWAKHR+IINPAF+ EKLK            
Sbjct  147   FMKINEYQKA-SHPLLKALACGLASHEGEKWAKHRKIINPAFHQEKLK------------  193

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSG-KGSCERDVWPDLQGLTCDVI  881
                             LM PAF  SC  M++KWE +VS  +GSCE DVWPDL+GLTCD I
Sbjct  194   ----------------LMIPAFYESCSGMINKWEKLVSADEGSCELDVWPDLRGLTCDAI  237

Query  882   SRTAFGSSYEEGKRIFELQKE-QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSS  1058
             SRT+FGS+YEEGKRIF+L KE   +    + + + +PG+RF+P   NRR+ AI+KE+K+S
Sbjct  238   SRTSFGSNYEEGKRIFDLLKEFTDLTVHVIMKAIVIPGYRFLPIPSNRRLKAIDKEIKAS  297

Query  1059  IRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFA  1235
             +  +I KR KAM  GE   +DLL +LLESN +EI++ G  K  GMSIEDVI+ECK+FYFA
Sbjct  298   LNALISKREKAMSAGEDAKNDLLDLLLESNFREIQEHGNTKSVGMSIEDVIDECKIFYFA  357

Query  1236  GQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRL  1415
             GQETTSV+L WTM+LL+++ +WQAR REEV+QVFG+++PDF+GLN LKV+TMILYE LRL
Sbjct  358   GQETTSVLLTWTMVLLAQYPNWQARGREEVVQVFGNKKPDFDGLNHLKVVTMILYEVLRL  417

Query  1416  YPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMK  1595
             YPP+  ++R   EE KLG ++LP G  + +PT+L+H D E+WG+DA EFKP+RF EG+ K
Sbjct  418   YPPVIMLNRDVHEEIKLGNLLLPAGVQISVPTILLHQDRELWGDDASEFKPERFAEGVSK  477

Query  1596  ATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQ  1775
             ATK +  F PFG GPRICVGQNFA++EAKMA+AMILQR SFELSPSY HAP++++T QPQ
Sbjct  478   ATKSQVSFLPFGWGPRICVGQNFAMIEAKMALAMILQRCSFELSPSYVHAPHTVITLQPQ  537

Query  1776  HGAPLIIHKL  1805
             HGAP+I+ KL
Sbjct  538   HGAPMILRKL  547



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/549 (58%), Positives = 399/549 (73%), Gaps = 37/549 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + IS    + +L +AW +L++VW KPK+LEK+L+QQG KGN Y+ L GDMK
Sbjct  1     MEIPYYSLKIAISSFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMK  60

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E  KM  +A+SKP+  S D I PRV+PF  + +  YGK+C VW GPRP VLI DPEL+KE
Sbjct  61    ETKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKE  120

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KN+ YQK   NPL +  A G+A YE DKWA HRR++NPAF+ +KLK           
Sbjct  121   VLTKNFVYQKPLGNPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKH----------  170

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF  +  EMLSK E +VS  G+ E DVWP LQ LT D I
Sbjct  171   ------------------MLPAFQFTASEMLSKLEKVVSPNGT-EIDVWPYLQTLTSDAI  211

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGSSYEEG++IF+LQKEQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ +
Sbjct  212   SRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALV  271

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAG  1238
              GII KRM  ++ GE   DDLLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAG
Sbjct  272   FGIIKKRMSMIENGEA-PDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAG  330

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
             QETTS +LVWTMILL ++ +WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLY
Sbjct  331   QETTSSLLVWTMILLCKYPNWQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLY  390

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
             P    ++R   +ETKLG + LP G  L+LPT+L+  D+EIWG+DA EF P+RF +GI KA
Sbjct  391   PAGYVINRMVNKETKLGNLCLPAGVQLVLPTMLLQHDTEIWGDDAMEFNPERFSDGISKA  450

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             TKGK VFFPF  GPRIC+GQNFA++EAKMAMAMIL+ ++FELSPSYAHAP+ ++  QPQ+
Sbjct  451   TKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKTYAFELSPSYAHAPHPLL-LQPQY  509

Query  1779  GAPLIIHKL  1805
             GA LI++KL
Sbjct  510   GAQLILYKL  518



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/526 (56%), Positives = 387/526 (74%), Gaps = 29/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             +AW +L+W W KPK++EK L++QG KGN YR L GD++E A ++  A SKP++  D+IAP
Sbjct  39    WAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAP  98

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+P Y Q V  YGK CY W+GP P + I DP+ +KEV  K   +QK ++NPLG+ +  G
Sbjct  99    RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTG  158

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A++E +KWAKHR+IINPAF+ EKLK                            LM PAF
Sbjct  159   LASHEGEKWAKHRKIINPAFHQEKLK----------------------------LMLPAF  190

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
               SC E++SKWE ++S +GSCE DVWP +  LT DVISRTAFGS+YEEG RIF+LQ E  
Sbjct  191   NQSCSEIISKWENLMSTEGSCELDVWPYIVNLTSDVISRTAFGSNYEEGIRIFQLQTELA  250

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                ++  + VY+PGWR+VPTKRNRRM  ++KE++  +  II KR  AM+ GE   DDLLG
Sbjct  251   DLALQALQSVYIPGWRYVPTKRNRRMKELDKEIRVRLADIIRKREIAMKTGEAAKDDLLG  310

Query  1131  ILLESNLQEIRQQGGKEF-GMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             +L+ESNL+EI++ G  +  G+S +DVI+ECK+FYFAGQETTSV+L+WTM+LLS+ QDWQA
Sbjct  311   LLMESNLKEIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQA  370

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
              AREEVLQVFGD++PDF+GLN LK++ MI YE LRLYPP+  + R   +ETK+G+++LP 
Sbjct  371   HAREEVLQVFGDKKPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPA  430

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
              +++ L TLL+H D ++WG+DAKEFKP+RF EGI KATK +  +FPF  GPRIC+GQNFA
Sbjct  431   ESVIALQTLLVHHDKKLWGDDAKEFKPERFSEGISKATKNQVSYFPFAWGPRICIGQNFA  490

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             LVEAKMAMAMILQ FSFELS SY HAP++ +  QPQHGA LI+ KL
Sbjct  491   LVEAKMAMAMILQNFSFELSASYVHAPHAFIFLQPQHGAHLILRKL  536



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/529 (56%), Positives = 391/529 (74%), Gaps = 29/529 (5%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + +L YAW VL+W+W +PK+LE+ LKQQGL GN YR+L GD KE++ M  +A S+P+++S
Sbjct  16    ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISIS  75

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGR  575
             D+I  RV PF+   + KYGKS ++WMGP+P+V I +PELI++VL+ +  ++K R + L +
Sbjct  76    DDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  576   KVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVL  755
              +  G+   + +KWAKHR+IINPAF  EKLK                             
Sbjct  136   LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKN----------------------------  167

Query  756   MQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFEL  935
             M PAF LSC +M+SKWEG +S +GSCE DVWP LQ LT D ISRTAFGS+YEEG+ IFEL
Sbjct  168   MLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFEL  227

Query  936   QKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  1115
             Q+EQ    ++ S   ++PGWRF+PTK N+RM  I KEV + + GIIDKR KAM+ GET N
Sbjct  228   QREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLN  287

Query  1116  DDLLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
             DDLLGILLESN +EI++ +  K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+ 
Sbjct  288   DDLLGILLESNFKEIQEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKH  347

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G+
Sbjct  348   PNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGD  407

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + LP G  + LPT+L+H D EIWGEDA+EF P+RF +G++KATK    FFPFG G R+C+
Sbjct  408   MYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCI  467

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             GQNFA++EAKM +AMILQRFSF LSPSY+HAP S+VT +PQ+GA LI+H
Sbjct  468   GQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILH  516



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/549 (57%), Positives = 397/549 (72%), Gaps = 37/549 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + I     + +L +AW +L++VW KPK+LEK ++QQG KGN Y+ L GDMK
Sbjct  1     MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E+ KM  +A+SKP+  S D I PRV+PF  + +  YGK+C+VW GPRP VLI DPEL+KE
Sbjct  61    EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KN+ YQK    PL +  A G+A YE DKWA HRR++NPAF+ +KLK           
Sbjct  121   VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKH----------  170

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF  + CEMLSK E +VS  G+ E DVWP LQ LT D I
Sbjct  171   ------------------MLPAFQFTACEMLSKLEKVVSPNGT-EIDVWPYLQTLTSDAI  211

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGSSYEEG++IFELQKEQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ +
Sbjct  212   SRTAFGSSYEEGRKIFELQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALV  271

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAG  1238
              GII KR+  ++ GE   DDLLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAG
Sbjct  272   LGIIKKRLSMIENGEA-PDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAG  330

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
             QETTS +LVWTMILL +   WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLY
Sbjct  331   QETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLY  390

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
             P    ++R   +ETKLG + LP G  L+LPT+L+  D+EIWG+DA EF P+RF +GI KA
Sbjct  391   PAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAMEFNPERFSDGISKA  450

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             TKGK VFFPF  GPRIC+GQNFA++EAKMAMAMIL+ ++FELSPSYAHAP+ ++  QPQ+
Sbjct  451   TKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYAHAPHPLL-LQPQY  509

Query  1779  GAPLIIHKL  1805
             GA LI++KL
Sbjct  510   GAQLILYKL  518



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/547 (54%), Positives = 393/547 (72%), Gaps = 34/547 (6%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             E+E+I T   +C+++ L+ Y W VL+W WF+PKK EK+L++ GL GNPY++L GD+KEL 
Sbjct  8     EVEMIAT---ICVAILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELT  64

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
                 +A SKP++ S ++  R+IPF+   +NK GK+ + W+GP+P V I +P LIK++  K
Sbjct  65    NKLNEAKSKPISFSGDVPQRLIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEK  124

Query  534   NYQYQKAR-TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             +Y Y K + +NP  + + +G+   E+ KWAKHR+IINPAF+ EKLK              
Sbjct  125   HYVYHKNKHSNPFAKLLVQGLVTLEEQKWAKHRKIINPAFHFEKLKH-------------  171

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF  SC EML KWE  V  + S E DVWP  Q +T DVISRT
Sbjct  172   ---------------MVPAFYQSCSEMLRKWEEAVPKETSAELDVWPHFQLMTGDVISRT  216

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG+ IFELQKEQ  + +E    +Y+PG RF+P+K+ +RM  IEKE++++IR I
Sbjct  217   AFGSSYEEGRIIFELQKEQAEYVMEQIFSIYIPGSRFLPSKKKKRMVEIEKEIQTTIRRI  276

Query  1071  IDKRMKAMQGGET--NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             I+KR+  M+ GET  NN+DLLGILLESN +EI Q G K+FGM+I +VI+ECK+FYFAGQ+
Sbjct  277   IEKRLMTMKAGETSNNNEDLLGILLESNTKEIEQHGNKDFGMTITEVIDECKLFYFAGQD  336

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTMILL +  +WQ RAREEVL VFG+++PDFEGL+ LK++TMILYE+LRL+PP
Sbjct  337   TTSVLLVWTMILLCQHPEWQVRAREEVLNVFGNEKPDFEGLSRLKIVTMILYETLRLFPP  396

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                  R   +E KLGE+ LP   LL++P +L+H + E+WGEDAKEFKPDRF EG+ KAT 
Sbjct  397   ALLYGRTNKDEVKLGELSLPAEVLLIIPAILVHYNKELWGEDAKEFKPDRFSEGVSKATN  456

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+  F PFG GPRIC+GQNF + EAKM +AMILQ+FSFELSPSY HAP ++V+  PQ+GA
Sbjct  457   GQVSFIPFGWGPRICIGQNFVMTEAKMTIAMILQKFSFELSPSYTHAPVAVVSIHPQYGA  516

Query  1785  PLIIHKL  1805
             PL + KL
Sbjct  517   PLHMRKL  523



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/548 (57%), Positives = 399/548 (73%), Gaps = 36/548 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + I     + +L +AW +L++VWFKPKKLEK L+QQG KGN Y++L GDMK
Sbjct  1     MEISYYNLKIAIFSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  60

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E+ KM  +A SKP+  S D I PR+ PF  + +  YGK+C+VW GP+P VLI +P+LIKE
Sbjct  61    EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKE  120

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KNY YQKAR +PL +    G+A +EKDKWA HRRI+NPAF+ +KLK           
Sbjct  121   VLTKNYVYQKARGSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKH----------  170

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF L+  EML+ W+ ++S  G+ E DVWP LQ LT D I
Sbjct  171   ------------------MLPAFKLTVNEMLNIWKEVISKDGT-EIDVWPYLQTLTSDAI  211

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGS+YEEGK+ FELQKEQ     +++  +Y+PGWRFVPTK+N+RM  I  EVK+ I
Sbjct  212   SRTAFGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWRFVPTKKNKRMMQIFYEVKALI  271

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQ  1241
              GII+KRM+ ++ GE+ +DDLL ILL SNL+EI+Q G K+FGMSI++VIEECK+FYFAGQ
Sbjct  272   LGIINKRMRMIEAGES-HDDLLSILLTSNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQ  330

Query  1242  ETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYP  1421
             ETTS +LVWTMILL ++  WQ RAREEVLQVF   E D++ LN LKV+TMIL E LRLY 
Sbjct  331   ETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDYDKLNQLKVVTMILNEVLRLYT  390

Query  1422  PITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKAT  1601
              +  ++R    ETKLG++ LP G  L+L T+L+H D+EIWG+DA EFKP+RF EGI KAT
Sbjct  391   SVYAINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEFKPERFSEGISKAT  450

Query  1602  KGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHG  1781
             KG+ VFFPF  GPRIC+GQNFA++EAKMAM MIL+ ++FELSPSYAHAP+ ++  QPQ+G
Sbjct  451   KGQVVFFPFNWGPRICIGQNFAMLEAKMAMVMILKHYAFELSPSYAHAPHPLL-LQPQYG  509

Query  1782  APLIIHKL  1805
             A LI+HKL
Sbjct  510   AQLIMHKL  517



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/549 (57%), Positives = 397/549 (72%), Gaps = 37/549 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + I     + +L +AW +L++VW KPK+LEK ++QQG KGN Y+ L GDMK
Sbjct  1     MEIPYYSLKLTIFSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMK  60

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E+ KM  +A+SKP+  S D I PRV+PF  + +  YGK+C+VW GPRP VLI DPEL+KE
Sbjct  61    EIKKMGEEAMSKPINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKE  120

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KN+ YQK    PL +  A G+A YE DKWA HRR++NPAF+ +KLK           
Sbjct  121   VLTKNFVYQKPPGTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKH----------  170

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF  + CEMLSK E +VS  G+ E DVWP LQ LT D I
Sbjct  171   ------------------MLPAFQFTACEMLSKLEKVVSPNGT-EIDVWPYLQTLTSDAI  211

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGSSYEEG+++FELQKEQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ +
Sbjct  212   SRTAFGSSYEEGRKLFELQKEQLSLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRALV  271

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAG  1238
              GII KR+  ++ GE   DDLLGILL SNL+EI+Q G  K+FGMSI++VIEECK+FYFAG
Sbjct  272   LGIIKKRLSMIENGEA-PDDLLGILLASNLKEIQQHGNNKKFGMSIDEVIEECKLFYFAG  330

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
             QETTS +LVWTMILL +   WQ +AREEVLQVFG +E D++ LN LK++TMIL E LRLY
Sbjct  331   QETTSSLLVWTMILLCKHPSWQDKAREEVLQVFGSREVDYDKLNQLKIVTMILNEVLRLY  390

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
             P    ++R   +ETKLG + LP G  L+LPT+L+  D+EIWG+DA EF P+RF +GI KA
Sbjct  391   PAGYAINRMVTKETKLGNLCLPAGVQLLLPTILLQHDTEIWGDDAMEFNPERFSDGISKA  450

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             TKGK VFFPF  GPRIC+GQNFA++EAKMAMAMIL+ ++FELSPSYAHAP+ ++  QPQ+
Sbjct  451   TKGKLVFFPFSWGPRICIGQNFAMLEAKMAMAMILKNYAFELSPSYAHAPHPLL-LQPQY  509

Query  1779  GAPLIIHKL  1805
             GA LI++KL
Sbjct  510   GAQLILYKL  518



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/543 (56%), Positives = 390/543 (72%), Gaps = 31/543 (6%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             +++TLL  C  + + ++AW    WVW  P+KLEK L++QG+KG  Y+ LSG++K++   T
Sbjct  5     ILFTLLVTCAVIYISSWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSAT  64

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-NKNY  539
              +A +KPM LS  I PRV+PF  Q V KYGK  ++W GP  +V I DP++I+++L NK  
Sbjct  65    QEARAKPMELSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFG  124

Query  540   QYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGAS  719
              ++K RTNPLG+ +  GV +YE +KW KHRRI+NPAF+ EKLK                 
Sbjct  125   HFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLK-----------------  167

Query  720   LEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFG  899
                        +M PA   SC EM++KWE +VS + SCE DVWP LQ LT DVISRTAFG
Sbjct  168   -----------MMLPAIYTSCSEMVNKWEMMVS-QDSCELDVWPHLQNLTADVISRTAFG  215

Query  900   SSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDK  1079
             SSYEEG+RIF+LQ EQ    I+  + +Y+PG RF+PTKRN RM  I  E +  +R I++K
Sbjct  216   SSYEEGRRIFQLQSEQAGLVIKALQSIYIPGLRFLPTKRNNRMKEIYGEARVLLRDIVNK  275

Query  1080  RMKAMQGGETNNDDLLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             R KAM+ GE +NDDLLG+L+ESN +EI      K FGM+I++VI+ECK+FYFAGQETTS 
Sbjct  276   REKAMKIGEAHNDDLLGLLMESNFKEITDNVNSKNFGMTIDEVIDECKLFYFAGQETTST  335

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWTM++LS   DWQ +AREEVLQVFG ++PDF+GLN LK++TMILYE LRLYPP   M
Sbjct  336   LLVWTMVVLSMHPDWQEKAREEVLQVFGGKDPDFDGLNHLKIVTMILYEVLRLYPPAVLM  395

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R T +  KLGEI LP G  L +PTLL+H D E+WGEDA++F P+RF  G+ KATK +  
Sbjct  396   ARGTYKTMKLGEITLPAGVHLAMPTLLVHHDRELWGEDAEDFNPERFSGGVSKATKNQVS  455

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             FFPF  GPRIC+GQNFAL+E+KMA+AMILQRFSFELS +Y HAPY+++T QPQHGA LI+
Sbjct  456   FFPFSWGPRICIGQNFALLESKMAIAMILQRFSFELSSTYVHAPYTVITLQPQHGAQLIL  515

Query  1797  HKL  1805
             HKL
Sbjct  516   HKL  518



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/543 (55%), Positives = 402/543 (74%), Gaps = 32/543 (6%)
 Frame = +3

Query  186   IYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             + ++L   + V +L +AW VL+WVWF+PKK+E+ L+QQG  G PYR+L GD KE + M  
Sbjct  29    VTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDMLK  88

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A +KP+ LSD + PRV+PF  Q V  YGK+ ++W+GP+P+V I +P+ I++V  K  +Y
Sbjct  89    EARTKPLGLSDALLPRVVPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIRDVFMKINEY  148

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK  ++PL + +A G+A++E +KWAKHR+IINPAF+ EKLK                   
Sbjct  149   QKP-SHPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLK-------------------  188

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVS-GKGSCERDVWPDLQGLTCDVISRTAFGS  902
                      LM PAF  SC  M++KWE +VS  +GSCE DVWPDLQGL CD ISRT+FGS
Sbjct  189   ---------LMIPAFCESCSGMINKWEKLVSVDEGSCELDVWPDLQGLACDAISRTSFGS  239

Query  903   SYEEGKRIFELQKE-QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDK  1079
             +YEEGKRIF+L KE   +    + + V +PG+RF+P   NRR+ AI+KE+K+S+  +I+K
Sbjct  240   NYEEGKRIFDLLKELTDLTVNVIIKAVVIPGYRFLPIPSNRRLKAIDKEIKASLNALINK  299

Query  1080  RMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSV  1256
             R KAM  GE   +DLL +LLESN +EI++ G  K  GMSIEDVI+ECK+FYFAGQETTSV
Sbjct  300   REKAMSAGEDAKNDLLDLLLESNFREIQEHGNSKSAGMSIEDVIDECKIFYFAGQETTSV  359

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +L WTM+LL+++ +WQARAREEV+QVFG+++PDF+GLN LKV+TMILYE LRLYPP+  +
Sbjct  360   LLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTMILYEVLRLYPPVIML  419

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
             +R   EE KLG +++P G  + +PT+L+H D E+WG+DA EFKP+RF EG+ KATK +  
Sbjct  420   NRDVHEEIKLGNLLVPAGVQISVPTILLHQDRELWGDDASEFKPERFAEGVSKATKSQVS  479

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             F PFG GPRICVGQNFA++EAKMA+AMILQR SFELSPSY HAP +++T QPQHGAP+I+
Sbjct  480   FLPFGWGPRICVGQNFAMIEAKMALAMILQRCSFELSPSYIHAPRTVITLQPQHGAPMIL  539

Query  1797  HKL  1805
              KL
Sbjct  540   RKL  542



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/527 (57%), Positives = 393/527 (75%), Gaps = 30/527 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             Y W +L+W +  PK+L + L++QG KGN Y+++ GD+KEL +++ +A SKP+ L D+I  
Sbjct  19    YTWKLLNWAYITPKRLGEALRKQGFKGNAYKLVYGDLKELTQLSMEARSKPINLDDDIKN  78

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKART-NPLGRKVAR  587
             RV PF V  ++K+G   +VW+GPRP +++ DPEL+KEVL+K+Y Y +    NP+ + + +
Sbjct  79    RVAPFIVNAIHKHGNESFVWLGPRPSIILTDPELVKEVLSKSYLYLRPENRNPMTKLLLQ  138

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+A+YEKD+WAKHR+IINPAF+ EKLK                            LM PA
Sbjct  139   GLASYEKDEWAKHRKIINPAFHLEKLK----------------------------LMIPA  170

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F +SC E+L  WE  VS +GS E DVWP LQ LT D ISRTAFGSSY+EG+RIFELQ+EQ
Sbjct  171   FYMSCDEVLKTWEKNVSSEGSYEVDVWPYLQNLTSDAISRTAFGSSYQEGRRIFELQREQ  230

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNND-DL  1124
               H I+  R +YVPGWRFVPTKRNRRM  IE+EV+S+IRG+I KR++AM+ GE  +D DL
Sbjct  231   VEHIIQALRSIYVPGWRFVPTKRNRRMKQIEREVQSTIRGLISKRIEAMKTGEARHDEDL  290

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             L ILL SN QEI + G K FGM+I+ V+EECK+FYFAGQETTSV+LVWT++LLSR+ DWQ
Sbjct  291   LSILLASNFQEIEKGGNKSFGMTIDAVVEECKLFYFAGQETTSVLLVWTLVLLSRYPDWQ  350

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEV+QV G++ PDF+ LN LK++TMILYE LRLYPP+  + RR  EETKLG+  LP
Sbjct  351   TRAREEVMQVIGNRTPDFDSLNQLKIVTMILYEVLRLYPPVVALGRRASEETKLGKYTLP  410

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  L L  +++H D++IWG+DA EF P RF EG+ KA KG  +FFPFG GPRIC+GQ F
Sbjct  411   AGVQLSLSIIVLHHDTKIWGDDAMEFNPQRFSEGVAKAQKGPGIFFPFGWGPRICIGQVF  470

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAKMAMA++L+ FSFELSP+Y HAP +++TTQPQHGA L++HKL
Sbjct  471   AMLEAKMAMAVLLRSFSFELSPAYTHAPLNLITTQPQHGAHLLLHKL  517



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/553 (55%), Positives = 388/553 (70%), Gaps = 38/553 (7%)
 Frame = +3

Query  177   MEVIYTLLGV---CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME  Y+ + V   CI +  L  AW V +  W  PK+LEK LK+QGL+GNPY+ L GD K+
Sbjct  1     METAYSPIAVLCSCILLYFLMLAWKVFNCAWLTPKRLEKRLKEQGLRGNPYKFLHGDFKQ  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGK-------SCYVWMGPRPKVLIRDP  506
             ++ +  +A SK + LSD++ PRVIP   + V KYGK       + Y+W+GP+ +V+I +P
Sbjct  61    ISTLLKEAHSKTINLSDDLFPRVIPHLHEAVKKYGKYYLLFNYNTYIWLGPKLRVVIMNP  120

Query  507   ELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSS  686
             E I+E+ +K   +QK    P  + + +G+A+Y+ DKWAKHR++I PAF+ EKLK      
Sbjct  121   EHIREITSKLSIFQKPGGTPDTKLLVQGLASYDGDKWAKHRKLITPAFHVEKLKH-----  175

Query  687   TLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGL  866
                                    M P+F     EMLSKWE IVS  GSCE DVWPDL+ L
Sbjct  176   -----------------------MVPSFCTCAGEMLSKWEKIVSTNGSCELDVWPDLRTL  212

Query  867   TCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKE  1046
             TCD ISRTAFGS+Y+EG RIFELQ EQ  + ++  + VY PGWRF+PTKRNRRM  I K+
Sbjct  213   TCDAISRTAFGSNYKEGTRIFELQTEQAQYHLKAVQSVYFPGWRFLPTKRNRRMKQIAKD  272

Query  1047  VKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVF  1226
             V  SIR II+ R++AM+ G+   DDLL ILLESN +EI   G K FGMSI +VIEECK+F
Sbjct  273   VHESIRKIINARLEAMEAGDACADDLLSILLESNSKEIDYHGNKGFGMSIREVIEECKLF  332

Query  1227  YFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYES  1406
             YFAGQETTSV+LVWTMILLSR+ +WQARAREEVLQ FG  +PD +GLN LK++TMIL+E 
Sbjct  333   YFAGQETTSVLLVWTMILLSRYPNWQARAREEVLQHFGTNKPDLDGLNHLKLVTMILHEV  392

Query  1407  LRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREG  1586
             LRLYPP+  + R+  EET+LG + LP    + LP +L+H   EIWG+D KEFKP+RF +G
Sbjct  393   LRLYPPVPELARKAAEETQLGNLTLPSQVQVSLPAMLLHYAPEIWGDDVKEFKPERFADG  452

Query  1587  IMKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTT  1766
             +  AT GK  FFPFG GPRICVGQNFA++EAK+A+AMILQRFSFELSPSY HAP  ++T 
Sbjct  453   VSNATNGKVAFFPFGWGPRICVGQNFAMLEAKVALAMILQRFSFELSPSYRHAPRVVLTL  512

Query  1767  QPQHGAPLIIHKL  1805
             QPQ+GA LI+HKL
Sbjct  513   QPQYGAHLILHKL  525



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 391/545 (72%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+    + + +++ ++++  W  L WVWFKPK LE +L++QGL G PY  L GD+K   
Sbjct  1     MEISVASVTISVAIAVVSWWIWRTLQWVWFKPKMLESYLRRQGLVGTPYTPLVGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  +A SKP+ L+D+I PR++P+ +Q    YG++ Y W+GP P + I DPE IKEV NK
Sbjct  61    SMLAEARSKPINLTDDITPRIVPYPLQMFKTYGRTFYTWLGPIPTITIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK+ T PL R +A G+ +Y+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFQKSHTFPLARLIAAGLVSYDGDKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +W+ +VS KG SCE D+WP L  +T DVISRT
Sbjct  167   --------------MVPAFHRSCSEVVGQWDKLVSDKGLSCEVDIWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGFSYLPTKGNRRMKAKAREIQVILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A + GE  +DDLLGILLESNL   RQ  G   GMS ED++EECK+FYFAGQETT
Sbjct  273   VNKRLRAREAGEAPSDDLLGILLESNL---RQTEGN--GMSTEDLMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTMILLS+ QDWQARAREEV QVFGD+EPD EGLN LKV++MILYE LRLYPP+T
Sbjct  328   SVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMSMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +
Sbjct  388   QLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGNDAAEFKPERFKDGLSKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNFAL+EAKMAMA+IL+RFSFELSPSY HAPY+++T  PQ GA L
Sbjct  448   VSFFPFAWGPRICIGQNFALLEAKMAMALILKRFSFELSPSYVHAPYTVITIHPQFGAQL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   IMHKL  512



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/547 (55%), Positives = 392/547 (72%), Gaps = 36/547 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME  ++ +   +S   V L   AW  L+W WF+PKKL+K LKQQG KGNPY+++ GD K+
Sbjct  1     MEAAHSFMIALVSSCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQ  60

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
             ++ +  +A SKP++LSD+I PR++P +++ VNKYGK+ Y+W GPRP +LI DPELI++V 
Sbjct  61    ISSLFQEANSKPISLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVT  120

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             +K   +QK R  P  R +  G+  YE +KWAK R+++N AF++EKLK             
Sbjct  121   HKMDIFQKVRFRPQARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCER-DVWPDLQGLTCDVIS  884
                            LM PAF  S  EMLSKWE ++S KGS E  DVWP++Q +T D IS
Sbjct  168   ---------------LMVPAFYKSASEMLSKWEEMISVKGSFEVVDVWPNIQTMTSDAIS  212

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGS YEEG++IFELQ+EQ  H +E +R +Y+PG RF+PTKRNRRM  I KEV+ SIR
Sbjct  213   RTAFGSRYEEGRKIFELQREQARHLVEATRSIYIPGSRFLPTKRNRRMKQIAKEVEGSIR  272

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II+ R+KA++ GE  + D+LGILLES  QE       E GM+  ++I+ECK+FYFAGQE
Sbjct  273   EIINARLKALRAGEAIDADMLGILLESTSQET----DGESGMTTGEIIQECKLFYFAGQE  328

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TT+V+LVWTMILLS   DWQ RAREEVLQ FG   P+F+GLN LK++TMIL+E LRLYPP
Sbjct  329   TTAVLLVWTMILLSMHPDWQERAREEVLQHFGTDMPNFDGLNQLKIVTMILHEVLRLYPP  388

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                + R   EETK+G + +P G LL LP +L+H D EIWG+D KEFKP+RF +G+  ATK
Sbjct  389   FPNIGRSVAEETKIGNLTIPAGQLLTLPMILLHHDPEIWGQDVKEFKPERFADGVSSATK  448

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+ V+FPFG GPRIC+GQNFA++EAK+A+AMILQRFSFELSPSY+HAP+  +  QPQ GA
Sbjct  449   GQIVYFPFGWGPRICIGQNFAMLEAKLALAMILQRFSFELSPSYSHAPHLTIAIQPQFGA  508

Query  1785  PLIIHKL  1805
              L++HKL
Sbjct  509   HLMLHKL  515



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/529 (56%), Positives = 390/529 (74%), Gaps = 29/529 (5%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + +L YAW +L+W+W +PK+LE+ LKQQGL GN YR+L GD+KE+  M  +A S+P+++S
Sbjct  16    ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIKEASSRPISIS  75

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGR  575
             D+I  R+ PF    + KYGKS ++WMGP+P+V I +PELI++VL+ +  ++K R + L +
Sbjct  76    DDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  576   KVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVL  755
              +  G+   + +KWAKHR+IINPAF  EKLK                             
Sbjct  136   LLVSGLLFLDGEKWAKHRKIINPAFRLEKLKN----------------------------  167

Query  756   MQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFEL  935
             M PAF LSC +M+SKWEG +S +GSCE DVWP LQ LT D ISRTAFGS+YEEG+ IFEL
Sbjct  168   MLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFEL  227

Query  936   QKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  1115
             Q+EQ    ++ S   ++PGWRF+PTK N+RM  I KEV + + GIIDKR KAM+ GET N
Sbjct  228   QREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLN  287

Query  1116  DDLLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
             DDLLGILLESN +EI++ +  K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+ 
Sbjct  288   DDLLGILLESNFKEIQEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKH  347

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G+
Sbjct  348   PNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGD  407

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + LP G  + LPT+L+H D EIWGEDA+EF P+RF +G++KATK    FFPFG G R+C+
Sbjct  408   MYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCI  467

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             GQNFA++EAKM +AMILQRFSF LSPSY+HAP S+VT +PQ+GA LI+H
Sbjct  468   GQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILH  516



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/528 (57%), Positives = 391/528 (74%), Gaps = 29/528 (5%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L +AW +L+W+W KPKKLEK L++QGLKGN YR+L GDM +L KM  +A SKPM LSD+I
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMNLSDDI  76

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
              PRV  F  Q V K+GK+ ++W GP P+V I DP+ IK+VLNK Y +QK   NPL R +A
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ + E ++W+KHR+IINPAF+ EKLK                            +M P
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLK----------------------------IMLP  168

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
              F  SC +++SKWE ++S  GSCE DVWP LQ    DVISR AFGSSYEEGKRIF+LQ E
Sbjct  169   IFHKSCDDLISKWEKMLSSDGSCEMDVWPFLQNFASDVISRAAFGSSYEEGKRIFQLQTE  228

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
             Q     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DDL
Sbjct  229   QAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDDL  288

Query  1125  LGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  289   LGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  348

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + L
Sbjct  349   QARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLAL  408

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + L  +++H D E+WGEDAK F P+RF EG++KAT G+  FFPF GGPRIC+GQN
Sbjct  409   PAGVQVFLSIIMVHHDIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQN  468

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+++EAKMA+AMILQRFSFELSPSYAHAP +++T QPQ+GA +I+HKL
Sbjct  469   FSMLEAKMAIAMILQRFSFELSPSYAHAPATVITLQPQYGAHIILHKL  516



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/547 (56%), Positives = 391/547 (71%), Gaps = 39/547 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGV---LDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+  ++  V ISV L   +W +   L WVWFKPK LE +L++QGL G PY  L GD+K+
Sbjct  1     MEI--SVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKK  58

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
                M ++A SKP+ L+D+I+PRV+P+ +Q    YG++ + W GP P + I DPE IKEV 
Sbjct  59    NFTMLSEARSKPLKLTDDISPRVVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVF  118

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             NK Y +QK  T PL   +A+G+ANY+ DKWAKHRRIINPAF+ EK+K             
Sbjct  119   NKVYDFQKPHTFPLATIIAKGLANYDGDKWAKHRRIINPAFHIEKIKN------------  166

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVIS  884
                             M PAF  SC E++ +W+ +VS KG SCE DVWP L  +T DVIS
Sbjct  167   ----------------MVPAFHQSCREVVGEWDQLVSDKGSSCEVDVWPGLVSMTADVIS  210

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSY+EG+RIFELQ E     I+  R+ ++PG+ ++PTK NRRM A  +E++  +R
Sbjct  211   RTAFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKSNRRMKAAAREIQVILR  270

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             GI++KR++A + GE  +DDLLGILLESNL   RQ  G   GMS ED++EECK+FYFAGQE
Sbjct  271   GIVNKRLRAREAGEAPSDDLLGILLESNL---RQTEGN--GMSTEDLMEECKLFYFAGQE  325

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYPP
Sbjct  326   TTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPP  385

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +T + R   +E KLG++ LP G  + LP LL+  D E+WG DA EF PDRF++G+ KATK
Sbjct  386   VTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDIELWGNDAAEFNPDRFKDGLSKATK  445

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPF  GPRIC+GQNFAL+EAKMAMA+IL+RFSFE+SPSY HAPY+++T  PQ GA
Sbjct  446   SQVSFFPFAWGPRICIGQNFALLEAKMAMALILRRFSFEISPSYVHAPYTVITIHPQFGA  505

Query  1785  PLIIHKL  1805
              LI+HKL
Sbjct  506   QLIMHKL  512



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/537 (57%), Positives = 385/537 (72%), Gaps = 34/537 (6%)
 Frame = +3

Query  195   LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             L+  C+ + +LA  W VL WVWFKP+KLEK LKQQG KGNPY++  GD KE+  +  +A 
Sbjct  11    LVSSCLVLSVLA--WKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDFKEIGTLFQEAY  68

Query  375   SKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             SKP++LSD+I PRVIP ++  VNKYGK+ Y+W GP+P +LI DPEL ++V  K   +QK 
Sbjct  69    SKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRKVTQKMEIFQKP  128

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
             + +PL + +A+G   YE DKWAKHR+++N AF+ EKLK                      
Sbjct  129   QFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLK----------------------  166

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEE  914
                   LM PAF  S  EMLSKWE  +S KGS E DVWP LQ +T D ISRTAFGS YE+
Sbjct  167   ------LMVPAFYTSASEMLSKWEEGISAKGSIELDVWPHLQTMTGDAISRTAFGSKYEK  220

Query  915   GKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAM  1094
             G+RIFELQ EQ  H ++  + +Y+PG RF+PTKRNRRM  I  EV  SI  II  R+ A+
Sbjct  221   GRRIFELQTEQAQHLVKAVQSMYIPGLRFLPTKRNRRMKQIATEVNDSIGEIIRTRLNAL  280

Query  1095  QGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
             + GE ++DD+L +LLES+ QE      KEFGM+ ++++EECK+FYFAGQETT+V+LVWTM
Sbjct  281   RTGEASDDDMLSLLLESSSQET----DKEFGMTTKEIVEECKLFYFAGQETTAVLLVWTM  336

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             ILLS + DWQ  AREEVLQ FG   PDF+GLN L+++TMIL+E LRLYPP   + +   E
Sbjct  337   ILLSMYPDWQEHAREEVLQHFGTNIPDFDGLNRLRIVTMILHEVLRLYPPFPILGQTVAE  396

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             ETKLG +  P G LL +PT+L+H D EIWGED KEFKP+RF +G+  ATKG+ VFFPFG 
Sbjct  397   ETKLGNLTFPSGQLLTVPTILLHHDPEIWGEDVKEFKPERFADGVSHATKGQVVFFPFGW  456

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPRIC+GQNFA++EAK+ +AM LQRFSFELSPSY+HAPYS VT QPQ GA LI+HK+
Sbjct  457   GPRICIGQNFAMLEAKLVLAMALQRFSFELSPSYSHAPYSAVTLQPQFGAHLILHKM  513



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/533 (56%), Positives = 388/533 (73%), Gaps = 29/533 (5%)
 Frame = +3

Query  210   ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT  389
             + + LL YAW +L+WVW +PKKLE+ L+QQGL GN Y  L GD KE+++M  +A S+P++
Sbjct  11    VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  390   LSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPL  569
              SD+I  RV+PF+   + KYGK+ + W+GP+P V I +PELI++V  K+  +QK   +PL
Sbjct  71    FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  570   GRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTS  749
             G+ +A GV   E ++W K R+IINPAF+ EKLK                           
Sbjct  131   GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKH--------------------------  164

Query  750   VLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIF  929
               M  AF LSC +M++KWE  +S  GSCE DVWP L+ L  DVISRTAFGSSYEEG+RIF
Sbjct  165   --MVSAFQLSCSDMVNKWEKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIF  222

Query  930   ELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET  1109
             +LQ+EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET
Sbjct  223   QLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGET  282

Query  1110  NNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLS  1286
              N DLLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L+WTM+LLS
Sbjct  283   ANHDLLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLS  342

Query  1287  RFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKL  1466
             +  +WQ RAREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R    ++++
Sbjct  343   KHSNWQTRAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQV  402

Query  1467  GEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRI  1646
             G + LP G  + LP LL+H D EIWGEDAKEF P RF EG+ KA K +  FFPFG GPRI
Sbjct  403   GGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRI  462

Query  1647  CVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             CVGQNFA++EAKMA+AMILQRFSFELSPSYAHAP S++T QPQ+GA LI+H L
Sbjct  463   CVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISLITMQPQYGAHLILHGL  515



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 387/526 (74%), Gaps = 29/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIA  407
             +AW +L+W+W +PK+LE+ L++QGL+GN Y +  GD+KE  KM  +ALSKPM L S +IA
Sbjct  38    WAWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIA  97

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV+ F    VNK+GK+ ++W GP P+V + DPE IK+VLNK Y + K   NP  R +A 
Sbjct  98    PRVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAP  157

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ ++E +KW+KHR+IINPAF  EKLK                             M P 
Sbjct  158   GLVSHEGEKWSKHRKIINPAFNLEKLKN----------------------------MLPL  189

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F+  C +++SKWEG++S  G+ E D+WP  Q L  DVISRTAFGSSYEEG+RIF+L KEQ
Sbjct  190   FIKCCDDLISKWEGMLSSDGTSETDIWPFFQNLASDVISRTAFGSSYEEGRRIFQLLKEQ  249

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+   +V +PGWRFVPT  +RRM  I K++++S+  +I+KR  A++ GE   ++LL
Sbjct  250   TELTIQTFLKVNIPGWRFVPTTTHRRMKEINKDIEASLMDMINKRETALKAGEATKNNLL  309

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
              ILLESN +EI++QG K  GM++E+VIEECK+FYFAGQETTSV+LVWTMILLS + DWQ 
Sbjct  310   DILLESNHKEIQEQGNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQT  369

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEVLQVFG+++P+FEGLN LK++TMIL E LRLYPP+ G+ R+  E+ KLG + LP 
Sbjct  370   RAREEVLQVFGNRKPNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPA  429

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP +L+H D E+WG+DAKEFKP+RF EG++KAT G+  FF FGGGPRIC+GQNF+
Sbjct  430   GVQISLPIVLVHHDCELWGDDAKEFKPERFSEGLLKATNGRVSFFAFGGGPRICIGQNFS  489

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              +EAK+A++MILQRFSFELSP+Y HAP S++T QPQHGA LI+HK+
Sbjct  490   FLEAKIALSMILQRFSFELSPTYTHAPTSVITLQPQHGAHLILHKV  535



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 387/526 (74%), Gaps = 29/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIA  407
             +AW +L+W+W +PK+LE+ L++QGL+GN Y +  GD+KE  KM  +ALSKPM L S +IA
Sbjct  38    WAWKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIA  97

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV+ F    VNK+GK+ ++W GP P+V + DPE IK+VLNK Y + K   NP  R +A 
Sbjct  98    PRVLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAP  157

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ ++E +KW+KHR+IINPAF  EKLK                             M P 
Sbjct  158   GLVSHEGEKWSKHRKIINPAFNLEKLKN----------------------------MLPL  189

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F+  C +++SKWEG++S  G+ E D+WP  Q L  DVISRTAFGSSYEEG+RIF+L KEQ
Sbjct  190   FIKCCDDLISKWEGMLSSDGTSETDIWPFFQNLASDVISRTAFGSSYEEGRRIFQLLKEQ  249

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+   +V +PGWRFVPT  +RRM  I K++++S+  +I+KR  A++ GE   ++LL
Sbjct  250   TELTIQTFLKVNIPGWRFVPTTTHRRMKEINKDIEASLMDMINKRETALKAGEATKNNLL  309

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
              ILLESN +EI++QG K  GM++E+VIEECK+FYFAGQETTSV+LVWTMILLS + DWQ 
Sbjct  310   DILLESNHKEIQEQGNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQT  369

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEVLQVFG+++P+FEGLN LK++TMIL E LRLYPP+ G+ R+  E+ KLG + LP 
Sbjct  370   RAREEVLQVFGNRKPNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPA  429

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP +L+H D E+WG+DAKEFKP+RF EG++KAT G+  FF FGGGPRIC+GQNF+
Sbjct  430   GVQISLPIVLVHHDCELWGDDAKEFKPERFSEGLLKATNGRVSFFAFGGGPRICIGQNFS  489

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              +EAK+A++MILQRFSFELSP+Y HAP S++T QPQHGA LI+HK+
Sbjct  490   FLEAKIALSMILQRFSFELSPTYTHAPTSVITLQPQHGAHLILHKV  535



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/522 (56%), Positives = 383/522 (73%), Gaps = 29/522 (6%)
 Frame = +3

Query  243   VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIP  422
             +L+W+W +PK+LE+ L++QGL+GNPYRIL GD+KE+ K+  +A SKPM LS +I PRV  
Sbjct  1     MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  423   FYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANY  602
                Q V K+GK+ ++W GP+P+V + DPELIK+VLNK   ++K   NPL + +A G+ NY
Sbjct  61    HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  603   EKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSC  782
             + +KW KHRR+INPAF  EKLK                            +M P F  SC
Sbjct  121   DGEKWNKHRRLINPAFSLEKLK----------------------------IMLPIFFKSC  152

Query  783   CEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFI  962
              +++ KWEG++S  GSCE DVWP LQ L  DVI+RTAFGSS+EEGKRIF+LQKE     +
Sbjct  153   NDLIIKWEGMLSSDGSCEMDVWPFLQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTM  212

Query  963   EVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLE  1142
             +V  +VY+PGWRFVPT  NRRM  I++ +K+S+  +I KR KA + GE   DDLLGILLE
Sbjct  213   KVIMKVYIPGWRFVPTATNRRMKEIDRYIKASLMDMIKKREKAPKTGEATRDDLLGILLE  272

Query  1143  SNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  1319
             SN +EI++    K  GM++ DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DWQ+RARE
Sbjct  273   SNHKEIQEHRNNKNVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRARE  332

Query  1320  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  1499
             EVLQVFG Q P+F+GL+ LK++TMILYE LRLYPP  G+ R    + KLG + LP G  +
Sbjct  333   EVLQVFGKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQV  392

Query  1500  MLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEA  1679
              LP +++H D E+WG+DAKEF P+RF EG+ KAT G+  FFPFG GPRIC+GQNF+L+EA
Sbjct  393   SLPIIMVHHDRELWGDDAKEFNPERFSEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEA  452

Query  1680  KMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             KMA++MILQ FSFELSP+Y HAP++++T QPQ+GA +I+ K+
Sbjct  453   KMALSMILQHFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  494



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/528 (57%), Positives = 392/528 (74%), Gaps = 29/528 (5%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L +AW +L+W+W KPKKLEK L++QGLKGN YR+L GD+K+L K+  +A +KPM LSD+I
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDIKDLLKIRKEATTKPMNLSDDI  76

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
              PRV  F  Q V K+GK+ ++W GP P+V I DP+ IK+VLNK Y +QK   NPL R +A
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ + E ++W+KHR+IINPAF+ EKLK                            +M P
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLK----------------------------IMLP  168

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
              F  SC +M+SKWE ++S  GSCE DVWP LQ    DVISR AFGSSYEEGKRIF+LQ E
Sbjct  169   IFHKSCDDMISKWEKMLSSDGSCEMDVWPFLQNFASDVISRAAFGSSYEEGKRIFQLQTE  228

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
             Q     ++  +VY+PGWRF+PT   RRM  I++++K+S+  +I+ R +A++ GE   DDL
Sbjct  229   QAELTTKIMMKVYIPGWRFLPTATPRRMKEIDRDIKASLTDMINNRERALKAGEATKDDL  288

Query  1125  LGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LGILLESN +E+ + G  K+ GMS++DVIEECK+FYFAGQETTSV+LVWTM+LLSR+ DW
Sbjct  289   LGILLESNHKEMEEHGNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  348

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEVLQVFG+ +PDF+GL+ LK++TMILYE LRLYPP+  + RR  ++ KLG + L
Sbjct  349   QARAREEVLQVFGNNKPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLAL  408

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + L  +++H D E+WGEDAK F P+RF EG++KAT G+  FFPF GGPRIC+GQN
Sbjct  409   PAGVQVFLSIIMVHHDIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQN  468

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F+++EAKMA+AMILQRFSFELSPSYAHAP +++T QPQ+GA +I+HKL
Sbjct  469   FSMLEAKMAIAMILQRFSFELSPSYAHAPATVITLQPQYGAHIILHKL  516



>ref|XP_006348305.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006348306.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Solanum 
tuberosum]
Length=417

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/445 (66%), Positives = 347/445 (78%), Gaps = 28/445 (6%)
 Frame = +3

Query  471   MGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAF  650
             MGPRP++LI DPELIKEVL+KNY YQK   NPLG    +G+ +YEKDKWAKHR+IINPAF
Sbjct  1     MGPRPQILIMDPELIKEVLSKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAF  60

Query  651   YSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS  830
             + EKLK                             M PAF LSC EMLSKWE +V  +GS
Sbjct  61    HLEKLKH----------------------------MLPAFYLSCSEMLSKWEDVVQVEGS  92

Query  831   CERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPT  1010
              E DVWP LQ LTCDVISRTAFGSSYEEG++IFELQ+EQ  HF+EV R VY+PGWRF+PT
Sbjct  93    HEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQHFLEVIRSVYIPGWRFLPT  152

Query  1011  KRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGM  1190
             KRNRRM  I+K+V+SSIRGIIDKR+KAM+ G  +N+DLLGILLESN +EI   G K+FGM
Sbjct  153   KRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIELHGNKDFGM  212

Query  1191  SIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLN  1370
             SIE+VIEECK+FYFAG ETTSV ++WT++LLSR+ DWQARAREEVLQVFG ++PDF+GLN
Sbjct  213   SIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVLQVFGSRKPDFDGLN  272

Query  1371  SLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGED  1550
              LKV+TMILYESLRLY PIT + RR  E+  LGE+ LP G L+ LP +L+H D +IWGED
Sbjct  273   HLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLPIILLHHDKDIWGED  332

Query  1551  AKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSP  1730
             A +F P+RFREGI  ATKG+  +FPF  GPRIC+GQNFA++EAKM + MILQ F FELSP
Sbjct  333   ANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTVCMILQSFFFELSP  392

Query  1731  SYAHAPYSMVTTQPQHGAPLIIHKL  1805
             SY HAP S+VTTQPQ+GAPLI HKL
Sbjct  393   SYTHAPQSLVTTQPQYGAPLIFHKL  417



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/529 (55%), Positives = 387/529 (73%), Gaps = 29/529 (5%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + +L YAW +L+W+W +PK+LE+ LKQQGL GN YR+L GD KE+  M  +A S+P+++S
Sbjct  16    ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIKEATSRPISIS  75

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGR  575
             D+I  R+ PF+   + KYGKS ++WMGP+P+V I +PELI++VL+ +  ++K R + L +
Sbjct  76    DDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVFRKPRVHALVK  135

Query  576   KVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVL  755
              +  G+   + +KWAKHR+IINPAF  EK+K                             
Sbjct  136   LLVSGLLFLDGEKWAKHRKIINPAFRLEKVKN----------------------------  167

Query  756   MQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFEL  935
             M PAF LSC +M+SKWEG +S +GSCE DVWP LQ LT D ISRTAFGS+YEEG+ IFEL
Sbjct  168   MLPAFHLSCSDMISKWEGKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFEL  227

Query  936   QKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  1115
             Q+EQ    ++ S   ++PGWRF+PTK N+RM    KEV   + GIIDKR KAM+ GET N
Sbjct  228   QREQAQLLVQFSESAFIPGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLN  287

Query  1116  DDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
             DDLLGILLESN +EI++ G  K  GMSI+DVI+ECK+FYFAGQETTSV+L+WTMILLS+ 
Sbjct  288   DDLLGILLESNFKEIQEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKH  347

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G+
Sbjct  348   PNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGD  407

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + LP G  + LPT+L+H D EIWGEDA+EF P+RF +G +KATK    FFPFG G R+C+
Sbjct  408   MYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCI  467

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             GQNFA++EAKM +AMILQRFSF LSPSY+HAP S+VT +PQ+GA LI+H
Sbjct  468   GQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILH  516



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/541 (55%), Positives = 390/541 (72%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCISVG---LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             L  V IS     LL YAW +L+WVW +PKKLE+ L+QQGL GN YR+L GD +E+++M  
Sbjct  3     LSSVAISFAFIVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMIN  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A S+P++ SD+I  RV+PF+   + KYGK+ + W GP+P V I +PELI++VL K+  +
Sbjct  63    EANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK   +PL + +A GV   E ++W K R+IINPAF+ EKLK                   
Sbjct  123   QKPPPHPLSKLLATGVVALEGEQWTKRRKIINPAFHLEKLKH------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M  AF LSC +M++KWE  +S  GSCE DVWP L+ L  DVISRTAFGSS
Sbjct  165   ----------MVSAFQLSCSDMVNKWEKKLSLDGSCELDVWPYLENLAGDVISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+LQ+EQ    I+V+R +YVPGWRF PTK NRRM  I  EV + ++GII+KR 
Sbjct  215   YEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTNRRMRQISNEVNALLKGIIEKRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             KAM+ GET N DLLG+L+ESN +++++    K  GMSI+DVIEECK+FY AGQETTSV+L
Sbjct  275   KAMKVGETANHDLLGLLMESNYRDMQENDERKNVGMSIKDVIEECKLFYLAGQETTSVLL  334

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             +WTM+LLS+  +WQ  AREEVL+VFG+++PD +GLN LK++TMI +E LRLYPP++ + R
Sbjct  335   LWTMVLLSKHSNWQTHAREEVLRVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLR  394

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                 ++++G + LP G  + LP LL+H D EIWGEDAKEF P RF EG+ KA K +  FF
Sbjct  395   TVFADSQVGGLYLPDGVQIALPILLLHHDHEIWGEDAKEFNPGRFSEGVSKAAKSQVSFF  454

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRICVGQNFA++EAKMA+AMILQRFSFELSPSYAHAP S++TT PQ+GA LI+H 
Sbjct  455   PFGYGPRICVGQNFAMMEAKMALAMILQRFSFELSPSYAHAPISLLTTHPQYGAHLILHG  514

Query  1803  L  1805
             L
Sbjct  515   L  515



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/544 (55%), Positives = 392/544 (72%), Gaps = 32/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++Y++L +  +  L   AW  L  VWF+P+KLEK L+Q+G  GN YR + GD K++A 
Sbjct  3     MEILYSILALFCAAFLSHNAWKFLTRVWFEPRKLEKRLRQEGFSGNSYRFMIGDSKQIAA  62

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
                 A SKP+  S++IAPRVIPF    + KYG++C++W G +P ++I D E+ KE+L+KN
Sbjct  63    -AKQANSKPIAFSNDIAPRVIPFIHHSLLKYGENCFIWYGSKPTIVILDQEMTKEILSKN  121

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +QK  T PL + +A+GVA YE DKWAKHRR++NPAF+ EKLK                
Sbjct  122   YVFQKTST-PLDKLLAQGVATYEADKWAKHRRLLNPAFHLEKLK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         LM P F LSC EMLSK E I+  +G CE DVWP LQ LT DVISRTAF
Sbjct  165   ------------LMLPLFYLSCGEMLSKLEKIIPSEGVCEVDVWPHLQALTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEG +IFEL KEQG    +  + +Y+PGWRF+PT+ N+RM  I  EV S + GII+
Sbjct  213   GSNYEEGGKIFELLKEQGALLFKAFQMLYIPGWRFLPTRTNKRMKEIAMEVDSLVLGIIN  272

Query  1077  KRMKAMQGGE-TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KRM+ ++ GE T + DLLGILLESN +EI Q+ G+  GMS+ +VI+ECK+FY AGQETTS
Sbjct  273   KRMQMIEAGEVTESSDLLGILLESNFKEI-QKNGEYLGMSLREVIDECKLFYLAGQETTS  331

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWTMILLS+  DWQARAR+EVLQV G  EPDF+ L+ L+++TMI +E +RLYP    
Sbjct  332   ALLVWTMILLSKHPDWQARARDEVLQVLGSHEPDFQELSRLQIVTMIFHEVMRLYPGAAI  391

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   +ET LG + LP G  L LPTLL+  D +IWGEDAKEF P+RFREG+ KAT+G+ 
Sbjct  392   LRRTIHKETTLGNVSLPAGVNLFLPTLLLQHDCKIWGEDAKEFNPERFREGVSKATRGQL  451

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              ++PFGGGPRIC+GQNFA+++AKMA+A+IL+ +SFELSPSYAHAPY +++ QPQ+GAPLI
Sbjct  452   XYYPFGGGPRICIGQNFAMLQAKMALALILKHYSFELSPSYAHAPYLVLSVQPQYGAPLI  511

Query  1794  IHKL  1805
             IH+L
Sbjct  512   IHRL  515



>ref|XP_006299550.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
 gb|EOA32448.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
Length=512

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/545 (55%), Positives = 389/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+    + + ++V L+++  W  L WVWFKPK LE +L++QGL G PY    GD+K   
Sbjct  1     MEISVASVTLSLAVVLMSWLVWRTLKWVWFKPKMLESYLRRQGLAGTPYSPFGGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  +A SKP+ L+D+I PR++P+ +Q +  +G++ Y W GP P + I +PE IKEV NK
Sbjct  61    SMLAEARSKPIKLTDDITPRLVPYPLQMLKTHGRTFYTWFGPIPTITIMEPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK  T PLG  +A+G+ANY+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFQKPHTFPLGTLIAKGLANYDGDKWAKHRRIINPAFHIEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E+  +W+ +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFYQSCSEVFGQWDKLVSEKGSSCEVDVWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+  R+ ++PG+ ++PTK NR M A  +E++  +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQAFRKAFIPGYSYLPTKGNRGMKAKAREIQVILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A + GE  +DDLLGIL+ESNL + +       GMS ED++EECK+FYFAGQETT
Sbjct  273   VNKRLRAREAGEAPSDDLLGILIESNLGQTKGN-----GMSTEDLMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+ MILYE LRLYPP+T
Sbjct  328   SVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMNMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +
Sbjct  388   QLTRAIHKEMKLGDLTLPGGVHISLPILLIQHDTELWGNDAAEFKPERFKDGLSKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNFAL+EAKMAMA+ILQ+FSFE+SPSY HAPY+++T  PQ GAPL
Sbjct  448   VSFFPFGWGPRICIGQNFALLEAKMAMALILQKFSFEISPSYLHAPYTIITVHPQFGAPL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/531 (59%), Positives = 394/531 (74%), Gaps = 32/531 (6%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + +L +AW +L++VW KPK LEK L++QG KG+ Y+ L GDMKE++KM  +A SKP+  S
Sbjct  17    IFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGEEAWSKPVNFS  76

Query  396   -DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLG  572
              D I PRV PF  + +  YGK+C+VW GPRP V+I DPE+IKEV+ KNY +QK   NPL 
Sbjct  77    HDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYVFQKPGGNPLT  136

Query  573   RKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSV  752
             + +A G+A+YE DKWA HRR++NPAF+ +KLK                            
Sbjct  137   KLLATGIADYEADKWAVHRRLLNPAFHLDKLKH---------------------------  169

Query  753   LMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFE  932
              M PAF L+  EMLSKWE IVS +GS E DV P LQ LT D ISRTAFGSSYEEG +IFE
Sbjct  170   -MLPAFKLTGNEMLSKWEKIVSREGS-EIDVLPYLQTLTSDAISRTAFGSSYEEGIKIFE  227

Query  933   LQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETN  1112
             LQKEQ    +EVSR +Y+PGWRF+PTKRN+RM  I  EV++ I  II+KRM+ ++ GE++
Sbjct  228   LQKEQIQLILEVSRTIYIPGWRFLPTKRNKRMKQIFNEVRTLILEIINKRMRMIEAGESH  287

Query  1113  NDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
              DDLLGILL SNL+EI+Q G K+FGMSI++VIEECK+FYFAGQETTS +LVWTMILLS+ 
Sbjct  288   -DDLLGILLSSNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQH  346

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQ RAREEVLQVFG  E D++ LN LKV+TMIL E LRLYP    M R    +TKLG 
Sbjct  347   PNWQDRAREEVLQVFGSNEVDYDKLNQLKVVTMILNEVLRLYPAGYMMTRMVKTKTKLGN  406

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + LP G  L+LPT+L+  D++IWG+DA EF P+RF +GI+KATKG+ VFFPFG GPRIC+
Sbjct  407   LCLPGGVQLLLPTILLQHDTKIWGDDAMEFNPERFSDGILKATKGQLVFFPFGWGPRICI  466

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GQNFA++EAKMAMAMIL+ ++FELS SY+HAP+ ++  QPQ GAPLI++KL
Sbjct  467   GQNFAMLEAKMAMAMILKHYAFELSSSYSHAPHPLM-LQPQFGAPLILYKL  516



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 389/526 (74%), Gaps = 29/526 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
              +AW V++W+W +PKKLE++L+QQGL GN YR +SGDMKE++  T  A SKPM+LS +IA
Sbjct  18    TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRVIPF+ + VN YGK+ +VWMG  P+V+I +PE +K +L K   + +   NPL + +A 
Sbjct  78    PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+A YE +KWAKHRRIINP F+ EKLK                             M PA
Sbjct  138   GIAFYEGEKWAKHRRIINPVFHLEKLKR----------------------------MLPA  169

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+ +WE +V  + SCE DVWP  Q LT DVISRTAFGSSY+EG++IF+L KEQ
Sbjct  170   FYESCSEMIVEWESLVLKESSCELDVWPYFQNLTADVISRTAFGSSYKEGRKIFQLLKEQ  229

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                  +V + VY+PGWRF+PTK N++M  I++E+++ + GII+KR  A++ G+   DDLL
Sbjct  230   VQLVTKVVQSVYIPGWRFLPTKTNKKMKGIDREIRALLMGIINKREGAIKAGKATKDDLL  289

Query  1128  GILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G+L+ESN++EIR+ G  K+ GMS+ DVIEECK+FYFAGQETTS +LVWTM+LL ++QDWQ
Sbjct  290   GVLMESNVKEIREHGNNKKVGMSMHDVIEECKLFYFAGQETTSGLLVWTMVLLGQYQDWQ  349

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
               AREEV++VFG  +PDF+GL  LKV+TMIL+E LRLYP ++ M R T ++T+L    LP
Sbjct  350   DHAREEVIEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALSLMTRITSKKTQLANYSLP  409

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LPTLL+H D ++WG+DA+EFKP+RF EG++KATK K  +FPFGGGPRIC+GQNF
Sbjct  410   AGVEVALPTLLVHHDKQLWGDDAQEFKPERFSEGVLKATKNKFTYFPFGGGPRICIGQNF  469

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             A+VEAK+A+++ILQ F+FELSPSYAHAP S +T +PQ GA +I+HK
Sbjct  470   AMVEAKVALSLILQHFTFELSPSYAHAPSSHLTIRPQFGAHIILHK  515



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/529 (56%), Positives = 386/529 (73%), Gaps = 29/529 (5%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + +L YAW VL+W+W +PK+LE+ LKQQGL GN YR+L GD KE++ M  +A S+P++ S
Sbjct  16    ITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIKEATSRPISFS  75

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGR  575
             D+I  RV PF+   + KYGKS ++WMG +P+V I +PELI++VL+ +  ++K R + LG+
Sbjct  76    DDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVFRKPRVHALGK  135

Query  576   KVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVL  755
             + A G+   E +KWAKHR+IINPAF  EKLK                             
Sbjct  136   QPASGLFFLEGEKWAKHRKIINPAFRLEKLKN----------------------------  167

Query  756   MQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFEL  935
             M PAF LSC +M+SKWE  +S  GSCE DVWP LQ LT D ISRTAFGS+YEEG+ IFEL
Sbjct  168   MLPAFHLSCSDMISKWEXKLSTXGSCEXDVWPYLQNLTGDAISRTAFGSNYEEGRMIFEL  227

Query  936   QKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  1115
             Q+EQ    ++ S+   +PGWRF+PTK N+RM    KEV   + GIIDKR KAM+ GET N
Sbjct  228   QREQAQLLVQFSQSACIPGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLN  287

Query  1116  DDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
             DDLLGILLESN +EI++ G  K  GMSI+DVI+ECK+FYFAGQETTSV+L+WTM+LLS+ 
Sbjct  288   DDLLGILLESNFKEIQEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKH  347

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQARAREEVL VFG+ +P+ +GLN LK++ MIL+E LRLYPP+  + R   E+ ++G+
Sbjct  348   PNWQARAREEVLHVFGNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGD  407

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + LP G  + LPT+L+H D EIWGEDA+EF P+RF +G +KATK    FFPFG G R+C+
Sbjct  408   MYLPAGVDVSLPTILVHHDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCI  467

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             GQNFA++EAKM +AMILQRFSF LSPSY+HAP S+VT +PQ+GA LI+H
Sbjct  468   GQNFAILEAKMVLAMILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILH  516



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/543 (55%), Positives = 400/543 (74%), Gaps = 32/543 (6%)
 Frame = +3

Query  186   IYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             + ++L   + V +L +AW +L+WVWF+PKK+E+ L+QQG  G PYR+L GD KE + M  
Sbjct  5     VSSILVSIVYVAVLRWAWRLLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESSDMLK  64

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A +KP+ LSD + PRV+PF  Q V  YGK+ ++W+GP+P+V I +P+ IK+V  K  +Y
Sbjct  65    EARTKPIGLSDALLPRVMPFLHQLVKDYGKNSFMWVGPKPRVNIMNPDQIKDVFMKINEY  124

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK  ++PL + +A G+ ++E +KW+ HR+IINPAF+ EK+K                   
Sbjct  125   QKP-SHPLLKAIACGLPSHEGEKWSNHRKIINPAFHQEKIK-------------------  164

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVS-GKGSCERDVWPDLQGLTCDVISRTAFGS  902
                      LM PAF  SC  M++KWE +VS  +GSCE DVWPDLQGLTCD ISRT+FGS
Sbjct  165   ---------LMIPAFYESCSGMINKWEKLVSIDEGSCELDVWPDLQGLTCDAISRTSFGS  215

Query  903   SYEEGKRIFELQKEQGMHFIEVS-RQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDK  1079
             +YEEGKRIF+L KE     + V  + + +PG+RF+P   NRR+ AI+KE+K+S+  +I+K
Sbjct  216   NYEEGKRIFDLLKELTDLTVHVIIKAIVIPGYRFLPIPSNRRLKAIDKEIKASLNALINK  275

Query  1080  RMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSV  1256
             R +AM  GE   +DLLG+LLESN +EI++ G  K  GMSIEDVI+EC++FYFAGQETT+V
Sbjct  276   REQAMSAGEDAKNDLLGLLLESNFREIQEHGNTKSVGMSIEDVIDECRIFYFAGQETTTV  335

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +L WTM+LL+++ +WQARAREEV+QVFG+++PDF+GLN LKV+TMI YE LRLYPP+  +
Sbjct  336   LLTWTMVLLAQYPNWQARAREEVVQVFGNKKPDFDGLNHLKVVTMIFYEVLRLYPPVIML  395

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
             +R   EE KLG ++LP G  + +PT+L+H D E+WG+DA EFKP RF EG+ KATK +  
Sbjct  396   NRDVHEEIKLGNLLLPAGVQVSVPTILLHQDHELWGDDASEFKPGRFAEGVSKATKSQVS  455

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             F PFG GPRICVGQNFAL+EAKMA+AMILQR SFELSPSY HAP +++T QPQHGAP+I+
Sbjct  456   FLPFGWGPRICVGQNFALIEAKMALAMILQRCSFELSPSYIHAPRTVITLQPQHGAPMIL  515

Query  1797  HKL  1805
              KL
Sbjct  516   RKL  518



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 388/526 (74%), Gaps = 29/526 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
              +AW V++W+W +PKKLE++L+QQGL GN YR +SGDMKE++  T  A SKPM+LS +IA
Sbjct  18    TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIA  77

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRVIPF+ + VN YGK+ +VWMG  P+V+I +PE +K +L K   + +   NPL + +A 
Sbjct  78    PRVIPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLAT  137

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+A YE +KWAKHRRIINP F+ EKLK                             M PA
Sbjct  138   GIAFYEGEKWAKHRRIINPVFHLEKLKR----------------------------MLPA  169

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+ +WE +V  + SCE DVWP  Q LT DVISRTAFGSSY+EG++IF+L KEQ
Sbjct  170   FYESCSEMIVEWESLVLKESSCELDVWPYFQNLTADVISRTAFGSSYKEGRKIFQLLKEQ  229

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                  +V + VY PGWRF+PTK N++M  I++E+++ + GII+KR  A++ G+   DDLL
Sbjct  230   VQLVTKVVQSVYTPGWRFLPTKTNKKMKGIDREIRALLMGIINKREGAIKAGKATKDDLL  289

Query  1128  GILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G+L+ESN++EIR+ G  K+ GMS+ DVIEECK+FYFAGQETTS +LVWTM+LL ++QDWQ
Sbjct  290   GVLMESNVKEIREHGNNKKVGMSMHDVIEECKLFYFAGQETTSGLLVWTMVLLGQYQDWQ  349

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
               AREEV++VFG  +PDF+GL  LKV+TMIL+E LRLYP ++ M R T ++T+L    LP
Sbjct  350   DHAREEVIEVFGSNKPDFDGLIHLKVVTMILHEVLRLYPALSLMTRITSKKTQLANYSLP  409

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LPTLL+H D ++WG+DA+EFKP+RF EG++KATK K  +FPFGGGPRIC+GQNF
Sbjct  410   AGVEVALPTLLVHHDKQLWGDDAQEFKPERFSEGVLKATKNKFTYFPFGGGPRICIGQNF  469

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             A+VEAK+A+++ILQ F+FELSPSYAHAP S +T +PQ GA +I+HK
Sbjct  470   AMVEAKVALSLILQHFTFELSPSYAHAPSSHLTIRPQFGAHIILHK  515



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/543 (55%), Positives = 386/543 (71%), Gaps = 30/543 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++ + L +C +V +L Y W +++ VWF+P+K+EK L+QQG  G  YR L GD+ E+  
Sbjct  1     MELLQSFLALCCTVVVLIYGWKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKN  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +ALSKP+  SD+  PR I F  + V  +G++ +VW+GP   V+I DPE ++EVL+K+
Sbjct  61    MGEEALSKPIDFSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSKS  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +QK   NPLG+ VA+G+A+YE DKWAKHRR+INPAF+ +K+K                
Sbjct  121   YVFQKPY-NPLGKLVAQGLASYETDKWAKHRRLINPAFHLDKVKH---------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M P+F  SC EMLSKWE IV  +G  E DVWP LQ +T D IS TAF
Sbjct  165   -------------MLPSFHKSCAEMLSKWEKIVPSEGCFELDVWPYLQTMTSDAISLTAF  211

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYE+G +IFELQKEQ    I+     ++PGWRF+PTK NRRM  I  EV+S +  IID
Sbjct  212   GSSYEQGIKIFELQKEQAALLIKAILSAFIPGWRFLPTKTNRRMKHIITEVESLLLAIID  271

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KR KA++ GE  ++DLL ILLESN +EI+Q G K FGMS++DVIEECK+FY AGQETTS 
Sbjct  272   KRTKAIEAGEATSNDLLDILLESNSKEIKQNGHK-FGMSLQDVIEECKLFYLAGQETTSS  330

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWTMILLS+  DWQARAREEVL VF    PDF+ L+ LK+++MI  E LRLYPP   +
Sbjct  331   LLVWTMILLSKHLDWQARAREEVLHVFRSGTPDFQDLSRLKIVSMIFQEVLRLYPPGLLI  390

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R   +ET LG IVLP G  L+LP +L+H D +IWGEDAK+F P+RF EG+ +AT G   
Sbjct  391   SRAVHKETALGNIVLPAGVQLLLPVILLHHDCKIWGEDAKDFNPERFSEGVSEATGGSLS  450

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             +FPFG GPRIC+GQNFA++EAKMA+AMILQ +SFELSPSY+HAP++++T QPQHGA LI+
Sbjct  451   YFPFGWGPRICIGQNFAMLEAKMALAMILQHYSFELSPSYSHAPHTVLTLQPQHGAHLIL  510

Query  1797  HKL  1805
              KL
Sbjct  511   RKL  513



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/528 (57%), Positives = 379/528 (72%), Gaps = 29/528 (5%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT-LSDN  401
             L  A+ VL+WVWFKPKK+EK L++QGLKGNPYR+L GD+KE+ K    A S+P+   S  
Sbjct  20    LYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKACSQPVKGFSHA  79

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKV  581
               PRVIP Y   V+KYGK+ Y W GP   V++ DPE IKEV  K   + K  +NPL + +
Sbjct  80    FEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFNKPHSNPLSKLL  139

Query  582   ARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQ  761
              RGV +YE DKW KHR+IINPAF+ +KLK                             M 
Sbjct  140   LRGVVSYEGDKWVKHRKIINPAFHQDKLKH----------------------------ML  171

Query  762   PAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
             P+F  S  E +S W+ +V+ KGS E DV P LQ LT D ISRTAFGS+YEEGKRIFELQ+
Sbjct  172   PSFHTSAMETVSIWDAMVAEKGSTEVDVLPYLQTLTSDAISRTAFGSNYEEGKRIFELQR  231

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             EQ    +   R +Y+PGWRF+PTK NRRM +I K V +SI  I+ +R+KAM+ G    DD
Sbjct  232   EQAELVVIALRSLYIPGWRFLPTKMNRRMKSISKVVNNSIGIIVSERIKAMEAGVACEDD  291

Query  1122  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LLG LLESN +E+ + G KE G+SI+DVIEECK+FYFAGQETTS +LVWTM+LLS++  W
Sbjct  292   LLGTLLESNFKEMDEHGKKEVGLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHW  351

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             Q  AREEVLQ FG ++PD++GL+ LK ++MILYE LRLYPP+  + RR+ +E KLG++ L
Sbjct  352   QTLAREEVLQHFGTKKPDYDGLHHLKTVSMILYEVLRLYPPVPVIARRSTQEIKLGKMTL  411

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G LL LP +L+H D+E+WGEDA EFKP+RF +G+  ATKG+ +FFPFG GPRIC+ QN
Sbjct  412   PAGGLLSLPIMLLHRDTELWGEDALEFKPERFADGVSHATKGQVIFFPFGWGPRICIAQN  471

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FAL+EAKMAMA+ILQRFSFELSPSY HAP S++T +PQ+GA LI+HK+
Sbjct  472   FALLEAKMAMALILQRFSFELSPSYTHAPISIITLRPQYGAHLILHKI  519



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/566 (54%), Positives = 409/566 (72%), Gaps = 35/566 (6%)
 Frame = +3

Query  195   LLGVCISVG----LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             L  V IS G    L++  W +L+WVW +PK+LE+ L++QGL GN YR+L GD KE+++M 
Sbjct  3     LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQ  542
              +A S+P++LSD+I  RV+PF+   + KYGK+ + W+GP P+V I +PEL+++VL K+  
Sbjct  63    KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  543   YQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASL  722
             +QK  ++PL + +  G+   E ++WAK R+IINPAF+ EKLK                  
Sbjct  123   FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKN-----------------  165

Query  723   EGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGS  902
                        M  AF LSC +M++KW+ + S +GSCE DVWP L+ LT DVISRTAFGS
Sbjct  166   -----------MLSAFHLSCSDMVNKWKKL-SVEGSCELDVWPYLENLTGDVISRTAFGS  213

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             SYEEG RIF+LQKEQ    I+V+  VY+PGWRF PTK N+RM  I KEV + + GII+KR
Sbjct  214   SYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIINKR  273

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVM  1259
              KAM+ GET N DLLGIL+ESN +EI++ Q   + GMS +DVI+ECK+FY AGQETTSV+
Sbjct  274   EKAMEAGETANSDLLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVL  333

Query  1260  LVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMD  1439
             L+WTM+LLS+  DWQARAREEVLQVFG+ +P+ +GLN LK++TMI +E LRLYPP+T + 
Sbjct  334   LLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLT  393

Query  1440  RRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVF  1619
             R   ++T++G++  P G  + LPT+L+H D EIWG+DAKEF P+RF EG+ KATK +  F
Sbjct  394   RMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSF  453

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
              PFG GPR+C+GQNFA++EAK+A+AMILQRFSFELSPSYAHAPYS++T QPQ+GA LI+ 
Sbjct  454   LPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPYSLITIQPQYGAHLILR  513

Query  1800  KL*YVSSQFPEIPLICSLESNFYIFC  1877
              L Y++    E   + ++ S+F  FC
Sbjct  514   GL-YINRNKREQIYLLTVISSFCRFC  538



>ref|XP_010465355.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/545 (56%), Positives = 389/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+    L V I++ ++++  W  L WVWFKPK LE++L++QGL G PY  L GD+K   
Sbjct  1     MEISGASLTVSIALVVVSWWVWRTLKWVWFKPKMLERYLRRQGLAGTPYTPLVGDLKRNV  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M T+A+SKP+ L+D+I PRV+P  +Q    +G+S + W+GP P + + DP+ IKEV N 
Sbjct  61    NMFTEAISKPIKLTDDITPRVMPHPLQMFKNHGRSFFTWLGPTPTITLMDPDQIKEVFNN  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QKA+T  LG  +A G+ NY+ DKWAKHRRIINPAF+ EKLK+              
Sbjct  121   VYDFQKAQTFLLGNLIATGLINYDGDKWAKHRRIINPAFHLEKLKK--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +WE +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQSCSEVVCEWEKLVSDKGSSCEVDVWPWLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+   +VY+PG+R++PTK NRRM A  KE++  +RGI
Sbjct  213   AFGSSYKEGQRIFELQTELVHLIIQAFWKVYIPGYRYLPTKNNRRMKAASKEIQDILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A   G+  NDDLLGILLESNL +      K  GMS EDV+EECK+FYFAGQETT
Sbjct  273   VNKRLRARDAGKAPNDDLLGILLESNLGQ-----AKGNGMSTEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ Q WQARAR+EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T
Sbjct  328   SVLLVWTMVLLSQHQAWQARARDEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP +L+  D+++WG DA EFKP+RF++GI KATK +
Sbjct  388   HLTRAIHKEMKLGDLTLPGGVHISLPVMLVQRDTKLWGNDAAEFKPERFKDGISKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNF L+EAKMAMA+IL RFSFELSPSY HAPY++VT  PQ GA L
Sbjct  448   VSFFPFAWGPRICIGQNFTLMEAKMAMALILLRFSFELSPSYVHAPYTVVTIHPQFGAHL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/545 (56%), Positives = 401/545 (74%), Gaps = 30/545 (6%)
 Frame = +3

Query  174   EMEVIYTL-LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             E+ V+ ++ L V  +  ++ +AW VL+WVW +PKKLE+ L+QQGL GN YR+L GD KE 
Sbjct  2     EVSVVASVALRVVWASVIITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKES  61

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             + M  +  SKPM L  ++APRV+PF  Q +N YGK+ ++W+GP P+V I +P+ +K++  
Sbjct  62    SMMVKETKSKPMDLCHDLAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFA  121

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             K   +QK  TNPL   +A G+++YE +KWAKHR+IINPAF+SEKLK              
Sbjct  122   KYEDFQKPATNPLVNLLATGLSSYEGEKWAKHRKIINPAFHSEKLKR-------------  168

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF  SC EM+ KWE + S +GSCE DVWP LQ LT DVISRT
Sbjct  169   ---------------MLPAFHQSCSEMIEKWESLASKEGSCELDVWPYLQNLTADVISRT  213

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSYEEG++IF+L K+QG   ++  + VY+PGW F+PT+ N+RM  I+KE+K S+ GI
Sbjct  214   AFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYIPGWWFLPTRMNKRMKEIDKEIKGSLMGI  273

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQET  1247
             I+KR +A++ GE   DDLLGIL+ SNL+EIR+ G  K FGMSIEDVIEECK+FYFAGQET
Sbjct  274   INKREEAIRVGEATKDDLLGILMASNLKEIRENGNTKNFGMSIEDVIEECKLFYFAGQET  333

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWT++LLS+ QDWQARAR+EVLQVFG  +PDF+GL+ +KV+TMIL E LRLYP +
Sbjct  334   TSVLLVWTLVLLSQNQDWQARARDEVLQVFGSNKPDFDGLSHVKVVTMILLEVLRLYPAV  393

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + R   + T+LG++ LP G  + L TLL+H D E+WGEDA EFKP+RF EG+ KATK 
Sbjct  394   VVLSRAIHKNTQLGKLSLPAGVEVSLNTLLVHHDKELWGEDANEFKPERFSEGVSKATKN  453

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             K  +FPFGGGPRIC+GQNFA+VEAK+A+A+ILQ F+FELSPSYAHAP + +T QPQ GA 
Sbjct  454   KFAYFPFGGGPRICIGQNFAMVEAKLALALILQHFAFELSPSYAHAPSAEITLQPQFGAH  513

Query  1788  LIIHK  1802
             +I+HK
Sbjct  514   IILHK  518



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/542 (56%), Positives = 399/542 (74%), Gaps = 30/542 (6%)
 Frame = +3

Query  186   IYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             +Y  +GV  +V L  +AW VL+ +W +PKKLEK L+  GL GN YR++ GD K++A M  
Sbjct  9     MYYSIGVSCAVALAVFAWRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLK  68

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A SKP+ LSD+I PRVIPF+++ + KYGK+ +VW+G  P V+I DP L++E+L KNY +
Sbjct  69    EANSKPINLSDDIVPRVIPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIF  128

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             +K R +P+ + +A+GV   E DKWAKHR+II+ AF+ +KLK                   
Sbjct  129   KKPRPHPIVKLLAQGVIFSEGDKWAKHRKIISSAFHLQKLKH------------------  170

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF  S  EMLSKWE  VS +GSCE DVWP LQ L  D ISRTAFGS+
Sbjct  171   ----------MLPAFYSSASEMLSKWEERVSPEGSCELDVWPYLQTLGADSISRTAFGSN  220

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIFELQ EQ  + +  +R VY PG RF+PT+RN+RM  IEKE+++ IR II+KR+
Sbjct  221   YEEGRRIFELQMEQAQYAVRATRSVYFPGLRFLPTRRNKRMKDIEKEIQAKIRDIINKRV  280

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLV  1265
             KA++ GET+NDDLLGI+LESN +EI   G K FGM+++DVI+ECK+FYFAGQE++S +LV
Sbjct  281   KALKAGETSNDDLLGIMLESNFKEIDLHGDKSFGMTMQDVIDECKLFYFAGQESSSTLLV  340

Query  1266  WTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRR  1445
             WT++LL R ++WQ++AR+EV QVFG  +P FEGLN LK++TMIL E LRLYPP   ++RR
Sbjct  341   WTLVLLGRHREWQSKARDEVSQVFGRNKPHFEGLNHLKIVTMILNEVLRLYPPAVALNRR  400

Query  1446  TVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV--F  1619
               +ETK+G++ LP G +L LP +L+H D EIWG+D KEFKP+RF EG+ KA  G+    F
Sbjct  401   VHQETKVGKLSLPAGVMLWLPVILLHHDREIWGDDVKEFKPERFSEGVSKAANGQSQAPF  460

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             FPFG GPRIC+GQNFA++EAK+A++MILQ FSF+LSPSY HAPY++ T QPQHGA L++H
Sbjct  461   FPFGWGPRICLGQNFAMLEAKLALSMILQHFSFQLSPSYVHAPYTVFTLQPQHGALLVLH  520

Query  1800  KL  1805
             KL
Sbjct  521   KL  522



>emb|CDX98484.1| BnaC05g38910D [Brassica napus]
Length=512

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/526 (57%), Positives = 382/526 (73%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + WG L+WVWFKPKKLE +L+ QGL G+PY  L GD+K    M  +A SKP+ L+D+I+ 
Sbjct  20    WTWGTLNWVWFKPKKLEIYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIKLTDDIST  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF ++ +  +G + + W+G  P + I DPELIKEV NK Y +QK  T PLG  +A+G
Sbjct  80    RVVPFPLEMLKTHGMTYFTWLGTIPTITIMDPELIKEVFNKFYDFQKPHTFPLGNVIAKG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +ANY+ +KWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LANYDGEKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E++ KW+ IVS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSEVVGKWDKIVSEKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQGEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I    + ++PG+ ++PTK NRR+ A  +E+K  +RGI++KR++A + GE  +DDLL
Sbjct  232   AQLIILAVLKAFIPGYLYLPTKGNRRIKAAAREIKVILRGIVNKRLRAREAGEAPSDDLL  291

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESNL    Q  G E  MS  DV+EECK+FYFAGQETTSV+LVWTM++LS+ QDWQA
Sbjct  292   GILLESNLG---QAKGNE--MSTADVMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQA  346

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAR+EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LPR
Sbjct  347   RARDEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPR  406

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             GA + LP LL+H D+++WGE+A EFKP+RF++G+ KAT GK  FFPF  GPRIC+GQ+FA
Sbjct  407   GAQISLPILLVHRDTQLWGEEAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFA  466

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+E KMA+A+IL+RFSFELSPSY HAPY+++T  PQ GAPLI+ KL
Sbjct  467   LLETKMALALILKRFSFELSPSYVHAPYAVITLHPQFGAPLILRKL  512



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/547 (57%), Positives = 394/547 (72%), Gaps = 35/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGL---LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+ Y       S  +   L +AW +L++VW KPK LEK L+Q+G KGN Y+ L GDMKE
Sbjct  1     MEIPYNFKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKE  60

Query  348   LAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEV  524
             ++KM  +ALSKP+  S D I PRV PF  + +  YGK+ +VW GP+P V+I DPE+IKEV
Sbjct  61    MSKMGEEALSKPVNFSHDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEV  120

Query  525   LNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
             + KNY +QK   NPL + +A G+A+YE DKWA HRR++NPAF+ +KLK            
Sbjct  121   MMKNYVFQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKH-----------  169

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                              M PAF L+  EML KWE IVS  GS E DV   LQ LT D IS
Sbjct  170   -----------------MLPAFKLTASEMLGKWEKIVSRDGS-EIDVLSYLQTLTSDAIS  211

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSYEEG +IFELQKEQ    ++VSR VY+PGWRF+PTKRN+RM  I  EV++ I 
Sbjct  212   RTAFGSSYEEGIKIFELQKEQIQLILQVSRTVYIPGWRFLPTKRNKRMKQIFNEVRTLIF  271

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II+KRM+ ++ GE++ DDLLGILL SNL+EI+Q G K+F MSI++VIEECK+FYFAGQE
Sbjct  272   EIINKRMRMIEAGESH-DDLLGILLSSNLKEIQQHGNKKFSMSIDEVIEECKLFYFAGQE  330

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS +LVWTMILLS+  +WQ RAREEVLQVFG  E D++ LN LKV+TMIL E LRLYP 
Sbjct  331   TTSTLLVWTMILLSQHPNWQDRAREEVLQVFGSNEVDYDKLNQLKVVTMILNEVLRLYPA  390

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                M R    +T LG + LP G  L+LPT+L+  D+EIWG+DA EF P+RF +GI+KATK
Sbjct  391   GYMMTRMVQTKTNLGNLCLPGGVQLLLPTILLQHDTEIWGDDAMEFNPERFSDGILKATK  450

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+ VFFPFG GPRIC+GQNFA++EAKMAMAMIL+ ++FELS SY+HAP+ ++  QPQ+GA
Sbjct  451   GQLVFFPFGWGPRICIGQNFAMLEAKMAMAMILKHYAFELSSSYSHAPHPLM-LQPQYGA  509

Query  1785  PLIIHKL  1805
             PLI++KL
Sbjct  510   PLILYKL  516



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/531 (56%), Positives = 388/531 (73%), Gaps = 30/531 (6%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             + LL +AW +L+WVW +PKKLE+ L++QGL GN YR+L GD +E+++M  +A S P++ S
Sbjct  13    ITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNNEANSGPISFS  72

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGR  575
             D+I  RV+PF+   + KYGK+ + W+GP+P V I +PELI++VL K+  +QK   +PLG+
Sbjct  73    DDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVFQKPPPHPLGK  132

Query  576   KVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVL  755
              +A GV   E ++W K R+IINPAF+ EKLK                             
Sbjct  133   LLATGVVALEGEQWTKRRKIINPAFHLEKLKH----------------------------  164

Query  756   MQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFEL  935
             M  AF LSC +M++KWE  +S   SCE D+WP LQ LT DVISRTAFGSSYEEG+RIF+L
Sbjct  165   MVSAFQLSCSDMVNKWEKKLSMDDSCELDIWPYLQILTGDVISRTAFGSSYEEGRRIFQL  224

Query  936   QKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNN  1115
             QKEQ     +V++ VYVPGWRF PTK NRRM  I  EV + ++GII+KR KAM+ GET N
Sbjct  225   QKEQAHLVAQVTQSVYVPGWRFFPTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETAN  284

Query  1116  DDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
              DLLG+L+ESN +E+++    K  GMSI+DVIEECK+FYFAGQETTSV+L+WTM+LLS+ 
Sbjct  285   HDLLGLLMESNYREMQENDERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKH  344

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQARAREEVLQVFG+++PD +GLN LK++TMI +E LRLYPP + + R    ++++G 
Sbjct  345   SNWQARAREEVLQVFGNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGG  404

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             + L  G L+ LP LL+H + EIWGEDAKEF P RF EG+ KA K +  FFPFG GPRICV
Sbjct  405   LYLSDGVLIALPILLIHHNHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICV  464

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GQNFA++EAKMA+AMILQRFSF+LSPSYAHAP S++  QPQHGA LI+H L
Sbjct  465   GQNFAMMEAKMALAMILQRFSFDLSPSYAHAPSSLL-MQPQHGAHLILHGL  514



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 381/538 (71%), Gaps = 37/538 (7%)
 Frame = +3

Query  204   VCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             V +SV ++A   + W  L+WVWFKPKKLE +L++QGL G PY  L GD++    M+ +A 
Sbjct  8     VTVSVAIVAVLWWVWRTLNWVWFKPKKLESYLRRQGLSGTPYTPLVGDVRRDYTMSMEAR  67

Query  375   SKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             SKP+ ++D+I PRV+PF    +  YG + + W GP P + I DPE IKEV NK Y +QK 
Sbjct  68    SKPIRITDDIVPRVVPFPSHMLKTYGMTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
              + PLGR +A G+ +Y+ DKWAKHRRIINPAF+ EK+K                      
Sbjct  128   HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKN---------------------  166

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYE  911
                    M PAF  SC E++ KW+ IV  KG SCE DVWP L  +T DVISRTAFGSSY+
Sbjct  167   -------MVPAFHQSCSEVVGKWDNIVVDKGSSCEVDVWPGLVSMTADVISRTAFGSSYK  219

Query  912   EGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKA  1091
             EG+RIFELQ E      +  R++++PG+R+ PTK NRRM A  +EV+  +RGI++KR++A
Sbjct  220   EGQRIFELQAELAQLLTQAFRRIFIPGYRYYPTKGNRRMKAAAREVQDILRGIVNKRLRA  279

Query  1092  MQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWT  1271
              + GE  ++DLLG LLESNL +      K  GMSIEDVIEECK+FYFAGQETTSV+LVWT
Sbjct  280   REAGEAPSEDLLGTLLESNLGQ-----AKGTGMSIEDVIEECKLFYFAGQETTSVLLVWT  334

Query  1272  MILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTV  1451
             M++LS+ QDWQARAR+EV QVFGD+EPD EGLN LK++TMILYE LRLYPP+  + R   
Sbjct  335   MVMLSQHQDWQARARDEVKQVFGDKEPDTEGLNHLKIMTMILYEVLRLYPPVVQLTRAIH  394

Query  1452  EETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFG  1631
             +E KLG++ LP G  + LP +L+  D+ +WG DA EFKPDRF++G+ KATK +  F PF 
Sbjct  395   KEMKLGDLTLPGGTHISLPVMLVQRDTNLWGNDAGEFKPDRFKDGVSKATKSQVSFIPFA  454

Query  1632  GGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              GPRIC+GQNFA++EAKMAMA+ILQRFSFELSPSY HAPY++ T  PQ GA LI+HKL
Sbjct  455   WGPRICIGQNFAMLEAKMAMALILQRFSFELSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 397/542 (73%), Gaps = 34/542 (6%)
 Frame = +3

Query  195   LLGVCISVG----LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             L  V IS G    L++  W +L+WVW +PK+LE+ L++QGL GN YR+L GD KE+++M 
Sbjct  3     LSSVAISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMM  62

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQ  542
              +A S+P++LSD+I  RV+PF+   + KYGK+ + W+GP P+V I +PEL+++VL K+  
Sbjct  63    KEAYSRPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNI  122

Query  543   YQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASL  722
             +QK  ++PL + +  G+   E ++WAK R+IINPAF+ EKLK                  
Sbjct  123   FQKTPSHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKN-----------------  165

Query  723   EGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGS  902
                        M  AF LSC +M++KW+ + S +GSCE DVWP L+ LT DVISRTAFGS
Sbjct  166   -----------MLSAFHLSCSDMVNKWKKL-SVEGSCELDVWPYLENLTGDVISRTAFGS  213

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             SYEEG RIF+LQKEQ    I+V+  VY+PGWRF PTK N+RM  I KEV + + GII+KR
Sbjct  214   SYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRFFPTKTNKRMKQISKEVHALLGGIINKR  273

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVM  1259
              KAM+ GET N DLLGIL+ESN +EI++ Q   + GMS +DVI+ECK+FY AGQETTSV+
Sbjct  274   EKAMEAGETANSDLLGILMESNFREIQEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVL  333

Query  1260  LVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMD  1439
             L+WTM+LLS+  DWQARAREEVLQVFG+ +P+ +GLN LK++TMI +E LRLYPP+T + 
Sbjct  334   LLWTMVLLSQHPDWQARAREEVLQVFGNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLT  393

Query  1440  RRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVF  1619
             R   ++T++G++  P G  + LPT+L+H D EIWG+DAKEF P+RF EG+ KATK +  F
Sbjct  394   RMVSKDTQVGDMYFPAGVQVSLPTILVHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSF  453

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
              PFG GPR+C+GQNFA++EAK+A+AMILQRFSFELSPSYAHAPYS++T QPQ+GA LI+ 
Sbjct  454   LPFGWGPRVCIGQNFAMMEAKIALAMILQRFSFELSPSYAHAPYSLITIQPQYGAHLILR  513

Query  1800  KL  1805
              L
Sbjct  514   GL  515



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/544 (54%), Positives = 388/544 (71%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME    + G  I + +L +AW +L W+W +PKKLEK L++QGLKGNPYR+L GDMKE  K
Sbjct  1     MEATSAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFK  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
                 A SKPM LSD+I  RV P+  Q V K+GK+ ++W GP P+V++ DPEL+K+V NK 
Sbjct  61    SEMKARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKM  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +QK  +NPL R +A G+  +E++KW  HR+IINPAF+ EKLK                
Sbjct  121   YDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         +M P    SC +M++KWE ++S  GSCE DVWP +Q L  DVI+RTAF
Sbjct  165   ------------MMLPVIFESCNDMINKWERMLSSDGSCEIDVWPSIQNLASDVIARTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG RIF+LQKEQ    +E+  +VY+PGWRF+PT  NRR+  I++ + +S+  II+
Sbjct  213   GSSYEEGIRIFQLQKEQAEITMEILMKVYIPGWRFLPTTTNRRLKEIDRVIIASLTKIIN  272

Query  1077  KRMKAMQGGETNNDDLLGILLESN-LQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR  A++ GET  +DLLGILLESN  +       K  GM+I+DVI+ECK+FY AG+ETTS
Sbjct  273   KRENAIKAGETPKNDLLGILLESNHKEIKENNNNKNVGMNIDDVIKECKLFYLAGEETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTMILLSR  +WQARAREEVLQVFG+++PDF+GL+ LK++TMILYE LRLYPP+  
Sbjct  333   VLLVWTMILLSRHPNWQARAREEVLQVFGNKKPDFDGLSHLKIITMILYEVLRLYPPLIV  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   +  ++G + LP G  + LP + +H + E+WG+DAK F P+RF EGI+KAT GK 
Sbjct  393   LPRAVQKNVRVGNLTLPAGVQIGLPIVWLHHECELWGDDAKVFNPERFSEGILKATNGKI  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPRIC+GQNF+L+EAKMA+A+ILQ FSFELSP+YAHAP  ++T QPQHGA +I
Sbjct  453   SFFPFGWGPRICIGQNFSLLEAKMAIALILQHFSFELSPTYAHAPAMIITLQPQHGAHII  512

Query  1794  IHKL  1805
             + KL
Sbjct  513   LRKL  516



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/545 (57%), Positives = 388/545 (71%), Gaps = 36/545 (7%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             V  +L+ V I V L   AW VLDWVW KPKKLE+ L++QG KGN YRIL GD KE   M 
Sbjct  9     VALSLVFVSIVVRL---AWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIML  65

Query  363   TDALSKPMTLS--DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
               A SKPM LS   +IAPRV P   Q V  YGK+  VWMGP P+V I +PE +K+V  + 
Sbjct  66    KKAKSKPMNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTEL  125

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               +QK  +NPL + +A G+  +E +KWAKHRRIINP F+ EKLK                
Sbjct  126   SDFQKPHSNPLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKR---------------  170

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSC-ERDVWPDLQGLTCDVISRTA  893
                          M PAF  SC EM+ +WE +VS + S  E DVWP LQ +T DVISRTA
Sbjct  171   -------------MLPAFYQSCDEMIKEWETVVSKESSSHEIDVWPSLQNVTADVISRTA  217

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSY+EG++IFEL KEQ ++ ++  + VY+PGWRFVPTK N+RM  I+KE+++ + GII
Sbjct  218   FGSSYQEGRKIFELLKEQAVYAMKSIQSVYIPGWRFVPTKMNKRMKQIDKEIRNVLMGII  277

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQG--GKEFGMSIEDVIEECKVFYFAGQET  1247
              KR +A++ GE   DDLLG L+ESNL+EIR  G   K+ GMSIEDVIEECK+FYFAGQET
Sbjct  278   SKREQAIEVGEAIKDDLLGALMESNLKEIRDHGKNNKDVGMSIEDVIEECKLFYFAGQET  337

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+LVWTM+LL + Q+WQ  AREEVLQVFG  +P+F+GL  LKV+TMIL E LRLYP +
Sbjct  338   TSVLLVWTMVLLCQNQNWQHLAREEVLQVFGMNKPEFDGLTHLKVVTMILLEVLRLYPAV  397

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + R T ++T+LG+  LP G  + LPTLL+H D E+WG+DAKEF+P+RF EG+ KATKG
Sbjct  398   VVLSRTTHKKTQLGKFSLPAGVEVELPTLLIHHDKELWGDDAKEFRPERFSEGVSKATKG  457

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
                FFPFG GPRIC+GQNFA++EAK+A+A+ILQ F+FELSPSY HAP ++VT QPQ GAP
Sbjct  458   HLSFFPFGAGPRICIGQNFAMMEAKLALALILQHFTFELSPSYTHAPSNLVTLQPQFGAP  517

Query  1788  LIIHK  1802
             +I+HK
Sbjct  518   IILHK  522



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/534 (56%), Positives = 386/534 (72%), Gaps = 30/534 (6%)
 Frame = +3

Query  210   ISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT  389
             + V ++ +A  +L+W W KPKKLEK L++QG +GN YR L GD+KE   ++  A SKP++
Sbjct  13    VIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHGILSRQAKSKPIS  72

Query  390   LSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPL  569
             L D+IAPRV+P Y Q    YGK+ Y W+GP P + I DP+ IKEV      +QK +TNPL
Sbjct  73    LDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPL  132

Query  570   GRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTS  749
             G+ +  G+A  E +KWAKHR+IINPAF+ EKLK                           
Sbjct  133   GKILTTGLAIREGEKWAKHRKIINPAFHQEKLK---------------------------  165

Query  750   VLMQPAFLLSCCEMLSKWEGIVSG-KGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRI  926
              LM PAF  SC E++SKWE ++ G +GSCE DVWP L  LT DVISRTAFGS+YEEG RI
Sbjct  166   -LMLPAFYQSCTEIISKWEKLMIGDQGSCELDVWPYLVKLTSDVISRTAFGSNYEEGIRI  224

Query  927   FELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE  1106
             F+LQ E     ++  + VY+PGWR+VPTKRNRRM  ++KE++ S+  II KR  AM+ GE
Sbjct  225   FQLQTELADIALQALQSVYIPGWRYVPTKRNRRMKELDKEIRVSLADIIRKREIAMKTGE  284

Query  1107  TNNDDLLGILLESNLQEIRQQGGKEF-GMSIEDVIEECKVFYFAGQETTSVMLVWTMILL  1283
                DDLLG+L+ESNL+EI++ G  +  G+S +DVI+ECK+FYFAGQETTSV+L+WTM+LL
Sbjct  285   AAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLL  344

Query  1284  SRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETK  1463
             S+ QDWQA AREEVLQV GD++PDF+GLN LK++ MI YE LRLYPP+  + R   +ETK
Sbjct  345   SKHQDWQAHAREEVLQVLGDKKPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETK  404

Query  1464  LGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPR  1643
             +G+++LP  +++ L TLL+H D ++WG+DAKEFKP+RF EGI KATK +  +FPF  GPR
Sbjct  405   IGDLILPAESVIALQTLLVHHDKKLWGDDAKEFKPERFSEGISKATKNQVSYFPFSWGPR  464

Query  1644  ICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             IC+GQNFALVEAKMAMAMILQ FSFELSPSY HAP++ +  QPQHG  LI+ KL
Sbjct  465   ICIGQNFALVEAKMAMAMILQNFSFELSPSYVHAPHAFIFLQPQHGVYLILRKL  518



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/535 (56%), Positives = 383/535 (72%), Gaps = 29/535 (5%)
 Frame = +3

Query  204   VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
               + V +L +AW VL+WVW +PKKLEK+L+QQGLKGN YR+L GD+KE +    +A ++P
Sbjct  11    TIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             ++L D+IA RV PF  + VN YGK+ ++W GP P+V I +P+ IK +  K   +QK  + 
Sbjct  71    LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL R +  G+A  E +KWAKHR++INPAF+ EKLK                         
Sbjct  131   PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLK-------------------------  165

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                LM PAF LSC E+++KWE  +S +GS E DVWP L  LT DVISRTAFGSSYEEG+R
Sbjct  166   ---LMLPAFYLSCIEIITKWEKQMSVEGSSELDVWPYLANLTSDVISRTAFGSSYEEGRR  222

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IF+LQ E     ++V R V++PGWRF+PTKRNRRM  I+KE+++S+ GII  R KAM+ G
Sbjct  223   IFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAG  282

Query  1104  ETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMIL  1280
             E  N+DLLGIL+E++ +EI + G  K  G S+ DVIEECK+FYFAGQETTSV+L WTM+L
Sbjct  283   EAANNDLLGILMETSFREIEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVL  342

Query  1281  LSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEET  1460
             LS+ QDWQ RAR+EVLQVFG+ +PD++GLN LK++ MILYE LRLYPP+T + R   +ET
Sbjct  343   LSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKET  402

Query  1461  KLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGP  1640
             KLG + LP G  + LP +L+H D E+WG+DA EFKP+RF EGI KA K +  +FPF  GP
Sbjct  403   KLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPERFAEGISKAAKNQVSYFPFALGP  462

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             RICVGQNFALVEAKMA AMILQ +SFELSPSY HAP ++ T  P+ G  LI+ KL
Sbjct  463   RICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPTAVPTLHPELGTQLILRKL  517



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/535 (56%), Positives = 383/535 (72%), Gaps = 29/535 (5%)
 Frame = +3

Query  204   VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
               + V +L +AW VL+WVW +P+KLEK+L+QQGLKGN YR+L GD+KE +    +A ++P
Sbjct  11    TIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARP  70

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             ++L D+IA RV PF  + VN YGK+ ++W GP P+V I +P+ IK +  K   +QK  + 
Sbjct  71    LSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTKINDFQKVNSI  130

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL R +  G+A  E +KWAKHR++INPAF+ EKLK                         
Sbjct  131   PLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLK-------------------------  165

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                LM PAF LSC E+++KWE  +S +GS E DVWP L  LT DVISRTAFGSSYEEG+R
Sbjct  166   ---LMLPAFYLSCIEIITKWEKQMSVEGSSELDVWPYLANLTSDVISRTAFGSSYEEGRR  222

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IF+LQ E     ++V R V++PGWRF+PTKRNRRM  I+KE+++S+ GII  R KAM+ G
Sbjct  223   IFQLQAELAELTMQVFRSVHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAG  282

Query  1104  ETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMIL  1280
             E  NDDLLGIL+E++ +EI + G  K  G S+ DVIEECK+FYFAGQETTSV+L WTM+L
Sbjct  283   EAANDDLLGILMETSFREIEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVL  342

Query  1281  LSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEET  1460
             LS+ QDWQ RAR+EVLQVFG+ +PD++GLN LK++ MILYE LRLYPP+T + R   +ET
Sbjct  343   LSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMILYEVLRLYPPVTVLSRAVFKET  402

Query  1461  KLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGP  1640
             KLG + LP G  + LP +L+H D E+WG+DA EFKP+RF EGI KA K +  +FPF  GP
Sbjct  403   KLGNLTLPAGVQIGLPMILVHQDPELWGDDAVEFKPERFAEGISKAAKNQVSYFPFALGP  462

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             RICVGQNFALVEAKMA AMILQ +SFELSPSY HAP ++ T  P+ G  LI+ KL
Sbjct  463   RICVGQNFALVEAKMATAMILQNYSFELSPSYVHAPTAVPTLHPELGTQLILRKL  517



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/541 (55%), Positives = 390/541 (72%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             ++G+ +S   VG+L + W +LDWVW +PK+LE+ L++QGL GN YR LSGD+KE   M+ 
Sbjct  6     VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
              A SKPM LSD+I   V PF  Q V   GKS + W+GP P+V I +PE I+E+  K   +
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK  +NPL   +  G+ N + ++WAKHR+IINPAF+ +KLK                   
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKN------------------  167

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF  SC EM+SKWE +V  +GS E DVWP L  LT DVISR AFGSS
Sbjct  168   ----------MLPAFYQSCIEMISKWEKLVFLEGSSELDVWPYLVKLTRDVISRAAFGSS  217

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+L ++Q    ++V +  Y+PGWR++PTK NR+M  I K++K S++G+I KR 
Sbjct  218   YEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKRE  277

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             +A +  E +NDDLLGIL+ESN++EI++QG  K  GMSIEDVIEECK+FYFAGQETTSV+L
Sbjct  278   EATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLL  337

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTMILL+R   WQ +AREEVL+VFGD +PD +GLN LKV+TMILYE LRLYP    + R
Sbjct  338   VWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNRLKVVTMILYEVLRLYPAGVALGR  397

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                ++TKLG+++LP GA + LP LL+H D E+WG+DA EF PDRF EG+ KATK + ++F
Sbjct  398   SVPKDTKLGKLLLPAGAEITLPVLLIHHDQELWGDDAHEFNPDRFSEGVSKATKSQVIYF  457

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRIC+GQNFAL+EAKMA+AMIL++F FELSPSYAH+P + +T +PQHGA +I+HK
Sbjct  458   PFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPSYAHSPCTFITLRPQHGAHIILHK  517

Query  1803  L  1805
             L
Sbjct  518   L  518



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/542 (56%), Positives = 397/542 (73%), Gaps = 29/542 (5%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             V   ++   +++  L +AW +L+W+W KPKKLEK L++QG KGN YR+L GD+++L K  
Sbjct  4     VTTAIILFTLTILSLTWAWRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLLKTR  63

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQ  542
              +A SKPM LSD+I PRV  +    V KYGK+ ++W GP P+V I DPE IK+VLNK Y 
Sbjct  64    KEATSKPMNLSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNKIYD  123

Query  543   YQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASL  722
             ++K  +NPL R +A G+ +YE +KW KHR+IINPAF+ EKLK                  
Sbjct  124   FRKPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFHLEKLK------------------  165

Query  723   EGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGS  902
                       +M P F  SC +++SKWE ++S +GSCE DVWP LQ L  DVISRTAFGS
Sbjct  166   ----------IMLPIFFKSCDDLISKWEKMLSLEGSCEMDVWPFLQNLASDVISRTAFGS  215

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             S+EEGKRIF+LQ EQ     ++  +VY+PGWRF+PT  ++RM  I++++K+S+  +I+KR
Sbjct  216   SFEEGKRIFQLQIEQAELTKQIMMKVYIPGWRFLPTTTHKRMKEIDRDIKASLTDMINKR  275

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVM  1259
              KA++ GE   DDLLGILLESN +E+ + G  K  GMS+EDVIEECK+FYFAGQETTSV+
Sbjct  276   EKALKAGEATKDDLLGILLESNHREMEEHGNNKNVGMSLEDVIEECKLFYFAGQETTSVL  335

Query  1260  LVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMD  1439
             LVWTM+ LSR+ DWQARAREEV QVFG+++PDF+GL+ LK++TMIL E LRLYPP+  + 
Sbjct  336   LVWTMVCLSRYPDWQARAREEVFQVFGNKKPDFDGLSHLKIVTMILNEVLRLYPPVIALA  395

Query  1440  RRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVF  1619
             R   ++ KLG I LP G  + LP +L+H D E+WG+DAK F P+RF EG++KAT GK  F
Sbjct  396   RSVHKDVKLGNITLPAGVQVSLPVVLVHHDCELWGDDAKVFNPERFSEGVLKATNGKVSF  455

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             FPFGGGPRIC+GQNF+++EAKMAMAMILQ FSFELSPSYAHAP +++T QPQ+GA +I+ 
Sbjct  456   FPFGGGPRICIGQNFSMLEAKMAMAMILQHFSFELSPSYAHAPATVITLQPQYGAHIILR  515

Query  1800  KL  1805
             K+
Sbjct  516   KV  517



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/528 (57%), Positives = 391/528 (74%), Gaps = 29/528 (5%)
 Frame = +3

Query  222   LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDN  401
             ++ +AW VL+WVW +PKKLE+ L+QQGL GN YR+L GD KE + M  +A SKPM L  +
Sbjct  19    IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHD  78

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKV  581
             +APRV+PF  Q +N YGK+ ++W+GP P+V I +PE +K++  K   +QK   NPL + +
Sbjct  79    LAPRVLPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLL  138

Query  582   ARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQ  761
             A G+ANYE +KWAKHR+IINPAF+SEKLK                             M 
Sbjct  139   ATGLANYEGEKWAKHRKIINPAFHSEKLKR----------------------------ML  170

Query  762   PAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
             PAF  SC E++ +WE + S +GSCE DVWP LQ LT DVISRTAFGSSYEEG++IF+L K
Sbjct  171   PAFHQSCSELIEEWESLASKEGSCELDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLK  230

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             +Q    I+  + VY+PGWRF+PT+ N+RM  I+KE+K S+ GII+KR +A++  E   DD
Sbjct  231   DQAQLTIKAIQSVYIPGWRFLPTRMNKRMKEIDKEIKGSLMGIINKREEAIRVREATRDD  290

Query  1122  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  1298
             LLGIL++SNL+EIR+ G  K  GMSIEDVIEECK+FYFAGQETTSV+LVWT++LLS+ QD
Sbjct  291   LLGILMDSNLKEIRENGNTKNVGMSIEDVIEECKLFYFAGQETTSVLLVWTLVLLSQNQD  350

Query  1299  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  1478
             WQARAR+EVLQVFG  +PDF+GL+ LKV+TMIL E LRLYP +  + R   + T+LG++ 
Sbjct  351   WQARARDEVLQVFGSNKPDFDGLSHLKVVTMILLEVLRLYPAVVVLSRAIHKNTQLGKLS  410

Query  1479  LPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQ  1658
             LP G  + L TLL+H D E+WGEDA EFKP+RF  G+ KATK K  +FPFGGGPRIC+GQ
Sbjct  411   LPAGVEVSLNTLLVHHDKELWGEDANEFKPERFSSGVSKATKNKFAYFPFGGGPRICIGQ  470

Query  1659  NFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             NFA+VEAK+A+A+ILQ F+FELSPSYAHAP + +T QPQ GA +I+HK
Sbjct  471   NFAMVEAKLALALILQHFAFELSPSYAHAPSADITLQPQFGAHIILHK  518



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/545 (55%), Positives = 389/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             E+ +    L + I+V +  + W  L+WVWFKPK LE +L++QGL G+PY  L GD+K   
Sbjct  2     EISIASATLSIAIAV-VSWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              +  +A SKP+ L+D+I PR++P+ ++ +  +G++ + W+GP P + I DPE IKEV NK
Sbjct  61    SLLKNARSKPIKLTDDITPRLVPYPLKMLKTHGRTYFTWLGPIPTITIVDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y + K  T PL R +  G+A+Y+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFPKTHTFPLARLIGTGLASYDGDKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +W+ +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQSCSEVVGEWDKLVSDKGLSCEVDVWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+  R+  +PG+R++PTK NR M A  +EV++ +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKAKAREVQAILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A + GE  +DDLLGILLESNL +++       GMS EDVIEECK+FYFAGQETT
Sbjct  273   VNKRLRAREAGEAPSDDLLGILLESNLGQVKGN-----GMSNEDVIEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQA+AREEV QVFGD+ PD +GLN LKV+TMILYE LRLYPP+T
Sbjct  328   SVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF+EG+ KATK +
Sbjct  388   QVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGNDAAEFKPERFKEGLSKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNFAL+EAKMAMA+ILQRFSFELSPSY HAPY+++T  PQ GA L
Sbjct  448   VSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTVITIHPQFGAHL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/545 (54%), Positives = 398/545 (73%), Gaps = 33/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME +  ++ + +++GL+ +AW VL  +W +PKKLEK L++QG +GN YRIL GD+K+L K
Sbjct  1     MEWVSGIILIIVTLGLI-WAWKVLSLLWLRPKKLEKLLREQGFQGNSYRILLGDIKDLFK  59

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQH-VNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             M  +A SK M LSD+I PRVIP Y+QH V  +GK+ Y+W G +P+V + +PE IK+VLNK
Sbjct  60    MEKEAKSKSMNLSDDITPRVIP-YIQHSVKIHGKNSYIWFGIKPRVTLTEPEQIKDVLNK  118

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
               ++ K     + + +A  +ANYE +KW+KHR++INPAF+ EKLK               
Sbjct  119   MSEFPKPNYK-IFKLLANALANYEGEKWSKHRKLINPAFHLEKLK---------------  162

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                          +M PAF  SC ++++KWE ++S  GSCE D+WP LQ L  D ISRTA
Sbjct  163   -------------IMTPAFFTSCNDLINKWEKMLSSDGSCEIDIWPSLQNLASDAISRTA  209

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEGKRIF+LQ+EQ    ++V  +  +P W F+PT  +R+MN I+KE+ SS++ +I
Sbjct  210   FGSSYEEGKRIFQLQREQAELIVKVVTKSIIPLWMFLPTIVHRKMNKIDKEITSSLKDMI  269

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             +KR KA++ GE   +DLL ILLESN +EI + +  K+ GMS++DV+EECK+F+FAGQETT
Sbjct  270   NKREKALKAGEPTRNDLLSILLESNRKEIDENENNKDVGMSLDDVVEECKLFHFAGQETT  329

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTMILLSR+ DWQ RAREEVL VFG+++PDF+GLN+LK++TMILYE LRLYPP+ 
Sbjct  330   SVLLVWTMILLSRYPDWQTRAREEVLHVFGNRKPDFDGLNNLKIVTMILYEVLRLYPPVI  389

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
             G+ R   ++ KLG + LP G  + LP LL+H D E+WG+DAK F P+RF  GI KAT G+
Sbjct  390   GLARNVEKDVKLGNLTLPAGVEIFLPILLIHHDCELWGDDAKMFNPERFFGGISKATNGR  449

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNF+L+EAKMAM +ILQ FSFELSP+YAHAP SM+T QPQ+GA +
Sbjct  450   VSFFPFGWGPRICIGQNFSLMEAKMAMTLILQHFSFELSPTYAHAPSSMITLQPQYGAHI  509

Query  1791  IIHKL  1805
             II KL
Sbjct  510   IIRKL  514



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/523 (55%), Positives = 384/523 (73%), Gaps = 30/523 (6%)
 Frame = +3

Query  243   VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIP  422
             +L+W + +PK+LEK L++QGL GN YR+L GD+++  K T +A +KP+ L D+I  RV+P
Sbjct  24    LLNWAYLRPKRLEKALRKQGLNGNSYRLLIGDLRDFMKATEEAKTKPINLDDDIKTRVVP  83

Query  423   FYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR-TNPLGRKVARGVAN  599
             F+V  ++K+GK  + W GP P +++ DP+L KE+L K+  + KAR +NPL R + +GV +
Sbjct  84    FFVNTLSKFGKDSFFWFGPHPTLIVTDPDLAKEILGKSDLFSKARSSNPLSRLLVQGVLS  143

Query  600   YEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLS  779
             +EK+KWAKHR+IINPAF+ +KLK                            LM PAF LS
Sbjct  144   HEKEKWAKHRKIINPAFHLDKLK----------------------------LMIPAFCLS  175

Query  780   CCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHF  959
             C +++S+WE  +S +G CE DVWP LQ +T D ISRTAFGSSY++G+RIFELQ EQ  + 
Sbjct  176   CDQVVSEWEKSLSPEGCCEVDVWPYLQKVTSDAISRTAFGSSYQQGRRIFELQSEQAGYA  235

Query  960   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  1139
             I   R VY+PGWR+VPTKRN+RM  I KEV+S I+ +ID+R++AM   E  ++DLL +LL
Sbjct  236   IHALRSVYIPGWRYVPTKRNKRMKEIAKEVRSIIQQLIDRRVEAMGREEGKHEDLLSMLL  295

Query  1140  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  1319
             ESN QEI + G K FGMS++DV+EECK+FYFAGQETT+ +LVW ++LLS+   WQ RARE
Sbjct  296   ESNSQEIEEHGSKSFGMSMDDVVEECKLFYFAGQETTASLLVWALVLLSKHPHWQTRARE  355

Query  1320  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  1499
             EVLQVFG Q P F+GLN LK++TMILYE LRLY PI    RR  ++TK+GE+ LP G   
Sbjct  356   EVLQVFGHQTPHFDGLNQLKIVTMILYEVLRLYSPIVAQRRRLSKDTKVGELALPAGVEF  415

Query  1500  MLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ-VFFPFGGGPRICVGQNFALVE  1676
             +LP++L+H D EIWG+DA EF P RF EG++KA + KQ VFFPFG GPRIC+GQ FA++E
Sbjct  416   ILPSILLHHDREIWGDDALEFNPGRFEEGVVKAQRKKQGVFFPFGWGPRICIGQTFAMLE  475

Query  1677  AKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             AK+ +A+ILQRF FELSPSY HAP ++VT QPQHGA L++HKL
Sbjct  476   AKVVLAVILQRFYFELSPSYTHAPVTVVTIQPQHGAHLLLHKL  518



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/541 (55%), Positives = 391/541 (72%), Gaps = 32/541 (6%)
 Frame = +3

Query  195   LLGVCIS---VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             ++G+ +S   VG+L + W +LDWVW +PK+LE+ L++QGL GN YR LSGD+KE   M+ 
Sbjct  6     VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
              A SKPM LSD+I   V PF  Q V   GKS + W+GP P+V I +PE I+E+  K   +
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK  +NPL   +  G+ N + ++WAKHR+IINPAF+ +KLK                   
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKN------------------  167

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PAF  SC EM+SKWE +V  +GS E DVWP L  LT DVISR AFGSS
Sbjct  168   ----------MLPAFYQSCIEMISKWEKLVFLEGSSELDVWPYLVKLTRDVISRAAFGSS  217

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG+RIF+L ++Q    ++V +  Y+PGWR++PTK NR+M  I K++K S++G+I KR 
Sbjct  218   YEEGRRIFQLLEDQTSLTMQVVQSAYIPGWRYLPTKTNRKMKVIAKDIKDSLKGMIKKRE  277

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             +A +  E +NDDLLGIL+ESN++EI++QG  K  GMSIEDVIEECK+FYFAGQETTSV+L
Sbjct  278   EATKASEVSNDDLLGILVESNIREIQEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLL  337

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTMILL+R   WQ +AREEVL+VFGD +PD +GLN LKV+TMIL+E LRLYP +  + R
Sbjct  338   VWTMILLARHPHWQTKAREEVLEVFGDSKPDSDGLNRLKVVTMILHEVLRLYPAVVALGR  397

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                ++T+LG+++LP GA + LP LL+H D E+WG+DA EF PDRF EG+ KATK + ++F
Sbjct  398   SVPKDTRLGKLLLPAGAEITLPVLLIHHDQELWGDDAHEFNPDRFSEGVSKATKSQVIYF  457

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFG GPRIC+GQNFAL+EAKMA+AMIL++F FELSPSYAH+P + +T +PQHGA +I+HK
Sbjct  458   PFGWGPRICIGQNFALMEAKMALAMILRQFWFELSPSYAHSPCTNITLRPQHGAHIILHK  517

Query  1803  L  1805
             L
Sbjct  518   L  518



>ref|XP_009146335.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/526 (56%), Positives = 381/526 (72%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L+WVWFKPKKLE +L+ QGL G+PY  L GD+K    M  +A SKP+ L+D+++ 
Sbjct  20    WTWRTLNWVWFKPKKLESYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIKLTDDVST  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF  + +  +G++ + W+G  P + I DPELIKEV NK Y +QK  T PLG  +A+G
Sbjct  80    RVVPFPFEMLKTHGRTYFTWLGTIPTITIMDPELIKEVFNKVYDFQKPHTFPLGNVIAKG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +ANY+ +KWAKHR+IINPAF+ EK+K                             M PAF
Sbjct  140   LANYDGEKWAKHRKIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E++ KW+ IVS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSEVVGKWDKIVSEKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I    + +VPG+ ++PTK NRR+ A  +E++  +RGI++KR++A + GE  +DDLL
Sbjct  232   AQLIILAVLKAFVPGYLYLPTKGNRRIKAAAREIQVILRGIVNKRLRAREAGEAPSDDLL  291

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESNL    Q  G E  MS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQA
Sbjct  292   GILLESNLG---QAKGNE--MSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQA  346

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAR+EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LP 
Sbjct  347   RARDEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPG  406

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             GA + LP LL+H D+++WGEDA EFKP+RF++G+ KAT GK  FFPF  GPRIC+GQ+FA
Sbjct  407   GAQISLPILLVHRDTQLWGEDAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFA  466

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+E KMA+A+IL+RFSFELSPSY HAPY+++T  PQ GAPLI+ KL
Sbjct  467   LLETKMALALILKRFSFELSPSYVHAPYTVITLHPQFGAPLILRKL  512



>emb|CDX98485.1| BnaC05g38900D [Brassica napus]
Length=512

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/545 (55%), Positives = 389/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             E+ +    L + I+V +  +AW  L+WVWFKPK LE +L++QGL G+PY  L GD+K   
Sbjct  2     EISIASATLSIAIAV-VSWWAWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              +  +A SKP+ L+D+I PRV+P+ ++ +  +G++ + W+GP P + I DPE IKEV NK
Sbjct  61    SLLKEARSKPIKLTDDITPRVVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK  T PL R +  G+A+Y+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFQKTHTFPLARLIGTGLASYDCDKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +W+ +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQSCSEVVGEWDKLVSEKGLSCEVDVWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+  R+  +PG+ ++PTK NR M A  +EV + +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYSYLPTKENRMMKAKAREVHAILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A + GE  +DDLLGILLESNL +++       GMS EDVIEECK+FYFAGQETT
Sbjct  273   VNKRLRAREAGEAPSDDLLGILLESNLGQVKGN-----GMSNEDVIEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQA+AREEV QVFG + PD +GLN LKV+TMILYE LRLYPP+T
Sbjct  328   SVLLVWTMVLLSQHQDWQAKAREEVKQVFGHKIPDTDGLNQLKVMTMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG+DA EFKP+RFREG+ KATK +
Sbjct  388   QVSRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGDDAGEFKPERFREGLSKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNFAL+EAKMAMA+ILQRFSFELSPSY HAPY+++T  PQ GA L
Sbjct  448   VSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTVITIHPQFGAHL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/545 (54%), Positives = 391/545 (72%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+      + I++ ++++  W  L+WVWFKPKKLE +L++QGL G+PY  L GD+K   
Sbjct  1     MEISIASATLSIAIAVVSWWLWRTLNWVWFKPKKLESYLRRQGLSGSPYTPLVGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              +  +A SKP+ L+D+I PR++P+ ++ +  +G++ + W+GP P + I DPE IKEV NK
Sbjct  61    SLLKEARSKPIKLTDDITPRLVPYPLKMLKTHGRTYFTWLGPIPTITIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y + K  T PL R +  G+A+Y+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFPKTHTFPLARLIGTGLASYDGDKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +W+ +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQSCSEVVGEWDKLVSDKGLSCEVDVWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+  R+  +PG+R++PTK NR M A  +EV+  +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQAFRKHIIPGYRYLPTKENRMMKAKAREVQDILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             ++KR++A + GE  +DDLLGILLESNL +++       GMS EDVIEECK+FYFAGQETT
Sbjct  273   VNKRLRAREAGEAPSDDLLGILLESNLGQVKGN-----GMSTEDVIEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQA+AREEV QVFGD+ PD +GLN LKV+TMILYE LRLYPP+T
Sbjct  328   SVLLVWTMVLLSQHQDWQAKAREEVKQVFGDKVPDIDGLNQLKVMTMILYEVLRLYPPVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG+DA EFKP+RF+EG+ KATK +
Sbjct  388   QVSRAIHKEMKLGDLTLPGGVQISLPILLVQHDTELWGDDASEFKPERFKEGLSKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNFAL+EAKMAMA+ILQRFSFELSPSY HAPY+++T  PQ+GA L
Sbjct  448   VSFFPFAWGPRICIGQNFALLEAKMAMALILQRFSFELSPSYVHAPYTVITIHPQYGAHL  507

Query  1791  IIHKL  1805
             I+ K+
Sbjct  508   ILKKI  512



>gb|KFK38821.1| hypothetical protein AALP_AA3G164800 [Arabis alpina]
Length=512

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/545 (55%), Positives = 387/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+   L+ V +++ L+++  W  L WVWF+PK+LE +L +QGL G  Y  L GD+K+  
Sbjct  1     MEISVALVTVSVAIVLVSWWVWRTLKWVWFEPKRLESYLSRQGLPGTSYTPLVGDLKKNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  +A SKP+ L+D+I  RV+P+ +  +  +G++ + W GP P + I DPELIKEV NK
Sbjct  61    AMLAEARSKPLKLTDDITTRVVPYPLHMLKTHGRTFFSWFGPIPTITIMDPELIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y + K  T PLGR +A G+ANY+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFPKTHTFPLGRLIATGLANYDGDKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ +W+ + S K  SCE DVWP L  LT DVISRT
Sbjct  167   --------------MVPAFHQSCSEIVGEWDKLASDKESSCEVDVWPWLVNLTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     ++  R+ ++PG+ ++PT  NRRM A  +E++  +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELARLIVQAFRKAFIPGYMYLPTNCNRRMKAAAREIQGILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             I+KR++A + GE  +DDLLGILLESNL +      K  GMSIEDV+EECK+FYFAGQETT
Sbjct  273   INKRLRAREAGEAPSDDLLGILLESNLGQ-----AKGNGMSIEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYP +T
Sbjct  328   SVLLVWTMVLLSQHQDWQARAREEVRQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPAVT  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +
Sbjct  388   QLARAVNKEMKLGDLTLPAGVQISLPILLVQRDTELWGNDAAEFKPERFKDGLSKATKNQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               +FPF  GPRIC+GQNFAL EAKMAM++ILQRFSFELSPSY HAP++++T  P+ GAPL
Sbjct  448   VSYFPFAWGPRICIGQNFALSEAKMAMSLILQRFSFELSPSYVHAPFTVITIHPEFGAPL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/526 (56%), Positives = 381/526 (72%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK LE  L++QGL G PY +L GD+K    M T+A SKP+ L+D+I P
Sbjct  20    WVWRTLQWVWFKPKILESNLRRQGLSGTPYTLLVGDLKRHFSMLTEAKSKPIKLTDDITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             R++P+ +Q +  +G++ + W+GP P + I DPE IKEV NK Y +QKA T PLGR +A G
Sbjct  80    RIVPYPLQMLKTHGRTFFTWLGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLGRLIAAG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LVSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E + +W+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSETVGEWDKLVSNKGSSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+   + ++PG+R++PTK NRRMNA  +E+K  +RGI+DKR++  +GGE  +DDLL
Sbjct  232   AQLIIQAFGKAFIPGYRYLPTKGNRRMNATAREIKVILRGIVDKRLRGREGGEVPSDDLL  291

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESNL + +       GMS E+++EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQA
Sbjct  292   GILLESNLGQTKGN-----GMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQA  346

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEV QVFG++EP+ EGLN LKV+T ILYE LRLYPP++ + R   +E KLG++ LP 
Sbjct  347   RAREEVKQVFGNKEPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPG  406

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP LL+  D+++WG DA EFKP+RF++G+ KATKG+  F  F  GPRIC+GQNFA
Sbjct  407   GVQITLPILLVQRDTDLWGNDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFA  466

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             ++EAKMAMA+ILQ+FSFELSPSY HAP +++TT PQ GAPLI+HKL
Sbjct  467   MLEAKMAMALILQKFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/560 (55%), Positives = 394/560 (70%), Gaps = 39/560 (7%)
 Frame = +3

Query  138   KSRTPTFPIASPEMEVIYTLLGVCISVGLLAYAWGV---LDWVWFKPKKLEKWLKQQGLK  308
             K  TP   +   +ME+  ++  V ISV ++  +W V   L WVWFKPK LE +L++QGL 
Sbjct  23    KLSTPLSLLWKKKMEI--SVASVTISVAVVVTSWLVWRALQWVWFKPKMLESYLRRQGLP  80

Query  309   GNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPK  488
             G  Y  L GD+K    M T+A SKP+ L+D+I PRV+P  +Q +  +G++ + W GP P 
Sbjct  81    GTSYTPLVGDVKRNFSMLTEARSKPINLTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPI  140

Query  489   VLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLK  668
             + I DPE IKEV NK Y +QK  T PL   +A+G+ANY+ DKWAKHRRIINPAF+ EK+K
Sbjct  141   ITIMDPEQIKEVFNKVYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIK  200

Query  669   EKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDV  845
                                          M PAF  SC E+L +WE +VS KG SCE DV
Sbjct  201   N----------------------------MVPAFHQSCSEVLGEWEKLVSDKGSSCEVDV  232

Query  846   WPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRR  1025
             WP L  +T DVISRTAFGSSY+EG+RIFELQ E     I+  R+  +PG+ ++PTK NRR
Sbjct  233   WPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRR  292

Query  1026  MNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDV  1205
             M A  +E++  +RGI++KR++A + GE  +DDLLGILLESNL + +       GMS ED+
Sbjct  293   MKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLGQTKGN-----GMSTEDL  347

Query  1206  IEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVL  1385
             +EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+
Sbjct  348   MEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVM  407

Query  1386  TMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFK  1565
             TMILYE LRLYPP+T + R   +E KLG++ LP G  + LP LL+  D+E+WG+DA EFK
Sbjct  408   TMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAGEFK  467

Query  1566  PDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHA  1745
             P+RF++G+ KATK +  FFPF  GPRIC+GQNFA++EAKMAMA+ILQ+FSFELSPSY HA
Sbjct  468   PERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYLHA  527

Query  1746  PYSMVTTQPQHGAPLIIHKL  1805
             PY+++T  PQ GA LI+ KL
Sbjct  528   PYTIITIHPQFGAQLILQKL  547



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/545 (56%), Positives = 382/545 (70%), Gaps = 37/545 (7%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             +I +   V ISV ++    + W +L WVWFKPK LE +L+ QGL G  Y +L GD+K  +
Sbjct  1     MIISAKSVTISVAIVVVSWWIWRILKWVWFKPKMLESYLRGQGLPGTSYTLLVGDVKRNS  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  +A SKP+ L+D+IA RV+P+ +Q    +G++ + W+GP P + + DPELIKEV NK
Sbjct  61    NMLLEARSKPIKLTDDIASRVVPYPLQMAKTHGRNFFTWLGPIPSITLMDPELIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK    PLGR VA G+ +Y+ DKWAKHRRIINPAF+ EK+K               
Sbjct  121   IYNFQKPNVFPLGRLVATGLFSYDDDKWAKHRRIINPAFHIEKIKS--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ KW+ + S KG SCE DVWP L  LT DVISRT
Sbjct  167   --------------MVPAFHQSCSEVVGKWDKLASDKGLSCEVDVWPWLGSLTGDVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG RIFELQ E     I+  ++ ++PG+R++PTK NRRM    +EV+  +RGI
Sbjct  213   AFGSSYKEGHRIFELQSELTELLIQAVQRFFIPGYRYLPTKDNRRMKVAAREVQDILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             I+KR+ A + GE  ++DLLG LLESNL E     GK  GMSIEDV+EECK+FYFAGQETT
Sbjct  273   INKRLAAREAGEAPSNDLLGTLLESNLGE-----GKGNGMSIEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTMILLS+ QDWQARAREEV Q FGD+EPD EGLN LKV+TMI  E LRLYPP+ 
Sbjct  328   SVLLVWTMILLSQHQDWQARAREEVKQAFGDKEPDTEGLNHLKVMTMIFNEVLRLYPPVI  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +ETKLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++GI KATK +
Sbjct  388   QLTRAIHKETKLGDMTLPSGVHITLPILLVQHDTELWGNDAAEFKPERFKDGISKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQN A++EAKMAMA+ILQRFSFELSPSY HAP  + T  PQ GAPL
Sbjct  448   VSFFPFGWGPRICIGQNLAMLEAKMAMALILQRFSFELSPSYVHAPLPVFTVHPQFGAPL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/535 (55%), Positives = 386/535 (72%), Gaps = 29/535 (5%)
 Frame = +3

Query  204   VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
             V I+V ++A AW +L+W+W +PKKLE++L+QQGL GN YR  +GDMKE++ M   A SKP
Sbjct  13    VGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIKQAYSKP  72

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             ++LS +IAPRVIPF  Q VN YGK+ +VWMGP P+V I DPE +K +L K   + K   N
Sbjct  73    VSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDFPKPXAN  132

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL + +  G+A  E +KWAKHRRIINP F+ EKLK                         
Sbjct  133   PLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKR------------------------  168

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                 M P F  SC EM+ +WE +V  +GSCE DVWP  + +T DVISRTAFGSSY+EG++
Sbjct  169   ----MLPEFYQSCSEMIVEWESLVLKEGSCELDVWPYFENMTADVISRTAFGSSYKEGRK  224

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IF+L KEQ    I+V + VY+PG RF+PTK N +M  I++E+++ + GII+ R  A++ G
Sbjct  225   IFQLLKEQAKLAIKVVQSVYIPGARFLPTKINMKMKEIDREIRALLMGIINXREDAIRAG  284

Query  1104  ETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMIL  1280
             E   DDLLG+L+ESNL EI++ G  K+ GMS+ DVIEECK+FYFAGQETTSV+LVWTM+L
Sbjct  285   EATKDDLLGVLMESNLNEIKEHGNNKKVGMSMHDVIEECKLFYFAGQETTSVLLVWTMVL  344

Query  1281  LSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEET  1460
             L ++Q+WQ RAREEVLQVFG  +P+F G+  LKV+TMIL+E LRLYP +T M R T ++T
Sbjct  345   LGQYQNWQDRAREEVLQVFGSNKPEFXGIIHLKVVTMILHEVLRLYPALTVMTRTTNKKT  404

Query  1461  KLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGP  1640
             +L +  LP G  + L TLL+H D ++WG+DA EFKP+RF EGI KATK K ++FPFGGGP
Sbjct  405   QLSKYSLPAGVEVALSTLLVHHDKQLWGDDAHEFKPERFSEGIXKATKNKFMYFPFGGGP  464

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             R C+GQNFA+VEAK+A+++ILQ F+FELS SYAHAP S +  QPQ GA +I+HKL
Sbjct  465   RNCIGQNFAMVEAKLALSLILQHFTFELSASYAHAPSSNLIIQPQFGAHIILHKL  519



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 382/543 (70%), Gaps = 31/543 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M+V  + + +  +   L Y W +L+WVWF PKKLEK L+QQG  GN Y++  GD KE+  
Sbjct  1     MDVFISTVEISCAAVALIYLWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRS  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             +  +A+SKPM  S++IAPR IP Y Q   +YG+  + W GP+P + I +PE+I+E+ +KN
Sbjct  61    IAKEAVSKPMNFSNDIAPRAIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSKN  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y + K   NP G+ +A+GVA YE DKWAKHR++INPAF+ +KLK                
Sbjct  121   YVFLKPTGNPFGKMLAKGVALYETDKWAKHRKLINPAFHVQKLKH---------------  165

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF +S  +ML KW+ +V   GSCE DVWP LQ +T DVISRTAF
Sbjct  166   -------------MVPAFHVSTADMLKKWDELVPDGGSCEVDVWPGLQTMTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG +IF+LQ+EQ    IE  R + VPGW  +PTK NRR+  I  EV+S + GII+
Sbjct  213   GSSYEEGTKIFQLQREQVERIIEAGRHMPVPGW--LPTKNNRRLKEIVAEVESRVLGIIN  270

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
             KRMKAM+ GE + DDLLGILLESN +E+R+ G    GM+IE+V+EECKVFYFAGQET++ 
Sbjct  271   KRMKAMEAGEPSMDDLLGILLESNAKEMREHGNAS-GMTIEEVMEECKVFYFAGQETSAS  329

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWTMILLS+ QDWQ RAR+EVLQVFG  +PD++ LN LK++ MIL ESLR+Y P   +
Sbjct  330   LLVWTMILLSKHQDWQDRARDEVLQVFGKGKPDYQELNQLKIMNMILNESLRVYTPGATL  389

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R T  E   G+  +P G  L+LP L +H D+ +WG+DA  FKP+RF EG+ KAT+G+  
Sbjct  390   GRFTHSEANFGKYKIPAGVQLVLPVLAVHHDTRLWGDDATSFKPERFAEGVSKATQGQPK  449

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             F PFG GPRIC+GQNFA++EAK+AM MILQ +SF+LSPSYAHAP++++T QPQ+GA LI+
Sbjct  450   FIPFGSGPRICIGQNFAMLEAKLAMVMILQNYSFKLSPSYAHAPHALITLQPQYGAHLIL  509

Query  1797  HKL  1805
              KL
Sbjct  510   TKL  512



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/526 (55%), Positives = 375/526 (71%), Gaps = 30/526 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W ++DW+WF+PKKLEK L++QG  GN YRIL GD+KE A M  +A+SKPM  S++IAPR
Sbjct  24    GWKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPR  83

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             VIP     +  YGK   +W+GP P+V I DPE +K V +    +QK   NPL R + +G+
Sbjct  84    VIPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQGL  143

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
             A+ E  KW KHR+IINPAF+ EKLK+                            M PAF 
Sbjct  144   ASLEGQKWVKHRKIINPAFHVEKLKD----------------------------MVPAFY  175

Query  774   LSC-CEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
              SC  EM+SKWEG+VS +GSCE DV P LQ +  DVISRTAFGSSYE+GK+IFELQ E  
Sbjct  176   HSCYNEMVSKWEGMVSREGSCELDVMPYLQNMASDVISRTAFGSSYEKGKKIFELQTELA  235

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                I+ +  +Y+PGWRF+PTK NR+M  I KE+ + I GI++++ K+++ GE    DLL 
Sbjct  236   NLVIQANLGIYIPGWRFLPTKSNRKMKEISKEITTLILGIMNEKEKSIKAGEAIQTDLLS  295

Query  1131  ILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             IL+ESN+ EI+Q G  K  GMSIEDVIEECK+FY AGQETT+ +LVWTM+LLS + +WQ 
Sbjct  296   ILMESNMNEIKQHGNNKNIGMSIEDVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQE  355

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAR EV ++FG+++PD++GLN LKV+TMI  E LRLYPP+    R   +ET+LG + LP 
Sbjct  356   RARAEVFEIFGNKKPDYDGLNRLKVVTMIFNEVLRLYPPVNMFGRIIRKETRLGNLTLPE  415

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G +L LP +L+H+D E+WGEDA EF P+RF EGI KATK    F PFG GPRIC+GQNFA
Sbjct  416   GVMLGLPVVLIHLDPELWGEDAHEFNPERFSEGISKATKNPSAFIPFGWGPRICIGQNFA  475

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             ++EAKMA+++ILQRFSFELSPSY HAP +++TTQPQHGA +I+HKL
Sbjct  476   MIEAKMALSIILQRFSFELSPSYTHAPIAVLTTQPQHGAHIILHKL  521



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 381/526 (72%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK LE +L++QGL G  Y  L GD+K    M T+A SKP+ L+D+I P
Sbjct  20    WVWRTLQWVWFKPKMLESYLRRQGLAGTSYTPLVGDLKRHFSMLTEAKSKPIKLTDDITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             R++P+ +Q +  +G++ + W+GP P + I DPELIKEV NK Y +QKA T PLGR +A G
Sbjct  80    RIVPYPLQMLKTHGRTHFTWLGPIPTITIMDPELIKEVFNKVYDFQKAHTFPLGRLIAAG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LLSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E + +W+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSETVGEWDKLVSNKGSSCELDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+  ++ ++PG+R++PTK NRRMNA  +++K  +RGI+DKR++A +GGE  +DDLL
Sbjct  232   AQLIIQAFQKTFIPGYRYLPTKGNRRMNATARKIKVILRGIVDKRLRAREGGEVPSDDLL  291

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESN  +         GMS E+++EECK+FYFAGQETTSV+LVWTM+LLS+ +DWQA
Sbjct  292   GILLESNSGQTEGN-----GMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQA  346

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEV QVFGD+EP  EGLN LK++T ILYE LRLYPP++ + R   +E KLG++ LP 
Sbjct  347   RAREEVKQVFGDEEPTTEGLNQLKIMTTILYEVLRLYPPVSQLTRAINKEMKLGDMTLPS  406

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP +L+  D+E+WG+DA EFKP+RF++G+ KATKG+  F  F  GPRIC+GQNFA
Sbjct  407   GVQITLPIMLVQRDTELWGKDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFA  466

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             ++EAKMAMA+ILQ+FSFELSPSY HAP +++TT PQ GAPLI+HKL
Sbjct  467   MLEAKMAMALILQKFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/545 (54%), Positives = 392/545 (72%), Gaps = 30/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M  +  ++ +   V +L++ W V+  +W+KP KLE+ L++QGLKG P+R+LSG++K+  +
Sbjct  1     MAELLIVVILAFPVLILSWIWSVVYSIWWKPMKLERNLREQGLKGPPHRLLSGNLKDELR  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-NK  533
             M  +A S+PM LS NI PRV+PF  Q +  YGK    W G  P+V I  PELIK++L NK
Sbjct  61    MRKEAWSRPMNLSHNIVPRVVPFTHQTIKTYGKMSVTWFGRTPRVNIMHPELIKDILSNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
                ++K + N L + +A G+ANYE +KWAKHRRIINPAF+ EKLK               
Sbjct  121   FGHFEKPKLNQLIKLLANGLANYEGEKWAKHRRIINPAFHIEKLKR--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF  SC E +++WE +V+ KG CE DVWP+ Q LT DVISRTA
Sbjct  167   --------------MLPAFYTSCSETITRWEKLVALKGCCELDVWPEFQNLTGDVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSY+EG+RIF+LQ EQ    ++ +  +Y+PG+  +PTKRN RM  I++EV+  +RGII
Sbjct  213   FGSSYDEGRRIFQLQNEQAKLVVQAALSIYIPGYSLLPTKRNNRMKEIDREVRGLLRGII  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQ-GGKEFGMSIEDVIEECKVFYFAGQETT  1250
             +KR KA++ GE + +DLLG+LLESN +EI++    K  GM+I+DVIEECK+FYFAGQETT
Sbjct  273   NKREKAIKLGEASQNDLLGLLLESNFKEIQEHDNAKNLGMNIDDVIEECKLFYFAGQETT  332

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             + +LVWTM++LS   +WQ R+REEVLQ FG  +PDF+GLN LKV+TMILYE LRLYPP  
Sbjct  333   ANLLVWTMVVLSMHPEWQIRSREEVLQAFGKDKPDFDGLNHLKVVTMILYEVLRLYPPAV  392

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R T ++ KLG I LP G  L+LPT+L+H   E+WGEDA+EFKP+RF  G+ KATK +
Sbjct  393   ILTRHTYKKIKLGGIYLPPGVELLLPTILIHHSRELWGEDAQEFKPERFSSGVSKATKNQ  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNFA+ EAKMA+A+ILQ+FSFELSPSYAHAPY+++T QPQ+GA +
Sbjct  453   VSFFPFGWGPRICIGQNFAMTEAKMALALILQQFSFELSPSYAHAPYTIITLQPQYGAQI  512

Query  1791  IIHKL  1805
             I+HKL
Sbjct  513   ILHKL  517



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/545 (55%), Positives = 384/545 (70%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+    + V +++ ++++  W  L+WVWFKPK LE +L++QGL G PY  L+GD K   
Sbjct  1     MEISAASVTVSVAIAVVSWWVWRTLNWVWFKPKTLESYLRRQGLVGTPYTPLAGDSKRTF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M+ +A SKP+ L+D+I PRV+PF +  +  YG++ + W G  P + I DPE IKEV NK
Sbjct  61    NMSMEARSKPINLTDDIIPRVLPFSLHMLKTYGRTFFTWRGHIPVITIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK  T PLGR +A G+ +Y+ DKWA HRRIINPAF+ EK+K               
Sbjct  121   IYDFQKPHTFPLGRLIATGLFSYDGDKWANHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  +C E++ +W+ +VS KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQTCSEVIGEWDKLVSDKGSSCEVDVWPWLMSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E         +  ++PG+RF+PTKRNRR+ A  +E++  + GI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLITLSVQTAFIPGYRFLPTKRNRRIKAAAREIQIILSGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             I+KR++A + GE  ++DLLGILLESNL +      K  GMS EDV+EECK+FYFAGQETT
Sbjct  273   INKRLRAREAGEAPSNDLLGILLESNLGQ-----AKGNGMSTEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+TMI YE LRLYPP+ 
Sbjct  328   SVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMTMIFYEVLRLYPPVN  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+  D+E+WG+DA EFKP+RF+EGI KATK +
Sbjct  388   QLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDTELWGKDAAEFKPERFQEGISKATKSQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNFAL+EAKMAMA+IL RFS ELSPSY HAPY++ T  PQ GA L
Sbjct  448   VSFFPFGWGPRICIGQNFALLEAKMAMALILHRFSLELSPSYVHAPYTVFTIHPQFGAHL  507

Query  1791  IIHKL  1805
             I+HKL
Sbjct  508   ILHKL  512



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/548 (56%), Positives = 394/548 (72%), Gaps = 36/548 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCIS----VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             ME+ Y  L + I     + +L + W +L++VWFKPKKLEK L+QQG KGN Y++L GDMK
Sbjct  20    MEISYYNLKIAIFSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMK  79

Query  345   ELAKMTTDALSKPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKE  521
             E+ KM  +A SKP+  S D I PR+ PF  + +  YGK+C+VW+GP+P VLI +P+LI+E
Sbjct  80    EMKKMIEEATSKPIDFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIRE  139

Query  522   VLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSA  701
             VL KNY Y KAR +PL + V  G+A +EKDKWA HRRI+NPAF+ +KLK           
Sbjct  140   VLTKNYVYHKARGSPLSKLVISGLAGHEKDKWATHRRILNPAFHLDKLKH----------  189

Query  702   ALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVI  881
                               M PAF L+  EML+ W+ +VS  G+ E DVWP LQ LT D I
Sbjct  190   ------------------MLPAFKLTVNEMLNTWKKVVSKDGT-EIDVWPYLQTLTSDAI  230

Query  882   SRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSI  1061
             SRTAFGS+YEEGK+ FELQKEQ    + +   + +  +RFVPTK+N+RM  I  EVK+ I
Sbjct  231   SRTAFGSNYEEGKKNFELQKEQIELILTIINVIMIMNYRFVPTKKNKRMMQIFYEVKALI  290

Query  1062  RGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQ  1241
              GII+KRM+ ++ GE++ DDLL ILL SNL+EI+Q G K+FGMSI++VIEECK+FYFAGQ
Sbjct  291   LGIINKRMRMIEAGESH-DDLLSILLTSNLKEIQQHGNKKFGMSIDEVIEECKLFYFAGQ  349

Query  1242  ETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYP  1421
             ETTS +LVWTMILL ++  WQ RAREEVLQVF   E D++ LN LKV+TMIL E LRLY 
Sbjct  350   ETTSTLLVWTMILLCKYPIWQERAREEVLQVFASDELDYDKLNQLKVVTMILNEVLRLYT  409

Query  1422  PITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKAT  1601
                 ++R    ETKLG++ LP G  L+L T+L+H D+EIWG+DA EFKP+RF EGI KAT
Sbjct  410   SAYTINRMVNTETKLGDLCLPSGVQLILATMLVHHDTEIWGDDAMEFKPERFSEGISKAT  469

Query  1602  KGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHG  1781
             KG+ VFFPF  GPRIC+GQNFA++EAKMAM MIL+ ++FELSPSYAHAP+ ++  QPQ+G
Sbjct  470   KGQVVFFPFSWGPRICIGQNFAMLEAKMAMVMILKYYAFELSPSYAHAPHPLL-LQPQYG  528

Query  1782  APLIIHKL  1805
             A LI+HKL
Sbjct  529   AQLIMHKL  536



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/538 (54%), Positives = 386/538 (72%), Gaps = 32/538 (6%)
 Frame = +3

Query  204   VCISVGL---LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             VC+ V L   L  AW VL+W+W +PK+LE+ L++QGL+GNPYR+L GD+KE+  M  +  
Sbjct  7     VCLVVILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQKEVT  66

Query  375   SKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             SKPM LS +I PRV  F    +N +GK+ ++W G +P+V+I +PELIK+VLNK + + K 
Sbjct  67    SKPMNLSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDFPKP  126

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
              T+PL + +A G+ N+E +KW KHRRII+PAF  EKLK                      
Sbjct  127   DTSPLVKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKN---------------------  165

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEE  914
                    M P F  SC +++ KWE ++S  GSCE DVWP LQ L+ D I+RTAFGSSYEE
Sbjct  166   -------MLPIFYKSCNDLIIKWEEMLSSDGSCEIDVWPFLQNLSSDAIARTAFGSSYEE  218

Query  915   GKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAM  1094
             G++IF+L KEQ    ++   ++Y+PGWRF+PT  +RRM  I++E+K+S+  +I  R KA+
Sbjct  219   GRKIFQLLKEQAELAMKAIMKLYIPGWRFLPTANHRRMKEIDREIKASLTDMISNREKAL  278

Query  1095  QGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWT  1271
             + GE   +DLLGILLESN +E  + G  K  GMS+EDVIEECK+FYFAGQETTS +LVWT
Sbjct  279   KAGEATENDLLGILLESNHKETEEHGNSKNVGMSLEDVIEECKLFYFAGQETTSALLVWT  338

Query  1272  MILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTV  1451
             M+LLSR+ DWQARAREEVLQVFG Q+P+F+GL+ LK+++MIL E LRLYPP  G++R   
Sbjct  339   MVLLSRYPDWQARAREEVLQVFGKQKPNFDGLSHLKIVSMILNEVLRLYPPAVGLNRNVD  398

Query  1452  EETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFG  1631
              + KLG + LP G  + LPT ++H D E+WG+D  EFKP+RF EG++KAT G+  FFPFG
Sbjct  399   RDMKLGNLSLPAGVQVSLPTTMVHHDRELWGDDVNEFKPERFSEGVLKATNGRVSFFPFG  458

Query  1632  GGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              GPRIC+GQNF+L+EAKMA++ ILQ FSFELSP+YAHAP ++ T QPQ+GA +I+ K+
Sbjct  459   WGPRICIGQNFSLLEAKMALSTILQHFSFELSPAYAHAPVTVFTLQPQYGAHVILRKV  516



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/527 (56%), Positives = 378/527 (72%), Gaps = 35/527 (7%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK LE +LK+QGL G PY  L GD+K  + M   A SKP+ L+D+I P
Sbjct  20    WVWRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF +  +  +G++ + W GP P + I DPELIKEV NK Y +QKA T PLGR +A G
Sbjct  80    RVVPFPLHMLKTHGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPLGRIIAAG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LVSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGK--GSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
               SC E++ +W+ +   K   SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E
Sbjct  172   HQSCSEVVGQWDKLALDKEGSSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAE  231

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                  I+  R+ ++PG+ ++PTK NRRM A  +EVK  + GI++KR++A + G+  +DDL
Sbjct  232   LAKLIIQAFRKAFIPGYNYLPTKGNRRMKAAAREVKVILGGIVNKRLRAREAGDATSDDL  291

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LGILLESNL    Q+ G   GM+ E+++EECK+FYFAGQETT+V+LVWTM+LLS+ QDWQ
Sbjct  292   LGILLESNLG---QKKGN--GMTTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQ  346

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             ARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP
Sbjct  347   ARAREEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLP  406

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQNF
Sbjct  407   SGVQISLPILLVQRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNF  466

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAKMAMA+ILQ+FSFELSPSY HAP++++T  PQ GAPLI+HKL
Sbjct  467   AMLEAKMAMALILQKFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>ref|NP_188083.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 sp|Q9LUC9.1|C7A11_ARATH RecName: Full=Cytochrome P450 72A11 [Arabidopsis thaliana]
 dbj|BAB02397.1| cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF00623.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE75551.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=512

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/522 (57%), Positives = 373/522 (71%), Gaps = 34/522 (7%)
 Frame = +3

Query  243   VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIP  422
              L WVWFKPK LE +L++QGL G PY  L GD+K+   M  +A SKP+ L+D+I PR++P
Sbjct  24    TLQWVWFKPKMLESYLRRQGLAGTPYTPLVGDLKKNFSMRAEARSKPINLTDDITPRIVP  83

Query  423   FYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANY  602
             + +Q +  +G++ + W G  P + I DPE I EVLNK Y +QKA T PLGR +A GV +Y
Sbjct  84    YPLQMLKTHGRTFFTWFGAIPTITIMDPEQITEVLNKVYDFQKAHTFPLGRLIATGVLSY  143

Query  603   EKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSC  782
             + DKWAKHRRIINPAF+ EK+K                             M PAF  SC
Sbjct  144   DGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAFHQSC  175

Query  783   CEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHF  959
              E++ KW+ +VS K  SCE DVWP L  +T DVISRTAFGSS  EG+RIFELQ E     
Sbjct  176   SEIVCKWDKLVSDKESSCEVDVWPGLVSMTADVISRTAFGSSCVEGQRIFELQAELAQLI  235

Query  960   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  1139
             I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR++A + GE  NDDLLGILL
Sbjct  236   IQTVRKAFIPGYSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPNDDLLGILL  295

Query  1140  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  1319
             ESNL + +       GMS ED++EECK+FYF GQETTSV+LVWTM+LLS+ QDWQARARE
Sbjct  296   ESNLGQTKGN-----GMSTEDLMEECKLFYFVGQETTSVLLVWTMVLLSQHQDWQARARE  350

Query  1320  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  1499
             EV QVFGD+EPD EGLN LKV+TMILYE LRLYPPI  + R   +E +LG++ LP G L+
Sbjct  351   EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPIPQLSRAIHKEMELGDLTLPGGVLI  410

Query  1500  MLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEA  1679
              LP LL+  D+E+WG DA EFKPDRF++G+ KATK +  FFPF  G RIC+GQNFAL+EA
Sbjct  411   NLPILLVQRDTELWGNDAGEFKPDRFKDGLSKATKNQASFFPFAWGSRICIGQNFALLEA  470

Query  1680  KMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             KMAMA+ILQRFSFELSPSY HAPY++ T  PQ GAPLI+HKL
Sbjct  471   KMAMALILQRFSFELSPSYVHAPYTVFTIHPQFGAPLIMHKL  512



>emb|CDP15980.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/544 (55%), Positives = 381/544 (70%), Gaps = 28/544 (5%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             EM    ++  +     LL  AW + +W+W KPKKLEK LKQQG KGNPYR+L GD+K+++
Sbjct  2     EMSAYSSIAVLSSCFVLLTLAWKLFNWIWLKPKKLEKLLKQQGFKGNPYRLLFGDLKDIS  61

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
                 +A SKP++LSD+I PR+IP + + V KYG   Y+W GP P + I+DPEL++E    
Sbjct  62    NSAREARSKPISLSDDIIPRIIPEFHKLVQKYGTKTYIWYGPEPAIFIQDPELLREAAQA  121

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
                + K       R +  G+A+Y  DKWAKHR++INP F  EKLK               
Sbjct  122   ITVFHKPDAGQFTRLLTPGLASYNGDKWAKHRKLINPVFNGEKLKT--------------  167

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF  S  EM+ KWE IV  KGSCE D+WP LQ +TCD ISRTA
Sbjct  168   --------------MLPAFQTSASEMMRKWEEIVLPKGSCELDIWPYLQRVTCDAISRTA  213

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGS+YEE ++IFELQ EQ  H ++    +++PGWRF+PTKRNRRM  IEKEV  SIR I+
Sbjct  214   FGSNYEEARKIFELQGEQLEHCVKAVWSMFIPGWRFLPTKRNRRMRQIEKEVDDSIRRIV  273

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             + R+KAM+ GE+ +DD LG LLESN QEI + G K  GMS ++V+EECK+FYFAGQETTS
Sbjct  274   NSRLKAMRAGESCDDDFLGRLLESNSQEIHKHGSKGVGMSTQEVVEECKLFYFAGQETTS  333

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+L+WTMILLSR+Q+WQ RAREEVLQ+FG  +PD++GLN LKV+TMILYE LRLYPP+  
Sbjct  334   VLLLWTMILLSRYQNWQKRAREEVLQLFGTNKPDYDGLNRLKVVTMILYEVLRLYPPLPV  393

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
               RRT EE +LG + +P G L++    L+H D E+WG+D KEFKP+RF +G+  A KG+ 
Sbjct  394   NSRRTAEEARLGNLSIPAGILILKHIALIHHDPELWGDDVKEFKPERFSDGVSNAAKGQA  453

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPRIC GQNF+++EAK+ M MILQRFSFE SPSY+HAPYS++T +PQHGA LI
Sbjct  454   AFFPFGWGPRICTGQNFSMLEAKIVMVMILQRFSFEFSPSYSHAPYSLITLKPQHGAHLI  513

Query  1794  IHKL  1805
             + KL
Sbjct  514   LQKL  517



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 393/545 (72%), Gaps = 30/545 (6%)
 Frame = +3

Query  174   EMEVIYTL-LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKEL  350
             E+ V+ ++ L V +   ++  AW VL+WVW +PKKLE+ L+QQGL GN YR+L GD KE 
Sbjct  2     EVSVVASVALRVFLVSTVITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKES  61

Query  351   AKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             + M  +A SKPM LS +I PRV+PF  Q V  YGK+ ++W+GP P+V I +P  +K+V  
Sbjct  62    SMMVKEAKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFT  121

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
                 +QK   NPL + +A G+ NYE +KWAKHR+IINPAF+ EKLK              
Sbjct  122   NYEDFQKPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKR-------------  168

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF LSC EM+ +WE +VS +GSCE DVWP L+ L  DVISR 
Sbjct  169   ---------------MLPAFHLSCSEMIEEWERLVSKEGSCELDVWPYLESLAADVISRA  213

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             +FGSSY+EG++IF+L KEQ    I   + VY+PGWRF+PT+ N+RM AI+KE+K S+R I
Sbjct  214   SFGSSYQEGRKIFQLLKEQAKLTIRALQSVYIPGWRFLPTRSNKRMKAIDKEIKGSLRDI  273

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQET  1247
             I  R +A++ GE   DDLLGILLESNL+EIR+ G  K  GMSIEDVIEECK+FYFAGQET
Sbjct  274   ISTREEAIRMGEATKDDLLGILLESNLKEIRENGNTKNVGMSIEDVIEECKLFYFAGQET  333

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TSV+L+WT++LLS+ Q+WQARAR+EVLQVFG  +PDF+GLN LKV+TMIL E LRLYP +
Sbjct  334   TSVLLLWTLVLLSQNQNWQARARDEVLQVFGSNKPDFDGLNHLKVVTMILLEVLRLYPSV  393

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               + R T  +T LG++ LP G  + LP LL+H D E+WGEDA  F P+RF EG+ KA+K 
Sbjct  394   VALPRTTHNKTHLGKLSLPAGVEVSLPILLLHHDKELWGEDAIGFNPERFSEGVSKASKN  453

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  +FPFGGGPRIC+GQNFA++EAK+A +++LQRF+FELSPSYAHAP  +++ QPQ+GA 
Sbjct  454   QFAYFPFGGGPRICIGQNFAMLEAKLAFSLLLQRFTFELSPSYAHAPSLIISLQPQYGAH  513

Query  1788  LIIHK  1802
             +I+HK
Sbjct  514   IILHK  518



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/527 (56%), Positives = 381/527 (72%), Gaps = 35/527 (7%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L+WVWFKPK LE +L++QGL G PY  L GD+K  + M  +A SKP+ L+D+I P
Sbjct  20    WVWRTLNWVWFKPKMLESYLRRQGLAGTPYTPLVGDVKRNSSMLAEARSKPIQLTDDITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF++  +  +G++ + W+GP P V I DPELIKEV N    +QKA +NPLGR +A G
Sbjct  80    RVVPFHLHMLKTHGRTFFTWLGPIPTVTIMDPELIKEVFNNVNDFQKAHSNPLGRLIATG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LVSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG--SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
               SC E++ +W+ +V  K   SCE DVWP L  LT DVISRTAFGSSY+EG+RIFELQ E
Sbjct  172   HQSCSEVVGQWDKLVLDKEGLSCEMDVWPWLVSLTADVISRTAFGSSYKEGQRIFELQAE  231

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                  I+  R+ ++PG+ ++PTK NRRM A  +E+K  + GI+++R++A + G+  +DDL
Sbjct  232   LARLLIQNFRKAFIPGYNYLPTKGNRRMKAAAREIKVIMGGIVNRRLRAREAGDAPSDDL  291

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LGILLESNL    Q+ G   GMS E+++EECK+FYFAGQETT+V+LVWTM+LLS+ QDWQ
Sbjct  292   LGILLESNLG---QEKGN--GMSTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQ  346

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             ARAREEV QVFG +EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP
Sbjct  347   ARAREEVKQVFGAKEPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDMTLP  406

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQNF
Sbjct  407   SGVQISLPILLVQRDTELWGNDAGEFKPERFKDGVSKATKNQVSFFPFAWGPRICIGQNF  466

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAKMAMA+ILQ+FSFELSPSY HAP++++T  PQ GAPLI+HKL
Sbjct  467   AMLEAKMAMALILQKFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/535 (55%), Positives = 380/535 (71%), Gaps = 31/535 (6%)
 Frame = +3

Query  210   ISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPM  386
             ++VG+L    W +L+W W  PKKLEK L+QQG  GN YR+L G++KE+  MT  A S+PM
Sbjct  15    LAVGVLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPM  74

Query  387   TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNP  566
             +L+D+IAP VIP+Y Q V  YGK+   W GP P+V I DPELI+E+ NK  ++QK R NP
Sbjct  75    SLTDDIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINP  134

Query  567   LGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRT  746
             L   +  G+   E ++WAKHR+II P+F+ +KLK                          
Sbjct  135   LITLLFSGILTLEGERWAKHRKIITPSFHLDKLKN-------------------------  169

Query  747   SVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRI  926
                M PAF   C EM+ KWE  VS  GS E DVWP L  LT DVISR AFGSSYEEG+RI
Sbjct  170   ---MLPAFYECCTEMIEKWEEAVSVNGSSEVDVWPCLVNLTRDVISRAAFGSSYEEGRRI  226

Query  927   FELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE  1106
             F L  EQ     E  + +YVPGWRF+PTK N+++  ++KE+K S+R ++  R KA++ GE
Sbjct  227   FLLLDEQTNLLTETVQSLYVPGWRFLPTKTNKKLKLMDKEIKDSLRELVKNREKAVKAGE  286

Query  1107  TNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILL  1283
               NDDLLGIL+ESN +EI + G  K  GMSI+DV++ECK+FY AGQETTSV+LVWTM+LL
Sbjct  287   VKNDDLLGILVESNFKEIEEHGDRKNMGMSIQDVVDECKLFYIAGQETTSVLLVWTMVLL  346

Query  1284  SRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETK  1463
             +R  DWQ +AREEV QVF D +PD +GL+ LKV+TMIL E LRLYPP+  + R   ++ K
Sbjct  347   ARNPDWQTKAREEVFQVFSDGKPDPDGLSHLKVMTMILNEVLRLYPPVVMLGRSMAKDMK  406

Query  1464  LGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV-FFPFGGGP  1640
             LG+++LP GA++ +P LL+H D EIWG+DA EF+P+RF EG+ KATK  Q+ FFPFGGGP
Sbjct  407   LGKLLLPAGAVISIPVLLIHHDQEIWGDDAHEFRPERFAEGVSKATKSNQLAFFPFGGGP  466

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             RIC+GQNFAL+EAKM +AMIL+RF FELSPSYAH+P +++T +PQHGA LI+HKL
Sbjct  467   RICIGQNFALMEAKMVLAMILKRFRFELSPSYAHSPITVITLRPQHGAHLILHKL  521



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/527 (55%), Positives = 382/527 (72%), Gaps = 30/527 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIA  407
             +AW +L+WVWF PK+LE+ L++QGL+GNPY +L GD K+ AKM  +A SKPM L S +I 
Sbjct  23    WAWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIV  82

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV  F+   +N +GK  ++W GP P+V I DPELIK+VLNK Y ++K   NP  R +A 
Sbjct  83    PRVFSFFHHSINTHGKKSFMWFGPAPRVTITDPELIKDVLNKTYDFEKINMNPQVRLLAP  142

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ ++E +KW+KHR+IINPAF  EKLK+                            M P 
Sbjct  143   GLVSHEGEKWSKHRKIINPAFNLEKLKD----------------------------MLPL  174

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F+  C +++  WE + S  GS E DVWP LQ L  D ISRTAFGSS+EEG+RIF+L KEQ
Sbjct  175   FVKCCDDLIGNWEKMSSSDGSSEMDVWPFLQNLARDAISRTAFGSSFEEGRRIFQLLKEQ  234

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 +++  +VY+PGWRFVPT  +RRM AI+KE+K+S+  II+ + KA++ GE   +DLL
Sbjct  235   TELTVQLMLKVYIPGWRFVPTPTHRRMKAIDKEIKASLMDIINNKEKALKAGEATKNDLL  294

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             GILLESN +EI++ G  K  GM+IEDVI ECK+FYFAGQETTS +LVWTMILLS + DWQ
Sbjct  295   GILLESNHKEIQEHGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPDWQ  354

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG+++PDF+GLN LK++TMIL E  RLYPP+ G+ R+  ++ KLG + L 
Sbjct  355   TRAREEVLQVFGNRKPDFDGLNHLKIVTMILNEVFRLYPPVIGLARKVSKDVKLGNLSLV  414

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + +P +L+H D E+WG+DAKEFKP+RF EG++KATKG+    PFGGGPRIC+GQNF
Sbjct  415   AGMQVSIPIILVHHDCELWGDDAKEFKPERFAEGVLKATKGRASLIPFGGGPRICIGQNF  474

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +L+EAK+A++MILQRFSFELS +Y HAP  ++T QPQ+GA LI+ K+
Sbjct  475   SLMEAKIALSMILQRFSFELSSTYTHAPTPVITIQPQYGANLILRKV  521



>ref|XP_010465360.1| PREDICTED: cytochrome P450 72A15 [Camelina sativa]
Length=512

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 388/547 (71%), Gaps = 39/547 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGV---LDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+  ++  V ISV ++  +W V   L WVWFKPK LE +L++QGL G  Y  L GD+K 
Sbjct  1     MEI--SVASVTISVAVVVMSWLVWRALLWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKR  58

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
                M T+A SKP+ L+D+  PR++P  +Q +  +G++ + W GP P + I DPE IKEV 
Sbjct  59    NFSMLTEARSKPIKLTDDTRPRLVPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVF  118

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             NK Y +QK  T PL   +A+G+ANY+ DKWAKHRRIINPAF+ EK+K             
Sbjct  119   NKVYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKN------------  166

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVIS  884
                             M PAF  SC E++ +WE +VS KG SCE DVWP L  +T DVIS
Sbjct  167   ----------------MVPAFHQSCSEVVGEWEKLVSDKGSSCEVDVWPGLVSMTADVIS  210

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSY+EG+RIFELQ E     I+  R+  +PG+ ++PTK NRRM A  +E++  +R
Sbjct  211   RTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKAKAREIQVILR  270

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             GI++KR++A + GE  +DDLLGILLESNL + +       GMS ED++EECK+FYFAGQE
Sbjct  271   GIVNKRLRAREAGEAPSDDLLGILLESNLGQTKGN-----GMSTEDLMEECKLFYFAGQE  325

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS+ +DWQARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYPP
Sbjct  326   TTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPP  385

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +T + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK
Sbjct  386   VTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQRDTELWGNDAGEFKPERFKDGLSKATK  445

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPF  GPRIC+GQNFA++EAKMAMA+ILQ+FSFELSPSY HAPY+++T  PQ GA
Sbjct  446   SQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSPSYLHAPYTIITIHPQFGA  505

Query  1785  PLIIHKL  1805
              LI+HKL
Sbjct  506   QLILHKL  512



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/539 (55%), Positives = 380/539 (71%), Gaps = 37/539 (7%)
 Frame = +3

Query  201   GVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              V +SV ++A   + W  L+WVWFKPK LE +L++QGL G+PY  L GD++    M+ +A
Sbjct  7     SVTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDNNMSMEA  66

Query  372   LSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
              SKP+ ++D+I PRV+PF    +  +GK+ + W GP P + I DPE IKEV NK Y  QK
Sbjct  67    RSKPIKITDDIVPRVVPFPSHMLKTHGKTFFTWRGPIPTITITDPEQIKEVFNKIYDCQK  126

Query  552   ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGK  731
               + PL R +A G+ +Y+ DKWAKHRRIINPAF+ EK+K                     
Sbjct  127   PHSFPLSRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKN--------------------  166

Query  732   SQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSY  908
                     M PAF  SC E++ KW+ +VS KG SCE DVWP L  +T DVISRTAFGSSY
Sbjct  167   --------MVPAFHQSCSEVVGKWDKLVSEKGSSCEVDVWPGLVSMTADVISRTAFGSSY  218

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             +EG+RIFELQ E      +  R++++PG+R+ PTK NRRM A  +EV+  +RGI++KR++
Sbjct  219   KEGQRIFELQAELAQLLTQAFRRIFIPGYRYYPTKGNRRMKAAAREVQDILRGIVNKRLR  278

Query  1089  AMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVW  1268
             A + GE  +DDLLG LLESNL +      K  GMSIEDVIEECK+FYFAGQETTSV+LVW
Sbjct  279   AREAGEAPSDDLLGTLLESNLGQ-----AKGTGMSIEDVIEECKLFYFAGQETTSVLLVW  333

Query  1269  TMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRT  1448
             TM++LS+ QDWQA+AREEV QVFGD+EPD EGLN LK++TMILYE LRLYPP+  + R  
Sbjct  334   TMVMLSQHQDWQAKAREEVKQVFGDKEPDTEGLNHLKIMTMILYEVLRLYPPVIQLTRAI  393

Query  1449  VEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPF  1628
              +E KLG++ LP G  + LP +L+  D+ +WG DA +FKPDRF++G+ KATK +  F PF
Sbjct  394   HKEMKLGDLTLPGGIHISLPVMLVQRDTNLWGNDAGDFKPDRFKDGVSKATKSQVSFIPF  453

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
               GPRIC+GQNFA++EAKMAMA+ILQRFSFE SPSY HAPY++ T  PQ GA LI+HKL
Sbjct  454   AWGPRICIGQNFAMLEAKMAMALILQRFSFEFSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_010502007.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 387/547 (71%), Gaps = 39/547 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGV---LDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+  ++  V ISV ++  +W V   L WVWFKPK LE +L++QGL G  Y  L GD+K 
Sbjct  1     MEI--SVASVTISVAVVVTSWLVWRALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKR  58

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
                M T+A SKP+ L+D+I PRV+P  +Q +  +G++ + W GP P + I DPE IKEV 
Sbjct  59    NFSMLTEARSKPINLTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVF  118

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             NK Y +QK  T PL   +A+G+ANY+ DKWAKHRRIINPAF+ EK+K             
Sbjct  119   NKVYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKN------------  166

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVIS  884
                             M PAF  SC E+L +WE +VS KG SCE DVWP L  +T DVIS
Sbjct  167   ----------------MVPAFYQSCSEVLGEWEKLVSDKGSSCEVDVWPGLVSMTADVIS  210

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSY+EG+RIFELQ E     I+  R+  +PG+ ++PTK NRRM A  +E++  +R
Sbjct  211   RTAFGSSYKEGQRIFELQAELAQLIIQAFRKAIIPGFSYLPTKGNRRMKATAREIQVILR  270

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             GI++KR++A + GE  +DDLLGILLESNL + +       GMS ED++EECK+FYFAGQE
Sbjct  271   GIVNKRLRAREAGEAPSDDLLGILLESNLGQTKGN-----GMSTEDLMEECKLFYFAGQE  325

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS+ +DWQARAREEV QVFGD+EPD EGLN LKV+TMILYE +RLYPP
Sbjct  326   TTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDKEPDAEGLNQLKVMTMILYEVVRLYPP  385

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +T + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK
Sbjct  386   VTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQRDTELWGNDAGEFKPERFKDGLSKATK  445

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPF  GPRIC+GQNFA++EAKMAMA+ILQ+FSFELS SY HAPY+++T  PQ GA
Sbjct  446   SQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQKFSFELSLSYLHAPYTIITIHPQFGA  505

Query  1785  PLIIHKL  1805
              LI+ KL
Sbjct  506   QLILQKL  512



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/537 (54%), Positives = 386/537 (72%), Gaps = 33/537 (6%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             +   I + LL + W  ++W+W +PK LEK LK+ G +GN Y++L GDMKE+  M  +A S
Sbjct  9     ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KP+  S +I PR++PF  + +  YGK+ ++W+ P P +LI DPELI+E+L+K+  +QK  
Sbjct  69    KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
                  + +  G+ +YE DKWAKHRRIINPAF+ +KLK                       
Sbjct  129   PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKH----------------------  166

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                   M P+F LS CEMLS+WE + S +GS E DVWP LQ LT D ISRTAFGSSYEEG
Sbjct  167   ------MIPSFHLSTCEMLSEWEKVASAEGS-EVDVWPYLQSLTSDAISRTAFGSSYEEG  219

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             ++IFELQ+E     ++V+   Y+    F+PTK NRRM  I +EV+S + GII+KRM A++
Sbjct  220   RKIFELQQELAKIILKVTESSYI---MFLPTKENRRMKQIYQEVRSLVLGIINKRMDAIE  276

Query  1098  GGET-NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
               E  NNDDLLGILL+SNL+EI++ G K+FGMS+++VIEECK+FYFAGQETTS +L W+M
Sbjct  277   AREAFNNDDLLGILLDSNLKEIKEHGNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSM  336

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             I+LS+  DWQARAREEVLQVFG+  PD++ LN LKV+TMI+ E LRLYPP+  M R   +
Sbjct  337   IVLSKHSDWQARAREEVLQVFGNNRPDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHK  396

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             ETKLG + LP G  L+LPT+++H D EIWGED KEF P+RF EG+ KATKGK  +FPF  
Sbjct  397   ETKLGNLSLPGGVQLLLPTIMLHHDQEIWGEDVKEFNPERFSEGVNKATKGKFAYFPFSW  456

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPRIC+GQ+FA+++AKMA+AMILQ ++F++SPSYAH PYS++T QPQHGA LI+HKL
Sbjct  457   GPRICIGQHFAMLQAKMALAMILQHYAFDVSPSYAHVPYSVLTLQPQHGAQLILHKL  513



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 385/547 (70%), Gaps = 39/547 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKE  347
             ME+  ++  V ISV ++    + W  L WVWFKPK LE +L++QGL G  Y  L GD+K 
Sbjct  1     MEI--SVASVTISVAIVVVSLWVWRTLQWVWFKPKMLESYLRRQGLAGTRYTPLVGDLKR  58

Query  348   LAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL  527
              A M  +A SKP+ L+D+  PR++PF +  +  +G++ + W+GP P + I DPELIKEV 
Sbjct  59    NANMLAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITIMDPELIKEVF  118

Query  528   NKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
             NK Y +QKA T PLGR +  G+ +Y+ DKW KHRRIINPAF+ EK+K             
Sbjct  119   NKVYDFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFHLEKIKN------------  166

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVIS  884
                             M PAF  SC E + +W+ +VS KG SCE DVWP L  +T DVIS
Sbjct  167   ----------------MVPAFHQSCSETVGEWDKLVSNKGSSCEVDVWPWLLSMTADVIS  210

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSSY+EG+RIFELQ E     I+  ++ ++PG+ ++PTK NRRMNA  +E+K  +R
Sbjct  211   RTAFGSSYKEGQRIFELQAELSQLIIQAVQKAFIPGYSYLPTKGNRRMNATAREMKVILR  270

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
             GIIDKR++  +GGE  +DDLLGILLESNL + +       GMS E+++EECK+FYFAGQE
Sbjct  271   GIIDKRLRGREGGEVPSDDLLGILLESNLGQTKGN-----GMSTEELMEECKLFYFAGQE  325

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS+ QDWQARAREEV QVFGD+EPD EGLN LKV+T ILYE LRLYPP
Sbjct  326   TTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEPDAEGLNQLKVMTTILYEVLRLYPP  385

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                + R   +E KLG++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK
Sbjct  386   PCQLTRTINKEMKLGDMTLPSGVQISLPVLLIQRDTELWGHDAGEFKPERFKDGLSKATK  445

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+  F  F  GPR C+GQN+A++EAKMAMA+ILQ+FSFELSPSY HAP +++TT PQ GA
Sbjct  446   GQVSFLAFAWGPRFCIGQNYAMLEAKMAMALILQKFSFELSPSYVHAPDTVLTTHPQFGA  505

Query  1785  PLIIHKL  1805
             PLI+HKL
Sbjct  506   PLILHKL  512



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/544 (53%), Positives = 386/544 (71%), Gaps = 31/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME+I++ L +C +V ++ YAW ++++VWF+PKK+EK L+QQG  G PYR L GD+ E+  
Sbjct  1     MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +ALSKP+  SD+  PR+IPF  + V  +G++C++W+GP P VLI DP++++EVL+K 
Sbjct  61    MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
             Y +QK   NPL   +ARG+A+YE DKWAKHRR+INPAF+ +K+K                
Sbjct  121   YVFQKPY-NPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKH---------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M P+F   C EMLSKWE IV  +G  E DVWP LQ +T D IS TAF
Sbjct  165   -------------MIPSFHKCCAEMLSKWEKIVPSEGCFELDVWPYLQTMTSDAISLTAF  211

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSR-QVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             G+SYE+G++IFELQKEQ     + +    ++  WR++PTK NRRM  I  E++S +R II
Sbjct  212   GTSYEQGRKIFELQKEQATLITKSNLFSTFILAWRYLPTKTNRRMKRIITELESLLRAII  271

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             D+R KA++ GE  ++DLL ILLESN +EI+Q G K FGMS++DVIEECK+FY AGQETTS
Sbjct  272   DQRTKAIEAGEATSNDLLDILLESNSKEIKQNGHK-FGMSLQDVIEECKLFYLAGQETTS  330

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWTMILLS++ DWQARAREEVL VF  + P+F+ L  LK+++MI+ E LRLY P   
Sbjct  331   SLLVWTMILLSKYLDWQARAREEVLHVFRSETPNFQDLGRLKIVSMIINEVLRLYSPGLL  390

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
               R   +ET LG IVLP+GA L+LP +L+H D ++WGED K+F P+RF  G+ +AT GK 
Sbjct  391   FSRTVNKETALGNIVLPKGAYLLLPAILLHHDVKLWGEDVKDFNPERFSGGVTEATGGKL  450

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              +FPFG GPRIC+ QNFA++EAK A+AMIL+ +SFELSPSY+HAP   +  QPQHGA LI
Sbjct  451   SYFPFGWGPRICIAQNFAMLEAKTALAMILRNYSFELSPSYSHAPRIALNLQPQHGAHLI  510

Query  1794  IHKL  1805
             + KL
Sbjct  511   LRKL  514



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/540 (54%), Positives = 383/540 (71%), Gaps = 31/540 (6%)
 Frame = +3

Query  192   TLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              +L V     ++A+AW VL+WVW +PKKLEK L++QGL GN YR+L GD K+L+KM    
Sbjct  6     AVLSVVWVSMVIAWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQT  65

Query  372   LSKPMTLS--DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
              SKP+ LS   +IAP V PF+ Q VN YGK+ +VWMGP P+V I +PE +K+  N++  +
Sbjct  66    QSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDF  125

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
              K   NP+ + + +G+   E ++WAKHR+IINPAF+ EKLK                   
Sbjct  126   HKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKG------------------  167

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M P F  SC EM++KWE +VS + SCE DVWP L+  T DVISR AFGSS
Sbjct  168   ----------MVPIFYRSCSEMINKWESLVSKESSCELDVWPYLENFTSDVISRAAFGSS  217

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG++IF+L +E+   +    R VY+PGWRF+PTK+N++   I  E+K  ++GII+KR 
Sbjct  218   YEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKRE  277

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             +AM+ GE   DDLLGIL+ESN +EI++ G  K  GMSIEDVI ECK+FYFAGQETTSV+L
Sbjct  278   EAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLL  337

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTM+LLS+ QDWQARAREEVLQVFG   P +E L+ LKV+TMIL E LRLYP +  + R
Sbjct  338   VWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPR  397

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
              T ++T+LG++ LP G  + LP LL+H D E+WGEDA EFKP+RF EG+ KATK +  +F
Sbjct  398   TTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPERFSEGVSKATKNQFTYF  457

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFGGGPRIC+GQNFA++EAK+A+++IL+ F+ ELSP YAHAP   +T QPQ+GA +I+HK
Sbjct  458   PFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPSVTITLQPQYGAHIILHK  517



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/525 (55%), Positives = 373/525 (71%), Gaps = 29/525 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W ++DW+WF+PKKLEK L++QG  GN YRIL GD+KE A M  +A+SKPM  S++IAPR
Sbjct  28    GWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPR  87

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             VIP     +  YGK+ ++W+GP P+V I DPE IK V +    +QK   NPL R + +G+
Sbjct  88    VIPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQGI  147

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
             AN E +KWAKHR+IINPAF+ EKLK+                            M PAF 
Sbjct  148   ANLEGEKWAKHRKIINPAFHLEKLKD----------------------------MVPAFY  179

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC EM+SKWE +VS +GSCE DV P L+ +  DVISRTAFGSSYE+G +IF+LQ E G 
Sbjct  180   HSCNEMVSKWESMVSREGSCELDVMPCLKNMASDVISRTAFGSSYEKGXKIFKLQTELGN  239

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGI  1133
               I+ S  +Y+PGW F+PTK NR+M  I KE+ + I GI+++R K+M  GE    DLL I
Sbjct  240   LVIQASLGIYIPGWSFLPTKSNRKMKEISKEITTLILGIMNEREKSMNAGEAIQTDLLSI  299

Query  1134  LLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  1310
             L+ESN+ EI+Q G  K+ GMSIE+VIEECK+FY AGQETT+ +LVWTM+LLS + +WQ R
Sbjct  300   LMESNMNEIKQHGNNKDIGMSIEEVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQER  359

Query  1311  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  1490
             AR EV ++FG+++P+++GLN LKV+TMI  E LRLYPP++   R   +ETKLG + LP+G
Sbjct  360   ARAEVFEIFGNKKPNYDGLNRLKVVTMIFNEVLRLYPPVSIFGRIVRKETKLGNLTLPKG  419

Query  1491  ALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFAL  1670
              +L LP +L+  D E+WGEDA EF P+RF EG+ KATK    F PFG GPRIC+G NF +
Sbjct  420   VMLGLPIVLIQRDPELWGEDAHEFNPERFSEGVSKATKNPCAFIPFGWGPRICIGLNFTM  479

Query  1671  VEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +EAKM ++MILQRFSFELSPSY H+P + +TTQPQHGA +I+HKL
Sbjct  480   IEAKMTLSMILQRFSFELSPSYTHSPSASLTTQPQHGAHIILHKL  524



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/531 (55%), Positives = 373/531 (70%), Gaps = 31/531 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W ++DW+WF+PKKLEK L+QQG  GN YRIL GD+KE A M   A+SKPM  S++IAPR
Sbjct  27    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPR  86

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN--KNYQYQKARTNPLGRKVAR  587
             VIP     +  YGK+ ++W+GP P+V I DPE +K V +   +YQ   A  NPL + +A 
Sbjct  87    VIPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  146

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ N+E  KW KHR+IINPAF+ EKLK+                            M PA
Sbjct  147   GLLNHEGHKWVKHRKIINPAFHLEKLKD----------------------------MVPA  178

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+SKWE +VS +GSCE DV P LQ +T DVISRTAFGSSYE+GK+IF+LQ E 
Sbjct  179   FYHSCDEMISKWESMVSVQGSCELDVMPYLQNMTADVISRTAFGSSYEKGKKIFKLQTEL  238

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I  +  +Y+PGWRF+PTK N +M  I KE+ + I GII++R  +M+ GE    DLL
Sbjct  239   AEMVIRSTLGIYIPGWRFLPTKSNNKMKVISKEISTLIMGIINERETSMKAGEATQTDLL  298

Query  1128  GILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
              IL+ESNL EI+Q G  K+ GMSIEDVI+ECK+FY AGQETT+ +L WTM+LLS + +WQ
Sbjct  299   SILMESNLNEIKQHGNNKDIGMSIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSEWQ  358

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAR EV ++FG+++PD++GL+ LKV+TMIL E LRLYPP++   R   +ETKLG++ LP
Sbjct  359   ERARAEVFEIFGNKKPDYDGLSRLKVVTMILNEVLRLYPPVSMFGRFIKKETKLGKLTLP  418

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G +L LPT+L+  D E+WGEDA EFKP+RF EG+ KATK    F PFG GPRIC+G NF
Sbjct  419   AGVMLGLPTVLIQCDPELWGEDAHEFKPERFFEGVSKATKNSGAFVPFGWGPRICIGLNF  478

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL*YVS  1817
             A++EAKM ++MILQRFS ELS SY HAP   +TTQPQHGA +I+HKL  V+
Sbjct  479   AMIEAKMTLSMILQRFSLELSSSYTHAPIVAITTQPQHGAHIILHKLELVT  529



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/544 (54%), Positives = 391/544 (72%), Gaps = 35/544 (6%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWG--VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ++Y  L +   + ++ Y WG   ++W+W +PK LEK L++ G +GN Y++L GDMKE+  
Sbjct  1     MLYISLAISFVIIIILYRWGWRFMNWLWLQPKCLEKCLRELGFRGNSYKLLYGDMKEVVM  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKP+  S +I PR++PF  + +  YGK  ++W+GP P +LI DPELI+E+L+K+
Sbjct  61    MDEEAKSKPIKFSHDIVPRIMPFIQKTIIDYGKKSFIWLGPTPALLIMDPELIREILSKS  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               +QK       + +A G+ +YE DKWAKHRRIIN AF+ +KLK                
Sbjct  121   NIFQKPPPTAQTKLLAEGILSYEADKWAKHRRIINHAFHLDKLKH---------------  165

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M P+F L  CEMLSKWE IVS +GS E DVWP LQ LT D ISRTAF
Sbjct  166   -------------MVPSFHLCTCEMLSKWEKIVSAEGS-EVDVWPYLQSLTSDAISRTAF  211

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             G+SYEEG+++FELQ+E     ++V+   Y+   +F+P K +RRM  I +EV+S + GII+
Sbjct  212   GNSYEEGRKMFELQQELAKIILKVTESSYI---KFLPNKEDRRMKQIYQEVRSLVLGIIN  268

Query  1077  KRMKAMQGGE-TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KRM A++ GE +NNDDLLGILLESNL+EI++   K+FGMS+++VIEECK+FYFAGQETTS
Sbjct  269   KRMNAIEAGEASNNDDLLGILLESNLKEIQEHRNKKFGMSMDEVIEECKLFYFAGQETTS  328

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +L W+MI+LS+  +WQARAREEVLQVFG+ +PD++ LN LKV+TMI+ E LRLYPP+  
Sbjct  329   ALLTWSMIVLSKHSEWQARAREEVLQVFGNNKPDYDMLNQLKVVTMIIQEVLRLYPPLLL  388

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             M R    ETKLG + LP G  L+LPT++++ D EIWGED KEF P+RF EG+ KATKGK 
Sbjct  389   MGREVHTETKLGNLSLPSGVQLLLPTIMLYHDQEIWGEDIKEFNPERFSEGVNKATKGKF  448

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              +FPF  GPRIC+GQNFA++EAKMA+AMILQ ++F++SPSYAH PYS++T QPQHGA LI
Sbjct  449   AYFPFSWGPRICIGQNFAMLEAKMALAMILQHYAFDVSPSYAHVPYSVLTLQPQHGAQLI  508

Query  1794  IHKL  1805
             +HKL
Sbjct  509   LHKL  512



>emb|CDY32348.1| BnaC01g36670D [Brassica napus]
Length=512

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/539 (56%), Positives = 377/539 (70%), Gaps = 37/539 (7%)
 Frame = +3

Query  201   GVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              V +SV + A   + W  L+WVWFKPK LE +L++QGL G PY +L GD+K    MTT+A
Sbjct  7     SVTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEA  66

Query  372   LSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
              SKP+ L+D+I PRV+PF    +  YG++ + W GP P + I +PE IKEVLNK Y +QK
Sbjct  67    RSKPIKLTDDIVPRVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQK  126

Query  552   ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGK  731
               T PL R VA G+ +Y+ DKWAKHRRIINPAF+ +K+K                     
Sbjct  127   PNTFPLSRLVASGLFSYDGDKWAKHRRIINPAFHLDKIKN--------------------  166

Query  732   SQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS-CERDVWPDLQGLTCDVISRTAFGSSY  908
                     M PAF  SC E++ KW+ IV  KGS CE DVWP L  +T DVISRTAFGSSY
Sbjct  167   --------MVPAFHQSCSEVVVKWDNIVMDKGSSCEVDVWPWLMNMTADVISRTAFGSSY  218

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             +EG RIFELQ E     I+  R+ ++PG+ ++PTK NRRM A  +E ++ +RGI+DKR++
Sbjct  219   KEGHRIFELQAELSELIIQSFRKAFIPGYSYLPTKGNRRMKAAARESQAILRGIVDKRLR  278

Query  1089  AMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVW  1268
             A + GE  + DLLG LLESNL +     GK  GMSIEDVIEECK+FYFAGQETTSV+LVW
Sbjct  279   AREAGEAPSQDLLGTLLESNLGQ-----GKGNGMSIEDVIEECKLFYFAGQETTSVLLVW  333

Query  1269  TMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRT  1448
             TMILLS+ QDWQARAREEV QVFGD+EP+ EGLN LKV+TMIL E LRLYPP+  M R  
Sbjct  334   TMILLSQHQDWQARAREEVKQVFGDKEPNAEGLNQLKVMTMILQEVLRLYPPVINMARAI  393

Query  1449  VEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPF  1628
              +E KLG + LP G  + LP +L+  D + WG DA EFKP+RF++GI KA K +  F PF
Sbjct  394   HKEMKLGGVTLPGGVNITLPIMLVQRDIQQWGNDAAEFKPERFKDGISKAAKSQVSFIPF  453

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
               GPRIC+GQNFA++EAKMAMA+ILQRFSF+LSPSY HAPY++ T  PQ GA LI+HK+
Sbjct  454   SWGPRICIGQNFAMLEAKMAMALILQRFSFDLSPSYVHAPYTVFTLHPQFGAHLIMHKI  512



>emb|CDX97591.1| BnaA05g24880D [Brassica napus]
Length=495

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 377/523 (72%), Gaps = 34/523 (7%)
 Frame = +3

Query  240   GVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVI  419
              ++ WVW KPKKLE +L+ QGL G+PY  L GD+K    M  +A SKP+ L+D+I+ RV+
Sbjct  6     ALVTWVWLKPKKLESYLRSQGLSGSPYTPLIGDLKRTFSMAMEARSKPIKLTDDISTRVV  65

Query  420   PFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVAN  599
             PF ++ +  +G + + W+G  P V I DPEL+KEV NK Y +QK  T PLG  +A+G+AN
Sbjct  66    PFPLEMLKTHGMTYFTWLGTIPTVTIMDPELVKEVFNKVYDFQKPHTFPLGNVIAKGLAN  125

Query  600   YEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLS  779
             Y+ +KWAKHR+IINPAF+ EK+K                             M PAF  S
Sbjct  126   YDGEKWAKHRKIINPAFHLEKIKN----------------------------MVPAFHQS  157

Query  780   CCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMH  956
             C E++ KW+ IVS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E    
Sbjct  158   CSEVVGKWDKIVSEKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQL  217

Query  957   FIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGIL  1136
              I    + +VPG+ ++PTK NRR+ A  +E++  +RGI++KR++A + GE  +DDLLGIL
Sbjct  218   IILAVLKAFVPGYLYLPTKGNRRIKAAAREIQVILRGIVNKRLRAREAGEAPSDDLLGIL  277

Query  1137  LESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAR  1316
             LESNL    Q  G E  MS EDV+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQARAR
Sbjct  278   LESNLG---QAKGNE--MSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAR  332

Query  1317  EEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGAL  1496
             +EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E KLG++ LP GA 
Sbjct  333   DEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQ  392

Query  1497  LMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVE  1676
             + LP LL+H D+++WGEDA EFKP+RF++G+ KAT GK  FFPF  GPRIC+GQ+FAL+E
Sbjct  393   ISLPILLVHRDTQLWGEDAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFALLE  452

Query  1677  AKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              KMA+A+IL+RFSF LSPSY HAPY+++T  PQ GAPLI+ KL
Sbjct  453   TKMALALILKRFSFGLSPSYVHAPYTVITLHPQFGAPLILRKL  495



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/558 (55%), Positives = 401/558 (72%), Gaps = 40/558 (7%)
 Frame = +3

Query  156   FPIASPEMEVIY---TLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRI  326
             F I + EM+V Y   ++LG C     L  AW +L+W W KPKKLEK L+Q GLKGN YR+
Sbjct  11    FQIRNREMDVFYRGISVLGTCF---FLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRL  67

Query  327   LSGDMKELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDP  506
             L GD+ E ++M  +A SKP+  +++I PR++PF  + +  +GK+ ++W GP P V+I DP
Sbjct  68    LIGDLGETSQMDKEAKSKPINFTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVIITDP  127

Query  507   ELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSS  686
             ELIKEVL KNY YQK  ++ LG+ +++GVA Y+KDKWAKHRR++NPAF+ EKLK      
Sbjct  128   ELIKEVLTKNYTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFHIEKLKH-----  182

Query  687   TLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGI--VSGKGSCERDVWPDLQ  860
                                    M PAF LSC EML KWE +   S +GS E DVWP LQ
Sbjct  183   -----------------------MLPAFHLSCSEMLKKWEKLASASAEGSFELDVWPYLQ  219

Query  861   GLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIE  1040
              +T DVISRTAFGS+ EEGK IF+LQKE   H +++ +  Y PG  ++PTKR RRM  I 
Sbjct  220   DMTSDVISRTAFGSNLEEGKNIFKLQKEILEHILQILQSFYFPGMLYLPTKRIRRMKKIS  279

Query  1041  KEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEF----GMSIEDVI  1208
             KEV SS+  II KR++AM+ GE +NDDLLGILL+SN +EI    G       GMS E+VI
Sbjct  280   KEVHSSVLNIIMKRVEAMKAGEPSNDDLLGILLDSNFKEIENDNGNNSNKNCGMSFEEVI  339

Query  1209  EECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLT  1388
             EECK+FYFAGQETT+V+LVWT++LLS+  +WQ RAR+EVLQ+FG+ EPDF+ LN LKV+T
Sbjct  340   EECKLFYFAGQETTAVLLVWTLLLLSKHPEWQMRARDEVLQIFGNSEPDFDALNHLKVIT  399

Query  1389  MILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKP  1568
             M++ E LRLYPP   M R   E+TKLG + LP G  + LPT+++H D E+WG+DAKEFKP
Sbjct  400   MVINEVLRLYPPGFMMSRVIHEDTKLGSLSLPGGISIFLPTIMLHHDEELWGDDAKEFKP  459

Query  1569  DRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAP  1748
             +RF EGI KATKG+ ++FPF GGPRIC+G NFA++EAKMA+A+ILQRF+FE+SPSY HAP
Sbjct  460   ERFSEGISKATKGQFIYFPFSGGPRICIGNNFAMLEAKMALALILQRFTFEISPSYTHAP  519

Query  1749  YSMVTTQPQHGAPLIIHK  1802
             +++VT QPQ+GA LI++K
Sbjct  520   HTLVTLQPQYGAQLILYK  537



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/540 (54%), Positives = 384/540 (71%), Gaps = 32/540 (6%)
 Frame = +3

Query  192   TLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              L  V +S+ ++ +AW VL+WVW +PKKLEK L++QGL GN YR+L GD K+L+KM    
Sbjct  10    ALCVVWVSI-VITWAWRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQT  68

Query  372   LSKPMTLS--DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
              SKP+ LS   +IAP V PF+ Q VN YGK+ +VWMGP P+V I +PE +K+  N++  +
Sbjct  69    QSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDF  128

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
              K   NP+ + + +G+   E ++WAKHR+IINPAF+ EKLK                   
Sbjct  129   HKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKG------------------  170

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M P F  SC EM++KWE +VS + SCE DVWP L+  T DVISR AFGSS
Sbjct  171   ----------MVPIFYRSCSEMINKWESLVSKESSCELDVWPYLENFTSDVISRAAFGSS  220

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG++IF+L +E+   +    R VY+PGWRF+PTK+N++   I  E+K  ++GII+KR 
Sbjct  221   YEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKRE  280

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVML  1262
             +AM+ GE   DDLLGIL+ESN +EI++ G  K  GMSIEDVI ECK+FYFAGQETTSV+L
Sbjct  281   EAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLL  340

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VWTM+LLS+ QDWQARAREEVLQVFG   P +E L+ LKV+TMIL E LRLYP +  + R
Sbjct  341   VWTMVLLSQNQDWQARAREEVLQVFGSNIPTYEELSQLKVVTMILLEVLRLYPSVVALPR  400

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
              T ++T+LG++ LP G  + LP LL+H D E+WGEDA EFKP+RF EG+ KATK +  +F
Sbjct  401   TTHKKTQLGKLSLPAGVEVSLPILLVHHDKELWGEDANEFKPERFSEGVSKATKNQFTYF  460

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PFGGGPRIC+GQNFA++EAK+A+++IL+ F+ ELSP YAHAP   +T QPQ+GA +I+HK
Sbjct  461   PFGGGPRICIGQNFAMMEAKLALSLILRHFALELSPLYAHAPSVTITLQPQYGAHIILHK  520



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/528 (56%), Positives = 386/528 (73%), Gaps = 29/528 (5%)
 Frame = +3

Query  222   LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDN  401
             ++ +AW VL+WVW +PKKLE+ L+QQGL GN YR+L GD KE + M  +A SKPM LS +
Sbjct  6     IITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHD  65

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKV  581
             I PRV+PF  Q V  YGK+ ++W+GP P+V I +P  +K+V      +QK   NPL + +
Sbjct  66    ITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFL  125

Query  582   ARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQ  761
             A G+ NYE +KWAKHR+IINPAF+ EKLK                             M 
Sbjct  126   ATGLPNYEGEKWAKHRKIINPAFHLEKLKR----------------------------ML  157

Query  762   PAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
             PAF  SC EM+ KWE +VS +GSCE DVWP L+ L  DVISR +FGSSY+EG++IF+L K
Sbjct  158   PAFHQSCSEMIEKWERLVSKEGSCELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLK  217

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             EQ    I   +  Y+PGWRF+PT+ N+RM AI+KE+K S+R II  R +A++ GE   DD
Sbjct  218   EQAKLTIRALQSFYIPGWRFLPTRSNKRMKAIDKEIKGSLRDIISTREEAIRMGEAAKDD  277

Query  1122  LLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQD  1298
             LLGIL+ESNL+EIR+ G  K  GMSIEDVIEECK+FYFAGQETTSV+L+WT++LLS+ Q+
Sbjct  278   LLGILMESNLKEIRENGNTKNVGMSIEDVIEECKLFYFAGQETTSVLLLWTLVLLSQNQN  337

Query  1299  WQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIV  1478
             WQARAR+EVLQVFG  +PDF+GL+ LKV+TMIL E LRLYP +  + R T ++T+LG++ 
Sbjct  338   WQARARDEVLQVFGSNKPDFDGLSHLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLS  397

Query  1479  LPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQ  1658
             LP G  + LP LL+H D E+WGEDA EF P+RF EG+ KA+K +  +FPFGGGPRIC+GQ
Sbjct  398   LPAGVEVSLPILLLHHDKELWGEDAIEFNPERFSEGVSKASKNQFAYFPFGGGPRICIGQ  457

Query  1659  NFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             NFA++EAK+A +++LQRF+FELSPSYAHAP  +++ QPQ+GA +I+HK
Sbjct  458   NFAMLEAKLAFSLLLQRFTFELSPSYAHAPSLIISLQPQYGAHIILHK  505



>ref|XP_010502013.1| PREDICTED: cytochrome P450 72A13 isoform X1 [Camelina sativa]
Length=519

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/533 (55%), Positives = 378/533 (71%), Gaps = 41/533 (8%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK LE +LK+QGL G PY  L GD+K  + M   A SKP+ L+D+I P
Sbjct  20    WVWRTLQWVWFKPKMLESYLKRQGLAGTPYTPLVGDLKRNSSMLAVARSKPIKLTDDITP  79

Query  411   RVIPFYVQHVNKY------GKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLG  572
             RV+PF +  +  +      G++ + W GP P + I DPELIKEV NK Y +QKA T PLG
Sbjct  80    RVVPFPLHMLKTHVAVAETGRTFFTWFGPVPVITIMDPELIKEVFNKVYDFQKAHTFPLG  139

Query  573   RKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSV  752
             R +A G+ +Y+ DKWAKHRRIINPAF+ EK+K                            
Sbjct  140   RIIAAGLVSYDGDKWAKHRRIINPAFHLEKIKN---------------------------  172

Query  753   LMQPAFLLSCCEMLSKWEGIVSGK--GSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRI  926
              M PAF  SC E++ +W+ +   K   SCE DVWP L  +T DVISRTAFGSSY+EG+RI
Sbjct  173   -MVPAFHQSCSEVVGQWDKLALDKEGSSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRI  231

Query  927   FELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE  1106
             FELQ E     I+  R+ ++PG+ ++PTK NRRM A  +EVK  + GI++KR++A + G+
Sbjct  232   FELQAELAKLIIQAFRKAFIPGYNYLPTKGNRRMKAAAREVKVILGGIVNKRLRAREAGD  291

Query  1107  TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLS  1286
               +DDLLGILLESNL    Q+ G   GM+ E+++EECK+FYFAGQETT+V+LVWTM+LLS
Sbjct  292   ATSDDLLGILLESNLG---QKKGN--GMTTEELMEECKLFYFAGQETTTVLLVWTMVLLS  346

Query  1287  RFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKL  1466
             + QDWQARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KL
Sbjct  347   QHQDWQARAREEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKL  406

Query  1467  GEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRI  1646
             G++ LP G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +  FFPF  GPRI
Sbjct  407   GDLTLPSGVQISLPILLVQRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRI  466

Query  1647  CVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             C+GQNFA++EAKMAMA+ILQ+FSFELSPSY HAP++++T  PQ GAPLI+HKL
Sbjct  467   CIGQNFAMLEAKMAMALILQKFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  519



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/527 (56%), Positives = 379/527 (72%), Gaps = 35/527 (7%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L+WVWFKPK LE +L++QGL G  Y  L GD+K  + M  +A SKP+ L+D I P
Sbjct  20    WVWRTLEWVWFKPKMLESYLRRQGLAGTHYTPLVGDLKRNSSMLAEARSKPINLTDEITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF +  +  +G++ + W+GP P V I DPELIKEV NK Y +QK  T PLGR +A G
Sbjct  80    RVVPFPLHMLKTHGRTFFTWLGPVPVVTIMDPELIKEVFNKVYDFQKPHTFPLGRIIAAG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAK+RRIINPAF+ EK+K                             M PAF
Sbjct  140   LVSYDGDKWAKYRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGK--GSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
               SC E++ +W+ +V  K   SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E
Sbjct  172   HQSCSEVVGQWDKLVLDKDGSSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAE  231

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                  I+  R+ ++PG+ ++PTK NRRM A  +E+K  + GI++KR++A + GE  +DDL
Sbjct  232   LATLIIQAFRKAFIPGYNYLPTKGNRRMKAAAREIKVIMGGIVNKRLRAREVGEAPSDDL  291

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LGILLESNL    Q+ G   GM+ E+++EECK+FYFAGQETT+V+LVWTM+LLS+ QDWQ
Sbjct  292   LGILLESNLG---QKKGN--GMTTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQ  346

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             ARAREEV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP
Sbjct  347   ARAREEVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLP  406

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LP LL+  D+E+WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQNF
Sbjct  407   SGVQISLPILLVQRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNF  466

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAKMAMA+ILQ+FSFELSPSY HAP++++T  PQ GAPLI+HKL
Sbjct  467   AMLEAKMAMALILQKFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>ref|XP_010324391.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/544 (56%), Positives = 381/544 (70%), Gaps = 73/544 (13%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME++ T     I++ L    W VL+WVWF+PKKLEK L++QGL GN YR+L GDMK+ +K
Sbjct  1     MELV-TACCCAITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM LS++I PR++PF+++ + KY                             
Sbjct  60    MIKEANSKPMNLSNDITPRLVPFFLETIKKYAL---------------------------  92

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
                           + +G+A YE+DKWAKHR+IINPAF+ EKLK                
Sbjct  93    --------------LVQGLAAYEEDKWAKHRKIINPAFHLEKLKH---------------  123

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PAF LSC EMLSKWE  V  +GSCE DVWP LQ LTCDVISRTAF
Sbjct  124   -------------MLPAFHLSCSEMLSKWEDAV--EGSCEIDVWPHLQQLTCDVISRTAF  168

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG++IFELQ+EQ  HFI+  R V +P WRF+PTKRNRRM  I+ EV++S++GIID
Sbjct  169   GSSYEEGRKIFELQREQAQHFIDTVRSVNIPRWRFLPTKRNRRMKEIKNEVRTSMKGIID  228

Query  1077  KRMKAMQGG-ETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KRMKAM+ G + +N+DLLG+LLESN +EI Q G K+FGMSIE+VIEECK+FYFAGQET +
Sbjct  229   KRMKAMKAGHDADNEDLLGVLLESNFKEIEQHGNKDFGMSIEEVIEECKLFYFAGQETIA  288

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWT++LLSR+QDWQ +AREEVLQVFG ++PDF+GLN LKV+TMILYESLRLY P+  
Sbjct  289   VLLVWTLVLLSRYQDWQTQAREEVLQVFGSRKPDFDGLNHLKVVTMILYESLRLYSPLFT  348

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
              +R+  E+T L E+ LP   L+ LPT+++H D +IWGEDA +F P+RFREGI  AT GK 
Sbjct  349   HNRQASEDTVLVELCLPADVLVSLPTIILHHDKDIWGEDANKFNPERFREGISSATMGKV  408

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              +FPF  GPRIC+GQNFA++EAKM + MILQ FSFELSPSY HAP  ++T  PQ+GAPLI
Sbjct  409   TYFPFSWGPRICIGQNFAMLEAKMTLCMILQSFSFELSPSYTHAPQPLLTIHPQYGAPLI  468

Query  1794  IHKL  1805
              HKL
Sbjct  469   FHKL  472



>emb|CDP15979.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 377/543 (69%), Gaps = 28/543 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             +  I  +  +  ++ L+A AW +  WVW  PKKLEK L+QQG +GN Y  + GD+  ++ 
Sbjct  9     LSSIVLVTALSSAIFLVALAWKLFKWVWLNPKKLEKLLRQQGFRGNSYIPVLGDVIAMST  68

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             +   A SKP+ LSD+I PR+IP Y+  V K+GK+ Y+W GP P V I+DPELI+E     
Sbjct  69    LLKQAHSKPINLSDDIVPRIIPEYLDLVKKHGKNTYIWYGPEPSVCIQDPELIREASQNI  128

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               + K   N L R +A G+ +Y  DKWAKHR++INPAF+ EKLK                
Sbjct  129   NLFHKPVVNQLTRLLAPGLISYNGDKWAKHRKLINPAFHGEKLK----------------  172

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         LM P+F  S   ML KWE I+S  G CE DVWP L+ L+ D ISRTAF
Sbjct  173   ------------LMLPSFCTSATAMLRKWEEIISPTGFCELDVWPSLRSLSSDAISRTAF  220

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEG+ IFELQ EQ    I+    + +PGWRF+PTKRNRRM  I K+V  SIR II+
Sbjct  221   GSNYEEGRVIFELQGEQCELCIKALWSMLIPGWRFLPTKRNRRMGQIFKDVTDSIREIIN  280

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSV  1256
              R+  ++ GE  +DD LG+LL+SN QEI + G K+FGM+IE+VIEEC++FY AGQETTSV
Sbjct  281   SRLNEIRAGEFGDDDFLGLLLQSNSQEIDRHGNKDFGMTIEEVIEECRLFYVAGQETTSV  340

Query  1257  MLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGM  1436
             +LVWT+ILLS  Q+WQ RAR+EVLQVFG + PDF+GLN LK++TM+LYE LRLYPPI   
Sbjct  341   LLVWTLILLSVHQEWQTRARDEVLQVFGTRIPDFDGLNHLKLVTMVLYEVLRLYPPIPVN  400

Query  1437  DRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV  1616
              R T  ETKLG + LP G L+++ TLL+H D  IWGEDAKEFKP+RF +G   ATKG   
Sbjct  401   GRITAAETKLGNLSLPSGVLVLIQTLLVHHDQAIWGEDAKEFKPERFSQGASHATKGNIA  460

Query  1617  FFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLII  1796
             FFPFG GPR C+GQ++A++EAK+ +AMILQRF F+LSPSY+HAP S+VT +PQ+GAPLI+
Sbjct  461   FFPFGWGPRSCIGQSYAMLEAKLVLAMILQRFWFKLSPSYSHAPISLVTLKPQYGAPLIL  520

Query  1797  HKL  1805
             HKL
Sbjct  521   HKL  523



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/555 (54%), Positives = 377/555 (68%), Gaps = 69/555 (12%)
 Frame = +3

Query  261   FKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIPFYVQHV  440
              +PK+LEK L++QGLKGN YR L GD+KE   M  +A SKP+ LSD+I  RV PF +Q V
Sbjct  31    LRPKRLEKCLRKQGLKGNSYRFLFGDLKESISMYKEARSKPINLSDDITTRVFPFVLQTV  90

Query  441   NKYG----------------------------------------KSCYVWMGPRPKVLIR  500
              KYG                                        K  ++W+GP P+V I 
Sbjct  91    QKYGMYLYSTQSGGQTVIFGTQGSQIDHKTLFNKRKAFSFPVSGKDSFMWIGPNPRVNIT  150

Query  501   DPELIKEVLNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLM  680
             +PE +K++ NK   + K   NPL   +A G+A+YE +KWAKHR+IINPAF+ EKLK    
Sbjct  151   NPEHLKDIFNKIGDFPKPHNNPLVELLATGLASYEGEKWAKHRKIINPAFHVEKLKH---  207

Query  681   SSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQ  860
                                      M PAF LSC EML KWE  ++ +GSCE DVWP LQ
Sbjct  208   -------------------------MLPAFYLSCNEMLKKWESFLNNEGSCEIDVWPYLQ  242

Query  861   GLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIE  1040
              +T DVISRTAFGSSYEEG+RIF+LQ+EQ    I+  + VYVPGWRF PT  N+RM  ++
Sbjct  243   NMTGDVISRTAFGSSYEEGRRIFQLQREQAELAIKAIQTVYVPGWRFAPTTLNKRMKEVD  302

Query  1041  KEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEEC  1217
              EV+  ++ II KR KAM+ GE  NDDLLGIL+ESN +EI++ G  K  G+SI DVIEEC
Sbjct  303   HEVQGLLKDIIHKREKAMRAGEAPNDDLLGILMESNFKEIQEHGNNKNMGISIRDVIEEC  362

Query  1218  KVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMIL  1397
             K+FYFAGQETTSV+LVWTM+LLSR+ DWQARAREEVLQVFG   PDF+GL  LK++TMIL
Sbjct  363   KLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGYNNPDFDGLGHLKIVTMIL  422

Query  1398  YESLRLYPPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRF  1577
             YE LR YPP+  + R   ++T+LG + LP G  + LP +L+H D+ +WGEDAKEFKP+RF
Sbjct  423   YEVLRFYPPVILLTRTVQKQTQLGNLSLPPGVQISLPVILVHRDTNLWGEDAKEFKPERF  482

Query  1578  REGIMKATKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSM  1757
              EG+ KATKG+  FFPFG GPRIC+GQNFA++EAKMA+A+ILQRF+FELSPSYAHAP ++
Sbjct  483   AEGVSKATKGQVSFFPFGWGPRICIGQNFAMIEAKMALALILQRFTFELSPSYAHAPCTV  542

Query  1758  VTTQPQHGAPLIIHK  1802
             +T QPQ+GA + +HK
Sbjct  543   ITLQPQYGAHITLHK  557



>gb|AGX93056.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Lonicera japonica]
Length=519

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/547 (53%), Positives = 395/547 (72%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             M + Y L+G  +  G++ Y  +  L+W+WF+PKKLEK L++QG  GN YR+  GD +E  
Sbjct  1     MMMSYNLIGGSLIFGVITYWVYSFLNWIWFRPKKLEKCLREQGFGGNAYRLFLGDQQESK  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  DA+S+P+TLSD+I  RVIP  ++ +N +GK+ ++W+G  P++ I +PELI++VL K
Sbjct  61    VMIRDAMSRPITLSDDIKQRVIPHVLKTMNNHGKNSFMWVGRMPRLHITEPELIRDVLTK  120

Query  534   NYQYQKART--NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              Y++QK     +P+ + +  G+ + E + WA+ RR+IN AF+ EKLK             
Sbjct  121   YYKFQKNHHSLDPITKYLLSGIGSLEGEPWAQRRRVINSAFHFEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVIS  884
                            LM PAF LSC +M++KWE +VS KG S E +V  DL+ LT DVIS
Sbjct  168   ---------------LMLPAFYLSCLDMVNKWEKVVSSKGGSVEVEVHHDLETLTGDVIS  212

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RT FGS++EEGK+IFEL KE  +  I+V + VY+PGWRF+PTKRN R+  I+K+V+ SI 
Sbjct  213   RTLFGSNFEEGKKIFELMKELTVLTIQVIQSVYIPGWRFMPTKRNNRIKKIDKDVRVSIT  272

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II+ +MKAM+ GE+++ D LGILLE N+ EI Q   K  G+SIE++I ECK+FYFAGQ+
Sbjct  273   EIINNKMKAMKAGESSSSDFLGILLECNMTEIEQTKNKNAGLSIEEIIGECKLFYFAGQD  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS +L WTM++LSRF DWQARAREEVLQVFGD +PD++G+N LK +TMILYE LRLYPP
Sbjct  333   TTSTLLCWTMVILSRFPDWQARAREEVLQVFGDGKPDYDGINRLKTVTMILYEVLRLYPP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +  + +   E+TKLG++ +P G  +MLPT+L+H + +IWGED  EFKP+RF +G++KATK
Sbjct  393   VVELTKVAHEDTKLGDLTIPAGVQVMLPTILLHHNPDIWGEDVDEFKPERFAQGVLKATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPF  GPR+C+GQNFAL+EAKMA+A+IL RFSFELSPSY HAPY+++T QPQ GA
Sbjct  453   SQGSFFPFSLGPRMCIGQNFALLEAKMALALILPRFSFELSPSYVHAPYTLITMQPQFGA  512

Query  1785  PLIIHKL  1805
              LI+HK+
Sbjct  513   HLILHKI  519



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/544 (53%), Positives = 392/544 (72%), Gaps = 29/544 (5%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME+ Y  + +  +  LL+ AW     VW +P++LE+ L++QGL GN YR L GD K+++ 
Sbjct  1     MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A S+P+ LSD+I PRVIPF  + + +YGK+ + W+GP P+V I  PELI+EV  + 
Sbjct  61    MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
              ++QK + NPL   +  G+ +YE +KWAKHR+++NPAF+ EKLK                
Sbjct  121   GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         LM PAF LSC +M+SK E +VS +GSCE DVWP L+ LT D +SRTAF
Sbjct  165   ------------LMSPAFHLSCRQMISKMEEMVSPEGSCELDVWPFLKNLTADALSRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+R+F+L +EQ    +EV + VY+PGW ++PTKRN+RM  I+KE+ + +  II 
Sbjct  213   GSSYEEGRRLFQLLQEQTYLTMEVFQSVYIPGWWYLPTKRNKRMKKIDKEMNTLLNDIIT  272

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR KAM+ G+T N+DLLGIL+ESN +EI++ G  K  G+S+++VIEECK+FY AGQETTS
Sbjct  273   KRDKAMKDGKTANEDLLGILMESNSKEIQEGGNSKNAGISMQEVIEECKLFYLAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +L+WTM+LLS+  +WQ  AREEV QVFG  +P+F GL+ LKV+TMI YE LRLYPP   
Sbjct  333   NLLLWTMVLLSKHPNWQTLAREEVFQVFGKNKPEFAGLSRLKVVTMIFYEVLRLYPPGAT  392

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             ++R   E+  LGE+ LP G  ++LPT+L+H D EIWG+D KEFKP+RF EG+MKATKG+ 
Sbjct  393   LNRAVYEDINLGELYLPSGVEIVLPTILVHHDPEIWGDDVKEFKPERFSEGVMKATKGQV  452

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              +FPFG GPRIC+GQNFA+ EAKMA+AMILQ F+FELSPSY HAP S++T QPQ+GA LI
Sbjct  453   SYFPFGWGPRICIGQNFAMAEAKMALAMILQCFTFELSPSYTHAPTSVLTLQPQYGAHLI  512

Query  1794  IHKL  1805
             +HK+
Sbjct  513   LHKI  516



>gb|EYU30753.1| hypothetical protein MIMGU_mgv1a004802mg [Erythranthe guttata]
Length=509

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/539 (54%), Positives = 386/539 (72%), Gaps = 35/539 (6%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             L   + V L  YAW VL+WVWF P+ LEK L++QG  GN Y+IL GD+KE+A +     S
Sbjct  3     LCFVVVVLLFYYAWKVLNWVWFTPRNLEKRLREQGYNGNSYKILFGDLKEMAFIIKQFNS  62

Query  378   KPMTLS-DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             KP++ S D + PRVIPF  + V KYG    +W GPRP +L  DPE+++EVL+K+Y +Q+ 
Sbjct  63    KPVSFSRDTVVPRVIPFISKTVEKYGPKSIMWFGPRPAILCFDPEIVREVLSKSYVFQRP  122

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
                PL + + +GV  YE +KWAKHRR++ PAF+ +KLK                      
Sbjct  123   PLTPLTKLLVQGVGAYETEKWAKHRRLVTPAFHPDKLKN---------------------  161

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIV-SGKGSCERDVWPDLQGLTCDVISRTAFGSSYE  911
                    M PAF LSC +MLSKWE IV S  GSCE DVWP LQ ++ DVISRTAFGSSYE
Sbjct  162   -------MLPAFYLSCNDMLSKWEEIVISDDGSCEVDVWPYLQNMSSDVISRTAFGSSYE  214

Query  912   EGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKA  1091
             EG+ +FELQ+EQ   +   S+ VY+PGWRF+PTK N+RM  I KEV+S + GII+KRM+ 
Sbjct  215   EGRIVFELQREQTELYGLASQSVYIPGWRFLPTKINKRMKEIAKEVQSCVLGIINKRMRE  274

Query  1092  MQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWT  1271
             M+ GE N+DDLL ILLESN +EI QQ G ++GMS E+VIEECK+FYFAGQETTS +L WT
Sbjct  275   METGEANSDDLLSILLESNSKEI-QQNGNKYGMSCEEVIEECKLFYFAGQETTSALLAWT  333

Query  1272  MILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTV  1451
             MILLS+  DWQ+RAR+EVL+ FG ++P F+ LN LK++TMI +E LRLYPP+  + + T 
Sbjct  334   MILLSKHLDWQSRARDEVLRAFGTRKPTFDELNQLKIVTMIFHEVLRLYPPVPTLTKMTQ  393

Query  1452  EETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQV-FFPF  1628
             +ET +GE  +P G  +++P++L+H D EIWG+DAKEF P RF EG    +KG+ + +FPF
Sbjct  394   KETSMGEEKIPAGVKIIIPSILIHTDKEIWGDDAKEFNPHRFNEGF---SKGQILSYFPF  450

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             G GPRIC+GQ+FA++EAKMA+ MILQRFSF++SPSYAHAP +++  QPQ+GA L++ KL
Sbjct  451   GWGPRICIGQSFAMLEAKMALTMILQRFSFDVSPSYAHAPRTVIALQPQYGAQLLLQKL  509



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/533 (55%), Positives = 385/533 (72%), Gaps = 35/533 (7%)
 Frame = +3

Query  207   CISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPM  386
             C+ + +LA  W VL+W WF+PKKL+K LKQQG KGNPY+++ GD+K+++ +  +A SKP+
Sbjct  16    CVVLSVLA--WRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDLKQISSLFQEANSKPI  73

Query  387   TLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNP  566
             +LSD I PR+ P +++ VNKYGK+ Y+W GPRP +LI DPELI++V  K   +QK + +P
Sbjct  74    SLSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIRKVTQKMDIFQKVKFHP  133

Query  567   LGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRT  746
                 +  G+  YE +KW K R+++N AF+ EKLK                          
Sbjct  134   QASLLVAGILGYEGEKWVKQRKLLNQAFHMEKLK--------------------------  167

Query  747   SVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRI  926
               LM PAF  S CEMLSKWE ++S KGS E DVWP +Q +T D ISRTAFGS YEEG++I
Sbjct  168   --LMVPAFYKSACEMLSKWEEMISVKGSFEVDVWPTIQTMTSDAISRTAFGSRYEEGRKI  225

Query  927   FELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE  1106
             FELQ+EQ  H +  +R +Y+PG RF+PTKRNRRM  I KEV+ SIR II+ R+KA++ GE
Sbjct  226   FELQREQAGHLVLATRSIYIPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGE  285

Query  1107  TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLS  1286
               + D+LG+LL ++     Q+ G E GM+  ++I+ECK+FY AGQETT+V+LVWTMILLS
Sbjct  286   AIDTDMLGLLLATS-----QETGGESGMTTGEIIQECKLFYVAGQETTAVLLVWTMILLS  340

Query  1287  RFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKL  1466
                DWQ RAREEVLQ FG   P+F+GLN LK++TMIL+E LRLYPPI+ + R   EETK+
Sbjct  341   MHPDWQERAREEVLQHFGTNMPNFDGLNQLKIVTMILHEVLRLYPPISNIGRTVAEETKI  400

Query  1467  GEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRI  1646
             G + +P G  L LP +L+H D EIWGED KEFKP+RF +G+  ATKG+ V+FPFG GPRI
Sbjct  401   GNLTIPAGQRLALPVILLHHDPEIWGEDVKEFKPERFADGVSSATKGQIVYFPFGWGPRI  460

Query  1647  CVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             C+G NFAL+EAK+A+AMILQRFSFELSPSY+HAP+  +  QPQ GAPL++HKL
Sbjct  461   CIGANFALLEAKLALAMILQRFSFELSPSYSHAPHQGIALQPQFGAPLVLHKL  513



>emb|CDX82468.1| BnaA03g33530D [Brassica napus]
Length=527

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/545 (55%), Positives = 385/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLA-YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+   L+ V +++ L++ + W  L  VWF+PK LE +L++QGL G PY  L GD+K   
Sbjct  1     MEISVALVTVSVAIVLVSSWTWRTLKLVWFRPKMLESYLRRQGLSGTPYTPLIGDLKRNF  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              MT DA SKP+ L+D+I+PRV+PF  + +   G++ + W+G  P + I DPE IKEV NK
Sbjct  61    SMTMDARSKPIKLTDDISPRVMPFPFEMLKNQGRTFFTWLGTTPTITIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK  T PL   VA+G+A Y+ +KWAKHRRIINPAF+ EK+K               
Sbjct  121   IYDFQKPHTFPLRNVVAKGLAKYDGEKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC +++ KWE +V  KG SCE DVWP L  +T DVISRT
Sbjct  167   --------------MVPAFHQSCSQVVGKWEKLVLDKGSSCEVDVWPGLVSMTADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     +    + ++PG+ ++PTK NRRM A  +E+   +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLMMLTFLKSFIPGYLYLPTKNNRRMKAASREIHVILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             I+KR++A + GE  +DDLLGILLESN     Q  G E  MSIEDV+EECK+FYFAGQETT
Sbjct  273   INKRLRAREAGEAPSDDLLGILLESNSG---QAKGNE--MSIEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM+LLS+ Q+WQARAREEV QVFGD+EP+ EGLN LKV+TMILYE LRLYPP  
Sbjct  328   SVLLVWTMVLLSQHQEWQARAREEVKQVFGDKEPNTEGLNQLKVMTMILYEVLRLYPPAA  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+H D ++WG+DA EFKP+RF +G+ KATKG+
Sbjct  388   QLTRAIHKEMKLGDLTLPGGVQINLPILLVHRDIQLWGKDAAEFKPERFEDGVSKATKGQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNFAL+E KMA+A++LQRFSFELSPSY HAPY+++T QPQ GA L
Sbjct  448   VSFFPFGWGPRICIGQNFALMETKMALALMLQRFSFELSPSYVHAPYTVLTLQPQSGAHL  507

Query  1791  IIHKL  1805
             I+HK+
Sbjct  508   ILHKI  512



>emb|CDY20078.1| BnaA01g29240D [Brassica napus]
Length=512

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/539 (56%), Positives = 376/539 (70%), Gaps = 37/539 (7%)
 Frame = +3

Query  201   GVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              V +SV + A   + W  L+WVWFKPK LE +L++QGL G PY +L GD+K    MTT+A
Sbjct  7     SVTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEA  66

Query  372   LSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
              SKP+ L+D+I P V+PF    +  YG++ + W GP P + I  PE IKEVLNK Y +QK
Sbjct  67    RSKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITSPEQIKEVLNKIYDFQK  126

Query  552   ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGK  731
               T  L R VA G+ +Y+ DKWAKHRRIINPAF+ EK+K                     
Sbjct  127   PNTFALSRPVASGLFSYDGDKWAKHRRIINPAFHLEKIKN--------------------  166

Query  732   SQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS-CERDVWPDLQGLTCDVISRTAFGSSY  908
                     M PAF  SC E++ KW+ IV  KGS CE DVWP L  +T DVISRTAFGSSY
Sbjct  167   --------MVPAFHQSCSEVVGKWDNIVLDKGSSCEVDVWPWLMSMTADVISRTAFGSSY  218

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             +EG+RIFELQ E     I+  R+ ++PG+ ++PTK NRRM A  +E ++ +RGI++KR++
Sbjct  219   KEGQRIFELQTELSELIIQAFRKAFIPGYSYLPTKGNRRMKAAARESQAILRGIVNKRLR  278

Query  1089  AMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVW  1268
             A++ GE  + DLLG LLESNL +     GK  GMSIEDVIEECK+FYFAGQETTSV+LVW
Sbjct  279   AIEAGEAPSQDLLGTLLESNLGQ-----GKGNGMSIEDVIEECKLFYFAGQETTSVLLVW  333

Query  1269  TMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRT  1448
             TMILLS+ QDWQARAREEV QVFGD EP+ EGLN LKV+TMIL E LRLYPP+  M R  
Sbjct  334   TMILLSQHQDWQARAREEVKQVFGDTEPNAEGLNQLKVMTMILQEVLRLYPPVINMTRAI  393

Query  1449  VEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPF  1628
              +E KLG + LP G  + LP +L+  D + WG DA EFKP+RF++GI KATK +  F PF
Sbjct  394   HKEMKLGGVTLPGGVNITLPIMLVQRDIQQWGNDAAEFKPERFKDGISKATKSQVSFIPF  453

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
               GPRIC+GQNFA++EAKMAMA+I+QRFSF+LSPSY HAPY++ T  PQ GA LI+HK+
Sbjct  454   SWGPRICIGQNFAMLEAKMAMALIIQRFSFDLSPSYVHAPYTVFTLHPQFGAHLIMHKI  512



>ref|XP_009116688.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/539 (56%), Positives = 376/539 (70%), Gaps = 37/539 (7%)
 Frame = +3

Query  201   GVCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDA  371
              V +SV + A   + W  L+WVWFKPK LE +L++QGL G PY +L GD+K    MTT+A
Sbjct  7     SVTVSVAIAAVLWWIWRTLNWVWFKPKMLESYLRRQGLVGTPYTLLVGDVKREYSMTTEA  66

Query  372   LSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQK  551
              SKP+ L+D+I P V+PF    +  YG++ + W GP P + I +PE IKEVLNK Y +QK
Sbjct  67    RSKPIKLTDDIVPLVLPFPSHMLKTYGRTFFTWRGPIPTITITNPEQIKEVLNKIYDFQK  126

Query  552   ARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGK  731
               T  L R VA G+ +Y+ DKWAKHRRIINPAF+ EK+K                     
Sbjct  127   PNTFALSRLVASGLFSYDGDKWAKHRRIINPAFHLEKIKN--------------------  166

Query  732   SQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS-CERDVWPDLQGLTCDVISRTAFGSSY  908
                     M PAF  SC E++ KW+ IV  KGS CE DVWP L  +T DVISRTAFGSSY
Sbjct  167   --------MVPAFHQSCSEVVGKWDNIVLDKGSSCEVDVWPWLMSMTADVISRTAFGSSY  218

Query  909   EEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMK  1088
             +EG+RIFELQ E     I+  R+ ++PG+ ++PTK NRRM A  +E ++ +RGI++KR++
Sbjct  219   KEGQRIFELQTELSELIIQAFRKAFIPGYSYLPTKGNRRMKAAARESQAILRGIVNKRLR  278

Query  1089  AMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVW  1268
             A+Q GE  + DLLG LLESNL +     GK  GMSIEDVIEECK+FYFAGQET SV+LVW
Sbjct  279   AIQAGEAPSQDLLGTLLESNLGQ-----GKGNGMSIEDVIEECKLFYFAGQETASVLLVW  333

Query  1269  TMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRT  1448
             TMILLS+ QDWQARAREEV QVFGD EP+ EGLN LKV+TMIL E LRLYPP+  M R  
Sbjct  334   TMILLSQHQDWQARAREEVKQVFGDTEPNAEGLNQLKVMTMILQEVLRLYPPVINMTRAI  393

Query  1449  VEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPF  1628
              +E KLG + LP G  + LP +L+  D + WG DA EFKP+RF++G+ KATK +  F PF
Sbjct  394   HKEMKLGGVTLPGGVNITLPIMLVQRDIQQWGNDAAEFKPERFKDGMSKATKSQVSFIPF  453

Query  1629  GGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
               GPRIC+GQNFA++EAKMAMA+ILQRFSF+LSPSY HAPY++ T  PQ GA LI+HK+
Sbjct  454   SWGPRICIGQNFAMLEAKMAMALILQRFSFDLSPSYVHAPYTVFTLHPQFGAHLIMHKI  512



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/545 (53%), Positives = 380/545 (70%), Gaps = 36/545 (7%)
 Frame = +3

Query  195   LLGVCISVGL-----LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKM  359
             ++G+ I++G+     L + W +L+WVWF+PKKLEK L++QGLKGN Y+ L GDMKE  +M
Sbjct  1     MIGLFIAIGIALCVILTWVWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRM  60

Query  360   TTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNY  539
               +A  KP+  +++   RV+PF  QHVNKYG++C+ W GP P + I +PELI+E   +  
Sbjct  61    RAEARGKPIPFTNDYYSRVLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMN  120

Query  540   QYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGAS  719
             ++QK R NPL   +  G+  YE +KWAKHR+++NPAF+ EKLK                 
Sbjct  121   EFQKTRLNPLIGLLVPGLVGYEGEKWAKHRKLVNPAFHMEKLK-----------------  163

Query  720   LEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFG  899
                        LM PAF  S  E+++KWE IV   GS E DVWP L  L+ DVISR AFG
Sbjct  164   -----------LMIPAFGASVTEIINKWEKIVPESGSSEIDVWPYLMSLSADVISRAAFG  212

Query  900   SSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDK  1079
             SSYEEGKRIFEL KEQ    + + + VY+PGWR+VPTK NR+M  I  ++++ + G+I+K
Sbjct  213   SSYEEGKRIFELLKEQTQITLRLFQSVYIPGWRYVPTKTNRKMKEINSQIQNLLTGLINK  272

Query  1080  RMKAMQGGETNNDDLLGILLESNLQEIRQQGGKE--FGMSIEDVIEECKVFYFAGQETTS  1253
             R KAM+ GE   DDLLGIL++SN +  +  G  +    MS +D+I+ECK+FYFAGQETTS
Sbjct  273   RKKAMEAGEVAKDDLLGILMDSNFKASQNVGSHKQLLAMSFQDMIDECKLFYFAGQETTS  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWTMILL + QDWQ RAREEVL  FG+ +PDF+GLN LK + MI+YE LRLYP +  
Sbjct  333   TLLVWTMILLGKHQDWQTRAREEVLATFGNNQPDFDGLNHLKTVAMIIYEVLRLYPAVVS  392

Query  1434  MDRRTVE-ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
               R     ETKLG +++PRGA++ L  L +H D  +WG+DAKEFKP+RF EGI KATKG 
Sbjct  393   ASRMVHNRETKLGNLLVPRGAMVSLSILHVHQDPRLWGDDAKEFKPERFSEGIAKATKGN  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRIC+GQNFA+ EAKMA++MILQRFSFELSPSY HAP +++T QPQ+GA L
Sbjct  453   ISFFPFGWGPRICIGQNFAIAEAKMALSMILQRFSFELSPSYTHAPTTVITLQPQYGAHL  512

Query  1791  IIHKL  1805
             I+ ++
Sbjct  513   ILQRV  517



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/544 (52%), Positives = 393/544 (72%), Gaps = 31/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             ME   +++ + ++VGL+ +AW +L+W+W +PKKLEK L++QGL+GNPYRIL GD+K+L K
Sbjct  1     MEWYSSIIPIIVTVGLI-WAWRILNWLWLRPKKLEKLLREQGLQGNPYRILYGDIKDLLK  59

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SK M L+D+I PRVIP+   +V  +GK+ ++W G +P+V++ +PE I +VLN  
Sbjct  60    MEKEARSKSMNLTDDIMPRVIPYIQHNVKIHGKNSFMWFGTKPRVILTEPEQIIDVLNNI  119

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               + K   + + + +  G+A+ E +KW+KHRR+INPAF+SEKLK                
Sbjct  120   SDFPK-NNHKIFKLLVSGLASLEGEKWSKHRRLINPAFHSEKLK----------------  162

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         +M P F  SC +++ KWE ++S  GSCE D+WP LQ L  DVISRT F
Sbjct  163   ------------VMTPTFFTSCNDLIRKWEEMLSPDGSCEIDIWPSLQNLASDVISRTTF  210

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+RIF+LQ EQ     +V    Y+P WRFVPT  NRR+N I K++KSS++ +I+
Sbjct  211   GSSYEEGRRIFQLQIEQAELMTKVQMNFYIPLWRFVPTMVNRRINEIGKDIKSSLKDMIN  270

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTS  1253
             KR+K ++ G  N +DLLGIL+E+N +EI++ G     GM+IEDVI+ECK+FYFAGQETTS
Sbjct  271   KRVKILKEGGENKNDLLGILIETNHKEIKEHGNNVNVGMNIEDVIQECKLFYFAGQETTS  330

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +LVWTM+LLSR+ +WQARAREEVLQ+FG+++P+F+GLN+LK++TMILYE +RLYPPI  
Sbjct  331   TLLVWTMVLLSRYPEWQARAREEVLQIFGNKKPNFDGLNNLKIVTMILYEVMRLYPPIIE  390

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   +  KLG + L  G  + +P +L+H D E+WG+DAK F P+RF  GI KAT G+ 
Sbjct  391   LSRNVEKNVKLGNLTLSAGVEVFMPIILLHHDCELWGDDAKMFNPERFSGGISKATNGRV  450

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPRIC+GQNF+L+EAKMAM +ILQ FSF+LSP+YAHAP +++  +PQ+GA +I
Sbjct  451   SFFPFGWGPRICIGQNFSLLEAKMAMTLILQHFSFQLSPAYAHAPATVIALKPQYGAHII  510

Query  1794  IHKL  1805
             + KL
Sbjct  511   LRKL  514



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 371/531 (70%), Gaps = 31/531 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W ++DW+WF+PKKLEK L+QQG  GN YRIL GD+KE A M   A+SKPM  S+ IAPR
Sbjct  28    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPMNFSNYIAPR  87

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN--KNYQYQKARTNPLGRKVAR  587
             VIP     +  YGK+ ++W+GP P+V I DPE +K V +   +YQ   A  NPL + +A 
Sbjct  88    VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ N+E  KW KHR+IINPAF+ EKLK+                            M PA
Sbjct  148   GLLNHEGQKWVKHRKIINPAFHLEKLKD----------------------------MVPA  179

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+SKWE +VS +G CE DV P LQ +T DVISRTAFGSSYE+GK+IF+LQ E 
Sbjct  180   FYHSCDEMISKWESMVSVEGFCELDVMPYLQNMTADVISRTAFGSSYEKGKKIFKLQTEL  239

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
             G   ++ +  +Y+PGWRF+PTK N +M  I KE+ + I  II++R  +M+ GE    DLL
Sbjct  240   GEMVMQSTLGIYIPGWRFLPTKSNNKMKVISKEISTLIMDIINERETSMKSGEAIQTDLL  299

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
              IL+ESNL EI+Q G  K+ GMSIEDVI+ECK+FY AGQETT+ +L WTM+LLS + DWQ
Sbjct  300   SILMESNLNEIKQHGNNKDIGMSIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSDWQ  359

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAR EV ++FG+++P+++GL+ LKV+TMIL E LRLYPP++   R   +ETKLG++ LP
Sbjct  360   ERARAEVFEIFGNKKPNYDGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLP  419

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G +L LP +LM  D E+WGEDA EFKP+RF EG+ KA K    F PFG GPRIC+G NF
Sbjct  420   AGVMLGLPVVLMQCDPELWGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNF  479

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL*YVS  1817
             A++EAKM ++MILQRFS ELS SY HAP + +TTQPQHGA +I+HKL  V+
Sbjct  480   AMIEAKMTLSMILQRFSLELSSSYTHAPIAAITTQPQHGAHIILHKLELVT  530



>ref|NP_188084.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
 sp|Q9LUC8.1|C7A13_ARATH RecName: Full=Cytochrome P450 72A13 [Arabidopsis thaliana]
 dbj|BAB02398.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAL57694.1| AT3g14660/MIE1_16 [Arabidopsis thaliana]
 gb|AAO22574.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75552.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
Length=512

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/522 (55%), Positives = 372/522 (71%), Gaps = 34/522 (7%)
 Frame = +3

Query  243   VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIP  422
              L  VW KPK LE +L++QGL G PY  L GD+K    M  +A SKP+ L+D+I PR++P
Sbjct  24    TLQRVWLKPKMLESYLRRQGLAGTPYTPLVGDLKRNFSMLAEARSKPINLTDDITPRIVP  83

Query  423   FYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANY  602
             + +Q +  +G++ + W GP P + I DPE IKEV NK Y +QKA T PLGR +A G+ +Y
Sbjct  84    YPLQMLKTHGRTFFTWFGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLGRLIAAGLVSY  143

Query  603   EKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSC  782
             + DKW KHRRIINPAF+ EK+K                             M PAF  SC
Sbjct  144   DGDKWTKHRRIINPAFHLEKIKN----------------------------MVPAFHQSC  175

Query  783   CEMLSKWEGIVSGK-GSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHF  959
              E++ +W+ +V+ K  SCE D+WP L  +T DVISRTAFGSSY+EG+RIFELQ E     
Sbjct  176   SEIVGEWDKLVTDKQSSCEVDIWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLI  235

Query  960   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  1139
             I+  R+  +PG+R+ PTK NRRM A  +E+K  +RGI++KR++A + GE  +DDLLGILL
Sbjct  236   IQAFRKAIIPGYRYFPTKGNRRMKAAAREIKFILRGIVNKRLRAREAGEAPSDDLLGILL  295

Query  1140  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  1319
             ESNL + +       GMS E+++EECK+FYFAGQETT+V+LVWTM+LLS+ QDWQARARE
Sbjct  296   ESNLGQTKGN-----GMSTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARARE  350

Query  1320  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  1499
             EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+  + R   +E +LG++ LP G  +
Sbjct  351   EVKQVFGDKEPDAEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMQLGDLTLPGGVQI  410

Query  1500  MLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEA  1679
              LP LL+  D E+WG DA EFKPDRF++G+ KATK +  FFPF  GPRIC+GQNFAL+EA
Sbjct  411   SLPILLIQRDRELWGNDAGEFKPDRFKDGLSKATKNQVSFFPFAWGPRICIGQNFALLEA  470

Query  1680  KMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             KMAM +IL++FSFELSPSY HAPY+++TT PQ GAPLI+HKL
Sbjct  471   KMAMTLILRKFSFELSPSYVHAPYTVLTTHPQFGAPLILHKL  512



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/525 (54%), Positives = 371/525 (71%), Gaps = 29/525 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W + DW+WF+PKKLEK L+QQG  GN YRIL GD+KE A M  +A+SKPM  S++IAPR
Sbjct  20    GWKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPR  79

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             VIP     + +YGK+ ++W+GP P+V I DPE +K V +    +QK   NP  + + +G+
Sbjct  80    VIPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGI  139

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
              N + +KW KHR+IINPAF+ EKLK+                            M PAF 
Sbjct  140   VNLDGEKWVKHRKIINPAFHLEKLKD----------------------------MVPAFY  171

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC EM+SKWE +VS +GSCE DV P L+ +  DVISRTAFGSSYE+GK+IF+LQ E   
Sbjct  172   HSCNEMVSKWESMVSKEGSCELDVMPYLKXMASDVISRTAFGSSYEKGKKIFKLQTELTN  231

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGI  1133
               I+ +  +Y+PGWRF+PTK NR+M  I KE+ + I GI+D+R K+M+ GE    DLL I
Sbjct  232   FVIQTTLGIYIPGWRFLPTKLNRKMKEISKEITTLILGIMDEREKSMKAGEAIQTDLLSI  291

Query  1134  LLESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  1310
             L+ESN+ EI+Q G K+  GMSIEDVIEECK+FY AGQETT+ +LVWTMILLS + +WQ R
Sbjct  292   LMESNMNEIKQHGNKKXIGMSIEDVIEECKLFYIAGQETTATLLVWTMILLSSYSEWQER  351

Query  1311  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRG  1490
             AR EV ++FG+++P+++GLN LKV+TMI  E LRLYPP +   R   +ET+LG + LP G
Sbjct  352   ARAEVFEIFGNKQPNYDGLNRLKVVTMIFNEVLRLYPPGSLFVRIVRKETRLGNLTLPGG  411

Query  1491  ALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFAL  1670
              +L LP +L+  D E+WGEDA EF P+RF  G+ KATK    F PFG GPRIC+GQ FA+
Sbjct  412   VMLGLPIVLIQRDPELWGEDAHEFNPERFSGGVSKATKNPSAFIPFGWGPRICIGQTFAM  471

Query  1671  VEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +EAKMA++MILQRFSFELSPSY H+P + +TTQPQHGA +I+HKL
Sbjct  472   IEAKMALSMILQRFSFELSPSYTHSPIASLTTQPQHGAHIILHKL  516



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/535 (56%), Positives = 384/535 (72%), Gaps = 36/535 (7%)
 Frame = +3

Query  198   LGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALS  377
             L   ++V L  +AW  ++WVW +PK+LE+ L+QQGL G  Y  L GD+KE  +M  +A S
Sbjct  10    LATVLAV-LTTWAWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKS  68

Query  378   KPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKAR  557
             KP+ +SD+I PR++PF  Q    YGK  + WMGP P+V I +PE IKEV +K Y Y K  
Sbjct  69    KPIAVSDDIKPRLLPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPA  128

Query  558   TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
             +NPL + +A G+AN+E +KWA+HR+IINPAF+ EKLK                       
Sbjct  129   SNPLVKLLADGLANHEGEKWARHRKIINPAFHMEKLK-----------------------  165

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                  LM PAF LSC EM+ +WE  V  + SCE D W DLQ LT DVISRTAFGSS+EEG
Sbjct  166   -----LMLPAFYLSCTEMVDRWEKSVLEERSCEVDAWVDLQNLTRDVISRTAFGSSFEEG  220

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             KRIFELQ+EQ +  I+  + VY+PGWRFVPTK NRRM  I KEV++ +  II +R+KA++
Sbjct  221   KRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMKNINKEVQAVLMDIIRRRVKAIR  280

Query  1098  GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMI  1277
              G+   DDLLG+LLESN++E       + GMS+ DVIEECK+FYFAGQETTSV+LVWTM+
Sbjct  281   AGDAAGDDLLGLLLESNMKE-------DVGMSLHDVIEECKLFYFAGQETTSVLLVWTMV  333

Query  1278  LLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEE  1457
             LLS   DWQARAREEVLQ FG ++PDF+GL+ LK++TMIL E LRLYPP   M R+  +E
Sbjct  334   LLSVHPDWQARAREEVLQTFGSRKPDFDGLSHLKIVTMILNEVLRLYPPAIVMARKVPKE  393

Query  1458  TKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGG  1637
             TKLG++ LP G  L + TLL+H D E+WGEDA+EFKP+RF EG+  ATK +  FFPFG G
Sbjct  394   TKLGKLTLPAGVQLSMSTLLIHHDKELWGEDAEEFKPERFAEGVSNATKNQVCFFPFGWG  453

Query  1638  PRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PR CVGQNFA++EAKMA+AMILQ+F+FELSPSYAHAP ++ T QPQ+G  +I+HK
Sbjct  454   PRTCVGQNFAMIEAKMALAMILQQFTFELSPSYAHAPLTIFTLQPQYGVQVILHK  508



>ref|XP_011082820.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/545 (55%), Positives = 379/545 (70%), Gaps = 38/545 (7%)
 Frame = +3

Query  186   IYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             ++T L   I++    +AW +++WVW +PK +EK L+ QG  GNPYRIL GD  ++AKM  
Sbjct  5     LFTFLFFAIAI----WAWRIVNWVWIRPKNIEKRLRAQGFGGNPYRILYGDTNDMAKMIK  60

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A SKP+ LSD++ PRVIP +   V KYGK+C+VW+GP  +V+I +PELIKEVLN N+ +
Sbjct  61    EANSKPIKLSDDVLPRVIPLHHHIVRKYGKACFVWIGPVARVVIMEPELIKEVLNNNHIF  120

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             +K   NPL R +  G+  YE DKW+KHR+IINPAFY EKL+                   
Sbjct  121   KKPTPNPLARFLVCGINGYEDDKWSKHRKIINPAFYVEKLRH------------------  162

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGS----CERDVWPDLQGLTCDVISRTA  893
                       M PA   SC EM+ KWE +V  +G      E DV P  + LT  VISRTA
Sbjct  163   ----------MVPAMHRSCVEMIEKWEKLVEIEGGKRKGIEIDVGPYFEDLTGQVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG+RIFELQKEQ     +V + VYVPGWR+VPTKRNRR+  I  ++ S +RGII
Sbjct  213   FGSSYEEGRRIFELQKEQAELTRQVLQSVYVPGWRYVPTKRNRRLKEINDDLCSLLRGII  272

Query  1074  DKRMKAMQ-GGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
              +R  AMQ G  T +DDLLGILL+SN +E+++ G K  GMSIE+VIEECK FYF+GQE+T
Sbjct  273   KQRQTAMQTGNSTEDDDLLGILLKSNEKEMKENGKKS-GMSIEEVIEECKTFYFSGQEST  331

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             S +L WTM LLS  QDWQ RAREE+ QVFGD  PDF+GLN LK++TMILYE LRLYPP  
Sbjct  332   SNLLSWTMFLLSIHQDWQKRAREELFQVFGDSAPDFDGLNRLKIVTMILYEVLRLYPPAI  391

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
               +R   +ETKLGE+ LP G  L LP +L+H D  +WGEDAKEFKP+RF +GI KATK +
Sbjct  392   IFNRIIHKETKLGEVTLPAGVHLQLPIILLHHDQNLWGEDAKEFKPERFSQGIAKATKNQ  451

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+G NFAL+E KMA+AMIL+ FSF+LSPSY HAP  ++T QPQ G  L
Sbjct  452   LSFFPFSWGPRICIGNNFALMETKMALAMILRAFSFDLSPSYTHAPSYVLTLQPQCGVHL  511

Query  1791  IIHKL  1805
             ++ ++
Sbjct  512   MMTQI  516



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/531 (54%), Positives = 370/531 (70%), Gaps = 31/531 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W ++DW+WF+PKKLEK L+QQG  GN YRIL GD+KE A M   A+SKPM  S+ IAPR
Sbjct  28    GWKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPMNFSNYIAPR  87

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN--KNYQYQKARTNPLGRKVAR  587
             VIP     +  YGK+ ++W+GP P+V I DPE +K V +   +YQ   A  NPL + +A 
Sbjct  88    VIPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLAD  147

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ N+E  KW KHR+IINPAF+ EKLK+                            M PA
Sbjct  148   GLLNHEGQKWVKHRKIINPAFHLEKLKD----------------------------MVPA  179

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+SKWE +VS +G CE DV P LQ +T DVISRTAFGSSYE+GKR F+LQ E 
Sbjct  180   FYHSCDEMISKWESMVSVEGFCELDVMPYLQNMTADVISRTAFGSSYEKGKRXFKLQTEL  239

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
             G   ++ +  +Y+PGWRF+PTK N +M  I KE+ + I  II++R  +M+ GE    DLL
Sbjct  240   GEMVMQSTLGIYIPGWRFLPTKSNNKMKVISKEISTLIMDIINERETSMKSGEAIQTDLL  299

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
              IL+ESNL EI+Q G  K+ GMSIEDVI+ECK+FY AGQETT+ +L WTM+LLS + +WQ
Sbjct  300   SILMESNLNEIKQHGNNKDIGMSIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSEWQ  359

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAR EV ++FG+++PD++GL+ LKV+TMIL E LRLYPP++   R   +ETKLG++ LP
Sbjct  360   ERARAEVFEIFGNKKPDYDGLSRLKVVTMILNEVLRLYPPVSMFGRLVKKETKLGKLTLP  419

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G +L LP +LM  D E+WGEDA EFKP+RF EG+ KA K    F PFG GPRIC+G NF
Sbjct  420   AGVMLGLPVVLMQCDPELWGEDAHEFKPERFSEGVSKAAKNPGAFVPFGWGPRICIGLNF  479

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL*YVS  1817
             A++EAKM ++MILQRFS ELS SY HAP + +TTQPQHGA +I+HKL  V+
Sbjct  480   AMIEAKMTLSMILQRFSLELSSSYTHAPIAAITTQPQHGAHIILHKLELVT  530



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/545 (54%), Positives = 371/545 (68%), Gaps = 30/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M+   +++     V LL   W  L+W+W  PKKLEK L++QG  GNPYR+ SGD+ ++  
Sbjct  1     MDFRNSMIWFVFMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVA  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M  +A SKPM  S +I PRVIP     + KYGK+ ++W+GP P+VLI DPE +K  L+  
Sbjct  61    MEEEAKSKPMNFSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLY  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               +QK  TNPL R +  G+ N+E +KW KHR+IIN AF+ EKLK+               
Sbjct  121   NDFQKPTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKD---------------  165

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M P    SC EM+SKWE + S  GSCE DV P LQ LT DVISRTAF
Sbjct  166   -------------MVPTMFESCNEMISKWEKMTSKDGSCELDVVPYLQSLTADVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GS+YEEGK IF   KE     ++ S  VY+PGWRF+PTK N RM  I KE+K+ +  IID
Sbjct  213   GSTYEEGKIIFNHFKELIRLVLQASNTVYLPGWRFLPTKSNNRMKKITKEIKTILMNIID  272

Query  1077  KRMKAMQGGET-NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR + M+  ET ++DDLLGILLESN  EI++ G    GMSI D+IEECK+FYFAGQETT+
Sbjct  273   KRQRTMKEDETMHSDDLLGILLESNSNEIKEHGNVNIGMSINDLIEECKIFYFAGQETTA  332

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTM+LL  +  WQ RAR EVLQVFG+ +PDF+GLN LK++TMIL E LRLYPP + 
Sbjct  333   VLLVWTMVLLGSYTKWQDRARAEVLQVFGNDKPDFDGLNRLKIVTMILNEVLRLYPPGSA  392

Query  1434  MDRRTVE-ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
             + R  V+ ET+LG +    G  L  P +L+H D E+WGEDA EF P+RF EG+ KATK +
Sbjct  393   VSRNLVKKETRLGNLKFSSGVTLSFPIILIHRDKELWGEDADEFNPERFAEGVSKATKNQ  452

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPFG GPRICVGQNFA++EAK+A+++ILQ FSFELSPSY HAP S++T QPQHGA +
Sbjct  453   TAFFPFGWGPRICVGQNFAMIEAKIALSIILQHFSFELSPSYTHAPISILTIQPQHGAHI  512

Query  1791  IIHKL  1805
             I+HKL
Sbjct  513   ILHKL  517



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/529 (54%), Positives = 380/529 (72%), Gaps = 31/529 (6%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
               Y   +L+WVWF+P+ LEK L++QG  GN YR+L GD+K++  M+ +A SKP+  S + 
Sbjct  16    FTYVCKILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRLMSKEASSKPLDFSHDF  75

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
               R++P +   + KYG++C+VW GP P +L+ +PE ++EV++K+  +QK    P  R ++
Sbjct  76    VHRIMPIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKSNVFQKPPGRPFIRLMS  135

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
             +G+   E DKWAKHRR+INPAF+  KL+                             M P
Sbjct  136   KGLVTLETDKWAKHRRLINPAFHVHKLEH----------------------------MVP  167

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
             +F LSC EMLSKW+ IV  +G CE DVWP LQ LT DVISRTAFGSSY EG++IFELQ+E
Sbjct  168   SFYLSCDEMLSKWDKIVGNEGCCEVDVWPYLQTLTSDVISRTAFGSSYLEGRKIFELQRE  227

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                H +E +R VY+PG+RF+PTK NRR+  I KEV+SS+ GII+ R KAM+ GE + +DL
Sbjct  228   LAQHVMEGNRSVYIPGYRFLPTKVNRRVKEITKEVRSSMLGIINTRSKAMEAGEASKEDL  287

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             LGILLESN +EI Q G K  GMS+++VIEECK+FYFAG ETT+ +LVWTMILLS+ +DWQ
Sbjct  288   LGILLESNSKEIEQHGSKH-GMSMDEVIEECKLFYFAGXETTASLLVWTMILLSKHEDWQ  346

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
             +RAR+EVLQVF   E D++ LN+LK+L MIL+E LRLYPP   + R T  E +LG + LP
Sbjct  347   SRARDEVLQVFKRGESDYQELNNLKILGMILHEVLRLYPPGLVLLRFTPNECRLGNVNLP  406

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK--GKQVFFPFGGGPRICVGQ  1658
              G  LMLP +L+H D +IWG+DA+EF+P+RFR+G+ KA +  G+  +FPFG GPR C+ Q
Sbjct  407   AGVQLMLPLILLHHDPKIWGDDAEEFRPERFRDGVPKAAQGAGQLAYFPFGWGPRXCIAQ  466

Query  1659  NFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             NFA++EAKMAMAMILQR+SF+LSPSY HAPY ++T QPQHGA LI+ KL
Sbjct  467   NFAMLEAKMAMAMILQRYSFQLSPSYTHAPYKVITLQPQHGAHLILTKL  515



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/527 (54%), Positives = 378/527 (72%), Gaps = 29/527 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
             A AW VL+WVW +PKKLEK L+QQGL GN YR+ SGD+KE++ M  +A+SKPM  S + A
Sbjct  34    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTA  93

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV+P+  Q V+ YGK+ ++W+GP P+V I +PE +K +  K+  + K   NPL + +  
Sbjct  94    PRVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLT  153

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ANY  +KWAKHR+IINPAF+SEKLK                             M PA
Sbjct  154   GLANYGGEKWAKHRKIINPAFHSEKLKR----------------------------MLPA  185

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
                SC EM+ +WE +VS + S E DVWP LQ +T DVISRT+FGSSY+EG+ IF+L K Q
Sbjct  186   IYQSCSEMIEEWESLVSKESSYELDVWPYLQNMTADVISRTSFGSSYKEGREIFQLLKLQ  245

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 ++  + VY+PGWRF+PTK N+R+  ++KE++  + GII+KR +A++ GE   DDLL
Sbjct  246   IELTMKTKQSVYIPGWRFLPTKMNKRLKGVDKEIRELLMGIINKREEAIKAGEAAKDDLL  305

Query  1128  GILLESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G+LLESN +EI++ G K E GMSI+D++ ECK+FYFAGQETTS +LVWTM+LLS  Q+WQ
Sbjct  306   GLLLESNNKEIKEHGNKKEVGMSIQDILGECKLFYFAGQETTSTLLVWTMVLLSENQNWQ  365

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG ++PD +GLN LKV+T IL E+LRLYP I  + R   ++T+  E  LP
Sbjct  366   DRAREEVLQVFGGEKPDVDGLNHLKVVTTILLEALRLYPSIVTLSRMIHKKTQFTEFSLP  425

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LPT+L+H D E+WG+DA +FKP RF EG+ KATK K  +FPFGGG RIC+GQNF
Sbjct  426   AGVEISLPTVLIHHDKELWGDDATQFKPMRFAEGVSKATKNKLTYFPFGGGARICIGQNF  485

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAK+A+A+ILQ F+F+LSPSYAHAP  + T QPQ GA +++HKL
Sbjct  486   AMMEAKLAVALILQHFTFKLSPSYAHAPSGITTLQPQFGAHIVLHKL  532



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/542 (55%), Positives = 384/542 (71%), Gaps = 30/542 (6%)
 Frame = +3

Query  183   VIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMT  362
             VI TLL   + VG+L   W +LDWVW KPK+LE+ L++QGL+GN YR LSGD+KE + M+
Sbjct  6     VIGTLLSFLV-VGILIGGWRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKESSDMS  64

Query  363   TDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQ  542
               A SKPM LSD+IA  V PF  Q V  YGK+ +VW+GPRP+V I +PE I+E+  K   
Sbjct  65    KQARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFTKFND  124

Query  543   YQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASL  722
             +QK R+ P+G  +  G+AN + ++WAKHR IINPAF+ +KLK                  
Sbjct  125   FQKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQDKLKN-----------------  167

Query  723   EGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGS  902
                        M PAF  SC EM+SKWE +V  +GS E DVWP L  LT DVISR AFGS
Sbjct  168   -----------MLPAFYQSCIEMISKWEKMVFVEGSSELDVWPYLINLTRDVISRAAFGS  216

Query  903   SYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKR  1082
             SYEEG+RIF+L  +Q    ++V + VY+PG  F+PTK NR++  I K++K  ++ +I KR
Sbjct  217   SYEEGRRIFQLLDDQINLTMQVIQSVYIPGSWFLPTKTNRKLKVIVKDIKDLLKEMIKKR  276

Query  1083  MKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVM  1259
              KA++ GE + DDLLGIL+ESN++EI++ G  K  GMSIEDVIE+CK+FYFAGQETTS++
Sbjct  277   EKAIKAGEASKDDLLGILVESNIKEIQEHGDHKNMGMSIEDVIEDCKLFYFAGQETTSIL  336

Query  1260  LVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMD  1439
             LVWTMILL+R   WQ +AR EV QVFGD +PD  G+N LKV+TMILYE LRLYP    + 
Sbjct  337   LVWTMILLARHPHWQTKARAEVSQVFGDSKPDSNGMNRLKVVTMILYEVLRLYPAAIALT  396

Query  1440  RRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVF  1619
             R   +ETKLG+++LP G  + LP LL+H D E+WG+DA EF PDRF EG+ K TK + ++
Sbjct  397   RSVPKETKLGKMLLPAGVEISLPVLLIHHDQELWGKDAHEFNPDRFSEGVSKPTKSQVIY  456

Query  1620  FPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIH  1799
             FPFG GPR+C+G NFAL+EAKMA+AMIL++F  E+SPSYAH+P   +T +PQHGA LI+H
Sbjct  457   FPFGWGPRMCIGMNFALMEAKMALAMILRQFWLEISPSYAHSPCIFLTLRPQHGAHLILH  516

Query  1800  KL  1805
             KL
Sbjct  517   KL  518



>ref|XP_006297414.1| hypothetical protein CARUB_v10013438mg [Capsella rubella]
 gb|EOA30312.1| hypothetical protein CARUB_v10013438mg [Capsella rubella]
Length=532

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/526 (55%), Positives = 372/526 (71%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK +E +L++QGL G PY  L GD+K    M  +A SKP  L+D+   
Sbjct  40    WVWRTLQWVWFKPKMIEGYLRRQGLAGTPYTPLVGDLKRHFAMLAEAKSKPFKLTDDTTT  99

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+P+ +Q +  +G++ + W+G  P + I DPE IKEV NK Y +QKA T PLGR +A G
Sbjct  100   RVVPYPLQMLKTHGRTFFTWLGHIPTITIMDPEQIKEVFNKAYDFQKAHTFPLGRLLAAG  159

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ DKWAKHRRIINPAF  EK+K                             M PAF
Sbjct  160   LVSYDGDKWAKHRRIINPAFNLEKIKN----------------------------MVPAF  191

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC +++ +W+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  192   HQSCSDIVGEWDKLVSDKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAEL  251

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+  R+ ++PG+ ++PTK NRRM+A  +E+K  +RGII+KR++  + GE   DDLL
Sbjct  252   AQLIIQAFRKAFIPGYSYLPTKGNRRMSAAAREIKVILRGIINKRLRGREAGEAPTDDLL  311

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESNL + +       GMS ++++EECK+FYFAGQETTSV+LVWTMILLS+ QDWQA
Sbjct  312   GILLESNLGQTKGN-----GMSTDELMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQA  366

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
              AR+EV +VFGD+EPD EGLN LKV+ MILYE LRLYPP+  + R   +E KLGE+ +P 
Sbjct  367   HARDEVKKVFGDKEPDAEGLNQLKVMNMILYEVLRLYPPVIQLTRAIQKEMKLGELTIPS  426

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP LL+  D+E+WG DA EFKPDRF++G+ KATKG+  FF F  GPR+C+GQNFA
Sbjct  427   GVQITLPILLVQHDTELWGSDAGEFKPDRFKDGVSKATKGQVSFFSFAWGPRVCIGQNFA  486

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+EAKMAMA+IL++FSFELSPSY HAP S++T  PQ GAPLI+HKL
Sbjct  487   LLEAKMAMALILRKFSFELSPSYVHAPDSVITIHPQFGAPLILHKL  532



>gb|AGX93060.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Tabernaemontana 
elegans]
Length=519

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/547 (53%), Positives = 390/547 (71%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ + L+ V   +GL  Y  + VLDWVWFKPKKLEK L++QG KGNPYR+  GD  E  
Sbjct  1     MEMNFKLVAVLGFIGLALYWVYRVLDWVWFKPKKLEKCLREQGFKGNPYRLFLGDQYESG  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K+  +A+SKP+ + +++  R+IP  ++ V  +GK+ ++W+G  P+V + DPELIKEVL K
Sbjct  61    KLIREAMSKPIGVEEDVKKRIIPHILKTVETHGKNSFMWVGRIPRVHVTDPELIKEVLTK  120

Query  534   NYQYQKARTN--PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              Y++QK   +  P+ + +  G+ + E + WAK R+IIN AF+ EKLK             
Sbjct  121   YYKFQKNHHDLDPITKFLLTGIGSLEGEPWAKRRKIINAAFHFEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC +++SKW+  V   GS E DVW D++ LT DVISR
Sbjct  168   ---------------LMLPAFYLSCRDLVSKWDKKVPEGGSAEVDVWHDIETLTGDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             T FGS+YEEG+RIFEL KE     I+V R VY+PG RF+PTKRN +M AI+KEV+  I+ 
Sbjct  213   TLFGSNYEEGRRIFELMKELTALTIDVIRSVYIPGQRFLPTKRNNKMRAIDKEVRVRIKE  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQE  1244
             IID +MK ++ G+T  DD LGILLE NL EIR+QG  K  GM+IE +I ECK+FYFAGQ+
Sbjct  273   IIDNKMKILKAGKTAGDDFLGILLECNLNEIREQGNNKNAGMTIEQIIGECKLFYFAGQD  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS +LVWTM+LLSRF +WQ RAREEVLQVFG++ PD++G++ LK +TMILYE LR+Y P
Sbjct  333   TTSTLLVWTMVLLSRFPEWQNRAREEVLQVFGNKTPDYDGISHLKTVTMILYEVLRIYTP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +  + +   E+T+LG+  +P G  LM+P +L+H D +IWGED  EFKP+RF EG++KATK
Sbjct  393   VAELTKVAHEDTQLGKYFIPAGVQLMMPQMLLHHDPQIWGEDVMEFKPERFSEGVLKATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  +FPF  GPR+C+GQNFAL+EAKMAMA+IL RFSFELSPSY HAP++++T QPQ+GA
Sbjct  453   SQGSYFPFSLGPRMCIGQNFALLEAKMAMALILCRFSFELSPSYVHAPFTLITMQPQYGA  512

Query  1785  PLIIHKL  1805
              LI+HKL
Sbjct  513   HLILHKL  519



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/535 (53%), Positives = 376/535 (70%), Gaps = 29/535 (5%)
 Frame = +3

Query  204   VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
               + V L+ +AW VL+W+W +PKKLEK+L+QQGLKGN YR+L GD+KE + M   A ++P
Sbjct  11    TIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESSIMLKKAKARP  70

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             ++L D+ A RV PF  +    YGK+ ++W GP P+V I +P+ IKE+  K   + K  +N
Sbjct  71    LSLDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFTKINDFPKINSN  130

Query  564   PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGR  743
             PL R +  G+ NYE ++WAKHR+IINPAF  EKLK                         
Sbjct  131   PLARILGVGLVNYEGEQWAKHRKIINPAFRQEKLK-------------------------  165

Query  744   TSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKR  923
                LM PAF  S  +++++WE ++S +GSCE DVWP L  LT DVISRTAFGS+YEEG+R
Sbjct  166   ---LMLPAFCQSSSDIITEWEKLMSTEGSCELDVWPYLANLTGDVISRTAFGSNYEEGRR  222

Query  924   IFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGG  1103
             IF+LQ E     I+V R VY+PGWRF+PTKRN+RM  ++KE+ +++ GII  R KAM+ G
Sbjct  223   IFQLQSELAELTIQVIRSVYIPGWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAG  282

Query  1104  ETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMIL  1280
             E  NDDLLGIL+++N +EI + G  K  GMS  DV+EECK+FYFAGQETTSV+L WTM+L
Sbjct  283   EAANDDLLGILMDTNFREIEEHGNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVL  342

Query  1281  LSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEET  1460
             LS+ QDWQ RAR+EVLQVFG+ +PD++GLN LK++ MI  E LRLYPP   + R   +ET
Sbjct  343   LSKHQDWQERARQEVLQVFGNNKPDYDGLNHLKIVQMIFNEVLRLYPPAVMLARAVNKET  402

Query  1461  KLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGP  1640
             KLG ++L  G  + LP +++H D E+WG+DA EFKP+RF EGI K  + +  +FPF  GP
Sbjct  403   KLGNLILLAGVQISLPVIMVHHDPELWGDDAIEFKPERFSEGISKVNRNQVSYFPFAWGP  462

Query  1641  RICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             RIC+G NFALVEAK+A+AMILQ FSFELSPSY HAP +++T  P+ G  LI+ KL
Sbjct  463   RICIGLNFALVEAKIALAMILQNFSFELSPSYVHAPTAVLTLHPEFGTHLILRKL  517



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/528 (54%), Positives = 384/528 (73%), Gaps = 30/528 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
             ++AW VL  +W++P KLEK  ++QG++G P   L G++K+  +M  +ALSKPM LS +IA
Sbjct  18    SWAWSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMNLSHDIA  77

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-NKNYQYQKARTNPLGRKVA  584
             PRV+PF  Q + KYG     W G  P++ + DP+LIK++L NK  Q++K ++NPL R   
Sbjct  78    PRVVPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFV  137

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ ++E +KWAKHRRIINPAF+ EKLK                             M P
Sbjct  138   DGLVSHEGEKWAKHRRIINPAFHIEKLKR----------------------------MLP  169

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
             AF  SC EM++KWE +V+ +GSCE D+WP+LQ LT DVISRTAFGSSY+EG+RIF+LQ E
Sbjct  170   AFYTSCFEMITKWEKLVALEGSCELDIWPELQNLTGDVISRTAFGSSYDEGRRIFQLQNE  229

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
             Q    ++V+  +Y+PG+R +PTKRN RM  I++EV+  +R I++KR KA++ GE + DDL
Sbjct  230   QAKIVMDVALSIYIPGYRLLPTKRNNRMKEIDREVRGLLRRIVNKREKAIKLGEASKDDL  289

Query  1125  LGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LG+LLESN +EIR+ G  K  GM++++VIEECK+FYFAGQETTS +LVWTM++LS   +W
Sbjct  290   LGLLLESNFKEIREHGNEKNIGMNVDEVIEECKLFYFAGQETTSNLLVWTMVVLSMHPEW  349

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             Q RAREEVLQ FG  +PDF+G+N LKV++MILYE LRLYPP   + R+T ++ KLG++ L
Sbjct  350   QMRAREEVLQSFGKDKPDFDGINHLKVVSMILYEVLRLYPPAVALTRQTYKKVKLGDVYL  409

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P    L LPT+L+H   E+WGEDA+EFKP+RF  G+ KA   +  F PFG GPRIC+GQN
Sbjct  410   PPRVELSLPTILIHHSRELWGEDAQEFKPERFLGGVSKAANNQVSFIPFGWGPRICIGQN  469

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FA++EAKMA+A+ILQ FSFELSPSYAHAP +++T QPQ+GA +I+HKL
Sbjct  470   FAMIEAKMALALILQHFSFELSPSYAHAPCTIITLQPQYGAQIILHKL  517



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/541 (54%), Positives = 389/541 (72%), Gaps = 35/541 (6%)
 Frame = +3

Query  189   YTLLGVCISVGLLAYA-WGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             Y  L +  ++ L+ +  W +L+W+W +P+ LEK L++ G +GN YR+L GDM E+ KM  
Sbjct  3     YISLTIAFAIILVIFLRWRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVKMDE  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A SKP+  S +I PR++PF  + +  YGK+ ++W+GP P +LI +PE I+E+L+K+  +
Sbjct  63    EAKSKPIKFSHDIVPRLMPFIHKTIIDYGKNSFIWLGPNPAMLIMEPEHIREILSKSNIF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK     L + +A G+ +YE DKWAKHRRIINPAF+ +KLK                   
Sbjct  123   QKP-PPALTKLLAEGILSYEADKWAKHRRIINPAFHLDKLKH------------------  163

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M P+F L+ CEMLSKWE IVS +GS E DVWP LQ LT D ISRTAFGSS
Sbjct  164   ----------MVPSFHLTTCEMLSKWEKIVSTEGS-EVDVWPYLQTLTSDAISRTAFGSS  212

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG++I ELQ+E     ++ +   Y+   RF+PTK  RRMN + +EV+S +  II+KRM
Sbjct  213   YEEGRKIHELQQELAKIIVKETEASYI---RFLPTKEKRRMNRLHQEVRSLVLRIINKRM  269

Query  1086  KAMQGGET-NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
               ++ GET N+DDLLGILLESNL+EI++ G K+FGMSI++VIEECK+FY AGQETTS +L
Sbjct  270   NEIEAGETSNSDDLLGILLESNLKEIQEHGNKKFGMSIDEVIEECKLFYLAGQETTSALL  329

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VW+MILLS+  DWQARAREEVLQVFG+  PD++ L+ LKV+TMI+ E LRLYPPI  M R
Sbjct  330   VWSMILLSKHSDWQARAREEVLQVFGNNIPDYDKLSQLKVVTMIMQEVLRLYPPIFLMGR  389

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                +ETKLG + +P G  L+LPT+L+H D EIWGED KEF P+RF EG+ +ATKGK  +F
Sbjct  390   EVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVKEFNPERFSEGVNRATKGKFAYF  449

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PF  GPR C+GQNFA++EAKMA+AMILQ+F+FE+SPSYAH PYS+ T  PQ+GA LI++K
Sbjct  450   PFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAHVPYSVFTLLPQYGAQLILNK  509

Query  1803  L  1805
             L
Sbjct  510   L  510



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/528 (55%), Positives = 370/528 (70%), Gaps = 34/528 (6%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L + W  L WVWFKPK LE +L++QG+ G PY  L GDM+    M+ +A SKP+ L+D+I
Sbjct  18    LLWIWRTLKWVWFKPKMLESYLRRQGIAGTPYTPLVGDMRRDNSMSKEARSKPIKLTDDI  77

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
               RV+PF    +  YG++ + W G  P + I DPE IKEV NK Y + K  T PL   + 
Sbjct  78    ISRVLPFPSHMLKTYGRTFFTWRGTIPSITITDPEQIKEVFNKVYDFPKPHTFPLTNLII  137

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ +Y+ DKWAKHRRIINPAF+ EK+K                             M P
Sbjct  138   SGLFSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVP  169

Query  765   AFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
              F  SC E++ KW+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ 
Sbjct  170   VFHQSCNEVVDKWDKMVSDKGSSCEVDVWPGLMSITEDVISRTAFGSSYKEGQRIFELQT  229

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             E     I+  R+ Y+PG+R++PTK NRR+ A  KE    +RG+++KR++A + GE  N+D
Sbjct  230   ELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKETHDILRGLVNKRLRAREAGEAPNED  289

Query  1122  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LLGILLESNL +      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMILLS+ QDW
Sbjct  290   LLGILLESNLGQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDW  344

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEV QVFGD+EPD EGLN LK++TMI+ E +RLYPP+T + R   +E KLG++ L
Sbjct  345   QARAREEVKQVFGDKEPDTEGLNHLKIMTMIINEVIRLYPPVTLLTRTIHKEMKLGDLTL  404

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LP +L+  D+++WG DA EFKP+RF +G+ KATK +  FFPF  GPRIC+GQN
Sbjct  405   PGGVQINLPIMLVQRDTQLWGNDAAEFKPERFEDGVSKATKSQVSFFPFAWGPRICIGQN  464

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FAL+EAKMAMA+ILQRFSFELSP+Y HAPY++ T  PQ+GA LI+HKL
Sbjct  465   FALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/538 (55%), Positives = 380/538 (71%), Gaps = 37/538 (7%)
 Frame = +3

Query  204   VCISVGLLA---YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             V +SV ++A   + W  L+WVWFKPK LE +L++QGL G+PY  L GD++    M+ +A 
Sbjct  8     VTVSVAIVAVLWWVWRTLNWVWFKPKMLESYLRRQGLSGSPYTPLVGDVRRDYTMSMEAR  67

Query  375   SKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             SKP+  +D+I PRV+PF    +  YG++ + W GP P + I DPE IKEV NK Y +QK 
Sbjct  68    SKPIKTTDDIIPRVVPFPSHMLKTYGRTFFTWRGPIPTITITDPEQIKEVFNKIYDFQKP  127

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
              + PLGR +A G+ +Y+ DKWAKHRRIINPAF+ EK+K                      
Sbjct  128   HSFPLGRLIATGLFSYDGDKWAKHRRIINPAFHLEKIKN---------------------  166

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYE  911
                    M PAF  SC E++ KW+ +VS KG SCE DVW  L  +T DVISRTAFGSSY+
Sbjct  167   -------MVPAFHQSCSEVVGKWDKLVSDKGSSCEVDVWLGLVSMTADVISRTAFGSSYK  219

Query  912   EGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKA  1091
             EG+RIFELQ E  +   +  R++++PG+R+ PTK NRRM A  +EV+  +RGI++KR++A
Sbjct  220   EGQRIFELQAELALLLTQAFRRIFIPGYRYYPTKGNRRMKAAAREVQDILRGIVNKRLRA  279

Query  1092  MQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWT  1271
              + GE  ++DLLG LLESNL +      K  GMSI DVIEECK+FYFAGQETTSV+LVWT
Sbjct  280   RESGEAPSEDLLGTLLESNLGQT-----KGTGMSIADVIEECKLFYFAGQETTSVLLVWT  334

Query  1272  MILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTV  1451
             M++LS+ QDWQA+AREEV QVFGD+EPD EGLN LK++T ILYE LRLYPP+  + R   
Sbjct  335   MVMLSQHQDWQAKAREEVKQVFGDKEPDTEGLNHLKIMTTILYEVLRLYPPVVQLTRAIH  394

Query  1452  EETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFG  1631
             +E KLG++ LP G  + LP +L+  D+ +WG DA EFKPDRF++G+ KATK +  F PF 
Sbjct  395   KEMKLGDLTLPGGTHISLPVMLVQRDTNLWGNDAGEFKPDRFKDGVSKATKSQVSFIPFA  454

Query  1632  GGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              GPRIC+GQNFA++EAKMAMA+ILQRFSFELSPSY HAPY++ T  PQ GA LI+HKL
Sbjct  455   WGPRICIGQNFAMLEAKMAMALILQRFSFELSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/545 (54%), Positives = 383/545 (70%), Gaps = 31/545 (6%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             E+  I  L  V +S+   + AW VL+WVW KPKKLEK L+QQGL GN YR+L GD+KE  
Sbjct  27    ELSFIIALSIVLLSIAS-SCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKESF  85

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             ++  +A SKPM LSD+ APRV+PF  Q + K+GK+ + W G  P+V I +P+ + E+L K
Sbjct  86    RVMKEACSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILTK  145

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
                +++  T P+ + ++ G+AN E +KW K R+IINPAF+ EKLK               
Sbjct  146   YDDFRRPHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKN--------------  191

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PA   SC +M++KWE +VS +GSCE D+WP LQ L+ DVISRTA
Sbjct  192   --------------MLPAIYQSCTDMITKWEIMVSKEGSCELDIWPFLQNLSGDVISRTA  237

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSSYEEG+ IFELQKEQ    I+     Y+PG+RF+PTK NRRM AI KEV+++++ II
Sbjct  238   FGSSYEEGRTIFELQKEQTELLIKALFSAYIPGFRFLPTKLNRRMKAISKEVEATMKRII  297

Query  1074  DKRMKAMQGG-ETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQET  1247
               +++A++ G E   +DLLGILLESN +EIRQ GG K  GMSIE+VI ECK+FY AG ET
Sbjct  298   SNKVEAIRAGDEDAKNDLLGILLESNWKEIRQYGGNKNLGMSIEEVIGECKLFYLAGAET  357

Query  1248  TSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPI  1427
             TS++L WTMILL R+ +WQARAR+EVLQVFG  +PDF+GL  LKV+TMI+YE LRLYPP+
Sbjct  358   TSILLTWTMILLCRYPNWQARARQEVLQVFGSNKPDFDGLIHLKVVTMIIYEVLRLYPPV  417

Query  1428  TGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKG  1607
               M R   +ET+LG ++LP G  L LP  L+  D  +WGEDA EF P RF EGI KATKG
Sbjct  418   PMMTRAVQKETQLGNLLLPSGVQLSLPIFLIQRDQTLWGEDANEFNPQRFSEGISKATKG  477

Query  1608  KQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAP  1787
             +  + PFG GPRIC+GQNF L+EAKMA++++L  F+FELSPSY H P +++TTQPQ+GA 
Sbjct  478   QVSYIPFGWGPRICIGQNFGLMEAKMALSLMLHSFTFELSPSYIHGPMTIITTQPQYGAH  537

Query  1788  LIIHK  1802
             +I+HK
Sbjct  538   IILHK  542



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/526 (55%), Positives = 364/526 (69%), Gaps = 30/526 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W  L+W+W  PKKLEK L++QG  GN YR+ SGD+K+L  M+ +A SKPM  S +IAPR
Sbjct  24    GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  83

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             VIP     + KYGK+ +VW+GP P+V I DPE +K  L+    +QK   NPL + +  G+
Sbjct  84    VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  143

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
              N+E +KW KHR+I+N AF+ EKLK+                            M P   
Sbjct  144   INHEGEKWVKHRKIVNHAFHFEKLKD----------------------------MVPTMF  175

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC EM++ WE +VS  GSCE DV P LQ L  DVISRTAFGS+YEEGK IF   KE   
Sbjct  176   ESCNEMINTWEKMVSKDGSCELDVMPYLQNLAADVISRTAFGSTYEEGKVIFNHFKELIC  235

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLG  1130
               I+ S  VY+PG RF+PTK N RM  I KE+K+ +  +IDKR + M+ GET  +DDLLG
Sbjct  236   LTIQASNIVYIPGRRFLPTKSNNRMKKITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLG  295

Query  1131  ILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  1310
             ILLESN  EI++ G    GMSI D+IEECK+FYFAGQETT+V+LVWTMILL  +  WQ R
Sbjct  296   ILLESNFNEIKEHGNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDR  355

Query  1311  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE-ETKLGEIVLPR  1487
             AR EVLQVFG+ +PDF+GLN LK++TMIL E LRLY P + + R+ V+ ETKLG    P 
Sbjct  356   ARAEVLQVFGNNKPDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPS  415

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G +L  P +L+H+D EIWGEDA EF P+RF EG+ KATK +  FFPFG GPRIC+GQNFA
Sbjct  416   GVMLSFPVILIHLDKEIWGEDANEFNPERFAEGVSKATKNQTGFFPFGWGPRICIGQNFA  475

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             ++EAK+A+++ILQ FSFELSPSY HAP S++TTQPQHGA +I+HKL
Sbjct  476   MIEAKIALSIILQHFSFELSPSYTHAPISILTTQPQHGAHIILHKL  521



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/527 (54%), Positives = 378/527 (72%), Gaps = 29/527 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
             A AW VL+WVW +PKKLEK L+QQGL GN YR+ SGD+KE++ M  +A+SKPM LS + A
Sbjct  21    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTA  80

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV+P+  Q V+ YGK+ ++W+GP P+V I +PE +K +  K+  + K   +PL + +  
Sbjct  81    PRVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLT  140

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ANY  +KWAKHR+II PAF+SEKLK                             M PA
Sbjct  141   GLANYGGEKWAKHRKIIKPAFHSEKLKR----------------------------MLPA  172

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
                SC EM+ +WE +VS + S E DVWP LQ +T DVISRT+FGSSY+EG+ IF+L K Q
Sbjct  173   IYQSCSEMIEEWESLVSKESSYELDVWPYLQNMTADVISRTSFGSSYKEGREIFQLLKLQ  232

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 +++   VY+PGWRF+PTK N+R+  ++KE++    GII+KR +A++ GE   DDLL
Sbjct  233   IELTVKMKHSVYIPGWRFLPTKTNKRLKEVDKEIRELFMGIINKREEAIKAGEAAKDDLL  292

Query  1128  GILLESNLQEIRQQGGKE-FGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G+LLESN +EI++ G K+  GMSI+DV+ ECK+FYFAGQETTS++LVWTM+LLS  Q+WQ
Sbjct  293   GLLLESNNKEIKEHGNKKKVGMSIQDVLGECKLFYFAGQETTSILLVWTMVLLSENQNWQ  352

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG  +PDF+GLN LKV+TMIL E+LRLYP    + R   ++T+  E  LP
Sbjct  353   DRAREEVLQVFGGNKPDFDGLNHLKVVTMILLEALRLYPSSFTLSRMIHKKTQFAEFSLP  412

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LPT+L+H D E+WG+DA +FKP+RF EG+ KATK K  +FPFGGG RIC+GQNF
Sbjct  413   AGVGISLPTILIHHDKELWGDDATQFKPERFAEGVSKATKNKLTYFPFGGGARICIGQNF  472

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAK+A+A+ILQ F+F+LSPSYAHAP  +   QPQ GA +++HKL
Sbjct  473   AMMEAKLAVALILQHFTFKLSPSYAHAPSGITLLQPQFGAHIVLHKL  519



>gb|AGX93058.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Amsonia hubrichtii]
Length=518

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/537 (54%), Positives = 384/537 (72%), Gaps = 34/537 (6%)
 Frame = +3

Query  204   VCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKP  383
             VC++   L + + +LDWVWF+PKKLEK L++QG KGNPYR+L GD  E  K+  +A+SKP
Sbjct  13    VCVA---LYWVYRLLDWVWFRPKKLEKCLREQGFKGNPYRLLLGDQYESGKLIREAMSKP  69

Query  384   MTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN  563
             + L +++  R+IP  ++ V  +GK+ ++W+G  P+V + DPELIKEVL K Y++QK   +
Sbjct  70    IGLEEDVKKRIIPHLLKTVETHGKNSFMWVGRIPRVQVTDPELIKEVLTKYYKFQKNHHD  129

Query  564   --PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQ  737
               P+ + +  G+ + E + WAK R+IIN AF+ EKLK                       
Sbjct  130   LDPITKLLLTGIGSLEGEPWAKRRKIINSAFHFEKLK-----------------------  166

Query  738   GRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEG  917
                  LM PAF LSC +++SKW+  V   GS E DVW D++ LT DVISRT FGS+YEEG
Sbjct  167   -----LMLPAFYLSCRDLVSKWDKKVPEGGSAEVDVWHDIETLTGDVISRTLFGSNYEEG  221

Query  918   KRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQ  1097
             +RIFEL KE     I+V R VY+PG RF+PTKRN RM  I+KEV+  I  II+ +MK M+
Sbjct  222   RRIFELMKELTALTIDVIRSVYIPGQRFLPTKRNNRMRTIDKEVRVRITEIINNKMKIMK  281

Query  1098  GGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTM  1274
              GE   DD LGILLE N  EIR+QG  K  GM+IE +I ECK+FYFAGQ+TTS +LVWTM
Sbjct  282   TGEAAGDDFLGILLECNQNEIREQGNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTM  341

Query  1275  ILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE  1454
             +LLSRF +WQ RAREEVLQVFGD+ PD++G++ LK++TMILYE LRLY P+  + +   E
Sbjct  342   VLLSRFPEWQTRAREEVLQVFGDKTPDYDGISHLKIVTMILYEVLRLYTPVAELTKVAHE  401

Query  1455  ETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGG  1634
             +T+LG+  +P G  LM+P +L+H D +IWGED  EFKP+RF EG++KATK +  +FPF  
Sbjct  402   DTQLGKYFIPAGVQLMMPQMLLHHDPQIWGEDVMEFKPERFSEGVLKATKSQGSYFPFSL  461

Query  1635  GPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GPR+C+GQNFAL+EAKMAMA+IL+RFSFELSPSY HAP++++T QPQ+GA LI+HKL
Sbjct  462   GPRMCIGQNFALLEAKMAMALILRRFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  518



>ref|XP_009394812.1| PREDICTED: cytochrome P450 72A15-like [Musa acuminata subsp. 
malaccensis]
Length=518

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/531 (53%), Positives = 375/531 (71%), Gaps = 29/531 (5%)
 Frame = +3

Query  216   VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLS  395
             V LLA A   L+W W++P++ E+ L+ QGL+G PYR + GD+KE  ++  +ALSKP+ LS
Sbjct  16    VLLLACAVWTLNWAWWRPRRQERLLRAQGLRGTPYRFIRGDVKEDRRLLAEALSKPIPLS  75

Query  396   DNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-NKNYQYQKARTNPLG  572
              +I PRV PF    +N++GK+ + W GP P+V+I DPEL++E+L NK   +++A  +PLG
Sbjct  76    HHIIPRVAPFLRAAMNEFGKTFFTWFGPVPRVMIMDPELVREILSNKFGHFERASLSPLG  135

Query  573   RKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSV  752
             R VA G+ +Y   KWAKHRRI+NPAF+ EKLK                            
Sbjct  136   RAVASGLISYHGGKWAKHRRILNPAFHVEKLKR---------------------------  168

Query  753   LMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFE  932
              M PAF  SC +++ +WE +V  +GSCE DVWP+ Q  T DVISR AFGSSYE+G+RIF+
Sbjct  169   -MLPAFSASCGDLVGRWENLVGQEGSCELDVWPEFQSFTGDVISRAAFGSSYEKGRRIFQ  227

Query  933   LQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETN  1112
             LQ E         ++ Y+PG+RF+PT +N R+NAI +EV+S +RGII +R +AM+ GE  
Sbjct  228   LQVELTQVVFHAIQRAYIPGYRFLPTPQNNRINAINREVRSLLRGIIKERQEAMRTGEAT  287

Query  1113  NDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRF  1292
             N+DLLG+L+ESNLQ  ++ G K  GM+ ++V+EECK+FYFAGQET S +L WTM++LS  
Sbjct  288   NNDLLGLLMESNLQHFQEHGNKNAGMTSDEVVEECKLFYFAGQETVSTLLTWTMVVLSMH  347

Query  1293  QDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGE  1472
              +WQ RAREEVLQ FG  +PDF+GL+ LK++TMILYE LRLYPP   + R   +  KLG 
Sbjct  348   PEWQVRAREEVLQAFGKNKPDFDGLSHLKIVTMILYEVLRLYPPAILIQRIAYKTMKLGN  407

Query  1473  IVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICV  1652
             IV P G LLM+P + +H D ++WG+DA EFKP+RF +GI KA+K +  FFPF GGPR+C+
Sbjct  408   IVYPPGVLLMVPIVFIHHDPDLWGKDASEFKPERFAQGIAKASKDQVAFFPFSGGPRVCI  467

Query  1653  GQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             GQNFAL+EAK A+ MILQ+FSFELSP+Y HAP + VT QPQHGA L +HKL
Sbjct  468   GQNFALLEAKTALCMILQQFSFELSPAYTHAPRTFVTLQPQHGAQLRLHKL  518



>ref|XP_009135394.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/545 (54%), Positives = 386/545 (71%), Gaps = 35/545 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLA-YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+   L+ V +++ L++ + W  L  VWF+PK LE +L++QGL G PY  L GD+K  +
Sbjct  1     MEISVALVTVSVAIVLVSSWTWRTLKLVWFRPKMLESYLRRQGLSGTPYTPLVGDLKRNS  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              M  DA SKP+ L+D+I+PRV+PF  + +  +G++ + W+G  P   I DPE IKEV NK
Sbjct  61    SMMMDARSKPIKLTDDISPRVVPFPFEMLKSHGRTFFTWIGTTPTTTIMDPEQIKEVFNK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y +QK RT+PL   +A+G+ +Y+ +KWAKHRRIINPAF+ EK+K               
Sbjct  121   VYDFQKPRTSPLDSVIAKGLTSYDGEKWAKHRRIINPAFHLEKIKN--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRT  890
                           M PAF  SC E++ KWE +V+ KG SCE DVWP +  +  DVISRT
Sbjct  167   --------------MVPAFHQSCSEVIGKWEKLVTDKGSSCEVDVWPGIVNMNADVISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSSY+EG+RIFELQ E     I+   + Y+PG+ ++PTK NRR+ A  +E++  +RGI
Sbjct  213   AFGSSYKEGQRIFELQAELAQLIIQTFVKSYIPGYIYLPTKDNRRIKAGSREIQVILRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             I+KR++A + GE  +DDLLGILLESN     Q  G E  MSIEDV+EECK+FYFAGQETT
Sbjct  273   INKRLRAREAGEAPSDDLLGILLESNSG---QAKGNE--MSIEDVMEECKLFYFAGQETT  327

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVW MI+LS+ QDWQARAREEV QVFGD+EP  EGLN LKV+TMILYE LRLYPP  
Sbjct  328   SVLLVWIMIMLSQHQDWQARAREEVKQVFGDKEPATEGLNQLKVMTMILYEVLRLYPPAV  387

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGK  1610
              + R   +E KLG++ LP G  + LP LL+H D+++WG DA EFKP+RF++G+ KATKG+
Sbjct  388   QLTRAIHKEMKLGDLTLPGGVQINLPILLVHRDTQLWGNDAAEFKPERFKDGVSKATKGQ  447

Query  1611  QVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPL  1790
               FFPF  GPRIC+GQNFAL+E KMA+A+IL++FSFELSPSY HAPY+++T  PQ GA L
Sbjct  448   VSFFPFAWGPRICIGQNFALMEIKMALALILKKFSFELSPSYVHAPYTVITMHPQFGAHL  507

Query  1791  IIHKL  1805
             I++K+
Sbjct  508   ILNKI  512



>emb|CDY28093.1| BnaC06g02740D [Brassica napus]
Length=512

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/538 (54%), Positives = 376/538 (70%), Gaps = 35/538 (7%)
 Frame = +3

Query  195   LLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDAL  374
             ++ + ISV LL + W  L WVWFKPK LE +L++QG+ G PY  L GDM+    M+ +A 
Sbjct  9     IVSLAISVVLL-WIWRTLKWVWFKPKMLESYLRRQGIAGTPYTPLVGDMRRDNSMSKEAR  67

Query  375   SKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKA  554
             SKP+ L+D+I  RV+PF    +  YG++ + W G  P + I DPE IKEV NK Y + K 
Sbjct  68    SKPIKLTDDIISRVLPFSSHMLKTYGRTFFSWRGTIPSITITDPEQIKEVFNKVYDFPKP  127

Query  555   RTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKS  734
              T PL   +  G+ +Y+ DKWAKHRRIINPAF+ EK+K                      
Sbjct  128   HTFPLTNLIISGLFSYDGDKWAKHRRIINPAFHLEKIKN---------------------  166

Query  735   QGRTSVLMQPAFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYE  911
                    M P F  SC E++ KW+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+
Sbjct  167   -------MVPVFHQSCNEVVDKWDKMVSDKGSSCEVDVWPGLMSITEDVISRTAFGSSYK  219

Query  912   EGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKA  1091
             EG+RIFELQ E     I+  R+ Y+PG+R++PTK NRR+ A  KE    +R +++KR++A
Sbjct  220   EGQRIFELQTELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKEAHDILRELVNKRLRA  279

Query  1092  MQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWT  1271
              + GE  N+DLLGILLESNL +      K  GMSIEDVIEECK+FYFAGQETTSV+LVWT
Sbjct  280   REAGEAPNEDLLGILLESNLGQ-----AKGNGMSIEDVIEECKLFYFAGQETTSVLLVWT  334

Query  1272  MILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTV  1451
             MILLS+ QDWQARAREEV QVFGD+EP+ EGLN LK++TMI+ E +RLYPP+T + R   
Sbjct  335   MILLSQHQDWQARAREEVKQVFGDKEPNTEGLNHLKMMTMIINEVIRLYPPVTQLSRTIH  394

Query  1452  EETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFG  1631
             +E KLG++ LP G  + LP +L+  ++++WG DA EFKP+RF +G+ KATK +  FFPF 
Sbjct  395   KEMKLGDLTLPGGVQINLPIMLVQRETQLWGNDAAEFKPERFEDGVSKATKNQVSFFPFA  454

Query  1632  GGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              GPRIC+GQNFAL+EAKM+MA+ILQRFSFELSP+Y HAPY++ T  PQ+GA LI+HKL
Sbjct  455   WGPRICIGQNFALLEAKMSMALILQRFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/527 (55%), Positives = 384/527 (73%), Gaps = 29/527 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
             A AW VL+WVW +PK LEK L+QQGL GN YR+ SGD++E + M  +A+SKPM LS + A
Sbjct  21    ACAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTA  80

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV+PF  Q V+ YGK+ ++W+GP P+V I +PE +K++  K+  + K   NPL + +A 
Sbjct  81    PRVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLAT  140

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ANYE DKWAKHRRI+NPAF+SEKLK                             M P+
Sbjct  141   GLANYEGDKWAKHRRIVNPAFHSEKLKR----------------------------MLPS  172

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+ +WE +VS   SCE DVWP LQ +T DVISRT+FGSSY+EG+ IF+L K Q
Sbjct  173   FYQSCSEMIEEWESLVSKDSSCELDVWPYLQNVTADVISRTSFGSSYKEGREIFQLLKVQ  232

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+  + VY+PGWRF+PTK N+ M  ++K+++  + GII+KR +A++ G+   DDLL
Sbjct  233   TELAIKTIQSVYIPGWRFLPTKMNKSMKGVDKKIRELLMGIINKREEAIKAGKATKDDLL  292

Query  1128  GILLESNLQEIRQQGGK-EFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G+LL+SN +EI++ G K + GMS +DV+EECK+FYFAGQETTSV+LVWTM+LLS  Q+WQ
Sbjct  293   GLLLDSNFKEIKEHGNKRKVGMSTQDVLEECKLFYFAGQETTSVLLVWTMVLLSENQNWQ  352

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG  +PDF+GLN LKV+TMIL E+LRLYPP+  + R   ++T+  E  LP
Sbjct  353   DRAREEVLQVFGGNKPDFDGLNHLKVVTMILLEALRLYPPVVMLTRMIHKKTQFVEFSLP  412

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + LPT+L+H D E+W +DA +FKP+RF +G+ KATK K ++FPFGGG RIC+GQNF
Sbjct  413   AGVEISLPTVLVHHDKELWCDDATQFKPERFSDGVSKATKNKLIYFPFGGGARICIGQNF  472

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++EAK+A+A+ILQ F+FELSPSYAHAP   +T QPQ GA +I+HKL
Sbjct  473   AMMEAKLALALILQHFTFELSPSYAHAPSRKLTLQPQFGAHIILHKL  519



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/546 (55%), Positives = 393/546 (72%), Gaps = 40/546 (7%)
 Frame = +3

Query  165   ASPEMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             AS +   + T+L V     L  +AW V++WVW +PK+LE+ L+QQGL G PY  L GD+K
Sbjct  3     ASIQSIALATVLAV-----LTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLK  57

Query  345   ELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEV  524
             E +++ T+A SKP+++SD+I PR++PF  Q    YGK  ++W+GP P+V I +PE +KE+
Sbjct  58    ENSRLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEI  117

Query  525   LNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
              +K   Y +  +NPL + +A G+A++E +KWA+HR+IINPAF+ EKLK            
Sbjct  118   FSKINDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLK------------  165

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                             LM PAF  SC EM+ +WE +VS   SCE D W DLQ LT +VIS
Sbjct  166   ----------------LMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVDLQNLTREVIS  209

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSS+EEGKRIFELQ EQ    +   + VY+PGWRFVPTK NRRM +I+KEV++ + 
Sbjct  210   RTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSIDKEVRALLM  269

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II +R KA++ GE   DDLLG+LLESN++E         GMS+ DVIEECK+FYFAGQE
Sbjct  270   DIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVIEECKLFYFAGQE  322

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS   DWQARAREEVLQ+FG  +PD +GL+ LK++TMIL E LRLYPP
Sbjct  323   TTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILNEVLRLYPP  382

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +T + R+   ETKLG++ +P G  L +PTLL+H D E+WGEDA+EFKP+RF EG+ KATK
Sbjct  383   VTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDQELWGEDAEEFKPERFAEGVSKATK  442

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPFG GPRIC+GQNFAL+EAKMA+AMILQ+F+FELSPSYAHAP +++T QP++G 
Sbjct  443   NQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVITLQPRYGV  502

Query  1785  PLIIHK  1802
              +I+ K
Sbjct  503   QVILRK  508



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/528 (55%), Positives = 369/528 (70%), Gaps = 34/528 (6%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L + W  L WVWFKPK LE +L++QG+ G PY  L GDM+    M+ +A SKP+ L+D+I
Sbjct  18    LLWIWRTLKWVWFKPKMLESYLRRQGIAGTPYTPLVGDMRRDNSMSKEARSKPIKLTDDI  77

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
               RV+PF    +  YG + + W G  P + I DPE IKEV NK Y + K  T PL   + 
Sbjct  78    ISRVLPFPSHMLKTYGMTFFTWRGTIPSITITDPEQIKEVFNKVYDFPKPHTFPLTNLII  137

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ +Y+ DKWAKHRRIINPAF+ EK+K                             M P
Sbjct  138   SGLFSYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVP  169

Query  765   AFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
              F  SC E++ KW+ +VS KG SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ 
Sbjct  170   VFHQSCNEVVDKWDKMVSDKGSSCEVDVWPGLMSITEDVISRTAFGSSYKEGQRIFELQT  229

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             E     I+  R+ Y+PG+R++PTK NRR+ A  KE    +RG+++KR++A + GE  N+D
Sbjct  230   ELAQLIIQAFRKSYIPGYRYLPTKDNRRIKAAAKETHDILRGLVNKRLRAREAGEAPNED  289

Query  1122  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LLGILLESNL +      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMILLS+ QDW
Sbjct  290   LLGILLESNLGQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDW  344

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEV QVFGD+EP+ EGLN LK++TMI+ E +RLYPP+T + R   +E KLG++ L
Sbjct  345   QARAREEVKQVFGDKEPNTEGLNHLKIMTMIINEVIRLYPPVTQLSRTIHKEMKLGDLTL  404

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LP +L+  D+++WG DA EFKP+RF +G+ KATK +  FFPF  GPRIC+GQN
Sbjct  405   PGGVQINLPIMLVQRDTQLWGNDAAEFKPERFEDGVSKATKSQVSFFPFAWGPRICIGQN  464

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FAL+EAKMAMA+ILQRFSFELSP+Y HAPY++ T  PQ+GA LI+HKL
Sbjct  465   FALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/477 (59%), Positives = 360/477 (75%), Gaps = 30/477 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLA-YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ Y L+    +V LL  YAW +L W WF+P+KLE+ L+QQGL GN Y+++ GD+KEL+
Sbjct  1     MEMAYYLVLSLFAVTLLVIYAWKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELS  60

Query  354   KMTTDALSKPMTLSDN-IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLN  530
             K   +  SKP+ +SD+ I PR++P++++ + KYGK+C+VW+GP P V +R+PE+IK+VL 
Sbjct  61    KSIEEVKSKPLNVSDDDIPPRILPYFIEAIKKYGKNCFVWLGPNPLVFVREPEVIKDVLT  120

Query  531   KNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALW  710
             ++  YQK ++ PL R +A+G+ +YE+DKWAKHR+I+NPAF+ EK+K              
Sbjct  121   RHALYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKH-------------  167

Query  711   GASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRT  890
                            M PAF LSC EM+S+WE   S KGSCE D+WP LQ L+ D ISRT
Sbjct  168   ---------------MLPAFHLSCSEMVSQWEEAASVKGSCELDIWPYLQRLSSDAISRT  212

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AF S+YEEG++IFELQKEQ  H I +SR +Y+PGWRF+PTKRNRRM  IEKEV+++IRGI
Sbjct  213   AFESNYEEGRKIFELQKEQAEHVIAISRTLYIPGWRFMPTKRNRRMKQIEKEVQATIRGI  272

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETT  1250
             IDKR+KAM+ GE N DDLLGILL+SN +EI Q G K+FGMS ++VIEECK+FYFAGQETT
Sbjct  273   IDKRVKAMKAGEANADDLLGILLDSNFKEIEQHGNKDFGMSTQEVIEECKLFYFAGQETT  332

Query  1251  SVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPIT  1430
             SV+LVWTM LLSR  DWQARAREEVLQVFGD   +F+GL+ LK++TMIL+ESLRLYPP+ 
Sbjct  333   SVLLVWTMFLLSRHPDWQARAREEVLQVFGDGMLEFDGLSRLKIVTMILHESLRLYPPVG  392

Query  1431  GMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKAT  1601
              + RR   +TKLGE+ LP G +L LP LL+H D EIWGEDAKEFKPDRF EG+ KAT
Sbjct  393   ALGRRITTKTKLGELGLPAGVMLSLPILLVHHDKEIWGEDAKEFKPDRFSEGVSKAT  449



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/527 (53%), Positives = 376/527 (71%), Gaps = 30/527 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIA  407
             +AW +L+W+WF PK+LE+ L++QGL+GNPY +L GD  E AKM  +A SKPM L S++I 
Sbjct  23    WAWMMLNWLWFTPKRLERLLREQGLQGNPYTLLVGDTNEFAKMRKEAFSKPMDLFSNDIV  82

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
              RV PF+   +N +GK+ ++W GP P+V++ DPELIK+V NK + +QK   NP  R +  
Sbjct  83    QRVYPFFRHSINTHGKNSFIWFGPAPRVILTDPELIKDVFNKTFDFQKIYLNPQVRLLTP  142

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ ++E +KW KHR+II P F  EKLK+                            M P 
Sbjct  143   GLVSHEGEKWRKHRKIITPVFNLEKLKD----------------------------MLPV  174

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
              +  C +++SKWE ++S  GS E DVWP LQ LT + ISRTAFGSSYEEG+RIF+L KEQ
Sbjct  175   LIKCCDDLISKWEEMLSLDGSSEMDVWPFLQNLTSEAISRTAFGSSYEEGRRIFQLLKEQ  234

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                  ++  +VY+PGWRFVPT  +RRM  I+KE K+S+  II+ + KA++ GE   +DLL
Sbjct  235   SELTAQLVYKVYIPGWRFVPTTTHRRMKEIDKETKASLMDIINNKEKALKAGEATKNDLL  294

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
              ILLESN +EI++ G  K  G++IEDVIEECK+FYFAGQ++TS +LVWTMILLS + DWQ
Sbjct  295   DILLESNHKEIQEHGNNKNVGLNIEDVIEECKLFYFAGQDSTSSLLVWTMILLSMYPDWQ  354

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG+ +PDF+GLN LK++ MIL E  RLYPP+ G+ R+ +++ KLG + L 
Sbjct  355   TRAREEVLQVFGNHKPDFDGLNHLKIVPMILNEVFRLYPPVIGLPRKVLKDVKLGNLSLV  414

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + +P +L+H D E+WG+DAKEFKP+RF EG++KAT G+    PFGGGPRIC G+NF
Sbjct  415   AGMQVSIPIILVHHDCELWGDDAKEFKPERFAEGVLKATNGRASLIPFGGGPRICTGRNF  474

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             + +EAK+A++MILQRFSFELS SY HAP + +T QPQ+GA LI+HK+
Sbjct  475   SFLEAKIALSMILQRFSFELSSSYTHAPITAITLQPQYGAHLILHKV  521



>ref|XP_010542332.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=509

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/526 (55%), Positives = 372/526 (71%), Gaps = 37/526 (7%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVW KPK LE  L++QGL G  Y  L GD++    M  +A SKP+ L+D+I P
Sbjct  20    WIWRFLKWVWLKPKILESRLRRQGLVGTHYTPLVGDVRRNFSMIKEARSKPINLTDDITP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF +  +  +GK+ + W+GP P + I +PE IKEV NK Y ++K  T PL R +A G
Sbjct  80    RVLPFPLTMLKTHGKTFFTWLGPIPAITITNPEQIKEVFNKVYDFEKPHTFPLARLIATG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +ANY+ DKWAKHR+IINPAF+ EK+K                             M PAF
Sbjct  140   LANYDGDKWAKHRKIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKGS-CERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E++ +WE +VS KGS CE DVWP L  +T DVISRTAFGSSY EG+RIF+LQ E 
Sbjct  172   YQSCSEIVGEWERLVSDKGSSCEVDVWPWLVNMTADVISRTAFGSSYREGQRIFQLQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 ++  R+ Y+PGWR++PTK NRRM  I++E+++ + GII KR KA +G    N+DLL
Sbjct  232   AQLIVQAFRKAYIPGWRYLPTKSNRRMKEIDREIRAILSGIIGKREKAREGP---NNDLL  288

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESN  +      K  GMS+E+V+EECK+FYFAGQETTSV+LVWTM+LLS+ QDWQA
Sbjct  289   GILLESNSGQ-----SKGNGMSLEEVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQA  343

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEV+QV GD++PD + LN LKV+TMI YE LRLYPP+  ++R   +E KLG++ LP 
Sbjct  344   RAREEVMQVLGDKKPDMDSLNQLKVITMIFYEVLRLYPPVVQLNRAVHKEQKLGDLTLPS  403

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  L LP +L+  D+E+WG DA EFKP+RF++GI KAT+ +  F PFG GPRIC+GQNFA
Sbjct  404   GVHLSLPIMLIQRDTELWGSDAGEFKPERFKDGISKATRNQVSFLPFGWGPRICIGQNFA  463

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+EAKMA+A+ILQRFSFELSP+Y HAPY++VT  PQ GA L++HKL
Sbjct  464   LIEAKMALALILQRFSFELSPTYIHAPYTVVTIHPQFGAHLVLHKL  509



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/527 (53%), Positives = 373/527 (71%), Gaps = 31/527 (6%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             + + W  L+WVW  PK+LE+ LKQ+G  GNPYR LSGD+KE   M+    +KPM +SD+I
Sbjct  20    MIWGWRALNWVWLTPKRLERCLKQEGFAGNPYRFLSGDIKESFTMSRQTRAKPMPVSDDI  79

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
                V+PF  Q +  +G + ++W+GPRP+V I DPE I+E+  K   +QK  +NPL R + 
Sbjct  80    EAYVLPFLHQTIKNHGNNSFMWIGPRPRVTIMDPEKIREIFTKFTDFQKLHSNPLARFLV  139

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G++N E D+W+KHR+I+NPAF+ +KLK                             M P
Sbjct  140   GGLSNLEGDQWSKHRKIVNPAFHQDKLKN----------------------------MLP  171

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
             AF  SC EM+SKWE +VS +G  E DVWP +  +T DVISR AFGSSYEEG+RIF+L ++
Sbjct  172   AFYQSCNEMISKWEEMVSKEGYSELDVWPYIVNMTRDVISRAAFGSSYEEGRRIFQLLED  231

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                  I+V + VY+PGWRF+PTK NR +    K++K S+R +I +R KA++ GE +N+DL
Sbjct  232   LTSLTIKVFQSVYIPGWRFLPTKTNRELKMKHKDIKESLREMIKRREKAIKAGEESNEDL  291

Query  1125  LGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             L IL+ESN   IR+   K  GMSIEDVIEECK+FYFAGQETTSV+LVWTM+LL+R+ DWQ
Sbjct  292   LDILVESN---IREMEAKHMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQ  348

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              +AR+EVL V GD++PD +GLN LKV+TMILYE LRLYPP+  + R   +E K+G ++LP
Sbjct  349   TKARDEVLHVLGDRKPDADGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLP  408

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  +++P L +H D + WG+DA EF+P+RF EG+ KATK +  F PFG GPRIC+GQNF
Sbjct  409   AGTEVLIPILQIHHDKDHWGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNF  468

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++E KMAMAMILQRF FELSPSYAH+P + +T +PQHGA +I+HKL
Sbjct  469   AMMEVKMAMAMILQRFWFELSPSYAHSPCTTMTLRPQHGAQIILHKL  515



>ref|XP_004248201.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=510

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/541 (54%), Positives = 387/541 (72%), Gaps = 35/541 (6%)
 Frame = +3

Query  189   YTLLGVCIS-VGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             Y L+ +CI  V +  ++W +++W+W +P+ LEK L++ G +GN Y+ L GDM E+ KM  
Sbjct  3     YILVAICIILVIIFRWSWRLMNWLWLQPRCLEKCLRELGFRGNSYKFLVGDMNEVVKMDE  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A SKP+  S +I  R++PF  + +  YGK+ ++W+GP P +LI DPE I+E+L+K+  +
Sbjct  63    EAKSKPIKFSHDIVKRLMPFIHKTIIDYGKNSFIWLGPNPAMLIMDPEHIREILSKSNIF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             QK     L + +A G+ +YE DKWAKHRRIINPAF+ +KLK                   
Sbjct  123   QKP-PPALTKLLAEGILSYEGDKWAKHRRIINPAFHLDKLKH------------------  163

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M P+F L+ CEMLSKWE IVS +GS E DVWP LQ LT D ISRTAFGSS
Sbjct  164   ----------MVPSFHLTTCEMLSKWEKIVSTEGS-EVDVWPYLQTLTSDAISRTAFGSS  212

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             YEEG++I ELQ+E     ++ +   Y+   RF+PTK  RRMN I +EV+S +  II+KRM
Sbjct  213   YEEGRQIHELQQELAKIILKETEASYI---RFLPTKEKRRMNRIHQEVRSLVLRIINKRM  269

Query  1086  KAMQGGET-NNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVML  1262
               ++ G+T N+DDLLGILLESN++EI++ G K+FGMSI++VIEECK+FY AGQETTS +L
Sbjct  270   NKIEAGDTSNSDDLLGILLESNMKEIQEHGNKKFGMSIDEVIEECKLFYLAGQETTSALL  329

Query  1263  VWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDR  1442
             VW+MILLS+  DWQARAREEV QVFG+  PD++ LN LKV+TMI+ E LRLYPP   M R
Sbjct  330   VWSMILLSKHSDWQARAREEVSQVFGNNVPDYDKLNQLKVVTMIIQEVLRLYPPNFLMGR  389

Query  1443  RTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFF  1622
                +ETKLG + +P G  L+LPT+L+H D EIWGED +EF P+RF EG+ +ATKGK  +F
Sbjct  390   EVHKETKLGNLSIPSGVQLLLPTILLHHDQEIWGEDVEEFNPERFSEGVNRATKGKFAYF  449

Query  1623  PFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             PF  GPR C+GQNFA++EAKMA+AMILQ+F+FE+SPSYAH PYS+ T  PQ+GA LI+HK
Sbjct  450   PFSWGPRNCIGQNFAMLEAKMALAMILQQFAFEVSPSYAHVPYSVFTLLPQYGAQLILHK  509

Query  1803  L  1805
             L
Sbjct  510   L  510



>ref|XP_010465366.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/522 (55%), Positives = 372/522 (71%), Gaps = 35/522 (7%)
 Frame = +3

Query  246   LDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIPF  425
             L WVWFKPK LE +L++QGL G  Y  L GD+K    M  +A SKP+ L+D+I PRV+P+
Sbjct  25    LKWVWFKPKMLESYLRRQGLAGTHYTPLVGDLKRNFSMLAEARSKPIKLTDDITPRVVPY  84

Query  426   YVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANYE  605
              +  +  +G++ + W GP P V I DPELIKEV NK   + KA   PLGR +A G+ +Y+
Sbjct  85    PLHILRTHGRTFFTWFGPVPVVTIMDPELIKEVFNKVNDFPKAHAFPLGRIIAAGLVSYD  144

Query  606   KDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSCC  785
              DKWAKHRRIINPAF+ EK+K                             M PAF  SC 
Sbjct  145   GDKWAKHRRIINPAFHLEKIKN----------------------------MVPAFHQSCS  176

Query  786   EMLSKWEGIVSGKG--SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHF  959
             E++ +W+ +V  K   SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E     
Sbjct  177   EVVGQWDKLVLDKEGLSCEMDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAELATLI  236

Query  960   IEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILL  1139
             I+  R+ ++PG+ ++PTK NRRM A  +EVK  + GI++KR++A + G+  +DDLLGILL
Sbjct  237   IQAFRKAFIPGYNYLPTKGNRRMKAAAREVKVILGGIVNKRLRAREAGDAPSDDLLGILL  296

Query  1140  ESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARARE  1319
             ESNL + +       GM+ E+++EECK+FYFAGQETT+V+LVWTMILLS+ +DWQ+RARE
Sbjct  297   ESNLGQTKGN-----GMTTEELMEECKLFYFAGQETTTVLLVWTMILLSQHKDWQSRARE  351

Query  1320  EVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALL  1499
             EV QVFGD+EPD EGLN LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G  +
Sbjct  352   EVKQVFGDKEPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDMTLPSGVQI  411

Query  1500  MLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEA  1679
              LP LL+  D+E+WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQNFA++EA
Sbjct  412   SLPILLVQHDTELWGNDAAEFKPERFKDGVSKATKNQVSFFPFAWGPRICIGQNFAMLEA  471

Query  1680  KMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             KMAMA+ILQ+FSFELSPSY HAP++++T  PQ GAPLI+HKL
Sbjct  472   KMAMALILQKFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>emb|CDY51038.1| BnaA06g03010D [Brassica napus]
Length=512

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/528 (55%), Positives = 372/528 (70%), Gaps = 34/528 (6%)
 Frame = +3

Query  225   LAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNI  404
             L + W  L WVWF+PK LE +L++QG+ G PY +L GD+K       +A SKP+ ++D+I
Sbjct  18    LWWIWRTLKWVWFEPKMLESYLRRQGIPGTPYTLLIGDIKRDHSTLMEARSKPIKVTDDI  77

Query  405   APRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVA  584
              PRV+PF    +  YG + + W+GP P + I DPE IKEV NK Y +QK  T PL   + 
Sbjct  78    IPRVLPFPSHMLKTYGMTFFTWLGPIPTITITDPEQIKEVFNKVYDFQKPHTFPLSNLII  137

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ +YE DKWAKHRRIINPAF+ EK+K                             M P
Sbjct  138   SGLFSYEGDKWAKHRRIINPAFHLEKIKN----------------------------MVP  169

Query  765   AFLLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
              F  SC +++ +W+ IVS KG SCE DVWP L  +T DVISRTAFGSSY+EG RIFELQ 
Sbjct  170   VFHQSCRDVVGQWDKIVSEKGSSCEVDVWPGLMSITEDVISRTAFGSSYKEGHRIFELQT  229

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             E     I+  ++ Y+PG+R++PTK NRR+ A   E +  +RG+++KR+ A + GE  ++D
Sbjct  230   ELAQLIIQAVQKSYIPGYRYLPTKDNRRIKAAAGEAQVILRGLVNKRLSAREAGEAPHED  289

Query  1122  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LLGILLESNL++      K  GMSI+DVIEECK+FYFAGQETTSV+LVWTMILLS+ QDW
Sbjct  290   LLGILLESNLEQ-----AKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDW  344

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEV QVFGD+EP+ EGLN LK++TMI+ E LRLYPP+T + R   +E KLG++ L
Sbjct  345   QARAREEVKQVFGDKEPNTEGLNHLKIMTMIINEVLRLYPPVTHVKRAIHKEMKLGDLTL  404

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LPT+L+  D+++WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQN
Sbjct  405   PGGVHISLPTMLVQRDTQLWGNDAAEFKPERFKDGVSKATKSQVSFFPFAWGPRICIGQN  464

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FAL+EAKMAMA+ILQRFSFELSP+Y HAPY++ T  PQ+GA LI+ KL
Sbjct  465   FALLEAKMAMALILQRFSFELSPTYVHAPYTVFTLHPQYGAHLILRKL  512



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/527 (54%), Positives = 379/527 (72%), Gaps = 30/527 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIA  407
             +AW +L+WVWF PK+LE+ L++QGL+GNPY +L GD K+ AKM  +A SKPM L S +I 
Sbjct  19    WAWMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIV  78

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRV  F+   +N +GK+ ++W GP P+V + DPELIK+V NK + +QK   NP    +  
Sbjct  79    PRVFSFFHHSINTHGKNSFIWFGPVPRVTLTDPELIKDVFNKTHDFQKINMNPQIWLLGP  138

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+ ++  +KW+KHR+IINPAF  EKLK                             M P 
Sbjct  139   GLLSHHGEKWSKHRKIINPAFNLEKLKN----------------------------MLPL  170

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F+    +++ KWE ++S  GS E DVWP LQ LT D ISRTAFGSSYEEG+RIF+L KEQ
Sbjct  171   FIKCGDDLIGKWEEMLSLDGSSEMDVWPFLQNLTSDAISRTAFGSSYEEGRRIFQLLKEQ  230

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 +++  +VY+PGWRFVPT  +R+MNAI++++K+S++ II+ R KA++ GE + + LL
Sbjct  231   SELTVQLMLEVYIPGWRFVPTATHRKMNAIDRKIKASLKDIINSREKALKAGEASKNYLL  290

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
               LLESN +EI++QG  K  GM+IEDVI ECK+FYFAGQETTS +LVWTMILLS + DWQ
Sbjct  291   DTLLESNQKEIQEQGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPDWQ  350

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLP  1484
              RAREEVLQVFG+ +PDF+GLN LK++TM+L E LRLYPPI G+ R   ++ KLG + L 
Sbjct  351   TRAREEVLQVFGNGKPDFDGLNHLKIVTMVLNEVLRLYPPIIGLAREVCKDVKLGNLSLA  410

Query  1485  RGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNF  1664
              G  + +  +L+H D E+WG+DAKEFKP+RF EG++KAT GK   FPFG GPRIC+GQNF
Sbjct  411   AGMQVYISIILVHHDCELWGDDAKEFKPERFAEGVLKATNGKVALFPFGWGPRICIGQNF  470

Query  1665  ALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             +L+EAK+A++MIL+ FSFELSP+Y HAP +++T QPQ+GA LI+ K+
Sbjct  471   SLLEAKVALSMILRHFSFELSPTYTHAPTTVITLQPQYGAQLILRKV  517



>dbj|BAL45203.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=520

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/544 (53%), Positives = 386/544 (71%), Gaps = 31/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             + + Y ++ + +++GL+ Y W VL+W+W KPK+LEK L++QG KGN YR++ GD+K+  K
Sbjct  5     LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCKGNSYRLVLGDLKDSYK  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M   A SKPM LSD+I PRVIP+  Q V  YGK+ ++W G  P++++ +PELIK+VLN+ 
Sbjct  64    MGKQAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
              + QK +   + + +  G+  +E +KW KHRR++N AF  EKLK                
Sbjct  124   SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLK----------------  166

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         +M P+FL SC +M+SKWE  +S  GS E D+WP LQ LT DVISR AF
Sbjct  167   ------------IMAPSFLTSCTDMISKWEATLSSDGSGEIDIWPSLQNLTSDVISRNAF  214

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEGKRIF+LQ+EQG   ++   +  +P WRF+PT   RRM+ IEK++ SS+R II+
Sbjct  215   GSSYEEGKRIFDLQREQGELVMKNLVKSLIPLWRFIPTATQRRMHEIEKDIDSSLRYIIN  274

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR KAM+ GE   +DLLG+LLESN QEIR  G  K  GMS+EDV+ ECK+FY AGQE+TS
Sbjct  275   KREKAMKAGEATENDLLGLLLESNHQEIRDHGNNKNMGMSLEDVVGECKLFYLAGQESTS  334

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              MLVWTMILLSR+ DWQ RAREEVLQ+FG+ +PD+EGLN LK+L MILYE LRLYPP  G
Sbjct  335   TMLVWTMILLSRYPDWQERAREEVLQIFGNNKPDYEGLNKLKILPMILYEVLRLYPPAFG  394

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   ++ K G + +P G  + LP +L+  ++E+WG+DAK F P+RF EGI KAT G+ 
Sbjct  395   VTRYVGKDIKFGNMEVPAGVEVFLPIILLQHNNELWGDDAKMFNPERFAEGISKATNGRF  454

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
             ++FPFGGGPR+C+GQNF+L+EAKMA++MILQ F FELSP+YAH P  ++T QP+ GA +I
Sbjct  455   IYFPFGGGPRVCMGQNFSLLEAKMAVSMILQNFYFELSPTYAHTPNLVMTIQPEKGAHVI  514

Query  1794  IHKL  1805
             + K+
Sbjct  515   LRKV  518



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/533 (53%), Positives = 378/533 (71%), Gaps = 31/533 (6%)
 Frame = +3

Query  216   VGLLAYAWG--VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMT  389
              GLL  AW   VL+W W++P++LE+ L+ QGLKG  YR   GD+KE A+ + +A +K M 
Sbjct  18    AGLLFLAWASRVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARFSKEARAKSMP  77

Query  390   LSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-NKNYQYQKARTNP  566
             L+ NI PR++PFY + +++YGK  + W GP P+V I DPEL++EVL NK   + K   NP
Sbjct  78    LAHNIIPRLLPFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKFGHFGKPNQNP  137

Query  567   LGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRT  746
             L R  ARG+A YE +KW KHRRI+NPAF++EKLK                          
Sbjct  138   LARFFARGLAVYEGEKWVKHRRILNPAFHAEKLKR-------------------------  172

Query  747   SVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRI  926
                M PAF   C +++ +WE +   +   E DVWP+LQ  T DVISRTAFGSS++EG+ I
Sbjct  173   ---MLPAFSACCSDLMDRWENMAGSEACYELDVWPELQSFTGDVISRTAFGSSHKEGRPI  229

Query  927   FELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGE  1106
             F+LQ EQ    I+V + +YVPG+RF+PT +N+R+ AI++E++S +RGII KR + ++ G+
Sbjct  230   FQLQAEQAELLIQVVQNLYVPGYRFLPTPKNKRIRAIDREIRSILRGIIKKREQDIKTGK  289

Query  1107  TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLS  1286
              +NDDLLG+L+ESN++ +++ G K  GM+ EDVIEECK+FYFAGQETTSV+L WTMI LS
Sbjct  290   ASNDDLLGLLMESNMKHLQEDGNKNAGMTTEDVIEECKLFYFAGQETTSVLLTWTMICLS  349

Query  1287  RFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKL  1466
                 WQ RAREEVL+VFGD +PDF+GLN LK++TMILYE LRLYPP   + R+T +  KL
Sbjct  350   MHPTWQIRAREEVLRVFGDDKPDFDGLNHLKIVTMILYEVLRLYPPFILLRRQTYKPMKL  409

Query  1467  GEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRI  1646
             G++V P G LL+L  + +H D  +WG+D  EF P+RF EG+ KA+K +  FFPFGGGPRI
Sbjct  410   GDVVYPPGVLLLLHVIFVHHDPNLWGKDVSEFNPERFAEGVSKASKEQVAFFPFGGGPRI  469

Query  1647  CVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             C+GQNFAL+EAKM ++MILQ FSF+LSPSYAHAP+++ T  PQHGA + + KL
Sbjct  470   CIGQNFALLEAKMGLSMILQHFSFDLSPSYAHAPHAVFTLHPQHGAQIRLRKL  522



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/546 (54%), Positives = 394/546 (72%), Gaps = 40/546 (7%)
 Frame = +3

Query  165   ASPEMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMK  344
             AS +   + T+L V     L  +AW V++WVW +PK+LE+ L+QQGL G PY  L GD+K
Sbjct  3     ASIQSIALATVLAV-----LTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLK  57

Query  345   ELAKMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEV  524
             E +++ T+A SKP+++SD+I PR++PF  Q    YGK  ++W+GP P+V I +PE +KE+
Sbjct  58    ENSRLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEI  117

Query  525   LNKNYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
              +K   Y +  +NPL + +A G+A++E +KWA+HR+IINPAF+ EKLK            
Sbjct  118   FSKINDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLK------------  165

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                             LM PAF  SC EM+ +WE +VS   SCE D W DLQ LT +VIS
Sbjct  166   ----------------LMLPAFYSSCTEMVGRWEKLVSVDRSCEIDAWVDLQNLTREVIS  209

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RTAFGSS+EEGKRIFELQ EQ    +   + VY+PGWRFVPTK NRRM +I+KEV++ + 
Sbjct  210   RTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGWRFVPTKMNRRMKSIDKEVRALLM  269

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II +R KA++ GE   DDLLG+LLESN++E         GMS+ DV+EEC++FYFAGQE
Sbjct  270   DIIRRREKAIREGEAAGDDLLGLLLESNMKE-------NVGMSLHDVMEECRLFYFAGQE  322

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTSV+LVWTM+LLS   DWQARAREEVLQ+FG  +PD +GL+ LK++TMIL E LRLYPP
Sbjct  323   TTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDPDGLSHLKIVTMILNEVLRLYPP  382

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +T M R+  +ETKLG++ +P    L++PTLL+H D E+WGEDA+EFKP+RF EG+ KATK
Sbjct  383   VTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKELWGEDAEEFKPERFAEGVSKATK  442

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  FFPFG GPRIC+GQNFAL+EAKMA+AMILQ+F+FELSPSYAHAP +++T QP++G 
Sbjct  443   NQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTFELSPSYAHAPSNVITLQPRYGV  502

Query  1785  PLIIHK  1802
              +I+ K
Sbjct  503   QVILRK  508



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/540 (52%), Positives = 378/540 (70%), Gaps = 29/540 (5%)
 Frame = +3

Query  186   IYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTT  365
             I  +L   I + L+ + W +++WVW +P+KLEK  ++QG+ G+PYR L GD KE+A+MT 
Sbjct  3     IVAILFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTK  62

Query  366   DALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQY  545
             +A  KP+ L+D+I PR+ PFY    NKYG  C+ W+GP P++ +  PELIKE++  N  +
Sbjct  63    EAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIF  122

Query  546   QKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLE  725
             +K +  PL + +  G+++YE DKWAKHR+I+N AFY+EKLK                   
Sbjct  123   KKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLK-------------------  163

Query  726   GKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSS  905
                       M PA   SC +M++KWE ++S   SCE DV P  +  T DVISRTAFGSS
Sbjct  164   ---------CMLPAMHTSCEDMINKWEILLSENKSCELDVHPYFEDFTSDVISRTAFGSS  214

Query  906   YEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRM  1085
             Y EG RIF LQKE      +  + VY+PGWR++PT+ NRRM AI+ E++  +R I+ KR 
Sbjct  215   YAEGTRIFHLQKELAELTRQAFQSVYIPGWRYLPTRTNRRMKAIDNELRDILRKIVSKRE  274

Query  1086  KAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLV  1265
             +AM G  ++ +DLLGILL+SNL+EI+++G K FGM+ ++VIEECKVFYFAGQE++S +LV
Sbjct  275   RAMVGEASDQEDLLGILLKSNLKEIQERGSK-FGMTTDEVIEECKVFYFAGQESSSNLLV  333

Query  1266  WTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRR  1445
             WTM+LLS  Q WQARAREEV QVF + +PDFEGL+ LK++TMIL E LRLYPP     R+
Sbjct  334   WTMVLLSVHQTWQARAREEVQQVFQNNKPDFEGLSRLKIVTMILNEVLRLYPPAPYFVRK  393

Query  1446  TVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFP  1625
               +ETKLG + +P   +L++PT+ +H + E+WGED KEFKP+RF EGI  ATK +  F P
Sbjct  394   VYKETKLGNMSIPPEVILVIPTIFVHHNPELWGEDVKEFKPERFAEGIATATKNRLCFLP  453

Query  1626  FGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             F  GPRIC+G NFA++E K+A+AMILQRF+FELSPSYAHAP  +VT +PQ GA LI+ KL
Sbjct  454   FSWGPRICIGNNFAMLETKIALAMILQRFAFELSPSYAHAPTYVVTLRPQCGAHLILQKL  513



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/526 (55%), Positives = 363/526 (69%), Gaps = 30/526 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPR  413
              W  L+W+W  PKKLEK L++QG  GN YR+ SGD+K+L  M+ +A SKPM  S +IAPR
Sbjct  90    GWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAPR  149

Query  414   VIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGV  593
             VIP     + KYGK+ +VW+GP P+V I DPE +K  L+    +QK   NPL + +  G+
Sbjct  150   VIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDGL  209

Query  594   ANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFL  773
              N+E +KW KHR+I+N AF+ EKLK+                            M P   
Sbjct  210   INHEGEKWVKHRKIVNHAFHFEKLKD----------------------------MVPTMF  241

Query  774   LSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGM  953
              SC EM++ WE +VS  GSCE DV P LQ L  DVISRTAFGS+YEEGK IF   KE   
Sbjct  242   ESCNEMINTWEKMVSKDGSCELDVMPYLQNLAADVISRTAFGSTYEEGKVIFNHFKELIC  301

Query  954   HFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGET-NNDDLLG  1130
               I+ S  VY+PG RF+PTK N RM  I KE+K+ +  +IDKR + M+ GET  +DDLLG
Sbjct  302   LTIQASNIVYIPGRRFLPTKSNNRMKKITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLG  361

Query  1131  ILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQAR  1310
             ILLESN  EI++ G    GMSI D+IEECK+FYFAGQETT+V+LVWTMILL  +  WQ R
Sbjct  362   ILLESNFNEIKEHGNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDR  421

Query  1311  AREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVE-ETKLGEIVLPR  1487
             AR EVLQVFG+ +PDF+GLN LK++TMIL E LRLY P + + R+ V+ ETKLG    P 
Sbjct  422   ARAEVLQVFGNNKPDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPS  481

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G +L  P +L+H+D EIWGEDA EF P+RF EG+ KAT  +  FFPFG GPRIC+GQNFA
Sbjct  482   GVMLSFPVILIHLDKEIWGEDANEFNPERFAEGVSKATXNQTGFFPFGWGPRICIGQNFA  541

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             ++EAK+A+++ILQ FSFELSPSY HAP S++TTQPQHGA +I+HKL
Sbjct  542   MIEAKIALSIILQHFSFELSPSYTHAPISILTTQPQHGAHIILHKL  587



>gb|ABC59075.1| cytochrome P450 monooxygenase CYP72A67 [Medicago truncatula]
 gb|KEH36885.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=520

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 386/544 (71%), Gaps = 31/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             + + Y ++ + +++GL+ Y W VL+W+W KPK+LEK L++QG  GN YR++ GD+K+  K
Sbjct  5     LAIYYGIILITVTLGLV-YTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             M   A SKPM LSD+I PRVIP+  Q V  YGK+ ++W G  P++++ +PELIK+VLN+ 
Sbjct  64    MGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
              + QK +   + + +  G+  +E +KW KHRR++N AF  EKLK                
Sbjct  124   SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLK----------------  166

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                         +M P+FL SC +M+SKWE  +S  GS E D+WP LQ LT DVISR AF
Sbjct  167   ------------IMAPSFLTSCIDMISKWESTLSSDGSGEIDIWPSLQNLTSDVISRNAF  214

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEGKRIF+LQ+EQG   ++   +  +P WRF+PT   RRM+ IEK++ SS+R II+
Sbjct  215   GSSYEEGKRIFDLQREQGELVMKNLVKSLIPLWRFIPTATQRRMHEIEKDIDSSLRYIIN  274

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR KAM+ GE   +DLLG+LLESN QEIR  G  K  GMS+EDV+ ECK+FY AGQE+TS
Sbjct  275   KREKAMKAGEATENDLLGLLLESNHQEIRDHGNNKNMGMSLEDVVGECKLFYLAGQESTS  334

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              MLVWTMILLSR+ DWQ RAREEVLQ+FG+++PD+EGLN LK+L MILYE LRLYPP  G
Sbjct  335   TMLVWTMILLSRYPDWQERAREEVLQIFGNKKPDYEGLNKLKILPMILYEVLRLYPPAFG  394

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R   ++ K G + +P G  + LP +L+  ++E+WG+DAK F P+RF EGI KAT G+ 
Sbjct  395   VTRYVGKDIKFGNMEVPAGVEVFLPIILLQHNNELWGDDAKMFNPERFAEGISKATNGRF  454

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
             ++FPFGGGPR+C+GQNF+L+EAKMA++MILQ F FELSP+YAH P  ++T QP+ GA +I
Sbjct  455   IYFPFGGGPRVCMGQNFSLLEAKMAVSMILQNFYFELSPTYAHTPNLVMTIQPEKGAHVI  514

Query  1794  IHKL  1805
             + K+
Sbjct  515   LRKV  518



>ref|NP_188082.1| cytochrome P450, family 72, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE75550.1| cytochrome P450, family 72, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=514

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/524 (56%), Positives = 371/524 (71%), Gaps = 36/524 (7%)
 Frame = +3

Query  243   VLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIP  422
              L WVWFKPK LE +L++QGL G PY  L GD+K    M T+A SKP+ L+++I PRV+P
Sbjct  24    TLQWVWFKPKMLESYLRRQGLAGTPYTPLIGDLKRNVNMLTEATSKPIKLTEDITPRVLP  83

Query  423   FYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANY  602
                Q +  +G++ + W+GP+P + I DPELIKEV NK Y Y KA+T  LGR +A G+ NY
Sbjct  84    HPFQMLKTHGRTFFTWLGPKPTITIMDPELIKEVFNKVYDYPKAQTFLLGRLIATGIINY  143

Query  603   EKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSC  782
             + DKWAKHRRIINPAF+ EK+K                             M PAF  SC
Sbjct  144   DGDKWAKHRRIINPAFHIEKIKN----------------------------MVPAFHQSC  175

Query  783   CEMLSKWEGIVSGKG--SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMH  956
              +++ +W  +VS KG  SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E    
Sbjct  176   SDVVGEWSKLVSDKGSSSCEVDVWPWLVSMTGDVISRTAFGSSYKEGQRIFELQAELVHL  235

Query  957   FIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETN-NDDLLGI  1133
              ++   +VY+PG+R++PTK NRRM A  +E++  ++GI++KR++A + G+   NDDLLGI
Sbjct  236   ILQAFWKVYIPGYRYLPTKSNRRMKAAAREIQVILKGIVNKRLRAREAGKAAPNDDLLGI  295

Query  1134  LLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARA  1313
             LLESNL +      K  GMS EDV+EECK+FYFAGQETTSV+LVW M+LLS  QDWQARA
Sbjct  296   LLESNLGQ-----AKGNGMSTEDVMEECKLFYFAGQETTSVLLVWAMVLLSHHQDWQARA  350

Query  1314  REEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGA  1493
             REEV QVFGD+EPD E L+ LKV+TMILYE LRLYPP+T + R   +E KLG++ LP G 
Sbjct  351   REEVKQVFGDKEPDTECLSQLKVMTMILYEVLRLYPPVTHLTRAIDKEMKLGDLTLPAGV  410

Query  1494  LLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALV  1673
              + LP +L+  D  +WG DA EFKP+RF++G+ KATK +  FFPF  GPRIC+GQNFA++
Sbjct  411   HISLPIMLVQRDPMLWGTDAAEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAML  470

Query  1674  EAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             EAKMAMA+ILQ F+FELSPSY HAP ++VT  PQ GA LI+ KL
Sbjct  471   EAKMAMALILQTFTFELSPSYVHAPQTVVTIHPQFGAHLILRKL  514



>gb|AGX93059.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Rauvolfia serpentina]
Length=520

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 387/548 (71%), Gaps = 33/548 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             MEV +  + V   VGL  Y  + VLDW+WF+PKKLEK L++QG KGNPYR+  GD  E  
Sbjct  1     MEVSFKSVTVLGFVGLALYWVYRVLDWIWFRPKKLEKCLREQGFKGNPYRLFLGDQYESG  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K+  +A+SKP+ + +++  R++P  ++ V  +GK+ ++W+G  P+V I DPELIKEVL K
Sbjct  61    KLIKEAMSKPIGVEEDVKKRIVPHILKTVETHGKNSFMWVGRIPRVQITDPELIKEVLTK  120

Query  534   NYQYQKART--NPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              Y++QK     +P+ + +  G+ + E + WAK R+IIN AF+ EKLK             
Sbjct  121   YYKFQKNHHDLDPITKFLLTGIGSLEGETWAKRRKIINAAFHFEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC +M++KW+  V   GS E DVW D++ LT DVISR
Sbjct  168   ---------------LMLPAFYLSCRDMVAKWDKKVPEGGSAEVDVWHDIETLTGDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             T FGS+Y EG+RIFEL KE     I+V R VY+PG RF+PTKRN RM AI+KEV+  I  
Sbjct  213   TLFGSNYGEGRRIFELMKELTALTIDVIRSVYIPGHRFLPTKRNNRMRAIDKEVRVRITE  272

Query  1068  IIDKRMKAMQGGE-TNNDDLLGILLESNLQEIRQQG-GKEFGMSIEDVIEECKVFYFAGQ  1241
             II+K+ K M+ GE    DD LGILLE NL EIR+QG  K  GM+IE++I ECK+FYFAGQ
Sbjct  273   IINKKTKIMKAGEAAAADDFLGILLECNLNEIREQGHNKTAGMTIEEIIGECKLFYFAGQ  332

Query  1242  ETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYP  1421
             +TTS +LVWTM+LLSRF +WQ RAREEV QVFG++ PD++G++ LKV+TMILYE LRLY 
Sbjct  333   DTTSTLLVWTMVLLSRFPEWQTRAREEVFQVFGNKTPDYDGISHLKVITMILYEVLRLYT  392

Query  1422  PITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKAT  1601
             P+  + +   E+T+LG+ ++P G  LM+P +L+H D EIWGED  EFKP+RF EG++KAT
Sbjct  393   PVAELTKVAHEDTQLGKYLIPAGVQLMMPQVLLHHDPEIWGEDVMEFKPERFAEGVLKAT  452

Query  1602  KGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHG  1781
             K +  FFPF  GPR+C+GQNFAL+EAKMAM +IL+RFSFELS SY HAP++++T QPQ+G
Sbjct  453   KSQGSFFPFSLGPRMCIGQNFALLEAKMAMTLILRRFSFELSLSYVHAPFTLITMQPQYG  512

Query  1782  APLIIHKL  1805
             A LI+HKL
Sbjct  513   AHLILHKL  520



>gb|AGX93061.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Vinca minor]
Length=520

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/528 (54%), Positives = 380/528 (72%), Gaps = 31/528 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + + VLDWVWF+PKKLEK L++QG KGNPYR+  GD  E  K+  +A+SKP+ + +++  
Sbjct  21    WIYRVLDWVWFRPKKLEKCLREQGFKGNPYRLFLGDQYESGKLIREAMSKPIGIDEDVKK  80

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTN--PLGRKVA  584
             R++P  ++ V  +GK+ ++W+G   +V I DPELIKEVL K Y++QK   +  P+ + + 
Sbjct  81    RIVPHILKAVETHGKNSFMWVGRILRVQITDPELIKEVLTKYYKFQKNHHDLDPITKLLL  140

Query  585   RGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQP  764
              G+ + E + WAK R+IIN AF+ EKLK                            LM P
Sbjct  141   GGIGSLEGESWAKRRKIINSAFHFEKLK----------------------------LMLP  172

Query  765   AFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKE  944
             AF LSC +M+ KW+  V   GS E +VW D++ LT DVISRT FGS+YEEG+RIFEL KE
Sbjct  173   AFYLSCRDMVEKWDKKVPEGGSSEVEVWHDIETLTGDVISRTLFGSNYEEGRRIFELMKE  232

Query  945   QGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDL  1124
                  I+V R VY+PG RF+PTKRN RM AI+KEV+  I  II+K+MK M+ GET  DD 
Sbjct  233   LTALTIDVIRSVYIPGQRFLPTKRNNRMRAIDKEVRVRITEIINKKMKIMKAGETAADDF  292

Query  1125  LGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LGILLE+NL EIR+QG  +  GM+IE +I ECK+FYFAGQ+TTS ++VWTM+LLSRF +W
Sbjct  293   LGILLENNLNEIREQGNNRNAGMTIEQIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEW  352

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             Q RAREEVLQVFG++ PD++G++ LKV+TMILYE LRLY P+  + +   E+T+LG+  +
Sbjct  353   QTRAREEVLQVFGNKPPDYDGISRLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYFI  412

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  LM+P  L+H D EIWGED  EFKP+RF EG++KATK +  FFPF  GPR+C+GQN
Sbjct  413   PAGVQLMMPQALLHHDPEIWGEDVMEFKPERFSEGVLKATKSQGSFFPFSLGPRMCIGQN  472

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             FAL+EAKMAM++IL+RF+FELSPSY HAP++++T QPQ+GA LI+HKL
Sbjct  473   FALLEAKMAMSLILRRFAFELSPSYVHAPFTLITMQPQYGAHLILHKL  520



>gb|AGX93062.1| CYP72A224 7-deoxyloganic acid 7-hydroxylase [Catharanthus roseus]
 gb|AHK60834.1| 7-deoxyloganic acid hydroxylase [Catharanthus roseus]
Length=521

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/549 (53%), Positives = 386/549 (70%), Gaps = 34/549 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ +  +   + V L  Y  + +LDWVWFKPKKLEK L++QG KGNPYR+  GD  +  
Sbjct  1     MELNFKSIIFLVFVSLTLYWVYRILDWVWFKPKKLEKCLREQGFKGNPYRLFLGDQYDSG  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K+   AL+KP+ + +++  R++P  ++ V  +GK  ++W+G  P+V I DPELIKEVL K
Sbjct  61    KLIRQALTKPIGVEEDVKKRIVPHILKTVGTHGKKSFMWVGRIPRVNITDPELIKEVLTK  120

Query  534   NYQYQKAR--TNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              Y++QK     +P+ + +  G+ + E D WAK R+IIN AF+ EKLK             
Sbjct  121   YYKFQKNHHDLDPITKLLLTGIGSLEGDPWAKRRKIINAAFHFEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC +M++KW+  V   GS E DVW D++ LT DVISR
Sbjct  168   ---------------LMLPAFYLSCRDMVTKWDNKVPEGGSAEVDVWHDIETLTGDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             T FGS++EEG+RIFEL KE     I+V R VY+PG RF+PTKRN RM AI+KEV+  I  
Sbjct  213   TLFGSNFEEGRRIFELMKELTALTIDVIRSVYIPGQRFLPTKRNNRMRAIDKEVRVRITE  272

Query  1068  IIDKRMKAMQGGETNN--DDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAG  1238
             II+K+MK M+ GE  +  DD LGILLE NL EI++QG  K  GM+I ++I ECK+FYFAG
Sbjct  273   IINKKMKVMKSGEAASAADDFLGILLECNLNEIKEQGNNKSAGMTIGEIIGECKLFYFAG  332

Query  1239  QETTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLY  1418
             Q+TTS +LVWTM+LLSRF +WQ RAREEV QVFG++ PD++G++ LKV+TMILYE LRLY
Sbjct  333   QDTTSTLLVWTMVLLSRFPEWQTRAREEVFQVFGNKTPDYDGISHLKVITMILYEVLRLY  392

Query  1419  PPITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKA  1598
              P+  + +   E T+LG+  +P G  LM+P +L+H D EIWGED  EFKP+RF EG++KA
Sbjct  393   TPVAELTKVAHEATQLGKYFIPAGVQLMMPQILLHHDPEIWGEDVMEFKPERFAEGVLKA  452

Query  1599  TKGKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQH  1778
             TK +  FFPF  GPR+C+GQNFAL+EAKMAM++IL+RFSFELSPSY HAP++++T QPQ+
Sbjct  453   TKSQGSFFPFSLGPRMCIGQNFALLEAKMAMSLILRRFSFELSPSYVHAPFTLITMQPQY  512

Query  1779  GAPLIIHKL  1805
             GA LI+HKL
Sbjct  513   GAHLILHKL  521



>ref|XP_010241316.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/544 (51%), Positives = 388/544 (71%), Gaps = 30/544 (6%)
 Frame = +3

Query  180   EVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKM  359
             E ++    V + + +L++ W +L  +W++P KLE++LK+QG+KG PY++L G++K+ +++
Sbjct  3     EFVFISATVILCILILSWVWRMLYLIWWRPMKLERYLKEQGIKGPPYKLLVGNLKDESRL  62

Query  360   TTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNY  539
               +ALSKPM LS NIAPRV PF +Q +  YGK    W G  P++ I DPELIK++L   +
Sbjct  63    RKEALSKPMNLSHNIAPRVAPFVLQTIQNYGKMSVSWSGRTPRIYITDPELIKDILLYKF  122

Query  540   -QYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               +++++ NP  R +A G+ +YE +KW KHRRIINPAF+ +KLK  L             
Sbjct  123   GHFERSKPNPFARSLASGLVSYEGEKWVKHRRIINPAFHLDKLKRLL-------------  169

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                            P F +SCC+++++WE +V  +GS E DVWP+L+ L+ D+ISR AF
Sbjct  170   ---------------PVFSISCCDLITRWEKLVPSEGSYEMDVWPELKNLSGDIISRAAF  214

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSYEEG+RIF++Q+EQ    ++ +  +++PG RF+PTKRN RM  +E+EV++ + GII 
Sbjct  215   GSSYEEGRRIFQIQEEQASLIMQDAMSIHIPGLRFLPTKRNNRMKEMEREVRALLEGIIS  274

Query  1077  KRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR KAM+ GE   +DLLG+L+E N +EI++ G  K  GMSI++VI ECK+FYFAG+ETTS
Sbjct  275   KREKAMRMGEACTNDLLGLLMEFNFKEIQEHGNLKNVGMSIDEVIGECKLFYFAGRETTS  334

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             ++L WTM++LS   +WQ RAREEVLQVFG  +PDF  LN LK++TMILYE LRLYPP+  
Sbjct  335   ILLTWTMLVLSMHSEWQLRAREEVLQVFGKNKPDFNELNQLKIVTMILYEVLRLYPPVFR  394

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R T ++ KLGEI LP G  L LP +L+H   E WG+DA+EFKP+RF  G+ KATK + 
Sbjct  395   ISRWTYKKIKLGEIFLPPGVELSLPIILLHHSIEFWGDDAQEFKPERFAGGVSKATKNQV  454

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPF  GPRIC+GQNFAL+  KMA+AMILQRFSFELSP+Y HAP +++T QPQ+GA ++
Sbjct  455   TFFPFSWGPRICIGQNFALMVVKMALAMILQRFSFELSPTYCHAPCTVLTLQPQYGAQIL  514

Query  1794  IHKL  1805
             +HKL
Sbjct  515   LHKL  518



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/547 (53%), Positives = 387/547 (71%), Gaps = 32/547 (6%)
 Frame = +3

Query  174   EMEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             E+++    + V I VGL+ +A  +L+WVWF+PKKLEK L++QGL+GNPYR L GDMK L 
Sbjct  4     ELKLSSIFISVLI-VGLITWAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTLI  62

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
              +T +  +K + LSD++AP ++P+Y Q +N+YG++ ++W GP P++ I DP+L+KE+L K
Sbjct  63    SVTKEEQTKSIQLSDHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILTK  122

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
                + K   +P+G  +A G+   E +KWA+HR+IINPAF+ EKLK               
Sbjct  123   PEVFHKPLPDPIGETIAGGLLFLEDEKWAQHRKIINPAFHMEKLKN--------------  168

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVS-GKGSCERDVWPDLQGLTCDVISRT  890
                           M  A  LSC  M+ KWE + S  + S E DVWP L+ L+ DVISRT
Sbjct  169   --------------MVSAIRLSCSNMVEKWESMFSRSERSLEIDVWPHLESLSGDVISRT  214

Query  891   AFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGI  1070
             AFGSS+EEG+RIFEL +EQ    +E+ +  ++PGWRFVPTK NRRM AI KE++S +RGI
Sbjct  215   AFGSSHEEGRRIFELHREQVKLVLELLKFFFIPGWRFVPTKANRRMRAISKEIQSLLRGI  274

Query  1071  IDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGK--EFGMSIEDVIEECKVFYFAGQE  1244
             I++R KAM+ GET  DDLL  L+ESNL+EI + GGK  + GM IEDVI ECK+FYFAG E
Sbjct  275   INQREKAMERGETVGDDLLSTLMESNLKEIEEHGGKKKDVGMDIEDVINECKLFYFAGSE  334

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS++LVWTM++LS+ Q+WQ RAREEV QVFG  EP FEGLN LKV+T IL+E LRLYPP
Sbjct  335   TTSLLLVWTMVMLSKHQEWQVRAREEVSQVFGKNEPTFEGLNRLKVVTTILHEVLRLYPP  394

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             +  + R   +  KLG I LP G  L+L   L+H D +IWG+D  +FKP+RF EGI  ATK
Sbjct  395   VPLITRAPTKTLKLGNITLPVGVDLILLIGLLHHDPKIWGDDVNQFKPERFSEGISSATK  454

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
             G+  F PF  GPR+CVGQ FA++EAK+A+ MILQ+FSFELS SY HAP+S++T +PQ+GA
Sbjct  455   GQFSFIPFSAGPRVCVGQQFAMIEAKLALVMILQKFSFELSSSYLHAPFSILTLRPQYGA  514

Query  1785  PLIIHKL  1805
              LI+H+L
Sbjct  515   ALILHRL  521



>emb|CDX82471.1| BnaA03g33500D [Brassica napus]
Length=512

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/526 (55%), Positives = 372/526 (71%), Gaps = 34/526 (6%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L  VWF+PK LE +L++QGL G PY  L GD+K  + M  DA SKP+ L+D+I+P
Sbjct  20    WTWRTLKLVWFRPKMLESYLRRQGLSGTPYTPLVGDLKRNSSMMMDARSKPIKLTDDISP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+PF  + +  +G + + W+G  P + I DPE IKEV NK Y +QK  T PL   +A+G
Sbjct  80    RVVPFPFEMLKSHGMTFFTWLGTTPTITIMDPEQIKEVFNKVYDFQKPHTAPLDSVIAKG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             + +Y+ +KWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LTSYDGEKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E++ KWE +V+ KG SCE DVWP +  +  DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSEVIGKWEKLVTDKGSSCEVDVWPGIVNMNADVISRTAFGSSYKEGQRIFELQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+   + Y+PG+ ++PTK NRR+ A  +E++  +RGII+KR++A + GE  +DDLL
Sbjct  232   AQLIIQTFVKSYIPGYIYLPTKDNRRIKAGSREIQVILRGIINKRLRAREAGEAPSDDLL  291

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESN     Q  G E  MSIEDV+EECK+FYFAGQETTSV+LVW MI+LS+ QDWQA
Sbjct  292   GILLESNSG---QAKGNE--MSIEDVMEECKLFYFAGQETTSVLLVWIMIMLSQHQDWQA  346

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEV QVFGD+EP  EGLN LKV+TMILYE LRLYPP   + R   +E KLG++ LP 
Sbjct  347   RAREEVKQVFGDKEPATEGLNQLKVMTMILYEVLRLYPPAVQLTRAIHKEMKLGDLTLPG  406

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP LL+H D+++WG DA EFKP+RF++G+ KATKG+  FFPF  GPRIC+GQNFA
Sbjct  407   GVQINLPILLVHRDTQLWGNDAAEFKPERFKDGVSKATKGQVSFFPFAWGPRICIGQNFA  466

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+E KMA+A+IL++FSFELSPSY HAPY+++T  PQ GA LI++K+
Sbjct  467   LMEIKMALALILKKFSFELSPSYVHAPYTVITMHPQFGAHLILNKI  512



>gb|AGX93057.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Cinchona calisaya]
Length=519

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/547 (52%), Positives = 389/547 (71%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAY-AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             ME+ +T + +   +GL  Y  + VLDWVW +PKKLEK L++QG +GNPYR+  GD  E  
Sbjct  1     MELNFTSIAILGFIGLSIYWFYRVLDWVWLRPKKLEKCLREQGFRGNPYRLFLGDQYESG  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             K+  +A+SKP+ + +++  R+ P  ++ V  +GK+ ++W+G  P+V + DPELI+EVL K
Sbjct  61    KLIREAMSKPIPVDEDVRKRIAPHILKTVQTHGKNSFMWVGRIPRVNVTDPELIREVLTK  120

Query  534   NYQYQKARTN--PLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAAL  707
              Y++QK   +  P+ + +  G+ + E D W++ R+IIN AF  EKLK             
Sbjct  121   YYKFQKNHHDLDPITKLLLTGIGSLEGDPWSRRRKIINSAFQFEKLK-------------  167

Query  708   WGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISR  887
                            LM PAF LSC +M+SKW+  V    S E DVW D++ LT DVISR
Sbjct  168   ---------------LMLPAFYLSCRDMVSKWDNKVPEDDSAELDVWHDIETLTGDVISR  212

Query  888   TAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRG  1067
             T FGS++EEG+RIFEL KE     I+V R VY+PG RF+PTKRN RM AI++EV+  I  
Sbjct  213   TLFGSNFEEGRRIFELMKELTSLTIDVIRSVYIPGQRFLPTKRNNRMRAIDREVRVRITE  272

Query  1068  IIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQE  1244
             II+K+M+AM+ GE   DD LGILLE NL EI++QG  K  GMSIE++I ECK+FYFAGQ+
Sbjct  273   IINKKMRAMKAGEATGDDFLGILLECNLNEIKEQGNNKSAGMSIEEIIGECKLFYFAGQD  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS ++VWTM+LLSRF +WQ  AREEVLQVFGD++PD++G++ LK++TMILYE LR+Y P
Sbjct  333   TTSTLIVWTMVLLSRFPEWQQHAREEVLQVFGDRKPDYDGISRLKIVTMILYEVLRIYTP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
             ++ + +   E+T+LG+  +P G  LM+P +L+H D EIWG+D  EFKP RF EG++KATK
Sbjct  393   VSELTKVAHEDTQLGKYFIPAGVQLMMPQILLHHDPEIWGDDVMEFKPQRFSEGVLKATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              +  +FPF  GPR+C+GQNFAL+EAKMAMA+IL+RFSFELSPSY HAP++++T QPQ+GA
Sbjct  453   SQGSYFPFSLGPRMCIGQNFALLEAKMAMALILRRFSFELSPSYVHAPFTLITMQPQYGA  512

Query  1785  PLIIHKL  1805
              LI+HKL
Sbjct  513   HLILHKL  519



>ref|XP_009116708.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Brassica rapa]
Length=508

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/526 (55%), Positives = 375/526 (71%), Gaps = 38/526 (7%)
 Frame = +3

Query  231   YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAP  410
             + W  L WVWFKPK LE +L++QG+ G PY  L GD+K+++ M T+A SKP+ L+D++ P
Sbjct  20    WVWRTLKWVWFKPKMLESYLRRQGIPGTPYTPLVGDLKKMSSMLTEARSKPIKLTDDVTP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV+P+    +  +G++ Y W GP P + I DPE IKEV N  Y + K  T PL R +A G
Sbjct  80    RVVPYPFHMLKTHGRTYYTWFGPIPTITIMDPEQIKEVFNNVYDFPKPHTFPLVRFIATG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A+Y+ DKWAKHRRIINPAF+ EK+K                             M PAF
Sbjct  140   LASYDGDKWAKHRRIINPAFHLEKIKN----------------------------MVPAF  171

Query  771   LLSCCEMLSKWEGIVSGKG-SCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
               SC E++ KW+ +V  +G SCE DVWP L  +T DVISRTAFGSSY+EG+RIFELQ E 
Sbjct  172   HQSCSEVVGKWDKLVLDRGLSCEVDVWPWLVSMTADVISRTAFGSSYKEGQRIFELQAEL  231

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                 I+  R+ ++PG+ ++PTK NRRM A  +E++  +RGI++KR+ A +     +DDLL
Sbjct  232   SELIIQDFRKAFIPGYSYLPTKDNRRMKAAAREIQVILRGIVNKRLLAREA----SDDLL  287

Query  1128  GILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             GILLESNL +   +G    GMS EDVIEECK+FYFAGQETTSV+LVWTM++LS+ QDWQA
Sbjct  288   GILLESNLGQ--DEGN---GMSTEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQA  342

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEV QVFGD++PD EGLN LKV+TMILYE LRLYPP+  + R   +E K+G++ LP 
Sbjct  343   RAREEVKQVFGDKKPDAEGLNQLKVMTMILYEVLRLYPPVAQLIRAVHKEMKVGDLTLPG  402

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP LL+  D+E+WG+DA EFKP+RF++G+ KATK +  +FPF  GPRIC+GQ+FA
Sbjct  403   GVHINLPILLVQRDTELWGQDAGEFKPERFKDGLSKATKNQVSYFPFSWGPRICIGQSFA  462

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             L+EAKMAMA+ILQRFSFELSPSY HAPY+++T  PQ GA L +HKL
Sbjct  463   LLEAKMAMALILQRFSFELSPSYVHAPYTVMTIHPQFGAHLTLHKL  508



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/527 (55%), Positives = 384/527 (73%), Gaps = 35/527 (7%)
 Frame = +3

Query  222   LLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDN  401
             L  +AW V++WVW +P++LE+ L+QQGL G PY  L GD+KE +++ T+A SKP+ +SD+
Sbjct  17    LTTWAWRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENSRLLTEANSKPIAVSDD  76

Query  402   IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKV  581
             I PR++PF  Q    YGK  ++W+GP P+V I +PE +KE+ +K   Y +  +NPL + +
Sbjct  77    IKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPRPGSNPLVKLL  136

Query  582   ARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQ  761
             A G+ ++E +KWA+HR+IINPAF+ EKLK                            LM 
Sbjct  137   ADGLTSHEGEKWARHRKIINPAFHMEKLK----------------------------LML  168

Query  762   PAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQK  941
             PAF  SC EM+ +WE +VS + SCE D W DLQ LT +VISRTAFGSS+EEGKRIFELQ 
Sbjct  169   PAFYSSCTEMVGRWEKLVSVERSCEIDAWVDLQNLTGEVISRTAFGSSFEEGKRIFELQG  228

Query  942   EQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDD  1121
             EQ    +   + VY+PGWRFVPTK NRRM +I+KEV++ +  I+ +R KA++ GE   DD
Sbjct  229   EQAQLTLIALQSVYIPGWRFVPTKMNRRMKSIDKEVRALLMDIVRRREKAIREGEAAGDD  288

Query  1122  LLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDW  1301
             LLG+LLESN++E         GMS+ DVIEECK+FYFAGQETTSV+LVWTM+LLS   DW
Sbjct  289   LLGLLLESNMKE-------NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDW  341

Query  1302  QARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVL  1481
             QARAREEVLQ+FG  +PD +GL+ LK++TMIL E LRLYPP+T + R+   ETKLG++ +
Sbjct  342   QARAREEVLQIFGSGKPDPDGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTI  401

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  L +PTLL+H D E+WGEDA+EFKP+RF EG+ KATK +  FFPFG GPRIC+GQN
Sbjct  402   PPGVQLSMPTLLIHHDKELWGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQN  461

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             FAL+EAKMA+AMILQ+F+F+LSPSYAHAP +++T QP++G  +I+ K
Sbjct  462   FALIEAKMALAMILQQFTFDLSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/544 (51%), Positives = 385/544 (71%), Gaps = 30/544 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M+++  L    +   L+ + W +++WVW +P+KLEK  ++QG+ G+PYR L GD KE+A+
Sbjct  1     MKIVAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  60

Query  357   MTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKN  536
             +T +A+ KP+ L+D+I PR+ PFY   +NKYG  CY W+GP P++ + +PELIKE++  N
Sbjct  61    LTKEAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNN  120

Query  537   YQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGA  716
               ++K +  PL + +  G+++YE +KWAKHR+IIN AFY+EKLK                
Sbjct  121   TIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLK----------------  164

Query  717   SLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAF  896
                          M PA   SC +M++KWE ++S   S E DV P  + LT DVISRTAF
Sbjct  165   ------------CMLPAMHTSCEDMINKWEILLSENKSYELDVHPYFEDLTSDVISRTAF  212

Query  897   GSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIID  1076
             GSSY EG RIF LQKE      +  + VY+PGWR++PT+ NRRM AI+ E++  +R I+ 
Sbjct  213   GSSYAEGTRIFHLQKELAELTRQAFQSVYIPGWRYLPTRTNRRMKAIDNELRDILRKIVS  272

Query  1077  KRMKAMQGGE-TNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
             KR +AM+ GE ++ +DLLGILL+SNL+EI Q+GG++FGM+ ++VIEECK+FYFAGQE++S
Sbjct  273   KRERAMKVGEASDEEDLLGILLKSNLKEI-QEGGRKFGMTTDEVIEECKIFYFAGQESSS  331

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
              +L+WTM+LLS  Q+WQARAREEV QVF + +PDFEGL+ LK++TMIL E LRLYPP   
Sbjct  332   NLLIWTMVLLSMHQNWQARAREEVQQVFQNNKPDFEGLSRLKIVTMILNEVLRLYPPAPY  391

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
               R+  +ETKLG + +P   +L++PT+ +H + E+WG+D KEFKP+RF EGI  ATK + 
Sbjct  392   FVRKAYKETKLGNMSIPPEVILVIPTIFVHHNPELWGDDVKEFKPERFAEGIATATKNRL  451

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              F PF  GPRIC+G NFA++E K+A+AMILQRF+F+LSPSY HAP  +VT +PQ GA LI
Sbjct  452   CFLPFSWGPRICIGNNFAIMETKIALAMILQRFAFQLSPSYTHAPTYVVTLRPQCGAHLI  511

Query  1794  IHKL  1805
             + KL
Sbjct  512   LQKL  515



>gb|AEI59772.1| cytochrome P450 [Helianthus annuus]
Length=519

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/547 (52%), Positives = 379/547 (69%), Gaps = 32/547 (6%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLAYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAK  356
             M+ +   + +  ++ ++ YAW +++ +W +PKKLEK L+ QG KGN Y+ L GDMKE   
Sbjct  1     MDAVTNTVAISCAIVVVLYAWKIINILWVRPKKLEKLLRNQGFKGNKYKFLFGDMKEFEM  60

Query  357   MTTDALSKPMTLSDN--IAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVL-  527
                 + +K + L D   + P ++PF  QH+ K+G+S + W+G  P++ + DPE+IK+VL 
Sbjct  61    SFQQSKTKHIDLDDEDGVLPYIVPFNHQHLQKFGRSYFKWIGWNPRLTVMDPEIIKDVLV  120

Query  528   NKNYQYQKARTNPLGRK-VARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAA  704
              K   +QK   NPL  K +A G+ ++E D+WAKHR++INP F++EKLK            
Sbjct  121   RKINDFQKLTFNPLFVKYIATGLVSHEGDQWAKHRKLINPGFHAEKLKN-----------  169

Query  705   LWGASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVIS  884
                              M PAF LSC EM+ KW+ ++S  GSCE DVWP LQ LT DVIS
Sbjct  170   -----------------MAPAFHLSCSEMIGKWDKLISSNGSCELDVWPHLQALTSDVIS  212

Query  885   RTAFGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIR  1064
             RT FGSSYEEG RI EL +EQ    +E  + +Y+PG +F+PTKRN RMNAI  EV+SSI 
Sbjct  213   RTTFGSSYEEGVRICELLREQSELVMETLKSLYIPGSKFLPTKRNMRMNAINNEVQSSIG  272

Query  1065  GIIDKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQE  1244
              II+ R+KAM+ GE N DDLLG+LLESN + + Q   K  GM+I +VI+ECK F+FAGQ 
Sbjct  273   SIIENRLKAMKAGEGNYDDLLGVLLESNKKAVEQHQNKSHGMTINEVIQECKAFHFAGQG  332

Query  1245  TTSVMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPP  1424
             TTS ++VWTMILLS+ Q+WQ+RAREEVL VFGD+    +GL+ LKV+TMILYE LRLYPP
Sbjct  333   TTSSLIVWTMILLSKHQEWQSRAREEVLNVFGDKNMVIDGLSHLKVVTMILYEVLRLYPP  392

Query  1425  ITGMDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATK  1604
                ++R+ V+ET +G   LP G  + LP +L+H D ++WG DAK+FKP+RF EGI KATK
Sbjct  393   FVEINRQVVKETTMGGFSLPSGIEIALPIILLHYDEQLWGSDAKKFKPERFSEGISKATK  452

Query  1605  GKQVFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGA  1784
              + ++FPF  GPR C+GQNFAL EAK+A+ +ILQ+FSFELSPSY HAP  ++T +PQ+GA
Sbjct  453   NQVIYFPFSWGPRFCIGQNFALQEAKIALVLILQKFSFELSPSYVHAPNVVLTLEPQNGA  512

Query  1785  PLIIHKL  1805
             PLI+HKL
Sbjct  513   PLILHKL  519



>ref|XP_004168302.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/520 (53%), Positives = 366/520 (70%), Gaps = 29/520 (6%)
 Frame = +3

Query  249   DWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIAPRVIPFY  428
             DW+WF P++LE+ L++QG  GN Y+IL GDMKE A M  +ALSKPM  S++IAPRVIP  
Sbjct  32    DWIWFGPRRLEQLLRRQGFTGNSYKILHGDMKESAAMRKEALSKPMKFSNHIAPRVIPSV  91

Query  429   VQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARGVANYEK  608
                + +YGK+  +W+GP P+V I DPE +K V +    +Q+  T+P  R +  G+ + E 
Sbjct  92    YHTIQRYGKNSMMWLGPLPRVHIMDPEQLKTVFSFFNDFQRPTTDPFIRLLIHGLVSLEG  151

Query  609   DKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAFLLSCCE  788
             +KW KHR+IINPAF+ EKLK                             M PAF  SC E
Sbjct  152   EKWVKHRKIINPAFHLEKLKA----------------------------MVPAFYHSCNE  183

Query  789   MLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQGMHFIEV  968
             M+SKWE +VS +GSCE DV P LQ +  DVISRTAFGSSYE GK+IF+LQ E     I+ 
Sbjct  184   MVSKWESMVSREGSCELDVMPYLQNMAADVISRTAFGSSYERGKKIFKLQTELTNLVIQA  243

Query  969   SRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLGILLESN  1148
             S + Y+PGWRF+PTK NR++    +E+ + + GII+++ K+M+ GE    DLL IL+ESN
Sbjct  244   SLETYIPGWRFLPTKSNRKIKETNREITTLVLGIINEKEKSMKAGEEIQTDLLSILMESN  303

Query  1149  LQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQARAREEV  1325
             + EI+  +  K+ GMSI+ VIEEC++FY AGQETT+ +L+WTM+LLS + DWQ RAR EV
Sbjct  304   MNEIKHGRNSKDVGMSIQAVIEECRLFYIAGQETTATLLIWTMVLLSSYSDWQERARAEV  363

Query  1326  LQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPRGALLML  1505
              ++FG+++PD++GLN LKV+TMI  E LRLYPP++ + R T +ETKLG + LP G +L L
Sbjct  364   FEIFGNKKPDYDGLNRLKVVTMIFNEVLRLYPPVSMLGRTTRKETKLGNMTLPGGIMLSL  423

Query  1506  PTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFALVEAKM  1685
             P +L+  D E+WGEDA EF P+RF EG+ KATK    F PFG GPRIC+GQNFA++EAKM
Sbjct  424   PIILIQRDPELWGEDAHEFNPERFSEGVFKATKNPGAFMPFGWGPRICIGQNFAMIEAKM  483

Query  1686  AMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
             A++MILQ FSFELSPSY H P++ +TTQPQHGA +I+HKL
Sbjct  484   ALSMILQHFSFELSPSYTHTPFAALTTQPQHGAHIILHKL  523



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/543 (55%), Positives = 385/543 (71%), Gaps = 36/543 (7%)
 Frame = +3

Query  177   MEVIYTLLGVCISVGLLA-YAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELA  353
             MEV    + +   + +L  +AW  ++WVW +PK+LE+ L+QQGL G PY  L GD+KE  
Sbjct  1     MEVSMQSIALATVLAVLTTWAWRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENL  60

Query  354   KMTTDALSKPMTLSDNIAPRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNK  533
             +M  +A SKP+ +SD+I PR++PF  +    YGK  + WMGP P+V I +PE IKE+ +K
Sbjct  61    RMLKEAKSKPIAVSDDIKPRLLPFLHRSFQTYGKDWFTWMGPIPRVNITNPEQIKEIFSK  120

Query  534   NYQYQKARTNPLGRKVARGVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWG  713
              Y Y K  +N L + +A G+AN+E +KWA+HR+IINPAF+ EKLK               
Sbjct  121   IYDYPKPASNALVKLLADGLANHEGEKWARHRKIINPAFHMEKLKH--------------  166

Query  714   ASLEGKSQGRTSVLMQPAFLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTA  893
                           M PAF  SC EM+ +WE  V  + SCE D W DLQ LT DVISRTA
Sbjct  167   --------------MLPAFYSSCTEMVDRWEKSVLEERSCEVDAWVDLQNLTRDVISRTA  212

Query  894   FGSSYEEGKRIFELQKEQGMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGII  1073
             FGSS+EEGKRIFELQ+EQ +  I+  + VY+PGWRFVPTK NRRM  I+KEV++ +  I+
Sbjct  213   FGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPTKMNRRMQNIDKEVQALLMDIV  272

Query  1074  DKRMKAMQGGETNNDDLLGILLESNLQEIRQQGGKEFGMSIEDVIEECKVFYFAGQETTS  1253
              +R KA++ G    DDLLG+LLESN++E         GMS+ DVIEECK+FY AGQETTS
Sbjct  273   RRREKAIRAGGAAGDDLLGLLLESNMKE-------NAGMSLHDVIEECKLFYIAGQETTS  325

Query  1254  VMLVWTMILLSRFQDWQARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITG  1433
             V+LVWTM+LLS   DWQARAREEVLQ FG ++PDF+GL+ LK++TMIL E LRLYPP+  
Sbjct  326   VLLVWTMVLLSVHPDWQARAREEVLQTFGSKKPDFDGLSHLKIVTMILNEVLRLYPPVVV  385

Query  1434  MDRRTVEETKLGEIVLPRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQ  1613
             + R+  +ETKLG++ LP G  + +PTLL+H D E+WGEDA+EFKP+RF EG+ KATK + 
Sbjct  386   LARKVPKETKLGKLTLPAGVQVSMPTLLIHHDKELWGEDAEEFKPERFTEGVSKATKNQV  445

Query  1614  VFFPFGGGPRICVGQNFALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLI  1793
              FFPFG GPRICVGQNFA++EAKMA+AMILQ+F+FELS SYAH+P + +T QPQ+G  +I
Sbjct  446   SFFPFGWGPRICVGQNFAMMEAKMALAMILQQFTFELSASYAHSPLTKITLQPQYGVQVI  505

Query  1794  IHK  1802
             +HK
Sbjct  506   LHK  508



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/527 (54%), Positives = 379/527 (72%), Gaps = 32/527 (6%)
 Frame = +3

Query  228   AYAWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTLSDNIA  407
              +AW V++W+W +PKKLE++L+QQGL GN YR  SGDMKE++  T  A SKPM+LS  IA
Sbjct  18    TWAWRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIA  77

Query  408   PRVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVAR  587
             PRVIPF+ + VN Y K+ +VWMG  P+V+I +PE +K +L K  ++ +   NPL + +A 
Sbjct  78    PRVIPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLAT  137

Query  588   GVANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPA  767
             G+A YE +KWAKH+RIINP F+ EKLK                             M PA
Sbjct  138   GIALYEGEKWAKHQRIINPVFHLEKLKR----------------------------MLPA  169

Query  768   FLLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQ  947
             F  SC EM+ +WE +V  +GSCE DV P L+ LT D+ISR+AFGSSY+EG++IF+L +EQ
Sbjct  170   FYESCSEMIVEWESLVLKEGSCELDVRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQ  229

Query  948   GMHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLL  1127
                  +V + VY+PGWRFVPTK N++M  I+KE++  + GII+KR + ++ GE   DDLL
Sbjct  230   AQLVTKVIQNVYIPGWRFVPTKMNKKMKGIDKEIRGLLMGIINKREEGIRAGEATKDDLL  289

Query  1128  GILLESNLQEIRQQGG-KEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQ  1304
             G L+ESNL+EI++ G  K  GMS++DVIEECK+FYFAGQETTS++LVWTM+LL + Q WQ
Sbjct  290   GNLMESNLKEIKEHGNDKTVGMSMDDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQ  349

Query  1305  ARAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYP-PITGMDRRTVEETKLGEIVL  1481
              RAREEVLQVFG  +PDF+G+  LKV+TMIL+E LRLYP P+  + R T + T+L    L
Sbjct  350   DRAREEVLQVFGSNKPDFDGIIHLKVVTMILHEVLRLYPSPL--LVRTTSKTTELRNFSL  407

Query  1482  PRGALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQN  1661
             P G  + LP LL+H D E+WG+DA+EFKP+RF EG+ K TK K  +FPF GGPR+C+GQN
Sbjct  408   PAGVEVALPLLLIHHDRELWGDDAQEFKPERFSEGVAKTTKNKFTYFPFSGGPRVCIGQN  467

Query  1662  FALVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHK  1802
             FA+VEAK+A+++ILQ F+FELSPSYAHAP + +   PQ GA +I+HK
Sbjct  468   FAMVEAKLAISLILQHFTFELSPSYAHAPSAKINLHPQFGAHIILHK  514



>ref|XP_003543172.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=519

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/526 (53%), Positives = 384/526 (73%), Gaps = 30/526 (6%)
 Frame = +3

Query  234   AWGVLDWVWFKPKKLEKWLKQQGLKGNPYRILSGDMKELAKMTTDALSKPMTL-SDNIAP  410
             AW +L+W+W  PK+LE+ L++QGL+GNPY +L GD  E+ K+  +ALSKP+TL S +I P
Sbjct  20    AWKLLNWLWLTPKRLERLLREQGLQGNPYTLLVGDSMEVIKIRKEALSKPITLFSHDIVP  79

Query  411   RVIPFYVQHVNKYGKSCYVWMGPRPKVLIRDPELIKEVLNKNYQYQKARTNPLGRKVARG  590
             RV  +    +NK+GK+ ++W GP P+V + DPELIKEVLNK Y + K + NP  + +  G
Sbjct  80    RVSSYAQHTLNKHGKNSFIWFGPIPRVTLTDPELIKEVLNKIYDFGKLKLNPHVKLLVPG  139

Query  591   VANYEKDKWAKHRRIINPAFYSEKLKEKLMSSTLCSAALWGASLEGKSQGRTSVLMQPAF  770
             +A  E++KW+KHR+IINPAF  +KLK                             M P F
Sbjct  140   LARLEREKWSKHRKIINPAFNLDKLKN----------------------------MLPLF  171

Query  771   LLSCCEMLSKWEGIVSGKGSCERDVWPDLQGLTCDVISRTAFGSSYEEGKRIFELQKEQG  950
             +  C +++SKWEG++S  GS E +VWP LQ L  D ISRTAFGSSYEEG+RIF+L KEQ 
Sbjct  172   IKCCDDLISKWEGMLSSDGSSEINVWPFLQNLASDAISRTAFGSSYEEGRRIFQLLKEQT  231

Query  951   MHFIEVSRQVYVPGWRFVPTKRNRRMNAIEKEVKSSIRGIIDKRMKAMQGGETNNDDLLG  1130
                +++  +VY+PGWRFVPT  +RR+  I++ +K+ +  +I+KR KA++  E   ++LL 
Sbjct  232   ELTMKIILKVYIPGWRFVPTTTHRRIKEIDRVIKALLMDMINKREKALKADEATKNNLLD  291

Query  1131  ILLESNLQEIRQ-QGGKEFGMSIEDVIEECKVFYFAGQETTSVMLVWTMILLSRFQDWQA  1307
             ILLESN +EI++ +  K  G+++E+VI+ECK+FYFAGQETTSV+LVWTMILLSR+ DWQ 
Sbjct  292   ILLESNHKEIQEHKNNKNVGLNLEEVIQECKLFYFAGQETTSVLLVWTMILLSRYPDWQT  351

Query  1308  RAREEVLQVFGDQEPDFEGLNSLKVLTMILYESLRLYPPITGMDRRTVEETKLGEIVLPR  1487
             RAREEVL+VFG+Q+P+F+GL+ LK++TMILYE LRLYPP  G+ R+  ++ KLG + LP 
Sbjct  352   RAREEVLKVFGNQKPNFDGLSHLKIVTMILYEVLRLYPPAIGLVRKVNKDVKLGNLSLPA  411

Query  1488  GALLMLPTLLMHVDSEIWGEDAKEFKPDRFREGIMKATKGKQVFFPFGGGPRICVGQNFA  1667
             G  + LP +L+H D E+WG+DAKEFKP+RF EG++KAT G+  FF FGGGPRIC+GQNF+
Sbjct  412   GVQISLPIVLVHHDCELWGDDAKEFKPERFSEGLLKATNGRFSFFAFGGGPRICIGQNFS  471

Query  1668  LVEAKMAMAMILQRFSFELSPSYAHAPYSMVTTQPQHGAPLIIHKL  1805
              +EAK+A++MILQRF F LSP+Y HAP +++T QPQ+GA LI+ K+
Sbjct  472   FLEAKIALSMILQRFLFGLSPTYTHAPTTVITLQPQYGAHLILRKV  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5862944212374