BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24812_g1_i1 len=945 path=[1:0-86 3099:87-95 97:96-99 101:100-140
142:141-187 189:188-188 190:189-263 265:264-394 2004:395-413
415:414-442 3177:443-448 450:449-481 483:482-550 552:551-569
3222:570-576 578:577-586 588:587-622 624:623-678 680:679-795
797:796-835 837:836-944]

Length=945
                                                                      Score     E

gb|AGC39165.1|  kiwellin                                                289   1e-93   
gb|AGC39164.1|  kiwellin                                                288   2e-93   
gb|AGC39167.1|  kiwellin                                                288   3e-93   
gb|AGC39166.1|  kiwellin                                                288   3e-93   
gb|AGC39171.1|  kiwellin                                                287   5e-93   
gb|AGC39168.1|  kiwellin                                                287   6e-93   
gb|AGC39169.1|  kiwellin                                                286   8e-93   
gb|AGC39173.1|  kiwellin                                                286   1e-92   
gb|AGC39170.1|  kiwellin                                                286   1e-92   
pdb|4PMK|A  Chain A, Crystal Structure Of Kiwellin                      283   5e-92   
gb|AGC39172.1|  kiwellin                                                284   9e-92   
gb|AGC39174.1|  kiwellin                                                283   2e-91   
ref|XP_011042953.1|  PREDICTED: kiwellin-like                           282   6e-91   
ref|XP_006488056.1|  PREDICTED: kiwellin-like                           281   1e-90   
ref|XP_007016801.1|  Kiwellin                                           281   1e-90   
ref|XP_006424528.1|  hypothetical protein CICLE_v10030227mg             282   2e-90   
sp|P84527.1|KIWEL_ACTDE  RecName: Full=Kiwellin; AltName: Allerge...    278   5e-90   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002285310.1|  PREDICTED: kiwellin                                279   7e-90   Vitis vinifera
ref|XP_011013321.1|  PREDICTED: kiwellin-like                           279   7e-90   
ref|XP_010109489.1|  hypothetical protein L484_007509                   276   9e-89   
ref|XP_008385345.1|  PREDICTED: kiwellin-like                           273   3e-87   
ref|XP_002529427.1|  Kiwellin, putative                                 272   4e-87   Ricinus communis
ref|XP_009757783.1|  PREDICTED: kiwellin-like                           271   1e-86   
ref|XP_003638071.1|  Ripening-related protein grip22                    270   2e-86   
ref|XP_010109492.1|  hypothetical protein L484_007512                   269   8e-86   
ref|XP_002285296.1|  PREDICTED: kiwellin-like                           268   1e-85   Vitis vinifera
ref|XP_006340162.1|  PREDICTED: kiwellin-like                           268   2e-85   
gb|KDP44017.1|  hypothetical protein JCGZ_05484                         267   2e-85   
ref|XP_010313436.1|  PREDICTED: kiwellin-like                           265   1e-84   
ref|XP_008226062.1|  PREDICTED: LOW QUALITY PROTEIN: kiwellin-like      265   2e-84   
gb|EYU30424.1|  hypothetical protein MIMGU_mgv1a018280mg                264   6e-84   
emb|CAJ77500.1|  putative kiwellin ripening-related protein precu...    263   9e-84   Solanum tuberosum [potatoes]
ref|XP_007207915.1|  hypothetical protein PRUPE_ppa019189mg             263   2e-83   
ref|XP_010038386.1|  PREDICTED: kiwellin-like                           262   3e-83   
ref|XP_010043782.1|  PREDICTED: kiwellin-like                           262   4e-83   
ref|XP_010109494.1|  hypothetical protein L484_007514                   259   3e-82   
gb|KDP44018.1|  hypothetical protein JCGZ_05485                         259   3e-82   
ref|XP_010043781.1|  PREDICTED: kiwellin-like                           259   6e-82   
ref|NP_001268052.1|  ripening-related protein grip22 precursor          258   2e-81   
ref|XP_003543455.1|  PREDICTED: kiwellin-like                           257   4e-81   
ref|XP_002282561.1|  PREDICTED: kiwellin-like                           255   2e-80   Vitis vinifera
ref|XP_004148934.1|  PREDICTED: kiwellin-like                           254   4e-80   
ref|XP_004173126.1|  PREDICTED: kiwellin-like                           254   4e-80   
ref|XP_006340163.1|  PREDICTED: kiwellin-like                           253   1e-79   
ref|XP_004165858.1|  PREDICTED: kiwellin-like                           253   2e-79   
gb|KGN46856.1|  hypothetical protein Csa_6G147495                       252   3e-79   
gb|EYU30381.1|  hypothetical protein MIMGU_mgv1a022999mg                251   1e-78   
ref|XP_006488057.1|  PREDICTED: kiwellin-like                           250   2e-78   
emb|CBI16343.3|  unnamed protein product                                255   2e-78   
gb|KEH39364.1|  Ripening related protein family                         249   3e-78   
ref|XP_009356890.1|  PREDICTED: kiwellin-like                           249   3e-78   
gb|KDO60174.1|  hypothetical protein CISIN_1g041049mg                   249   5e-78   
ref|XP_008465373.1|  PREDICTED: kiwellin-like                           249   5e-78   
ref|XP_006340404.1|  PREDICTED: kiwellin-like                           246   4e-77   
ref|XP_008462999.1|  PREDICTED: kiwellin-like                           246   5e-77   
ref|XP_007206338.1|  hypothetical protein PRUPE_ppa017478mg             246   5e-77   
ref|XP_004145811.1|  PREDICTED: uncharacterized protein LOC101211521    250   8e-76   
ref|XP_003638073.1|  Ripening-related protein grip22                    243   1e-75   
ref|XP_006372630.1|  hypothetical protein POPTR_0017s03400g             242   9e-75   
ref|XP_008227659.1|  PREDICTED: kiwellin-like                           239   2e-74   
ref|XP_003638074.1|  Ripening-related protein grip22                    239   3e-74   
gb|AEM42991.1|  ripening-related protein                                237   2e-73   
ref|XP_006340405.1|  PREDICTED: kiwellin-like                           236   3e-73   
ref|XP_009796010.1|  PREDICTED: kiwellin-like                           234   9e-73   
ref|XP_006340164.1|  PREDICTED: kiwellin-like                           234   2e-72   
ref|XP_008465372.1|  PREDICTED: kiwellin-like                           234   2e-72   
ref|XP_006424530.1|  hypothetical protein CICLE_v10029991mg             232   2e-71   
ref|XP_002314292.2|  hypothetical protein POPTR_0009s01510g             230   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011046088.1|  PREDICTED: kiwellin-like                           229   3e-70   
ref|XP_004165856.1|  PREDICTED: ripening-related protein grip22-like    228   8e-70   
ref|XP_009619990.1|  PREDICTED: kiwellin-like                           226   1e-69   
ref|XP_010109491.1|  hypothetical protein L484_007511                   226   3e-69   
gb|KGN46853.1|  hypothetical protein Csa_6G147470                       225   7e-69   
ref|XP_007219397.1|  hypothetical protein PRUPE_ppa020404mg             225   1e-68   
gb|KCW85767.1|  hypothetical protein EUGRSUZ_B02523                     224   2e-68   
ref|XP_004165855.1|  PREDICTED: kiwellin-like                           224   2e-68   
ref|XP_010046440.1|  PREDICTED: kiwellin-like                           223   7e-68   
ref|XP_004165857.1|  PREDICTED: kiwellin-like                           215   9e-65   
ref|XP_004145810.1|  PREDICTED: ripening-related protein grip22-like    221   9e-65   
ref|XP_008465375.1|  PREDICTED: kiwellin-like                           214   1e-64   
gb|KCW63132.1|  hypothetical protein EUGRSUZ_G00742                     213   3e-64   
gb|KGN46855.1|  hypothetical protein Csa_6G147490                       213   4e-64   
gb|KCW63127.1|  hypothetical protein EUGRSUZ_G00736                     211   3e-63   
ref|XP_010068220.1|  PREDICTED: kiwellin-like                           211   3e-63   
ref|XP_002973365.1|  hypothetical protein SELMODRAFT_99172              207   2e-61   
ref|XP_010262882.1|  PREDICTED: kiwellin-like                           205   4e-61   
ref|XP_004310165.1|  PREDICTED: kiwellin-like                           199   2e-59   
ref|XP_002976682.1|  hypothetical protein SELMODRAFT_443242             199   1e-58   
ref|XP_002973169.1|  hypothetical protein SELMODRAFT_99218              198   4e-58   
ref|XP_010109493.1|  hypothetical protein L484_007513                   193   2e-57   
ref|XP_004251166.1|  PREDICTED: kiwellin-like                           191   8e-56   
ref|XP_006593266.1|  PREDICTED: putative ripening-related protein...    187   4e-53   
ref|XP_008227665.1|  PREDICTED: kiwellin-like                           174   9e-50   
ref|XP_004986467.1|  PREDICTED: putative ripening-related protein...    174   2e-49   
gb|KEH39370.1|  Ripening related protein family                         174   2e-49   
ref|XP_008663663.1|  PREDICTED: putative ripening-related protein 5     174   2e-49   
ref|XP_003638067.1|  Kiwellin                                           174   3e-49   
ref|XP_004986465.1|  PREDICTED: putative ripening-related protein...    173   5e-49   
ref|XP_004986463.1|  PREDICTED: putative ripening-related protein...    173   6e-49   
ref|XP_002448653.1|  hypothetical protein SORBIDRAFT_06g030860          172   6e-49   Sorghum bicolor [broomcorn]
tpg|DAA35673.1|  TPA: hypothetical protein ZEAMMB73_121999              174   7e-49   
ref|XP_007206669.1|  hypothetical protein PRUPE_ppa022897mg             172   7e-49   
ref|XP_002448655.1|  hypothetical protein SORBIDRAFT_06g030870          172   1e-48   Sorghum bicolor [broomcorn]
ref|XP_009389228.1|  PREDICTED: putative ripening-related protein 1     172   1e-48   
ref|XP_004986464.1|  PREDICTED: putative ripening-related protein...    173   2e-48   
dbj|BAJ99885.1|  predicted protein                                      171   3e-48   
ref|XP_002464443.1|  hypothetical protein SORBIDRAFT_01g018510          171   4e-48   Sorghum bicolor [broomcorn]
tpg|DAA35674.1|  TPA: hypothetical protein ZEAMMB73_749031              170   8e-48   
emb|CBI16342.3|  unnamed protein product                                169   2e-47   
ref|XP_006340403.1|  PREDICTED: kiwellin-like                           169   2e-47   
ref|XP_002979938.1|  hypothetical protein SELMODRAFT_37481              167   3e-47   
ref|XP_004986461.1|  PREDICTED: putative ripening-related protein...    169   3e-47   
ref|XP_007016800.1|  Kiwellin, putative                                 168   3e-47   
gb|EAY79019.1|  hypothetical protein OsI_34128                          168   4e-47   Oryza sativa Indica Group [Indian rice]
gb|EAY78861.1|  hypothetical protein OsI_33966                          167   9e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008671058.1|  PREDICTED: uncharacterized protein LOC103648352    173   1e-46   
ref|XP_004986470.1|  PREDICTED: ripening-related protein 3-like         167   2e-46   
ref|XP_002467033.1|  hypothetical protein SORBIDRAFT_01g018590          166   2e-46   Sorghum bicolor [broomcorn]
ref|XP_011087068.1|  PREDICTED: putative ripening-related protein 1     166   3e-46   
ref|XP_002979937.1|  hypothetical protein SELMODRAFT_112102             165   7e-46   
ref|XP_004954840.1|  PREDICTED: putative ripening-related protein...    165   7e-46   
gb|EAY79011.1|  hypothetical protein OsI_34120                          165   9e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_003571925.1|  PREDICTED: ripening-related protein 3-like         164   1e-45   
ref|XP_004231182.1|  PREDICTED: uncharacterized protein LOC101261762    168   3e-45   
ref|NP_001047526.2|  Os02g0637000                                       163   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452504.1|  hypothetical protein SORBIDRAFT_04g027050          163   4e-45   Sorghum bicolor [broomcorn]
ref|XP_002467032.1|  hypothetical protein SORBIDRAFT_01g018580          162   6e-45   Sorghum bicolor [broomcorn]
gb|EMT07312.1|  hypothetical protein F775_16823                         162   1e-44   
ref|XP_011088932.1|  PREDICTED: putative ripening-related protein 1     161   1e-44   
ref|XP_003559355.2|  PREDICTED: putative ripening-related protein 5     161   2e-44   
ref|XP_003535456.1|  PREDICTED: ripening-related protein grip22-like    159   3e-44   
ref|XP_006339789.1|  PREDICTED: uncharacterized protein LOC102580900    165   3e-44   
ref|XP_004231181.1|  PREDICTED: putative ripening-related protein 5     165   4e-44   
ref|XP_002979936.1|  hypothetical protein SELMODRAFT_111688             160   4e-44   
ref|XP_006339790.1|  PREDICTED: putative ripening-related protein...    160   4e-44   
ref|XP_011092053.1|  PREDICTED: putative ripening-related protein 1     165   4e-44   
ref|XP_002987414.1|  hypothetical protein SELMODRAFT_126090             160   5e-44   
ref|XP_010940772.1|  PREDICTED: putative ripening-related protein 1     159   1e-43   
ref|XP_008644747.1|  PREDICTED: putative ripening-related protein 4     159   1e-43   
ref|XP_009798418.1|  PREDICTED: putative ripening-related protein 5     163   2e-43   
gb|EEC77096.1|  hypothetical protein OsI_15510                          158   2e-43   Oryza sativa Indica Group [Indian rice]
gb|EMS53907.1|  hypothetical protein TRIUR3_11616                       158   2e-43   
ref|XP_002980355.1|  hypothetical protein SELMODRAFT_26834              159   3e-43   
ref|XP_007051839.1|  Uncharacterized protein TCM_005355                 158   3e-43   
ref|XP_009596266.1|  PREDICTED: putative ripening-related protein 1     159   3e-43   
gb|EYU32103.1|  hypothetical protein MIMGU_mgv1a024967mg                158   3e-43   
ref|XP_010670661.1|  PREDICTED: putative ripening-related protein 1     158   4e-43   
ref|XP_009596258.1|  PREDICTED: putative ripening-related protein 5     162   4e-43   
ref|XP_004307389.1|  PREDICTED: putative ripening-related protein...    157   4e-43   
ref|XP_009342497.1|  PREDICTED: putative ripening-related protein 1     157   4e-43   
ref|XP_007219651.1|  hypothetical protein PRUPE_ppa023710mg             157   4e-43   
ref|XP_009596267.1|  PREDICTED: putative ripening-related protein 5     162   4e-43   
gb|KHN01022.1|  Ripening-related protein grip22                         157   5e-43   
ref|XP_009342495.1|  PREDICTED: putative ripening-related protein 1     157   6e-43   
ref|XP_008804752.1|  PREDICTED: uncharacterized protein LOC103717944    166   8e-43   
ref|XP_010088340.1|  hypothetical protein L484_005855                   157   9e-43   
gb|EYU32101.1|  hypothetical protein MIMGU_mgv1a024963mg                156   1e-42   
ref|XP_008789577.1|  PREDICTED: putative ripening-related protein 1     156   1e-42   
gb|EMT20057.1|  hypothetical protein F775_12209                         156   2e-42   
ref|XP_006838535.1|  hypothetical protein AMTR_s00002p00197000          156   2e-42   
ref|XP_003571929.2|  PREDICTED: putative ripening-related protein 5     160   2e-42   
ref|XP_002464451.1|  hypothetical protein SORBIDRAFT_01g018610          156   2e-42   Sorghum bicolor [broomcorn]
ref|XP_008244907.1|  PREDICTED: uncharacterized protein LOC103343014    160   3e-42   
ref|XP_010054777.1|  PREDICTED: putative ripening-related protein 1     155   3e-42   
gb|EYU32105.1|  hypothetical protein MIMGU_mgv1a018691mg                155   4e-42   
ref|XP_009397896.1|  PREDICTED: putative ripening-related protein 1     155   4e-42   
ref|XP_006838534.1|  hypothetical protein AMTR_s00002p00196350          155   4e-42   
ref|XP_008664817.1|  PREDICTED: ripening-related protein 3-like         155   5e-42   
ref|XP_011083325.1|  PREDICTED: putative ripening-related protein 1     158   5e-42   
gb|KDP24047.1|  hypothetical protein JCGZ_26731                         154   6e-42   
ref|XP_010910199.1|  PREDICTED: putative ripening-related protein 2     155   6e-42   
ref|XP_002530766.1|  Kiwellin, putative                                 154   6e-42   Ricinus communis
ref|XP_009767996.1|  PREDICTED: LOW QUALITY PROTEIN: putative rip...    154   6e-42   
ref|XP_002962732.1|  hypothetical protein SELMODRAFT_26835              155   7e-42   
ref|XP_010236628.1|  PREDICTED: uncharacterized protein LOC104584170    159   7e-42   
ref|XP_006445077.1|  hypothetical protein CICLE_v10023491mg             154   9e-42   
ref|XP_004306797.1|  PREDICTED: putative ripening-related protein...    159   9e-42   
gb|KCW71634.1|  hypothetical protein EUGRSUZ_E00161                     153   2e-41   
ref|XP_008375813.1|  PREDICTED: putative ripening-related protein 1     153   2e-41   
gb|EMT18094.1|  hypothetical protein F775_16043                         151   3e-41   
ref|XP_003558011.2|  PREDICTED: putative ripening-related protein 5     157   3e-41   
gb|KDP45133.1|  hypothetical protein JCGZ_17465                         152   4e-41   
ref|XP_002513616.1|  Kiwellin, putative                                 152   5e-41   Ricinus communis
ref|XP_003571933.2|  PREDICTED: putative ripening-related protein 4     157   7e-41   
ref|XP_010055145.1|  PREDICTED: putative ripening-related protein 1     156   7e-41   
gb|EMT13241.1|  hypothetical protein F775_11052                         157   1e-40   
ref|XP_004306800.1|  PREDICTED: putative ripening-related protein...    156   1e-40   
ref|XP_002320123.2|  hypothetical protein POPTR_0014s07760g             150   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010933191.1|  PREDICTED: putative ripening-related protein 1     151   1e-40   
ref|XP_006432702.1|  hypothetical protein CICLE_v10003380mg             151   1e-40   
ref|XP_003555496.1|  PREDICTED: ripening-related protein grip22-like    150   1e-40   
ref|XP_009346961.1|  PREDICTED: putative ripening-related protein 2     151   2e-40   
ref|XP_009383046.1|  PREDICTED: putative ripening-related protein 1     150   2e-40   
ref|XP_003535457.1|  PREDICTED: ripening-related protein grip22-like    150   2e-40   
ref|XP_009342513.1|  PREDICTED: uncharacterized protein LOC103934489    155   2e-40   
ref|XP_009373196.1|  PREDICTED: putative ripening-related protein 1     150   2e-40   
ref|XP_007218473.1|  hypothetical protein PRUPE_ppa011987mg             150   3e-40   
ref|XP_009342496.1|  PREDICTED: putative ripening-related protein 1     150   3e-40   
ref|XP_006647576.1|  PREDICTED: putative ripening-related protein...    150   3e-40   
ref|XP_007219480.1|  hypothetical protein PRUPE_ppa021545mg             150   3e-40   
ref|XP_003623922.1|  Ripening-related protein grip22                    150   3e-40   
ref|XP_010105959.1|  hypothetical protein L484_017307                   150   3e-40   
ref|XP_007051837.1|  Ripening-related protein 1                         150   3e-40   
ref|XP_006445076.1|  hypothetical protein CICLE_v10023417mg             150   4e-40   
ref|XP_009342515.1|  PREDICTED: uncharacterized protein LOC103934491    154   4e-40   
ref|XP_011036013.1|  PREDICTED: putative ripening-related protein 1     154   4e-40   
gb|EMT14348.1|  hypothetical protein F775_19872                         150   4e-40   
gb|EAY79018.1|  hypothetical protein OsI_34127                          150   7e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003605680.1|  Ripening-related protein grip22                    149   9e-40   
ref|XP_007219675.1|  hypothetical protein PRUPE_ppa025304mg             148   9e-40   
ref|XP_008244906.1|  PREDICTED: putative ripening-related protein 1     149   1e-39   
gb|KCW71633.1|  hypothetical protein EUGRSUZ_E00160                     149   1e-39   
ref|XP_010229674.1|  PREDICTED: putative ripening-related protein 5     149   1e-39   
ref|XP_002511839.1|  Kiwellin, putative                                 149   1e-39   Ricinus communis
ref|XP_002271952.2|  PREDICTED: uncharacterized protein LOC100260254    153   1e-39   Vitis vinifera
ref|XP_003623927.1|  Ripening-related protein                           149   1e-39   
ref|XP_002320124.1|  hypothetical protein POPTR_0014s07770g             148   1e-39   Populus trichocarpa [western balsam poplar]
ref|NP_001052553.1|  Os04g0364800                                       148   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007220087.1|  hypothetical protein PRUPE_ppa023816mg             147   1e-39   
emb|CAN63234.1|  hypothetical protein VITISV_026714                     148   2e-39   Vitis vinifera
emb|CAN61347.1|  hypothetical protein VITISV_007855                     148   2e-39   Vitis vinifera
ref|XP_002529817.1|  Kiwellin, putative                                 148   2e-39   Ricinus communis
ref|XP_004953214.1|  PREDICTED: putative ripening-related protein...    148   2e-39   
ref|XP_003552385.1|  PREDICTED: putative ripening-related protein...    148   3e-39   
ref|XP_002509793.1|  Kiwellin, putative                                 147   3e-39   Ricinus communis
gb|KCW54414.1|  hypothetical protein EUGRSUZ_I00364                     146   3e-39   
ref|XP_007135042.1|  hypothetical protein PHAVU_010G096700g             147   4e-39   
gb|EMT09991.1|  hypothetical protein F775_16502                         147   4e-39   
ref|XP_010096897.1|  hypothetical protein L484_008096                   147   4e-39   
ref|XP_002302579.2|  hypothetical protein POPTR_0002s16000g             147   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008376021.1|  PREDICTED: LOW QUALITY PROTEIN: putative rip...    151   6e-39   
emb|CDP09746.1|  unnamed protein product                                146   8e-39   
ref|XP_003555495.1|  PREDICTED: ripening-related protein grip22-like    145   8e-39   
gb|KHN29365.1|  Putative ripening-related protein 2                     146   8e-39   
gb|KDP45134.1|  hypothetical protein JCGZ_17466                         146   9e-39   
ref|XP_007220948.1|  hypothetical protein PRUPE_ppa026116mg             146   1e-38   
ref|XP_010654793.1|  PREDICTED: uncharacterized protein LOC100264620    150   1e-38   
ref|XP_006345629.1|  PREDICTED: uncharacterized protein LOC102601249    150   1e-38   
ref|XP_007139915.1|  hypothetical protein PHAVU_008G069300g             146   1e-38   
ref|XP_002320788.2|  hypothetical protein POPTR_0014s07840g             146   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008244910.1|  PREDICTED: uncharacterized protein LOC103343018    150   1e-38   
emb|CBI40342.3|  unnamed protein product                                146   1e-38   
emb|CAN71973.1|  hypothetical protein VITISV_009241                     145   2e-38   Vitis vinifera
gb|AES80144.2|  Ripening related protein family                         145   2e-38   
ref|XP_010933165.1|  PREDICTED: putative ripening-related protein 1     145   2e-38   
ref|XP_002304490.2|  hypothetical protein POPTR_0003s12630g             145   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_007051840.1|  Uncharacterized protein TCM_005356                 145   2e-38   
ref|XP_003623897.1|  Ripening-related protein                           145   2e-38   
ref|XP_010321532.1|  PREDICTED: putative ripening-related protein 1     145   2e-38   
gb|KEH18880.1|  Ripening related protein family                         145   2e-38   
ref|XP_011023354.1|  PREDICTED: putative ripening-related protein 1     145   3e-38   
ref|XP_007219700.1|  hypothetical protein PRUPE_ppa024048mg             145   3e-38   
ref|XP_002273508.2|  PREDICTED: uncharacterized protein LOC100253410    149   3e-38   Vitis vinifera
ref|XP_008244909.1|  PREDICTED: LOW QUALITY PROTEIN: ripening-rel...    149   4e-38   
gb|AES80137.2|  Ripening related protein family                         144   5e-38   
gb|AES80136.2|  kiwellin, putative                                      142   5e-38   
ref|XP_011036054.1|  PREDICTED: putative ripening-related protein 1     144   5e-38   
ref|XP_010105958.1|  hypothetical protein L484_017306                   144   7e-38   
ref|XP_003623917.1|  Ripening-related protein                           144   7e-38   
ref|XP_002511842.1|  Kiwellin, putative                                 144   7e-38   Ricinus communis
gb|EMT09993.1|  Putative ripening-related protein 4                     144   8e-38   
ref|XP_004306798.1|  PREDICTED: putative ripening-related protein...    148   8e-38   
ref|XP_002302580.2|  hypothetical protein POPTR_0002s16010g             144   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011022709.1|  PREDICTED: putative ripening-related protein 2     144   1e-37   
gb|EMT23801.1|  Putative ripening-related protein 4                     144   1e-37   
gb|AES80133.2|  Ripening related protein family                         143   1e-37   
ref|XP_003633977.2|  PREDICTED: putative ripening-related protein 1     147   1e-37   
ref|XP_011092064.1|  PREDICTED: putative ripening-related protein 2     143   1e-37   
gb|AES77577.2|  Ripening related protein family                         143   1e-37   
ref|XP_007021719.1|  Ripening-related protein 1                         143   2e-37   
ref|XP_002452503.1|  hypothetical protein SORBIDRAFT_04g027040          146   2e-37   Sorghum bicolor [broomcorn]
ref|XP_003605687.1|  Ripening-related protein                           142   2e-37   
gb|KHN01021.1|  Ripening-related protein grip22                         144   2e-37   
ref|XP_003623910.1|  Ripening-related protein                           143   2e-37   
gb|KHN42204.1|  Putative ripening-related protein 2                     141   2e-37   
ref|XP_008644746.1|  PREDICTED: ripening-related protein 3-like         143   2e-37   
emb|CBI36323.3|  unnamed protein product                                141   3e-37   
ref|XP_004500188.1|  PREDICTED: putative ripening-related protein...    142   3e-37   
gb|KHN15255.1|  Putative ripening-related protein 2                     142   3e-37   
ref|XP_003521901.2|  PREDICTED: putative ripening-related protein...    142   3e-37   
ref|XP_003623918.1|  Ripening-related protein grip22                    146   4e-37   
ref|XP_004953215.1|  PREDICTED: putative ripening-related protein...    142   4e-37   
ref|XP_009787752.1|  PREDICTED: putative ripening-related protein 1     142   5e-37   
ref|XP_003533611.2|  PREDICTED: LOW QUALITY PROTEIN: putative rip...    145   7e-37   
ref|XP_003621359.1|  Ripening-related protein                           143   9e-37   
gb|EMT12997.1|  Putative ripening-related protein 4                     140   1e-36   
ref|XP_003623926.1|  Ripening-related protein                           142   2e-36   
ref|XP_003521894.2|  PREDICTED: putative ripening-related protein...    140   2e-36   
ref|XP_003621358.1|  Ripening-related protein                           140   2e-36   
ref|XP_011002896.1|  PREDICTED: putative ripening-related protein 1     140   3e-36   
ref|XP_007139878.1|  hypothetical protein PHAVU_008G066000g             140   3e-36   
ref|XP_003623919.1|  Ripening-related protein                           142   3e-36   
ref|XP_002320125.1|  hypothetical protein POPTR_0014s07780g             139   3e-36   
emb|CBI40339.3|  unnamed protein product                                139   4e-36   
ref|XP_002464449.1|  hypothetical protein SORBIDRAFT_01g018600          139   5e-36   
ref|XP_004510831.1|  PREDICTED: putative ripening-related protein...    139   5e-36   
ref|XP_003605681.1|  Ripening-related protein                           143   6e-36   
ref|XP_006371560.1|  hypothetical protein POPTR_0019s13160g             139   8e-36   
ref|XP_011036026.1|  PREDICTED: uncharacterized protein LOC105133640    143   8e-36   
ref|XP_007051842.1|  Uncharacterized protein TCM_005358                 139   8e-36   
ref|XP_004492718.1|  PREDICTED: putative ripening-related protein...    138   9e-36   
ref|XP_002273545.1|  PREDICTED: putative ripening-related protein 2     137   9e-36   
ref|XP_004308384.1|  PREDICTED: putative ripening-related protein...    138   1e-35   
ref|XP_004986476.1|  PREDICTED: putative ripening-related protein...    137   1e-35   
ref|XP_003521892.2|  PREDICTED: putative ripening-related protein...    142   2e-35   
ref|XP_008376037.1|  PREDICTED: putative ripening-related protein 2     137   2e-35   
ref|XP_009595763.1|  PREDICTED: putative ripening-related protein 1     137   2e-35   
gb|KHN29366.1|  Putative ripening-related protein 2                     135   2e-35   
ref|XP_009400948.1|  PREDICTED: putative ripening-related protein 4     137   3e-35   
ref|XP_003623915.1|  Ripening-related protein                           141   3e-35   
ref|XP_002511840.1|  Kiwellin, putative                                 137   4e-35   
ref|XP_007139879.1|  hypothetical protein PHAVU_008G066100g             136   6e-35   
ref|XP_003623914.1|  Ripening-related protein                           136   7e-35   
ref|NP_001064923.1|  Os10g0490100                                       137   7e-35   
gb|KHN42209.1|  Putative ripening-related protein 5                     139   7e-35   
sp|Q9FWU1.2|RIP4_ORYSJ  RecName: Full=Putative ripening-related p...    137   8e-35   
ref|XP_007021720.1|  Uncharacterized protein TCM_031768                 135   9e-35   
ref|XP_009346960.1|  PREDICTED: putative ripening-related protein 2     135   1e-34   
gb|EAY79021.1|  hypothetical protein OsI_34130                          135   2e-34   
gb|EEC67138.1|  hypothetical protein OsI_33967                          134   3e-34   
ref|XP_010933166.1|  PREDICTED: putative ripening-related protein 2     134   3e-34   
ref|XP_004986475.1|  PREDICTED: putative ripening-related protein...    134   4e-34   
gb|EMT09204.1|  hypothetical protein F775_19055                         132   4e-34   
emb|CDP18484.1|  unnamed protein product                                134   4e-34   
gb|EMT09994.1|  hypothetical protein F775_16505                         134   4e-34   
ref|XP_008393502.1|  PREDICTED: putative ripening-related protein 1     134   5e-34   
gb|EYU32106.1|  hypothetical protein MIMGU_mgv1a025220mg                134   5e-34   
gb|EMT09990.1|  hypothetical protein F775_16501                         134   6e-34   
sp|Q8LN49.1|RIP5_ORYSJ  RecName: Full=Putative ripening-related p...    135   1e-33   
gb|KCW71809.1|  hypothetical protein EUGRSUZ_E00294                     133   2e-33   
gb|KCW53488.1|  hypothetical protein EUGRSUZ_J02753                     131   3e-33   
ref|XP_008664826.1|  PREDICTED: putative ripening-related protein 6     130   6e-33   
ref|XP_002467041.1|  hypothetical protein SORBIDRAFT_01g018690          129   8e-33   
gb|KDP37389.1|  hypothetical protein JCGZ_08400                         129   8e-33   
ref|XP_002458259.1|  hypothetical protein SORBIDRAFT_03g030120          130   9e-33   
ref|XP_002467036.1|  hypothetical protein SORBIDRAFT_01g018650          128   4e-32   
gb|EMT06199.1|  hypothetical protein F775_02570                         130   4e-32   
ref|XP_009606168.1|  PREDICTED: putative ripening-related protein 1     129   5e-32   
gb|EMT06198.1|  hypothetical protein F775_15549                         129   5e-32   
ref|XP_004986480.1|  PREDICTED: putative ripening-related protein...    128   6e-32   
gb|EMT20203.1|  hypothetical protein F775_21238                         127   8e-32   
gb|EMT09989.1|  Putative ripening-related protein 4                     129   9e-32   
gb|EMT07313.1|  hypothetical protein F775_16824                         127   9e-32   
ref|XP_006838536.1|  hypothetical protein AMTR_s00002p00197170          125   1e-31   
gb|EMT03636.1|  hypothetical protein F775_18063                         125   1e-31   
ref|XP_003571922.1|  PREDICTED: putative ripening-related protein 6     127   2e-31   
ref|XP_009762953.1|  PREDICTED: putative ripening-related protein 1     127   2e-31   
ref|XP_006385760.1|  hypothetical protein POPTR_0003s12650g             124   2e-31   
gb|EYU32104.1|  hypothetical protein MIMGU_mgv1a023875mg                125   2e-31   
ref|XP_004986479.1|  PREDICTED: putative ripening-related protein...    126   2e-31   
gb|AAG13534.1|AC023240_7  hypothetical protein                          131   3e-31   
ref|XP_004986462.1|  PREDICTED: uncharacterized protein LOC101769756    130   7e-31   
emb|CBI40343.3|  unnamed protein product                                125   8e-31   
ref|XP_004982771.1|  PREDICTED: putative ripening-related protein...    123   1e-30   
gb|EMT21337.1|  hypothetical protein F775_15054                         122   2e-30   
gb|EAZ16501.1|  hypothetical protein OsJ_31973                          124   2e-30   
ref|XP_004986562.1|  PREDICTED: putative ripening-related protein...    122   2e-30   
gb|EMT08513.1|  hypothetical protein F775_16984                         122   2e-30   
ref|XP_007219316.1|  hypothetical protein PRUPE_ppa019015mg             124   2e-30   
ref|XP_008666640.1|  PREDICTED: putative ripening-related protein 6     123   3e-30   
ref|XP_004971573.1|  PREDICTED: putative ripening-related protein...    122   3e-30   
gb|KHN26976.1|  Putative ripening-related protein 2                     121   6e-30   
ref|XP_004986478.1|  PREDICTED: putative ripening-related protein...    121   1e-29   
ref|XP_004986473.1|  PREDICTED: putative ripening-related protein...    120   1e-29   
ref|XP_008664819.1|  PREDICTED: putative ripening-related protein 6     120   3e-29   
ref|XP_007144142.1|  hypothetical protein PHAVU_007G132200g             119   3e-29   
ref|XP_004308386.1|  PREDICTED: putative ripening-related protein...    119   3e-29   
ref|XP_008664821.1|  PREDICTED: putative ripening-related protein 6     119   4e-29   
gb|KHN30712.1|  Ripening-related protein grip22                         119   4e-29   
ref|XP_008664131.1|  PREDICTED: putative ripening-related protein 6     119   5e-29   
gb|EMT00804.1|  hypothetical protein F775_15885                         119   5e-29   
gb|EMT20786.1|  hypothetical protein F775_14862                         118   9e-29   
ref|XP_004308385.1|  PREDICTED: putative ripening-related protein...    119   9e-29   
ref|XP_003571921.1|  PREDICTED: putative ripening-related protein 6     119   1e-28   
ref|XP_008666639.1|  PREDICTED: putative ripening-related protein 6     117   2e-28   
ref|XP_009628172.1|  PREDICTED: putative ripening-related protein 2     118   2e-28   
ref|XP_003566490.1|  PREDICTED: putative ripening-related protein 6     117   3e-28   
ref|XP_008666636.1|  PREDICTED: putative ripening-related protein 6     117   3e-28   
ref|XP_006845138.1|  hypothetical protein AMTR_s00005p00209770          116   3e-28   
emb|CBI40340.3|  unnamed protein product                                117   4e-28   
emb|CBI40341.3|  unnamed protein product                                117   4e-28   
ref|XP_010672191.1|  PREDICTED: putative ripening-related protein 1     117   5e-28   
ref|XP_008666637.1|  PREDICTED: putative ripening-related protein 6     116   5e-28   
emb|CBI36324.3|  unnamed protein product                                117   7e-28   
ref|XP_010321630.1|  PREDICTED: putative ripening-related protein 2     117   9e-28   
ref|XP_006845135.1|  hypothetical protein AMTR_s00005p00207640          115   1e-27   
ref|XP_007051843.1|  Uncharacterized protein TCM_005359                 116   1e-27   
gb|EMS67522.1|  hypothetical protein TRIUR3_10385                       114   2e-27   
ref|XP_006662465.1|  PREDICTED: ripening-related protein 3-like         114   2e-27   
tpg|DAA49532.1|  TPA: hypothetical protein ZEAMMB73_686221              113   1e-26   
emb|CDP08833.1|  unnamed protein product                                114   1e-26   
gb|KCW78054.1|  hypothetical protein EUGRSUZ_D02279                     113   1e-26   
gb|EMT12835.1|  hypothetical protein F775_33034                         115   2e-26   
ref|XP_009778801.1|  PREDICTED: putative ripening-related protein 2     111   8e-26   
ref|XP_006577381.1|  PREDICTED: LOW QUALITY PROTEIN: putative rip...    111   9e-26   
ref|XP_007051838.1|  Uncharacterized protein TCM_005354                 110   1e-25   
ref|XP_001784691.1|  predicted protein                                  110   1e-25   
sp|Q7XD66.1|RIP6_ORYSJ  RecName: Full=Putative ripening-related p...    110   1e-25   
ref|XP_006845139.1|  hypothetical protein AMTR_s00005p00210680          107   5e-25   
ref|XP_009606167.1|  PREDICTED: putative ripening-related protein 2     108   5e-25   
gb|EMT23046.1|  hypothetical protein F775_21160                         107   7e-25   
gb|EAY79006.1|  hypothetical protein OsI_34115                          108   7e-25   
gb|EAY79007.1|  hypothetical protein OsI_34116                          108   8e-25   
sp|Q7XD65.1|RIP7_ORYSJ  RecName: Full=Putative ripening-related p...    108   9e-25   
ref|XP_006845137.1|  hypothetical protein AMTR_s00005p00208720          106   1e-24   
ref|XP_002464453.1|  hypothetical protein SORBIDRAFT_01g018640          107   1e-24   
ref|XP_002464452.1|  hypothetical protein SORBIDRAFT_01g018620          106   2e-24   
gb|KEH18877.1|  Ripening related protein family                         105   5e-24   
ref|XP_004246115.2|  PREDICTED: putative ripening-related protein 1     105   6e-24   
ref|XP_009606175.1|  PREDICTED: putative ripening-related protein 2     105   1e-23   
gb|EMT12998.1|  Putative ripening-related protein 4                     103   1e-23   
ref|XP_003571924.1|  PREDICTED: putative ripening-related protein 6     104   2e-23   
ref|XP_009778812.1|  PREDICTED: putative ripening-related protein 2     103   2e-23   
ref|XP_002467039.1|  hypothetical protein SORBIDRAFT_01g018680          103   3e-23   
ref|XP_006845136.1|  hypothetical protein AMTR_s00005p00207990          102   4e-23   
ref|XP_010105957.1|  hypothetical protein L484_017305                   102   5e-23   
gb|KEH18878.1|  Ripening related protein family                         102   1e-22   
gb|EAY79020.1|  hypothetical protein OsI_34129                          102   1e-22   
ref|XP_002985726.1|  hypothetical protein SELMODRAFT_122553             103   2e-22   
ref|XP_004986472.1|  PREDICTED: putative ripening-related protein...    101   4e-22   
gb|EMT08817.1|  hypothetical protein F775_18973                         100   8e-22   
ref|XP_004972054.1|  PREDICTED: putative ripening-related protein...  98.6    2e-21   
gb|EMT09992.1|  hypothetical protein F775_16503                       97.4    5e-21   
gb|EMT05192.1|  hypothetical protein F775_13347                       96.7    7e-21   
ref|XP_002974428.1|  hypothetical protein SELMODRAFT_100893           98.6    9e-21   
gb|EMT09205.1|  hypothetical protein F775_19056                       94.4    1e-20   
ref|XP_010088338.1|  hypothetical protein L484_005853                 95.5    2e-20   
ref|XP_002467037.1|  hypothetical protein SORBIDRAFT_01g018660        93.6    7e-20   
gb|KEH18879.1|  Ripening related protein family                       93.6    7e-20   
ref|XP_002467038.1|  hypothetical protein SORBIDRAFT_01g018670        93.6    8e-20   
ref|XP_002968496.1|  hypothetical protein SELMODRAFT_89776            95.5    9e-20   
ref|XP_002448654.1|  hypothetical protein SORBIDRAFT_06g030865        90.9    1e-19   
ref|NP_001176217.1|  Os10g0490400                                     98.6    4e-19   
gb|ABG66160.1|  transposon protein, putative, unclassified, expre...  98.6    4e-19   
gb|EMT22499.1|  hypothetical protein F775_16308                       91.3    6e-19   
gb|EMT19057.1|  hypothetical protein F775_04199                       90.5    1e-18   
ref|XP_006878631.1|  hypothetical protein AMTR_s00011p00263200        89.7    1e-18   
gb|AAS48156.1|  putative ripening related protein                     90.1    1e-18   
gb|KCW77535.1|  hypothetical protein EUGRSUZ_D01855                   88.6    2e-18   
emb|CDM80613.1|  unnamed protein product                              90.1    2e-18   
gb|EMT32636.1|  hypothetical protein F775_12713                       89.7    2e-18   
gb|ABG66161.1|  hypothetical protein LOC_Os10g34896                   91.3    2e-18   
ref|XP_002993372.1|  hypothetical protein SELMODRAFT_136958           90.9    3e-18   
gb|EMT20884.1|  hypothetical protein F775_20950                       89.0    4e-18   
gb|EMT15945.1|  hypothetical protein F775_17478                       89.7    4e-18   
emb|CDM80614.1|  unnamed protein product                              89.0    4e-18   
emb|CBI16341.3|  unnamed protein product                              85.9    7e-18   
gb|EEC67220.1|  hypothetical protein OsI_34131                        89.7    8e-18   
gb|EMT00405.1|  hypothetical protein F775_07903                       88.2    9e-18   
gb|EMT19058.1|  hypothetical protein F775_42530                       88.2    9e-18   
gb|EEE51186.1|  hypothetical protein OsJ_31990                        92.4    1e-17   
ref|XP_003571923.1|  PREDICTED: putative ripening-related protein 6   87.8    1e-17   
emb|CDM80610.1|  unnamed protein product                              87.8    1e-17   
gb|EAZ30382.1|  hypothetical protein OsJ_14431                        86.7    2e-17   
emb|CDM80609.1|  unnamed protein product                              86.7    3e-17   
gb|EMT20326.1|  hypothetical protein F775_12822                       85.1    4e-17   
gb|EMT20878.1|  hypothetical protein F775_20946                       85.9    4e-17   
ref|XP_004986477.1|  PREDICTED: putative ripening-related protein...  87.0    1e-16   
gb|KCW44488.1|  hypothetical protein EUGRSUZ_L01996                   85.5    1e-16   
gb|EMT20883.1|  hypothetical protein F775_20949                       84.7    1e-16   
gb|EMT20325.1|  hypothetical protein F775_12821                       83.2    4e-16   
ref|XP_003600428.1|  hypothetical protein MTR_3g061050                83.2    4e-16   
emb|CDM80607.1|  unnamed protein product                              82.4    8e-16   
gb|EMT22498.1|  hypothetical protein F775_16307                       82.0    1e-15   
ref|XP_007206538.1|  hypothetical protein PRUPE_ppa019631mg           80.1    2e-15   
gb|AAS48157.1|  putative ripening related protein                     81.6    2e-15   
gb|EMT09261.1|  hypothetical protein F775_00970                       80.9    3e-15   
emb|CDM80612.1|  unnamed protein product                              80.9    3e-15   
gb|KCW55868.1|  hypothetical protein EUGRSUZ_I01673                   80.5    8e-15   
ref|XP_003623921.1|  Ripening-related protein                         79.0    1e-14   
ref|XP_011016628.1|  PREDICTED: putative ripening-related protein 1   78.2    2e-14   
gb|EMS67523.1|  hypothetical protein TRIUR3_10386                     78.2    2e-14   
ref|XP_008231515.1|  PREDICTED: probable receptor-like protein ki...  80.9    1e-13   
gb|EMT20882.1|  hypothetical protein F775_20948                       75.1    3e-13   
ref|XP_008791242.1|  PREDICTED: putative ripening-related protein 2   74.7    6e-13   
ref|XP_006445075.1|  hypothetical protein CICLE_v10022646mg           74.3    9e-13   
gb|EEC67217.1|  hypothetical protein OsI_34117                        72.0    1e-12   
gb|KDO86115.1|  hypothetical protein CISIN_1g033235mg                 72.8    2e-12   
ref|XP_002974255.1|  hypothetical protein SELMODRAFT_100881           72.4    4e-12   
ref|XP_002985625.1|  hypothetical protein SELMODRAFT_16503            72.0    4e-12   
gb|EMT23802.1|  hypothetical protein F775_01366                       71.6    5e-12   
gb|EMT23803.1|  hypothetical protein F775_12105                       72.4    7e-12   
ref|XP_004500182.1|  PREDICTED: uncharacterized protein LOC101498409  73.9    2e-11   
gb|EMT20877.1|  hypothetical protein F775_23651                       71.2    2e-11   
ref|XP_002972760.1|  hypothetical protein SELMODRAFT_17406            69.7    2e-11   
ref|XP_002976185.1|  hypothetical protein SELMODRAFT_37504            69.3    3e-11   
ref|XP_002968190.1|  hypothetical protein SELMODRAFT_16548            69.3    4e-11   
ref|XP_010088339.1|  hypothetical protein L484_005854                 67.8    9e-11   
ref|XP_002976190.1|  hypothetical protein SELMODRAFT_16546            68.6    9e-11   
ref|XP_002529429.1|  conserved hypothetical protein                   66.6    1e-10   
gb|EMT19602.1|  hypothetical protein F775_16985                       67.8    2e-10   
ref|XP_002993404.1|  hypothetical protein SELMODRAFT_27357            67.4    2e-10   
ref|XP_008664820.1|  PREDICTED: uncharacterized protein LOC103643424  68.9    2e-10   
ref|XP_008219641.1|  PREDICTED: probable receptor-like protein ki...  71.6    2e-10   
tpg|DAA49528.1|  TPA: hypothetical protein ZEAMMB73_599044            68.9    3e-10   
ref|XP_008245071.1|  PREDICTED: probable receptor-like protein ki...  69.7    6e-10   
gb|EMT20881.1|  hypothetical protein F775_20947                       66.2    7e-10   
ref|XP_006445070.1|  hypothetical protein CICLE_v10023281mg           65.5    7e-10   
tpg|DAA49527.1|  TPA: hypothetical protein ZEAMMB73_192145            68.6    1e-09   
gb|KDP25445.1|  hypothetical protein JCGZ_20601                       63.9    1e-09   



>gb|AGC39165.1| kiwellin [Actinidia deliciosa]
Length=213

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG CKP G++TC 
Sbjct  22   GTSISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHICRGTTPSPQPGGCKPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39164.1| kiwellin [Actinidia deliciosa]
Length=213

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP VGTHICRG + +P PG CKP G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHICRGTTPSPQPGGCKPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39167.1| kiwellin [Actinidia deliciosa]
Length=213

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG CKP G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIEGKCNDDPEVGTHICRGTTPSPQPGGCKPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39166.1| kiwellin [Actinidia deliciosa]
Length=213

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP VGTHICRG + +P PG CKP G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHICRGTTPSPQPGGCKPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39171.1| kiwellin [Actinidia eriantha]
Length=213

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = +1

Query  103  FSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGS  279
             +  G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG C P G+
Sbjct  18   LAPSGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHICRGTTPSPQPGGCNPSGT  77

Query  280  MTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGW  459
            +TC G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGW
Sbjct  78   LTCRGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDERYHSNNERIVALSTGW  137

Query  460  YAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDL  639
            Y GGSRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ L
Sbjct  138  YNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSAL  197

Query  640  GLDKDLGRVSLTWAMA  687
            GLDK++G V +TW+MA
Sbjct  198  GLDKNVGVVDITWSMA  213



>gb|AGC39168.1| kiwellin [Actinidia chinensis]
Length=213

 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG CKP G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHICRGTTPSPQPGGCKPSGTLTCQ  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSHPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGL+K
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLNK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39169.1| kiwellin [Actinidia eriantha]
Length=213

 Score =   286 bits (733),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG C P G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHICRGTTPSPQPGGCNPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDERYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>gb|AGC39173.1| kiwellin [Actinidia arguta]
Length=213

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 162/193 (84%), Gaps = 3/193 (2%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTP--GNCKPVGSMTC  288
            G ++SSCNGPC  L+DC+GQLICI GKCNDDP+VGTHIC GG+TP+P  G+CKP G++TC
Sbjct  22   GASISSCNGPCRDLNDCNGQLICIKGKCNDDPEVGTHIC-GGTTPSPQPGSCKPSGTLTC  80

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY G
Sbjct  81   QGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNG  140

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            GSRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLD
Sbjct  141  GSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLD  200

Query  649  KDLGRVSLTWAMA  687
            K++G V +TW+MA
Sbjct  201  KNVGVVDITWSMA  213



>gb|AGC39170.1| kiwellin [Actinidia eriantha]
Length=213

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCN  291
            G ++SSCNGPC  L+DC GQLICI GKCNDDP VGTHICRG + +P PG C P G++TC 
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHICRGTTPSPQPGGCNPSGTLTCR  81

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GG
Sbjct  82   GKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDERYHSNNERIVALSTGWYNGG  141

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK
Sbjct  142  SRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDK  201

Query  652  DLGRVSLTWAMA  687
            ++G V +TW+MA
Sbjct  202  NVGVVDITWSMA  213



>pdb|4PMK|A Chain A, Crystal Structure Of Kiwellin
 pdb|4PMK|B Chain B, Crystal Structure Of Kiwellin
Length=189

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = +1

Query  124  LSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCNGET  300
            +SSCNGPC  L+DC GQLICI GKCNDDP+VGTHICRG + +P PG CKP G++TC G++
Sbjct  1    ISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHICRGTTPSPQPGGCKPSGTLTCQGKS  60

Query  301  KSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRC  480
              TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY GGSRC
Sbjct  61   HPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNGGSRC  120

Query  481  EKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLG  660
             KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGL+K++G
Sbjct  121  GKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLNKNVG  180

Query  661  RVSLTWAMA  687
             V +TW+MA
Sbjct  181  VVDITWSMA  189



>gb|AGC39172.1| kiwellin [Actinidia arguta]
Length=213

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 160/193 (83%), Gaps = 3/193 (2%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTP--GNCKPVGSMTC  288
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHIC GG+TP+P  G+C P G++TC
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC-GGTTPSPQPGSCNPSGTLTC  80

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY G
Sbjct  81   QGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNG  140

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            GSRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLD
Sbjct  141  GSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLD  200

Query  649  KDLGRVSLTWAMA  687
            K++G V +TW+MA
Sbjct  201  KNVGVVDITWSMA  213



>gb|AGC39174.1| kiwellin [Actinidia arguta]
Length=213

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = +1

Query  115  GNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTP--GNCKPVGSMTC  288
            G ++SSCNGPC  L+DC GQLICI GKCNDDP+VGTHIC GG+TP+P  G C P G++TC
Sbjct  22   GASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC-GGTTPSPQPGGCNPSGTLTC  80

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             G++  TY CSPP+ SSTPA LT NDFSEGGDGG PSECDE YH NNER+VALSTGWY G
Sbjct  81   QGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECDESYHSNNERIVALSTGWYNG  140

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            GSRC KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLD
Sbjct  141  GSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLD  200

Query  649  KDLGRVSLTWAMA  687
            K++G V +TW+MA
Sbjct  201  KNVGVVDITWSMA  213



>ref|XP_011042953.1| PREDICTED: kiwellin-like [Populus euphratica]
Length=213

 Score =   282 bits (721),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 155/200 (78%), Gaps = 3/200 (2%)
 Frame = +1

Query  94   FFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTP--GNCK  267
             F F+   NA+SSCNGPC T DDC GQLICI GKCNDDPDVGT+IC GGS+P+P  GNC+
Sbjct  15   IFYFTFPSNAISSCNGPCQTSDDCDGQLICINGKCNDDPDVGTNICSGGSSPSPPEGNCQ  74

Query  268  PVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVAL  447
            P G++TC      TY CSPP  SST A LTLNDFSEGGDGGAPSECDE YH   E VVAL
Sbjct  75   PSGTLTCGDNAYPTYTCSPPESSSTDAQLTLNDFSEGGDGGAPSECDESYHAKTELVVAL  134

Query  448  STGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAV  627
            STGW+AG S+C  MIRI A NGRS TAKVVDECDSMHGCD EH  Q PC NNIVDGS AV
Sbjct  135  STGWFAGRSKCGSMIRISA-NGRSVTAKVVDECDSMHGCDSEHANQPPCKNNIVDGSDAV  193

Query  628  WNDLGLDKDLGRVSLTWAMA  687
            W  LGLDK++G V +TW+MA
Sbjct  194  WEALGLDKEVGVVPVTWSMA  213



>ref|XP_006488056.1| PREDICTED: kiwellin-like [Citrus sinensis]
 gb|KDO60175.1| hypothetical protein CISIN_1g040138mg [Citrus sinensis]
Length=216

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +1

Query  94   FFC---FSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPGNC  264
            FFC     L  NA+S CNGPC TLDDC GQLICI GKCNDDPDVGTHIC+GG     GNC
Sbjct  16   FFCTISLPLYSNAISQCNGPCGTLDDCDGQLICINGKCNDDPDVGTHICKGGEGGGGGNC  75

Query  265  KPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVA  444
            +P G++TC G +  TY+CSPP+ SST A LT NDFSEGGDGG PSECD  YHDN++ + A
Sbjct  76   QPSGTLTCQGNSYPTYKCSPPVTSSTQARLTNNDFSEGGDGGGPSECDGQYHDNSKPIAA  135

Query  445  LSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAA  624
            LSTGWY+GGSRC KMIRI A+NGRS  A+VVDECDSM GCD+EH GQ PCDNNIVDGS A
Sbjct  136  LSTGWYSGGSRCGKMIRITANNGRSVLAQVVDECDSMRGCDEEHAGQPPCDNNIVDGSDA  195

Query  625  VWNDLGLDKDLGRVSLTWAMA  687
            VW+ LGLDK++G V +TW+M+
Sbjct  196  VWSALGLDKEIGIVDVTWSMS  216



>ref|XP_007016801.1| Kiwellin [Theobroma cacao]
 gb|EOY34420.1| Kiwellin [Theobroma cacao]
Length=214

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +1

Query  61   LALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGG  240
            + L SL  F I        NA+S CNG C  L+DC GQLICI G+CNDDPD+GT IC   
Sbjct  5    VFLASLSFFFILISSPWLSNAISQCNGRCRDLNDCDGQLICINGQCNDDPDLGTRICGTP  64

Query  241  STPTPG-NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHY  417
            S+P+PG NC P GS+ CNG+T  TY CSPP+ SST A LT NDFSEGGDGGAPSECD+ Y
Sbjct  65   SSPSPGTNCNPSGSLRCNGQTYPTYICSPPITSSTKARLTNNDFSEGGDGGAPSECDDRY  124

Query  418  HDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCD  597
            H N+ERVVALSTGWYAGGSRC KMI I ASNGRS TAKVVDECDSM GCD+EH  Q PC 
Sbjct  125  HSNSERVVALSTGWYAGGSRCGKMITITASNGRSVTAKVVDECDSMRGCDEEHAYQPPCK  184

Query  598  NNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            NNIVDGS AVW  LGLDK++G V +TW+ A
Sbjct  185  NNIVDGSDAVWTALGLDKNVGIVDVTWSTA  214



>ref|XP_006424528.1| hypothetical protein CICLE_v10030227mg [Citrus clementina]
 gb|ESR37768.1| hypothetical protein CICLE_v10030227mg [Citrus clementina]
Length=250

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = +1

Query  94   FFC---FSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPGNC  264
            FFC     L  NA+S CNGPC TLDDC GQLICI GKCNDDPDVGTHIC+GG     GNC
Sbjct  50   FFCTISLPLYSNAISQCNGPCGTLDDCDGQLICINGKCNDDPDVGTHICKGGEGGGGGNC  109

Query  265  KPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVA  444
            +P G++TC G +  TY+CSP + SST A LT NDFSEGGDGG PSECD  YHDN++ +VA
Sbjct  110  QPSGTLTCQGNSYPTYKCSPSVTSSTQARLTNNDFSEGGDGGGPSECDGQYHDNSKPIVA  169

Query  445  LSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAA  624
            LSTGWY+GGSRC KMIRI A+NGRS  A+VVDECDSM GCD+EH GQ PCDNNIVDGS A
Sbjct  170  LSTGWYSGGSRCGKMIRITANNGRSVLAQVVDECDSMRGCDEEHAGQPPCDNNIVDGSDA  229

Query  625  VWNDLGLDKDLGRVSLTWAMA  687
            VW+ LGLDK++G V +TW+M+
Sbjct  230  VWSALGLDKEIGIVDVTWSMS  250



>sp|P84527.1|KIWEL_ACTDE RecName: Full=Kiwellin; AltName: Allergen=Act d 5; Contains: 
RecName: Full=Kissper; Contains: RecName: Full=KiTH-3; Contains: 
RecName: Full=KiTH-1; Contains: RecName: Full=KiTH-2 [Actinidia 
deliciosa]
Length=189

 Score =   278 bits (712),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +1

Query  124  LSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS-TPTPGNCKPVGSMTCNGET  300
            +SSCNGPC  L+DC GQLICI GKCNDDP VGTHICRG + +  PG CKP G++TC G++
Sbjct  1    ISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHICRGTTHSHQPGGCKPSGTLTCRGKS  60

Query  301  KSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRC  480
              TY CSPP+ SSTPA LT NDFSEGGD G PSECDE YH+NNER+VALSTGWY GGSRC
Sbjct  61   YPTYDCSPPVTSSTPAKLTNNDFSEGGDDGGPSECDESYHNNNERIVALSTGWYNGGSRC  120

Query  481  EKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLG  660
             KMIRI ASNG+S +AKVVDECDS HGCD EH GQ PC NNIVDGS AVW+ LGLDK++G
Sbjct  121  GKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDKNVG  180

Query  661  RVSLTWAMA  687
             V +TW+MA
Sbjct  181  VVDITWSMA  189



>ref|XP_002285310.1| PREDICTED: kiwellin [Vitis vinifera]
Length=217

 Score =   279 bits (714),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 164/217 (76%), Gaps = 5/217 (2%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNAL--SSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTH  225
            MAN  L    ++ +F  FSL    L  SSCN PC TLDDC GQLICI G+CNDDPD+GTH
Sbjct  1    MANQVLFLQSLYLLFSIFSLPFLPLVMSSCNDPCQTLDDCEGQLICINGQCNDDPDLGTH  60

Query  226  ICRGG---STPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            IC G    S+P+  +C+P GS+ CNG++  TY CSP + SST A+LT NDFSEGGDGG P
Sbjct  61   ICGGSPGTSSPSTDDCQPSGSLECNGQSYPTYTCSPQVTSSTSAVLTKNDFSEGGDGGGP  120

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S+CD+ YH+N++ ++ALSTGWY GGS C KMIRI A NG S  AKVVDECDSMHGCD EH
Sbjct  121  SKCDDKYHENSDPIIALSTGWYNGGSLCGKMIRITAQNGMSVLAKVVDECDSMHGCDQEH  180

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             GQ PCDNNIVDGS AVW+ LGLD ++GRV +TW+MA
Sbjct  181  AGQRPCDNNIVDGSNAVWDALGLDINIGRVDVTWSMA  217



>ref|XP_011013321.1| PREDICTED: kiwellin-like [Populus euphratica]
Length=213

 Score =   279 bits (713),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 155/200 (78%), Gaps = 3/200 (2%)
 Frame = +1

Query  94   FFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTP--GNCK  267
             F F+   NA+SSCNGPC T DDC GQLICI GKCNDDPDVGT+IC GGS+P+P  GNC+
Sbjct  15   IFYFTFPSNAISSCNGPCQTSDDCDGQLICINGKCNDDPDVGTNICSGGSSPSPPEGNCQ  74

Query  268  PVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVAL  447
              G++TC   +  TY CSPP  SST A LTLNDFSEGGDGGAPSECDE YH   E VVAL
Sbjct  75   SSGTLTCGDNSYPTYTCSPPESSSTDAQLTLNDFSEGGDGGAPSECDESYHAKTELVVAL  134

Query  448  STGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAV  627
            STGW+AG S+C  MIRI A NGRS TAKVVDECDSMHGCD EH  Q PC NNIVDGS AV
Sbjct  135  STGWFAGRSKCGSMIRISA-NGRSVTAKVVDECDSMHGCDSEHANQPPCKNNIVDGSDAV  193

Query  628  WNDLGLDKDLGRVSLTWAMA  687
            W  LGLDK++G V +TW+MA
Sbjct  194  WEALGLDKEVGVVPVTWSMA  213



>ref|XP_010109489.1| hypothetical protein L484_007509 [Morus notabilis]
 gb|EXC22900.1| hypothetical protein L484_007509 [Morus notabilis]
Length=213

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 161/216 (75%), Gaps = 7/216 (3%)
 Frame = +1

Query  52   MANLALISL---CIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MA  A + +    IF I    SL  +A+SSC G C  L+DC GQLICI GKCNDD D+GT
Sbjct  1    MARFAFLDVSLSLIFNILISQSLPSHAISSCYGSCRDLNDCEGQLICINGKCNDDTDLGT  60

Query  223  HICRGGSTPTPGN-CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPS  399
             ICR   TP PG  CK  G++TC+G T  TYRCSPP+ SST A LT NDFSEGGDGG PS
Sbjct  61   RICR--RTPAPGGGCKQYGTLTCDGNTYPTYRCSPPVTSSTQAKLTNNDFSEGGDGGGPS  118

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECD+ YH N+ER+VALSTGWY GGSRC KMIRI A NGRS  AKVVDECDSMHGCD EH 
Sbjct  119  ECDDRYHSNSERIVALSTGWYDGGSRCGKMIRITA-NGRSVVAKVVDECDSMHGCDAEHA  177

Query  580  GQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            GQ PC NNIVDGS AVW+ LGL+KDLG V +TW+MA
Sbjct  178  GQPPCKNNIVDGSDAVWSALGLNKDLGVVDVTWSMA  213



>ref|XP_008385345.1| PREDICTED: kiwellin-like [Malus domestica]
Length=217

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 162/214 (76%), Gaps = 6/214 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            +  L LI L I ++ F       A+SSCN  C TLDDC+GQLICI GKCNDDPD+G+  C
Sbjct  8    LVPLTLIVLSIVSLPF----PSTAISSCNDACKTLDDCAGQLICINGKCNDDPDIGSTEC  63

Query  232  RGGSTPTPG--NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            R GS+P P   NCK  G++ CNG++  TY CSP + SST A LTLNDFS+GGDGGAPS C
Sbjct  64   RHGSSPPPTTDNCKSSGTLVCNGKSYPTYTCSPAVTSSTKASLTLNDFSQGGDGGAPSYC  123

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH+N+ERVVALSTGW+   SRC  +IRI ASNG+S TAKVVDECDS  GCD+EHGGQ
Sbjct  124  DGKYHNNSERVVALSTGWFNNKSRCFNLIRITASNGKSVTAKVVDECDSRAGCDEEHGGQ  183

Query  586  GPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             PC NNIVDGS+AVWN LGL+KDLG V +TW+MA
Sbjct  184  PPCRNNIVDGSSAVWNALGLNKDLGVVPVTWSMA  217



>ref|XP_002529427.1| Kiwellin, putative [Ricinus communis]
 gb|EEF32953.1| Kiwellin, putative [Ricinus communis]
Length=213

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = +1

Query  61   LALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGG  240
            + L SL +      F+   NA+SSCNGPC TL+DC GQLICI G+CNDDPD+G+HIC  G
Sbjct  9    IHLFSLSLIFNSILFASLSNAISSCNGPCQTLNDCDGQLICINGQCNDDPDIGSHICSAG  68

Query  241  STPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
             +    +C+  GSMTC  ++  TY CSPP+ S+T A LTLNDFS+GGDGGAPSECDE YH
Sbjct  69   GS----DCQASGSMTCADKSYPTYTCSPPVTSATTAKLTLNDFSKGGDGGAPSECDEDYH  124

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
            D  E VVALSTGWY GGSRC +MIRI ASNGRSTTAKVVDECDS +GCD EH  Q PC N
Sbjct  125  DPTESVVALSTGWYNGGSRCGQMIRISASNGRSTTAKVVDECDSRNGCDSEHAYQPPCRN  184

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            ++VDGS AVW  LGLDK LG V +TW+MA
Sbjct  185  DVVDGSDAVWGALGLDKSLGIVDVTWSMA  213



>ref|XP_009757783.1| PREDICTED: kiwellin-like [Nicotiana sylvestris]
Length=212

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 161/212 (76%), Gaps = 5/212 (2%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            +  L  +SLCIF IF       +A+SSCNGPC TLDDC GQLICI GKCNDDPDVGT+IC
Sbjct  6    IIKLIFLSLCIFTIF---ISSSSAISSCNGPCQTLDDCDGQLICIRGKCNDDPDVGTNIC  62

Query  232  RGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
               S P P NC+P G + C+G T   YRCSPP+  ST A LTLNDFSEGGDGG PS+CD+
Sbjct  63   NN-SPPDPNNCQPSGQVNCHG-THPIYRCSPPVTGSTSAKLTLNDFSEGGDGGGPSKCDD  120

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YHDNNER+VALSTGWYAGGSRC KMIRIRA+NG+S TAKVVD CDS  GCD EHG Q P
Sbjct  121  QYHDNNERIVALSTGWYAGGSRCGKMIRIRANNGKSVTAKVVDGCDSTTGCDAEHGYQRP  180

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C  NIVD S AVW DLGLD D G V +TW++A
Sbjct  181  CKYNIVDASVAVWRDLGLDTDTGVVPITWSVA  212



>ref|XP_003638071.1| Ripening-related protein grip22 [Medicago truncatula]
 gb|KEH39367.1| Ripening related protein family [Medicago truncatula]
Length=220

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 162/220 (74%), Gaps = 11/220 (5%)
 Frame = +1

Query  61   LALISLCIF-AIFFCFSLQG-----NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            +A IS  IF A  F F++       NA+SSCNGPC TL+DC GQLICI GKCNDDPD+GT
Sbjct  1    MARISNLIFLACIFLFNIINIPFLTNAISSCNGPCNTLNDCDGQLICINGKCNDDPDIGT  60

Query  223  HICRGGSTPTPG-----NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDG  387
            HIC   S   P       C+  G++ C  ++   YRCSPP+ SST A LTLNDFSEGGDG
Sbjct  61   HICTNPSPSPPSGGGGGTCQSSGTLQCKKKSYPQYRCSPPVSSSTQASLTLNDFSEGGDG  120

Query  388  GAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCD  567
            G PS+CDE YHDN+ERVVALSTGWY GGSRC KMIRI A NGRS TAKVVD+CDS++GCD
Sbjct  121  GGPSQCDEKYHDNSERVVALSTGWYNGGSRCGKMIRITARNGRSVTAKVVDQCDSVNGCD  180

Query  568  DEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             EH GQ PC NNIVDGS +VWN LGL+ D G V +TW+MA
Sbjct  181  KEHAGQPPCHNNIVDGSVSVWNALGLNTDDGVVPVTWSMA  220



>ref|XP_010109492.1| hypothetical protein L484_007512 [Morus notabilis]
 gb|EXC22903.1| hypothetical protein L484_007512 [Morus notabilis]
Length=216

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 160/219 (73%), Gaps = 10/219 (5%)
 Frame = +1

Query  52   MANLAL--ISLCIFAIF----FCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPD  213
            MA L+   +SL  F +F        L  +A+SSCNGPC  L+DC GQLICI GKC+DDPD
Sbjct  1    MARLSFLDVSLSFFLVFNIMISMLPLPSHAISSCNGPCRDLNDCDGQLICINGKCDDDPD  60

Query  214  VGTHICRGGSTPTPGN-CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
            +G  IC    +P PG  CK  G++TC+G T  TY+CSP + SSTPA LT NDFSEGGDGG
Sbjct  61   IGIRIC---PSPAPGGGCKQYGTLTCDGRTYPTYKCSPQITSSTPAKLTNNDFSEGGDGG  117

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
             PS CD  YH N+ERVVALSTGW+A  SRC KMIRIRASNGRS  AKVVDECDSM GCD+
Sbjct  118  GPSYCDGKYHSNSERVVALSTGWFANRSRCGKMIRIRASNGRSVLAKVVDECDSMRGCDE  177

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            EH  Q PC NNIVDGS AVW+ LGLDKD G V +TW+MA
Sbjct  178  EHAFQPPCKNNIVDGSDAVWSALGLDKDWGIVDVTWSMA  216



>ref|XP_002285296.1| PREDICTED: kiwellin-like [Vitis vinifera]
Length=216

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 150/200 (75%), Gaps = 2/200 (1%)
 Frame = +1

Query  94   FFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICR--GGSTPTPGNCK  267
             F       A+SSC GPC TL+DC GQLIC+ GKCNDDPDVGTHIC+    S P+  NC+
Sbjct  17   IFSLPFLAFAISSCGGPCQTLNDCEGQLICVSGKCNDDPDVGTHICQTPSPSPPSGSNCQ  76

Query  268  PVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVAL  447
              G++TC G +  TYRCSP + SSTPA LT NDFSEGGDGG  SECDE YH N+ER+VAL
Sbjct  77   ASGTLTCGGISYPTYRCSPRVTSSTPAKLTNNDFSEGGDGGGASECDEQYHSNSERIVAL  136

Query  448  STGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAV  627
            STGWY GGSRC KMIRI A NGRS  AKVVDECDSM GCD EH  Q PC NNIVDGS AV
Sbjct  137  STGWYNGGSRCGKMIRITAQNGRSVVAKVVDECDSMRGCDQEHAYQPPCKNNIVDGSDAV  196

Query  628  WNDLGLDKDLGRVSLTWAMA  687
            W+ LGLDKD+G V +TW MA
Sbjct  197  WSALGLDKDIGVVDVTWTMA  216



>ref|XP_006340162.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=212

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 157/217 (72%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA +SL I  IF   S   NA+S CNGPC T DDC GQLICI GKCNDDP+VGT +C
Sbjct  1    MSNLAFLSL-ILTIFISTS---NAISQCNGPCKTWDDCDGQLICINGKCNDDPNVGTKVC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            +      P       C+P G++ CNG     YRCSPP+ SSTPA LTLNDFSEGGDGG P
Sbjct  57   KSNPPSVPSPTPTNTCRPSGTINCNG-VHPIYRCSPPVTSSTPAQLTLNDFSEGGDGGGP  115

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CD  YH+NNERVVALSTGW+AG SRC KMI IRA+NG++ TAKVVDECDS  GCD EH
Sbjct  116  SSCDGKYHNNNERVVALSTGWFAGRSRCGKMILIRANNGKTVTAKVVDECDSTMGCDAEH  175

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              Q PC NNIVDGS AVW  LGL+ DLG V +TW+M 
Sbjct  176  AFQSPCKNNIVDGSIAVWRALGLNTDLGIVPVTWSMV  212



>gb|KDP44017.1| hypothetical protein JCGZ_05484 [Jatropha curcas]
Length=206

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 153/206 (74%), Gaps = 7/206 (3%)
 Frame = +1

Query  91   IFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPG----  258
            +   F    N++SSCNGPC T +DC GQLICI G+CNDDPDVGTHIC GG          
Sbjct  1    MIISFPKLSNSISSCNGPCKTENDCDGQLICINGRCNDDPDVGTHICTGGGGNPSPPSPP  60

Query  259  ---NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
               NCKP G++TC G++   Y CSPP+ SST A LTLNDFSEGGDGG  SECDE YH+  
Sbjct  61   SNDNCKPYGTLTCKGKSYPKYSCSPPVTSSTRAKLTLNDFSEGGDGGDKSECDEKYHEKT  120

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            ERVVALSTGWYAGG+RC KMI+I ASNGRS  AKVVDECDS +GCD EH GQ PC NNIV
Sbjct  121  ERVVALSTGWYAGGTRCLKMIKITASNGRSVEAKVVDECDSRNGCDTEHAGQPPCKNNIV  180

Query  610  DGSAAVWNDLGLDKDLGRVSLTWAMA  687
            DGS AVW  LGL+KD+G V +TW+MA
Sbjct  181  DGSDAVWEALGLNKDVGVVDVTWSMA  206



>ref|XP_010313436.1| PREDICTED: kiwellin-like [Solanum lycopersicum]
Length=212

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 158/217 (73%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA++SL IF IF   S   NA+S CNGPC T DDC GQLICI GKCNDDP+VGT +C
Sbjct  1    MSNLAILSL-IFTIFISTS---NAISQCNGPCKTWDDCDGQLICINGKCNDDPNVGTKVC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            +      P       C+P G++ CNG     YRCSPP+ SSTPA LTLN+F+ GGDGG P
Sbjct  57   KNSPPSVPSPTPSNTCRPSGTINCNG-VHPIYRCSPPVTSSTPAQLTLNNFARGGDGGGP  115

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CD  YHDNNE +VALSTGW+AG SRC KMIRIRA+NG++ TAKVVDECDS  GCD EH
Sbjct  116  SSCDGKYHDNNESIVALSTGWFAGRSRCGKMIRIRANNGKTVTAKVVDECDSTMGCDAEH  175

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              Q PC NNIVDGS AVW  LGL+ +LG V +TW+M 
Sbjct  176  AFQSPCKNNIVDGSIAVWRALGLNTNLGIVPVTWSMV  212



>ref|XP_008226062.1| PREDICTED: LOW QUALITY PROTEIN: kiwellin-like [Prunus mume]
Length=216

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 160/217 (74%), Gaps = 6/217 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA+ +++ +    I     L   A+SSCNG C TL+DC+GQLICI GKCNDDPD+G++ C
Sbjct  1    MASTSVLLVSXINIIT-LPLLSTAISSCNGSCKTLNDCAGQLICINGKCNDDPDIGSNEC  59

Query  232  RGGSTP-----TPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
             GG        T  NC+P G++ C G++   Y CSPP+ SST A LTLNDFSEGGDGG P
Sbjct  60   GGGGGSSSPPPTTNNCQPSGTLVCQGKSYPKYTCSPPVTSSTKASLTLNDFSEGGDGGGP  119

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CDE YH N+ERVVALSTGW+   SRC KMIRIRASNG+S TAKVVDECDS  GCD EH
Sbjct  120  SYCDEKYHANSERVVALSTGWFDNKSRCGKMIRIRASNGKSVTAKVVDECDSRAGCDAEH  179

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             GQ PC NNIVDGSAAVWN LGL++DLG V +TW+MA
Sbjct  180  AGQPPCRNNIVDGSAAVWNALGLNQDLGVVPVTWSMA  216



>gb|EYU30424.1| hypothetical protein MIMGU_mgv1a018280mg [Erythranthe guttata]
Length=220

 Score =   264 bits (675),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 160/221 (72%), Gaps = 10/221 (5%)
 Frame = +1

Query  52   MANLALISLCIF---AIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MAN   IS C+F   +I   F++ GNA  SCNG C TL+DC+GQLIC  GKCNDDP VG+
Sbjct  1    MANTIPISFCLFTLISIIIQFAI-GNAQPSCNGLCQTLNDCAGQLICSNGKCNDDPRVGS  59

Query  223  HICRGGSTPTPG------NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGD  384
            H+C G    + G       C+P G++ C G++   Y CSP + SSTPA LTLNDFSEGGD
Sbjct  60   HVCSGSGGGSGGGGGGGGQCRPSGTLHCRGKSYPQYSCSPVVSSSTPAKLTLNDFSEGGD  119

Query  385  GGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGC  564
            GG PSECD  YH  +ERVVALSTGWY GGSRC KMIRI A NGRSTTAKVVDECD  +GC
Sbjct  120  GGGPSECDNKYHSKSERVVALSTGWYNGGSRCGKMIRIVARNGRSTTAKVVDECDLRNGC  179

Query  565  DDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            D EH GQ PC NNIVDGS AVW  LGLD+D+G V +TW+MA
Sbjct  180  DKEHAGQPPCLNNIVDGSDAVWKALGLDEDIGVVPVTWSMA  220



>emb|CAJ77500.1| putative kiwellin ripening-related protein precursor [Solanum 
tuberosum]
Length=212

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 156/216 (72%), Gaps = 10/216 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA +SL I  IF   S   NA+S CNGPC T DDC GQLICI GKCNDDP+VGT +C
Sbjct  1    MSNLAFLSL-ILTIFISTS---NAISQCNGPCKTWDDCDGQLICINGKCNDDPNVGTKVC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            +      P       C+P G++ CNG     YRCSPP+ SSTPA LTLNDFSEGGDGG P
Sbjct  57   KSNPPSVPSPTPTNTCRPSGTINCNG-VHPIYRCSPPVTSSTPAQLTLNDFSEGGDGGGP  115

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CD  YH+NNERVVALSTGW+AG S C KMI IRA+NG++ TAKVVDECDS  GCD EH
Sbjct  116  SSCDGKYHNNNERVVALSTGWFAGRSMCGKMILIRANNGKTVTAKVVDECDSTMGCDAEH  175

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAM  684
              Q PC NNIVDGS AVW  LGL+ DLG V +TW++
Sbjct  176  AFQSPCKNNIVDGSIAVWRALGLNTDLGIVPVTWSI  211



>ref|XP_007207915.1| hypothetical protein PRUPE_ppa019189mg [Prunus persica]
 gb|EMJ09114.1| hypothetical protein PRUPE_ppa019189mg [Prunus persica]
Length=220

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 152/203 (75%), Gaps = 5/203 (2%)
 Frame = +1

Query  94   FFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTP-----TPG  258
                 L   A+SSCNG C TL+DC+GQLICI GKCNDDPD+G++ C GG        T  
Sbjct  18   IITLPLLSTAISSCNGACKTLNDCAGQLICINGKCNDDPDIGSNECGGGGGSSSPPPTTN  77

Query  259  NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERV  438
            NC+P G++ C G++   Y CSPP+ SST A LTLNDFSEGGDGG PS CDE YH N+ERV
Sbjct  78   NCQPSGTLVCQGKSYPKYTCSPPVTSSTKASLTLNDFSEGGDGGGPSYCDEKYHANSERV  137

Query  439  VALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGS  618
            VALSTGW+   SRC KMIRIRASNG+S TAKVVDECDS  GCD EH GQ PC N+IVDGS
Sbjct  138  VALSTGWFDNKSRCLKMIRIRASNGKSVTAKVVDECDSRAGCDAEHAGQPPCRNDIVDGS  197

Query  619  AAVWNDLGLDKDLGRVSLTWAMA  687
            AAVWN LGL++DLG V +TW+MA
Sbjct  198  AAVWNALGLNQDLGVVPVTWSMA  220



>ref|XP_010038386.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
 gb|KCW46105.1| hypothetical protein EUGRSUZ_K00024 [Eucalyptus grandis]
Length=214

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
            L++L I      FS   +A+SSCNGPC TL+DC+GQLICI GKCNDDPDVGTHIC G   
Sbjct  8    LLALPIVISINLFSSPSHAISSCNGPCHTLNDCTGQLICINGKCNDDPDVGTHICSG--I  65

Query  247  PTPGN-CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHD  423
            P+PG  C+P G++ C G +   Y CSPP+ SST A LT NDFS+GGDGG PSECD  YHD
Sbjct  66   PSPGGGCQPSGTLYCRGNSYPKYTCSPPVTSSTQATLTNNDFSQGGDGGGPSECDGSYHD  125

Query  424  NNERVVALSTGWYAGGSRCEKMIRIRASN-GRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
            NNE++VALSTGWYAGGSRC  MI+I ++   RS  AKVVDECDSM+GCD EH  Q PC N
Sbjct  126  NNEKIVALSTGWYAGGSRCGHMIKIISTKTKRSVMAKVVDECDSMNGCDGEHAYQPPCKN  185

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            NIVDGS  VWN LGLD ++G  ++TW+MA
Sbjct  186  NIVDGSNGVWNALGLDTEVGLEAITWSMA  214



>ref|XP_010043782.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
 ref|XP_010043783.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
 gb|KCW85769.1| hypothetical protein EUGRSUZ_B02525 [Eucalyptus grandis]
 gb|KCW85770.1| hypothetical protein EUGRSUZ_B02526 [Eucalyptus grandis]
Length=215

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
            L++L I      FS   +A+SSCNGPC TLDDC+GQLICI GKC+DDPDVGTH+C    +
Sbjct  8    LLALPIVISINLFSSPSHAISSCNGPCHTLDDCTGQLICINGKCHDDPDVGTHVCPSTPS  67

Query  247  PTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            P+ G C+P G+M C  ++   Y CSPP+ SST A LT NDFSEGGDGG PSECD  YHDN
Sbjct  68   PSGGGCQPSGTMYCQDKSYPKYSCSPPVTSSTQATLTNNDFSEGGDGGGPSECDSSYHDN  127

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASN-GRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            +E++VALSTGWYA GSRC   I+I ++  GRS TAKVVDECDSM+GCD EH  Q PC NN
Sbjct  128  SEKIVALSTGWYADGSRCGNGIKITSTKTGRSVTAKVVDECDSMNGCDGEHANQPPCRNN  187

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            IVDGS AVW+ LGLD  +G   +TW+MA
Sbjct  188  IVDGSKAVWDALGLDIAVGEEDVTWSMA  215



>ref|XP_010109494.1| hypothetical protein L484_007514 [Morus notabilis]
 gb|EXC22905.1| hypothetical protein L484_007514 [Morus notabilis]
Length=216

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 153/219 (70%), Gaps = 10/219 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFC-----FSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDV  216
            MA LA + + +  + F        L  +A+SSCNGPC  L+DC GQLICI GKCNDDPD+
Sbjct  1    MARLAFLDVSLSFLLFIIMISTLPLPSHAISSCNGPCRDLNDCEGQLICINGKCNDDPDI  60

Query  217  GTHICRGGSTPTPGN--CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
            G  IC     P PG   CK   ++TCNG T  TY+CSPP+ SSTPA LT NDFS G DGG
Sbjct  61   GIRIC---PFPAPGGGGCKQYSTLTCNGRTYPTYKCSPPVTSSTPAKLTNNDFSAGWDGG  117

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
              S CD  YH N+ER+VALSTGW+   SRC KMIRIRASNGRS  AKVVDECDSM GCD 
Sbjct  118  GASFCDGKYHSNSERIVALSTGWFDNWSRCGKMIRIRASNGRSVVAKVVDECDSMRGCDQ  177

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            EH  Q PC N+IVDGS AVW+ LGLDKD G V +TW+MA
Sbjct  178  EHAFQPPCQNDIVDGSDAVWSALGLDKDWGVVDVTWSMA  216



>gb|KDP44018.1| hypothetical protein JCGZ_05485 [Jatropha curcas]
Length=218

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 157/219 (72%), Gaps = 8/219 (4%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M N  L    +F I   F+   NA+SSCNGPC T +DC GQLICI G CNDDPD+GT+ C
Sbjct  1    MENTLLFLSLLFNILL-FASTSNAISSCNGPCQTENDCDGQLICIHGSCNDDPDIGTNTC  59

Query  232  RGGSTPTPGN-------CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
             GGS    G        C+P GS+TC G++  TY CSP + SST A LTLNDFSEGGDGG
Sbjct  60   SGGSGGGGGGPSPSDDSCQPSGSLTCQGQSYPTYTCSPTVTSSTNAKLTLNDFSEGGDGG  119

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
            A SECD +YHD  E VVALSTGWYAGG+RC KMIRI ASNG+S  AKVVDECDS +GCD 
Sbjct  120  AQSECDGNYHDKTELVVALSTGWYAGGTRCGKMIRISASNGKSVEAKVVDECDSRNGCDS  179

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            EH GQ PC NNIVDGS AVW  LGL+KD G V +TW+MA
Sbjct  180  EHAGQPPCRNNIVDGSDAVWEALGLNKDDGVVDVTWSMA  218



>ref|XP_010043781.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
 gb|KCW85768.1| hypothetical protein EUGRSUZ_B02524 [Eucalyptus grandis]
Length=215

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 154/208 (74%), Gaps = 1/208 (0%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
            L++L I      FS   +A+SSCNG C TLDDC+GQLIC+ G+C+DDPDVGTH C    +
Sbjct  8    LLALPIVISIALFSSPSHAISSCNGLCHTLDDCTGQLICVNGRCHDDPDVGTHTCPSTPS  67

Query  247  PTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            P+ G C+P G+M C+G++   Y CSPP+ SSTPA LT NDFSEGGDGG PSECD+ YH N
Sbjct  68   PSGGGCQPAGTMNCHGKSFPRYHCSPPVTSSTPATLTNNDFSEGGDGGGPSECDDSYHKN  127

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASNG-RSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            +E +VALSTGWYA GSRC   IRI ++   RS  AKVVDECDSM+GCD EH GQ PC NN
Sbjct  128  SELIVALSTGWYADGSRCANRIRITSTKTRRSVIAKVVDECDSMNGCDGEHAGQPPCKNN  187

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            IVDGS AVW+ LGLD ++G   +TW+M 
Sbjct  188  IVDGSNAVWHALGLDIEVGEEDVTWSMV  215



>ref|NP_001268052.1| ripening-related protein grip22 precursor [Vitis vinifera]
 sp|Q9M4H4.1|GRI22_VITVI RecName: Full=Ripening-related protein grip22; Flags: Precursor 
[Vitis vinifera]
 emb|CAB85629.1| putative ripening-related protein [Vitis vinifera]
Length=220

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = +1

Query  52   MANLALI---SLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MA  AL+   S+C+             LSSC G C TL+D  GQLICI G+CNDDP+VGT
Sbjct  1    MAKSALVWLASVCLVFNILSLPFLALGLSSCGGSCQTLNDYEGQLICINGECNDDPEVGT  60

Query  223  HICRGGSTPTPGNCKPV----GSMTCNG-ETKSTYRCSPPMKSSTPAILTLNDFSEGGDG  387
            HIC G S+             G++ C G + K+TY CSPP+ SSTPA+LT N+F +GGDG
Sbjct  61   HICGGNSSTPSPPPPSTCQPSGTLACKGGKPKNTYTCSPPITSSTPAVLTNNNFEKGGDG  120

Query  388  GAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCD  567
            G PS CD  YHDN+ER+VALSTGWY GGSRC KMIRI A NGRS  AKVVDECDSMHGCD
Sbjct  121  GGPSACDNKYHDNSERIVALSTGWYNGGSRCGKMIRITAQNGRSVLAKVVDECDSMHGCD  180

Query  568  DEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             EH GQ PCDNNIVDGS AVWN LGLD ++G V +TW+MA
Sbjct  181  KEHAGQPPCDNNIVDGSNAVWNALGLDINIGEVDVTWSMA  220



>ref|XP_003543455.1| PREDICTED: kiwellin-like [Glycine max]
Length=216

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 157/212 (74%), Gaps = 5/212 (2%)
 Frame = +1

Query  64   ALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGS  243
            +L+ L    +   F L  NA+  CNGPC TL+DC GQLICI G+CNDD DVGTHIC GG 
Sbjct  6    SLVFLASTFLIINFPLLANAIG-CNGPCRTLNDCDGQLICINGRCNDDRDVGTHICGGGM  64

Query  244  TPTPG----NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
             P P     +C+  G++ C G++   YRCSPP+ SSTPAILTLNDFSEGGDGG PS+CDE
Sbjct  65   PPNPPPSGGSCQSSGTLNCGGKSYPQYRCSPPVTSSTPAILTLNDFSEGGDGGDPSQCDE  124

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             +H+N ERVVALSTGW+ G S C KMIRI A NGR+ TAKVVD+CDS++GCD  H GQ P
Sbjct  125  KFHNNTERVVALSTGWFNGSSLCLKMIRITAGNGRNVTAKVVDQCDSVNGCDRAHAGQPP  184

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C NNIVDGS AVW+ LGLD D+G   +TW+MA
Sbjct  185  CRNNIVDGSQAVWDALGLDSDVGEARVTWSMA  216



>ref|XP_002282561.1| PREDICTED: kiwellin-like [Vitis vinifera]
Length=230

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 153/213 (72%), Gaps = 3/213 (1%)
 Frame = +1

Query  52   MANLALI-SLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHI  228
            MAN+ L+ SLC+      F     A+SSCNGPC T +DC G+LICI GKCNDDP++GTH+
Sbjct  1    MANMPLLLSLCLIYTISFFPFLAFAISSCNGPCRTFNDCDGELICINGKCNDDPELGTHV  60

Query  229  CRG--GSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSE  402
            C G     P  G C   GS+ C G+   TY CSP + SST AILT NDFSEGGDGG PSE
Sbjct  61   CEGVPSPPPPSGYCHSSGSLRCKGQYYPTYTCSPQITSSTSAILTNNDFSEGGDGGGPSE  120

Query  403  CDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGG  582
            CD  YH+N++ +VALSTGWY GG RC KMI+I A NGRS  AKVVDECDS+ GCD+EH  
Sbjct  121  CDGKYHNNSDPIVALSTGWYNGGFRCGKMIKITADNGRSVLAKVVDECDSLRGCDEEHSD  180

Query  583  QGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            Q PC NNIV+GS AVW+ LGLD +LG V +TW+
Sbjct  181  QPPCKNNIVNGSDAVWSALGLDTNLGEVDVTWS  213



>ref|XP_004148934.1| PREDICTED: kiwellin-like [Cucumis sativus]
 gb|KGN44019.1| hypothetical protein Csa_7G106800 [Cucumis sativus]
Length=209

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 162/215 (75%), Gaps = 9/215 (4%)
 Frame = +1

Query  52   MANLAL-ISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHI  228
            MANL   ISL +       SL   A SSC+GPC TLDDC GQLICI G CNDDP++GT+ 
Sbjct  1    MANLVFFISLVLLPHI---SL---ATSSCDGPCQTLDDCEGQLICINGVCNDDPNIGTNQ  54

Query  229  CR-GGSTPTP-GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSE  402
            C  GGS+P+P  +C+ +GS+ C+GE+   Y+CSPP+ SST AILT NDFSEGGDGGA S+
Sbjct  55   CSDGGSSPSPNSDCQQIGSLNCDGESFPQYQCSPPVTSSTQAILTNNDFSEGGDGGAESK  114

Query  403  CDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGG  582
            CDE +HDN+E +VALSTGWY GGSRC KMIRI A+NG S  AKVVDECDS++GCD EH  
Sbjct  115  CDESFHDNSELIVALSTGWYNGGSRCGKMIRITATNGNSVLAKVVDECDSVNGCDAEHAN  174

Query  583  QGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            Q PC NNIVDGS AVW+ L L+KD G  ++TW+ A
Sbjct  175  QPPCRNNIVDGSDAVWSMLELNKDEGEEAITWSDA  209



>ref|XP_004173126.1| PREDICTED: kiwellin-like [Cucumis sativus]
Length=217

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 156/214 (73%), Gaps = 2/214 (1%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            +  L  +    F           A SSC+GPC TLDDC GQLICI G CNDDP++GT+ C
Sbjct  4    ITTLIFLKKTFFISLVLLPHISLATSSCDGPCQTLDDCEGQLICINGVCNDDPNIGTNQC  63

Query  232  R-GGSTPTP-GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
              GGS+P+P  +C+ +GS+ C+GE+   Y+CSPP+ SST AILT NDFSEGGDGGA S+C
Sbjct  64   SDGGSSPSPNSDCQQIGSLNCDGESFPQYQCSPPVTSSTQAILTNNDFSEGGDGGAESKC  123

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            DE +HDN+E +VALSTGWY GGSRC KMIRI A+NG S  AKVVDECDS++GCD EH  Q
Sbjct  124  DESFHDNSELIVALSTGWYNGGSRCGKMIRITATNGNSVLAKVVDECDSVNGCDAEHANQ  183

Query  586  GPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             PC NNIVDGS AVW+ L L+KD G  ++TW+ A
Sbjct  184  PPCRNNIVDGSDAVWSMLELNKDEGEEAITWSDA  217



>ref|XP_006340163.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=212

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 156/217 (72%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA +SL IF IF   S   NA+S CNGPC T DDC GQLICI GKCNDDP+VGT IC
Sbjct  1    MSNLAFLSL-IFTIFISTS---NAISQCNGPCKTWDDCDGQLICINGKCNDDPNVGTKIC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            +      P       C+P G++ CNG     YRCSPP+ SSTPA LT NDF EGGDGG P
Sbjct  57   KSSPPSVPSPTPTNTCRPSGTINCNG-VHPIYRCSPPVTSSTPAQLTFNDFGEGGDGGGP  115

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CD  YH+NNER+VALSTGW+AG SRC KMI IRA+NG++ TAKVVDECDS  GCD EH
Sbjct  116  SSCDGKYHNNNERIVALSTGWFAGRSRCGKMILIRANNGKTVTAKVVDECDSTMGCDAEH  175

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              Q PC NNIVDGS AVW  LGL+ DLG V +TW+M 
Sbjct  176  AFQSPCKNNIVDGSIAVWRALGLNTDLGIVPVTWSMV  212



>ref|XP_004165858.1| PREDICTED: kiwellin-like [Cucumis sativus]
Length=217

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 153/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA L  + + + A     +L G A+SSCNGPC TL+DC GQLICI GKCNDDPDVG+H+C
Sbjct  1    MAKLGWLVVSLSAFVLVTNL-GEAISSCNGPCKTLNDCDGQLICIKGKCNDDPDVGSHVC  59

Query  232  RGGSTPTPGN------CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              G      +      C+P G   CNG +   Y+CSP + SST AILT NDFSEGGDGGA
Sbjct  60   SNGGGGGGSSPPSGSSCQPFGHKICNGRSHPQYKCSPRVTSSTRAILTNNDFSEGGDGGA  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  +H N+E +VALSTGWY GGSRC K I+I  SNG+S  AKVVDECDS++GCD E
Sbjct  120  PSECDNKFHSNSELIVALSTGWYNGGSRCGKKIKITTSNGKSVLAKVVDECDSINGCDAE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H GQ PC NNIVD S AVW  LGL+ D+G V +TW+ A
Sbjct  180  HAGQPPCRNNIVDASNAVWKALGLNTDIGTVPVTWSDA  217



>gb|KGN46856.1| hypothetical protein Csa_6G147495 [Cucumis sativus]
Length=217

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 153/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA L  + +  F++F   +  G A+SSCNGPC TL+DC GQLICI GKCNDDPDVG+H+C
Sbjct  1    MAKLGWL-IVSFSVFVLVTNLGEAISSCNGPCKTLNDCDGQLICIKGKCNDDPDVGSHVC  59

Query  232  RGGSTPTPGN------CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              G      +      C+P G   CNG +   Y+CSP + SST A LT NDFSEGGDGGA
Sbjct  60   SNGGGGGGSSPPSDSSCQPFGHKICNGRSHPQYKCSPRVTSSTRATLTNNDFSEGGDGGA  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  +H N+E +VALSTGWY GGSRC K I+I  SNG+S  AKVVDECDS++GCD E
Sbjct  120  PSECDNKFHSNSELIVALSTGWYNGGSRCGKKIKITTSNGKSVLAKVVDECDSINGCDAE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H GQ PC NNIVD S AVW  LGL+ D+G V +TW+ A
Sbjct  180  HAGQPPCRNNIVDASNAVWKALGLNTDIGTVPVTWSDA  217



>gb|EYU30381.1| hypothetical protein MIMGU_mgv1a022999mg [Erythranthe guttata]
Length=230

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 164/231 (71%), Gaps = 20/231 (9%)
 Frame = +1

Query  52   MANLALISLCIF---AIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MAN   IS C+F   +I   F++ GNA SSCNGPC TL+DC+GQLIC  GKCNDDP VG+
Sbjct  1    MANTIPISFCLFTLISIIIQFAI-GNAQSSCNGPCQTLNDCAGQLICSNGKCNDDPRVGS  59

Query  223  HICRGGSTPTPG----------------NCKPVGSMTCNGETKSTYRCSPPMKSSTPAIL  354
             +C GGS    G                 C+P G++ C G++   Y CSP + SSTPA L
Sbjct  60   RVCSGGSGSGGGGGGSGGGGGGGGGEGGQCRPSGTLHCRGKSYPQYSCSPVVSSSTPAKL  119

Query  355  TLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKV  534
            TLNDFS+GGDGG PSECD +YH  +ERVVALSTGWY GGSRC KMIRI A NGRSTTAKV
Sbjct  120  TLNDFSDGGDGGGPSECDNNYHSKSERVVALSTGWYNGGSRCGKMIRIVARNGRSTTAKV  179

Query  535  VDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            VDECDS +GCD EH GQ PC NNIVDGS AVW  LGLD+D+G V +TW+MA
Sbjct  180  VDECDSRNGCDKEHDGQPPCLNNIVDGSDAVWKALGLDEDIGVVPVTWSMA  230



>ref|XP_006488057.1| PREDICTED: kiwellin-like [Citrus sinensis]
Length=217

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 154/218 (71%), Gaps = 7/218 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA   +    IFA+ F   L  NA+S CNGPC TLDDC G+LICI G CNDDP+VG+H C
Sbjct  1    MAKSLVSFTIIFAMMF-LPLLSNAISQCNGPCRTLDDCEGELICINGICNDDPEVGSHTC  59

Query  232  RGGSTPTPG------NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
             GG     G      +C   G++ C+G+    Y CSPP+ SST A LT NDFSEGG+GG 
Sbjct  60   AGGGGGGGGGGGGGVSCHSSGTLRCHGKPYPLYSCSPPVTSSTDAKLTNNDFSEGGEGGD  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YHDN+  VVALSTGWY GGSRC  MI+I A NGRS  AKVVDECDSMHGCD E
Sbjct  120  PSECDGKYHDNSVPVVALSTGWYNGGSRCGHMIKITAQNGRSVMAKVVDECDSMHGCDSE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H  + PCDN+I+DGS AVW+ LGLDKD+G V +TW++A
Sbjct  180  HADEPPCDNDIIDGSDAVWSALGLDKDIGVVGVTWSLA  217



>emb|CBI16343.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 149/207 (72%), Gaps = 2/207 (1%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRG--G  240
            L+SLC+      F     A+SSCNGPC T +DC G+LICI GKCNDDP++GTH+C G   
Sbjct  4    LLSLCLIYTISFFPFLAFAISSCNGPCRTFNDCDGELICINGKCNDDPELGTHVCEGVPS  63

Query  241  STPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
              P  G C   GS+ C G+   TY CSP + SST AILT NDFSEGGDGG PSECD  YH
Sbjct  64   PPPPSGYCHSSGSLRCKGQYYPTYTCSPQITSSTSAILTNNDFSEGGDGGGPSECDGKYH  123

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
            +N++ +VALSTGWY GG RC KMI+I A NGRS  AKVVDECDS+ GCD+EH  Q PC N
Sbjct  124  NNSDPIVALSTGWYNGGFRCGKMIKITADNGRSVLAKVVDECDSLRGCDEEHSDQPPCKN  183

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            NIV+GS AVW+ LGLD +LG V +TW+
Sbjct  184  NIVNGSDAVWSALGLDTNLGEVDVTWS  210



>gb|KEH39364.1| Ripening related protein family [Medicago truncatula]
Length=222

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 166/222 (75%), Gaps = 13/222 (6%)
 Frame = +1

Query  61   LALISLCIF--AIFFCFSLQG----NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            +A IS  +F  +IFF   + G    +A+SSCNGPC TL+DC+GQLICI GKCNDDPDVGT
Sbjct  1    MAQISNLVFLASIFFFNIINGPFLTDAISSCNGPCRTLNDCAGQLICINGKCNDDPDVGT  60

Query  223  HICR------GGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSS-TPAILTLNDFSEGG  381
             IC          +   G C+  G++ C+G++   YRCSPP  SS T A+LTLNDFS GG
Sbjct  61   RICSQPSPSPPPPSGGGGTCRTSGNLQCDGQSYPQYRCSPPYVSSGTQALLTLNDFSAGG  120

Query  382  DGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHG  561
            DGG  S+CDE +H N+ER+VALSTGWY+GGSRC K IRIRASNGR+ TAKVVD+CDS++G
Sbjct  121  DGGGASQCDEIFHSNSERIVALSTGWYSGGSRCGKFIRIRASNGRTVTAKVVDQCDSVNG  180

Query  562  CDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            CDDEH GQ PC NNIVDGSAAVW++L L+K+ G V +TW MA
Sbjct  181  CDDEHAGQPPCRNNIVDGSAAVWDELRLNKNDGVVPVTWTMA  222



>ref|XP_009356890.1| PREDICTED: kiwellin-like [Pyrus x bretschneideri]
Length=214

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 157/210 (75%), Gaps = 3/210 (1%)
 Frame = +1

Query  61   LALISLCIFAI-FFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRG  237
            L LISL +  I      L   A+SSCNGPC T DDC+G+L CI  KCNDDPDVGTHIC G
Sbjct  7    LMLISLSVILINIISLPLPSMAISSCNGPCKTPDDCTGKLTCINRKCNDDPDVGTHICGG  66

Query  238  GSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHY  417
            G      +CK  G++ C  ++   ++CSPP+ SST A LTLNDFSEGGDGG  SECD  +
Sbjct  67   GGGGG--SCKSSGTLNCKRKSFPQFKCSPPVTSSTSAKLTLNDFSEGGDGGGTSECDGKF  124

Query  418  HDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCD  597
            H N+ERVVALSTGWY  GSRC ++IRI ASNGRS TAKVVDECDS++GCD EH GQ PC 
Sbjct  125  HPNSERVVALSTGWYDKGSRCGRLIRITASNGRSVTAKVVDECDSVNGCDSEHAGQPPCK  184

Query  598  NNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            NNIVDGSAAVWN LGL++DLG V +TW++A
Sbjct  185  NNIVDGSAAVWNVLGLNQDLGIVDVTWSLA  214



>gb|KDO60174.1| hypothetical protein CISIN_1g041049mg [Citrus sinensis]
Length=217

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 153/218 (70%), Gaps = 7/218 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA   +    IFA+ F   L  NA+S CNGPC T DDC G+LICI G CNDDP+VG+H C
Sbjct  1    MAKSLVSFTIIFAMMF-LPLLSNAISQCNGPCRTPDDCEGELICINGICNDDPEVGSHTC  59

Query  232  RGGSTPTPG------NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
             GG     G      +C   G++ C+G+    Y CSPP+ SST A LT NDFSEGG+GG 
Sbjct  60   TGGGGGGGGGGGGGVSCHSSGTLRCHGKPYPLYSCSPPVTSSTDAKLTNNDFSEGGEGGD  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YHDN+  VVALSTGWY GGSRC  MI+I A NGRS  AKVVDECDSMHGCD E
Sbjct  120  PSECDGKYHDNSVPVVALSTGWYNGGSRCGHMIKITAQNGRSVMAKVVDECDSMHGCDSE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H  + PCDN+IVDGS AVW+ LGLDKD+G V +TW+MA
Sbjct  180  HADEPPCDNDIVDGSDAVWSALGLDKDIGVVGVTWSMA  217



>ref|XP_008465373.1| PREDICTED: kiwellin-like [Cucumis melo]
Length=214

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 159/216 (74%), Gaps = 6/216 (3%)
 Frame = +1

Query  52   MANLAL-ISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHI  228
            M NL L +   I +I   F L G ALSSCNGPC TL+DC GQLICI G C DDPDVGTHI
Sbjct  1    MGNLRLQLFSFILSIIMFFHLCG-ALSSCNGPCQTLNDCQGQLICINGICLDDPDVGTHI  59

Query  229  CRGGST---PTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPS  399
            C GG     P+P  C+ +G++ C G++   ++CSPP+ SST A+LT NDFS+GG GG PS
Sbjct  60   CSGGGGGGGPSP-RCQSIGNLNCKGKSFPQFKCSPPVTSSTRAVLTNNDFSKGGSGGDPS  118

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECD  +H N++ +VALSTGWY GGSRC KMI+I ASNGRS  AKVVDECDS++GCD EH 
Sbjct  119  ECDGKFHSNSDPIVALSTGWYNGGSRCGKMIKITASNGRSVLAKVVDECDSVNGCDKEHA  178

Query  580  GQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            G  PC NNIVDGS AVW+ LGLD D+G + +TW+ A
Sbjct  179  GLPPCHNNIVDGSDAVWHALGLDIDIGEIPVTWSDA  214



>ref|XP_006340404.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=213

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA +SL    IF  F    NA+S CNGPC T D C GQLICI  K NDDP+VGT IC
Sbjct  1    MSNLAFLSL----IFTIFIYTSNAISQCNGPCKTWDYCDGQLICINEKYNDDPNVGTKIC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGD-GGA  393
            +      P       C+P G++ CNG     YRCSPP+ SS PA LT NDFS GGD GG 
Sbjct  57   KSSPPSVPSPTPTNTCRPSGTVNCNG-VHPIYRCSPPVTSSMPAQLTFNDFSRGGDYGGG  115

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PS CD  YH+NNER+VALST W+ G SRC KMI IRA+NG++ TAKVVDECDS  GCD E
Sbjct  116  PSSCDGKYHNNNERIVALSTRWFGGRSRCGKMILIRANNGKTVTAKVVDECDSTMGCDAE  175

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H  Q PC NNIVDGS  VW  LGLD DLG V +TW+M 
Sbjct  176  HAFQSPCKNNIVDGSITVWRALGLDTDLGIVPVTWSMV  213



>ref|XP_008462999.1| PREDICTED: kiwellin-like [Cucumis melo]
Length=209

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 153/209 (73%), Gaps = 2/209 (1%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
            + +L  F           A+SSCNGPC TLDDC GQLICI G CNDDP++GT+ C  G +
Sbjct  1    MANLVFFISLILLPHISLAISSCNGPCQTLDDCEGQLICINGVCNDDPNIGTNQCSDGGS  60

Query  247  PTPGNCKP--VGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
             +  +     +GS+ CNGE+   Y+CSPP+ SST A LT NDFSEGGDGGAPS+CDE +H
Sbjct  61   SSSPSSDCQSIGSLNCNGESFPQYQCSPPVTSSTQATLTNNDFSEGGDGGAPSKCDESFH  120

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
            DN+E +VALSTGWY GGSRC KMIRI A+NG S  AKVVDECDS++GCD EH  Q PC N
Sbjct  121  DNSELIVALSTGWYNGGSRCGKMIRITATNGNSVLAKVVDECDSVNGCDAEHANQPPCRN  180

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            NIVDGS AVW+ LGL+KD+G  ++TW+ A
Sbjct  181  NIVDGSDAVWSTLGLNKDVGEETVTWSDA  209



>ref|XP_007206338.1| hypothetical protein PRUPE_ppa017478mg [Prunus persica]
 gb|EMJ07537.1| hypothetical protein PRUPE_ppa017478mg [Prunus persica]
Length=197

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 148/196 (76%), Gaps = 7/196 (4%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPG-------NCKPVGS  279
            A+SSC GPC T +DC+GQL CI  KCNDDP VGTHIC GG     G       NCK  G+
Sbjct  2    AISSCKGPCKTPNDCAGQLTCINRKCNDDPAVGTHICSGGGGGGGGGGGGGGGNCKSSGT  61

Query  280  MTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGW  459
            + C G++   + CSPP+ SST A LTLNDFSEGG+GG PSECD  +H N+ERVVALSTGW
Sbjct  62   LNCGGKSFPQFTCSPPVTSSTSAKLTLNDFSEGGEGGDPSECDGRFHSNSERVVALSTGW  121

Query  460  YAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDL  639
            Y  GSRC ++IRI ASNGRS TAKVVDECDS++GCD EH G  PC NNIVDGSAAVWN L
Sbjct  122  YDEGSRCGRLIRITASNGRSVTAKVVDECDSVNGCDREHAGLPPCRNNIVDGSAAVWNVL  181

Query  640  GLDKDLGRVSLTWAMA  687
            GL+KDLG V +TW++A
Sbjct  182  GLNKDLGIVDVTWSLA  197



>ref|XP_004145811.1| PREDICTED: uncharacterized protein LOC101211521 [Cucumis sativus]
Length=432

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 152/216 (70%), Gaps = 7/216 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA L  + +  F++F   +  G A+SSCNGPC TL+DC GQLICI GKCNDDPDVG+H+C
Sbjct  1    MAKLGWL-IVSFSVFVLVTNLGEAISSCNGPCKTLNDCDGQLICIKGKCNDDPDVGSHVC  59

Query  232  RGGSTPTPGN------CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              G      +      C+P G   CNG +   Y+CSP + SST A LT NDFSEGGDGGA
Sbjct  60   SNGGGGGGSSPPSDSSCQPFGHKICNGRSHPQYKCSPRVTSSTRATLTNNDFSEGGDGGA  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  +H N+E +VALSTGWY GGSRC K I+I  SNG+S  AKVVDECDS++GCD E
Sbjct  120  PSECDNKFHSNSELIVALSTGWYNGGSRCGKKIKITTSNGKSVLAKVVDECDSINGCDAE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            H GQ PC NNIVD S AVW  LGL+ D+G V +TW+
Sbjct  180  HAGQPPCRNNIVDASNAVWKALGLNTDIGTVPVTWS  215


 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 134/195 (69%), Gaps = 8/195 (4%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDV--GTHIC------RGGSTPTPGNCKPVG  276
            A+SSCN PC TL+DC GQLICI GKCN+DPDV  G+H+C       G S P   +C+P G
Sbjct  236  AISSCNDPCKTLNDCDGQLICIKGKCNNDPDVHVGSHVCSNEGSGEGSSPPLGDSCQPFG  295

Query  277  SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTG  456
               C G +   ++CSP + SST AILT  +F+  G+ GAPSECD  +H N+E VVALSTG
Sbjct  296  HKVCKGISHPQFKCSPRVTSSTRAILTNIEFNGDGENGAPSECDNKFHLNSELVVALSTG  355

Query  457  WYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWND  636
            WY  GSRC K I++ A NG+S  AKVVDECDS+ GCD  H GQ PC NNIVD + AVW+ 
Sbjct  356  WYNRGSRCGKKIKVTARNGKSVLAKVVDECDSISGCDALHAGQPPCRNNIVDAAKAVWDA  415

Query  637  LGLDKDLGRVSLTWA  681
            LGLD D+G   + W+
Sbjct  416  LGLDTDVGEEPVNWS  430



>ref|XP_003638073.1| Ripening-related protein grip22 [Medicago truncatula]
Length=222

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 165/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  61   LALISLCIF--AIFFCFSLQG----NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            +A IS  +F  +IFF   + G    +A+SSCNGPC TL+DC+GQLICI GKCNDDPDVGT
Sbjct  1    MAQISNLVFLASIFFFNIINGPFLTDAISSCNGPCRTLNDCAGQLICINGKCNDDPDVGT  60

Query  223  HICR----------GGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSS-TPAILTLNDF  369
             IC           GG    P  C    ++ C+G++   YRCSPP  SS T A+LTLNDF
Sbjct  61   RICSQPSPSPPPPSGGGVDLPNLC----NLQCDGQSYPQYRCSPPYVSSGTQALLTLNDF  116

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
            S GGDGG  S+CDE +H N+ER+VALSTGWY+GGSRC K IRIRASNGR+ TAKVVD+CD
Sbjct  117  SAGGDGGGASQCDEIFHSNSERIVALSTGWYSGGSRCGKFIRIRASNGRTVTAKVVDQCD  176

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            S++GCDDEH GQ PC NNIVDGSAAVW++L L+K+ G V +TW MA
Sbjct  177  SVNGCDDEHAGQPPCRNNIVDGSAAVWDELRLNKNDGVVPVTWTMA  222



>ref|XP_006372630.1| hypothetical protein POPTR_0017s03400g, partial [Populus trichocarpa]
 gb|ERP50427.1| hypothetical protein POPTR_0017s03400g, partial [Populus trichocarpa]
Length=260

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 151/206 (73%), Gaps = 8/206 (4%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
             + +C+F  F    +  +A+SSCNGPC T +DC GQLICI GKCNDDPDVGTHIC GG +
Sbjct  5    FVLVCVF--FLRSIISSHAISSCNGPCNTFNDCDGQLICIKGKCNDDPDVGTHICEGGGS  62

Query  247  PTPG-----NCKPVGSMTCNGET-KSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
                     NC   G  +C   +  + Y+CSPP+ S+T A LTLNDFSEGG+GGAPSECD
Sbjct  63   SPSSPPPSGNCPLSGERSCKEPSFPAKYKCSPPVTSTTKAKLTLNDFSEGGEGGAPSECD  122

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
            E YH   ERVVALSTGWY GGSRC +MI+I ASNG+S TAKVVDECD++HGCD EHG   
Sbjct  123  ERYHAKTERVVALSTGWYDGGSRCGRMIKITASNGKSVTAKVVDECDTLHGCDSEHGFLP  182

Query  589  PCDNNIVDGSAAVWNDLGLDKDLGRV  666
            PC+NNIVDGS AVW  LGL+KDL R+
Sbjct  183  PCENNIVDGSDAVWEALGLNKDLVRL  208



>ref|XP_008227659.1| PREDICTED: kiwellin-like [Prunus mume]
Length=210

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 146/205 (71%), Gaps = 5/205 (2%)
 Frame = +1

Query  88   AIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPG---  258
             +     L   A+SSC GPC   +DC+GQL CI  KCNDDP VGTHIC GG     G   
Sbjct  6    VLMISLPLPTMAISSCKGPCKNPNDCAGQLTCINLKCNDDPAVGTHICSGGGGGGGGGGG  65

Query  259  --NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNE  432
              NCK  G++ C G++   + CSPP+ SST A LTLNDFSEGG+GG PSECD  +H N+E
Sbjct  66   GGNCKSSGTLDCGGKSFPQFTCSPPVTSSTRAKLTLNDFSEGGEGGDPSECDGRFHSNSE  125

Query  433  RVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVD  612
             VVALSTGWY  GSRC + IRI ASNGRS  AKVVDECDS++GCD EH G  PC NNIVD
Sbjct  126  CVVALSTGWYDEGSRCGRFIRITASNGRSVMAKVVDECDSVNGCDREHAGLPPCRNNIVD  185

Query  613  GSAAVWNDLGLDKDLGRVSLTWAMA  687
            GSAAVWN LGL+KDLG V +TW++A
Sbjct  186  GSAAVWNVLGLNKDLGIVDVTWSLA  210



>ref|XP_003638074.1| Ripening-related protein grip22 [Medicago truncatula]
 gb|KEH39363.1| Ripening related protein family [Medicago truncatula]
Length=219

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 159/219 (73%), Gaps = 10/219 (5%)
 Frame = +1

Query  61   LALISLCIF-AIFFCFSLQG-----NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            + LIS  +F A  F F++       NA+SSCNG C  L+DC GQLICI GKCNDDPD+GT
Sbjct  1    MTLISNLVFLASIFLFNITNLPFLTNAISSCNGGCNDLNDCYGQLICINGKCNDDPDIGT  60

Query  223  HICRGGSTPTP----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
            HIC G  T  P    GNC+  G++ C+G++   Y+CSP + SST A+LT NDFSEGG GG
Sbjct  61   HICSGRKTINPPLAGGNCQSSGNLQCDGQSHPQYQCSPRVSSSTQALLTWNDFSEGGSGG  120

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
             PSEC   Y +NNE +VALSTGWY GGSRC +M+RI A NGRS TAKVVDECDS++GCD+
Sbjct  121  GPSECYGKYQNNNENIVALSTGWYKGGSRCGQMVRITARNGRSVTAKVVDECDSVNGCDE  180

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            EH  Q PC NNIVDGS AVWN LGL+ D G V +TW++A
Sbjct  181  EHAWQPPCRNNIVDGSVAVWNALGLNTDDGVVPVTWSIA  219



>gb|AEM42991.1| ripening-related protein [Siraitia grosvenorii]
Length=215

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 150/216 (69%), Gaps = 5/216 (2%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M N AL+     ++    SL   A+SSCNGPC TL+DC+GQLICI  +CNDDP+VGTH+C
Sbjct  1    MVNFALLVSLFLSVISLPSLSL-AISSCNGPCKTLNDCTGQLICINSRCNDDPNVGTHVC  59

Query  232  RGGSTPTP----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPS  399
              G          +C+  G++ C G++   ++CSPP+  ST AILT NDFS+GGDGG PS
Sbjct  60   SSGGGGGSSPPSNSCQSSGNLNCKGKSFPQFKCSPPVTRSTRAILTNNDFSQGGDGGDPS  119

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECD  +H N+E +VALSTGWY GGSRC K I+I A NGRS  AKVVDECDS++GCD  H 
Sbjct  120  ECDGKFHSNSELIVALSTGWYNGGSRCGKNIKIIAKNGRSVLAKVVDECDSINGCDKAHA  179

Query  580  GQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             Q PC NNIVDGS  VWN LGLD ++G   +TW+ A
Sbjct  180  FQPPCRNNIVDGSNGVWNALGLDINVGEEPVTWSDA  215



>ref|XP_006340405.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=212

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 148/223 (66%), Gaps = 22/223 (10%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M++LA +SL IF IF   S   NA+S CNGPC TLDDC GQLICI GKCNDDP+VGT IC
Sbjct  1    MSHLAFLSL-IFTIFISTS---NAISQCNGPCKTLDDCDGQLICINGKCNDDPNVGTKIC  56

Query  232  RGGSTPTPGNCKP----------VGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGG  381
            +      P    P           G++ CNG     YRCSPP+ S TPA LTLNDF  G 
Sbjct  57   KNSPPSVPFPPPPPPTTTNTCRPFGTVNCNG-IHPIYRCSPPVTSLTPAQLTLNDFDSG-  114

Query  382  DGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMH  558
                   CD  YH+NNER+V LSTGW+AGGSRC KMIRIR  SNGR+ TAKVVDECDS  
Sbjct  115  -----KSCDWKYHNNNERIVVLSTGWFAGGSRCGKMIRIRTNSNGRTVTAKVVDECDSTM  169

Query  559  GCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            GCD EH  Q PC NNIVDGS AVW  LGLD +L  V++TW+M 
Sbjct  170  GCDAEHAFQSPCKNNIVDGSIAVWRALGLDTNLDNVTVTWSMV  212



>ref|XP_009796010.1| PREDICTED: kiwellin-like [Nicotiana sylvestris]
Length=177

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 145/213 (68%), Gaps = 37/213 (17%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA    +SLCIFAIF   S +G A+SSCNGPC +L++C GQLICI GKCNDDPDVGT+ C
Sbjct  1    MAKFVFLSLCIFAIFISSSSRGTAISSCNGPCKSLNNCDGQLICISGKCNDDPDVGTNTC  60

Query  232  RGG-STPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
            +GG S+PT                           +STPA LTLNDFS+GGDGG PSECD
Sbjct  61   KGGGSSPT---------------------------TSTPAQLTLNDFSKGGDGGGPSECD  93

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
              YHDN+ERVVALST WYA GS+C KMI IRA+NG+S TAKVVDECDS++          
Sbjct  94   GQYHDNSERVVALSTRWYAKGSKCGKMILIRANNGKSVTAKVVDECDSIN---------D  144

Query  589  PCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             C NN+VDGS AVW  LGLD D GRV +TW+MA
Sbjct  145  GCANNVVDGSIAVWRALGLDTDKGRVPITWSMA  177



>ref|XP_006340164.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=212

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 149/217 (69%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M+NLA +SL IF IF   S   NA+S CNGPC T DDC GQLICI        +VGT IC
Sbjct  1    MSNLAFLSL-IFTIFISTS---NAISQCNGPCKTWDDCDGQLICITENVTMILNVGTKIC  56

Query  232  RGGSTPTP-----GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            +      P       C+P G++ CNG     YRCSPP+ SSTPA LT NDF EGGDGG P
Sbjct  57   KSSPPSVPSPTPTNTCRPSGTINCNG-VHPIYRCSPPVTSSTPAQLTFNDFGEGGDGGGP  115

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            S CD  YH+NNER+VALSTGW+AG SRC KMI IRA+NG++ TAKVVDECDS  GCD EH
Sbjct  116  SSCDGKYHNNNERIVALSTGWFAGRSRCGKMILIRANNGKTVTAKVVDECDSTMGCDAEH  175

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              Q PC NNIVDGS AVW  LGLD +LG V +TW+M 
Sbjct  176  AFQSPCKNNIVDGSIAVWRALGLDTNLGIVPVTWSMV  212



>ref|XP_008465372.1| PREDICTED: kiwellin-like [Cucumis melo]
Length=218

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 148/216 (69%), Gaps = 7/216 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA L  + + + ++F   +    A+SSCNGPC TL+DC GQLICI GKC+DDPDVG+H+C
Sbjct  1    MAKLGWLVVSL-SLFVLVTDLCEAISSCNGPCKTLNDCDGQLICIRGKCDDDPDVGSHVC  59

Query  232  RGGSTPTPGN------CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              G      +      C+P     C G +   Y+CSPP+ SST AILT NDFS+GGDGG 
Sbjct  60   SNGGGGGGSSPPSGNSCQPFSHKVCKGTSHPQYKCSPPVTSSTRAILTNNDFSQGGDGGG  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD+ +H N+E +VALSTGWY  GSRC K I+I A NG+S  AKVVDECDS++GCD E
Sbjct  120  PSECDDKFHSNSELIVALSTGWYNRGSRCGKKIKITARNGKSVLAKVVDECDSINGCDTE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            H  Q PC NNIVD S AVW+ LGLD D+G   + W+
Sbjct  180  HAQQPPCRNNIVDASNAVWDALGLDIDVGEEPINWS  215



>ref|XP_006424530.1| hypothetical protein CICLE_v10029991mg [Citrus clementina]
 gb|ESR37770.1| hypothetical protein CICLE_v10029991mg [Citrus clementina]
Length=217

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 151/218 (69%), Gaps = 7/218 (3%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            MA   +    IFA+ F   L  NA+S CNGPC T DDC G+LICI G CNDDP+VG+H C
Sbjct  1    MAKSLVSFTIIFAMMF-LPLLSNAISQCNGPCRTPDDCEGELICINGICNDDPEVGSHTC  59

Query  232  RGGSTPTPGNCKPVG------SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
             GG     G     G      ++ C+G+    Y CSPP+ SST A LT NDFSEGG+GG 
Sbjct  60   TGGGGGGGGGGGGGGSCHSSGTLRCHGKPYPLYSCSPPVTSSTYAKLTNNDFSEGGEGGD  119

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YHDN+  +VALSTGWY GGSRC  MI+I A NGRS  AKVVDECDSMHGCD E
Sbjct  120  PSECDGKYHDNSVPIVALSTGWYNGGSRCGHMIKITAQNGRSVMAKVVDECDSMHGCDSE  179

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            H  + PCDN+IVDGS AVW+ LGLDKD+G V +TW+MA
Sbjct  180  HADEPPCDNDIVDGSDAVWSALGLDKDIGVVGVTWSMA  217



>ref|XP_002314292.2| hypothetical protein POPTR_0009s01510g [Populus trichocarpa]
 gb|EEE88247.2| hypothetical protein POPTR_0009s01510g [Populus trichocarpa]
Length=185

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = +1

Query  172  QLICIGGKCNDDPDVGTHICRGGSTPTPGN--CKPVGSMTCNGETKSTYRCSPPMKSSTP  345
            QLICI GKCNDDP VGTH C G     P N  CKP G++ C G++   + CSPP+ S T 
Sbjct  12   QLICINGKCNDDPHVGTHTCTGERPSPPSNIDCKPSGTLRCEGKSFPRFTCSPPVTSFTK  71

Query  346  AILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTT  525
            A LTLNDFSEG + GAPSECDE++H+  ERVVALSTGWYAGGSRC KMI+I A NGRS  
Sbjct  72   ASLTLNDFSEGEEVGAPSECDENFHEKTERVVALSTGWYAGGSRCGKMIKITARNGRSVL  131

Query  526  AKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            AKVVDECDS +GCD EH G  PC NNIVDGS AVW  L L+KDLG V +TW++A
Sbjct  132  AKVVDECDSKNGCDSEHAGLPPCRNNIVDGSDAVWEALQLNKDLGVVDVTWSLA  185



>ref|XP_011046088.1| PREDICTED: kiwellin-like [Populus euphratica]
Length=215

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 153/213 (72%), Gaps = 8/213 (4%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
             + +C+F  F    +  +A+SSCNGPC TL+DC GQLICI GKCNDDPDV THIC+GG +
Sbjct  5    FVLVCVF--FLRSIISSHAISSCNGPCNTLNDCDGQLICIKGKCNDDPDVDTHICKGGGS  62

Query  247  PTPGNC----KPV-GSMTCNGETKST-YRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
                      +P+ G   C   +  T Y+ S P+ S+T A LTLN+FSEGG+GGAPSECD
Sbjct  63   SPSSPPPPGNRPLSGERLCKEPSFPTKYKFSSPVTSTTKAKLTLNNFSEGGEGGAPSECD  122

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
            E YH   ERV+ALSTGWY GGSRC +MI+I ASNGRS TAKVVDE +++HG D EHG   
Sbjct  123  ERYHAKTERVLALSTGWYDGGSRCGRMIKISASNGRSVTAKVVDEFNTLHGSDSEHGFLP  182

Query  589  PCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            PC+NNIVDGS AVW  L L+KDLG V +TW++A
Sbjct  183  PCENNIVDGSDAVWEALALNKDLGIVPVTWSIA  215



>ref|XP_004165856.1| PREDICTED: ripening-related protein grip22-like [Cucumis sativus]
 gb|KGN46854.1| hypothetical protein Csa_6G147480 [Cucumis sativus]
Length=215

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 147/219 (67%), Gaps = 11/219 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFF-CFSLQG--NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MA LA    C+ + FF   SL G   A+SSC  PC TL +C GQLICI G+CNDDPDVGT
Sbjct  1    MAKLA----CLVSFFFLVLSLLGLSQAISSCREPCQTLKNCKGQLICINGQCNDDPDVGT  56

Query  223  HICR----GGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
             IC      G+      C+  G + C G++   ++CSP + SST AILT NDFS+GGDGG
Sbjct  57   RICSTDSDNGADGEKFRCEAFGRLHCKGKSFPQFKCSPRVTSSTRAILTNNDFSKGGDGG  116

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
             PSECD  +H N++ +VALSTGWY GGSRC K IRI A NGRS  AKVVDECD+++GCD 
Sbjct  117  DPSECDGKFHHNSQPIVALSTGWYNGGSRCGKKIRITARNGRSVLAKVVDECDTINGCDK  176

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             H  Q PC NNIVDGS  VW+ LGLD ++G   + W+ A
Sbjct  177  AHAHQPPCRNNIVDGSNGVWHALGLDINVGEEPVVWSDA  215



>ref|XP_009619990.1| PREDICTED: kiwellin-like [Nicotiana tomentosiformis]
Length=182

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 142/212 (67%), Gaps = 30/212 (14%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M  L  + L I AIF   S  GNA+SSCNGP  +L+DC GQLICI GKCNDDPDVGT+ C
Sbjct  1    MVKLVFLFLYILAIFISSSWPGNAISSCNGPYNSLNDCDGQLICIRGKCNDDPDVGTNTC  60

Query  232  RGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            +G ++P+                      SP    STPA LTLNDFS+GGDGG PSECDE
Sbjct  61   KGRNSPS-------------------VPSSP--TDSTPAQLTLNDFSKGGDGGGPSECDE  99

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YHDN+ERVVALST WYA GS+C KMIRI A+NG+S TAKVVD+CDS++           
Sbjct  100  KYHDNSERVVALSTRWYAKGSKCGKMIRIMANNGKSVTAKVVDQCDSIN---------DG  150

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C NN+VDGS AVW  LGLD D GRV +TW+MA
Sbjct  151  CANNVVDGSIAVWRALGLDTDKGRVPITWSMA  182



>ref|XP_010109491.1| hypothetical protein L484_007511 [Morus notabilis]
 gb|EXC22902.1| hypothetical protein L484_007511 [Morus notabilis]
Length=212

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = +1

Query  172  QLICIGGKCNDDPDVGTHICRGGSTPTPGN-CKPVGSMTCNGETKSTYRCSPPMKSSTPA  348
             LICI  +CNDDPDVGTHIC G S  +  + C+P G+  CNG + +TY CSPP+ SST A
Sbjct  40   MLICIKDQCNDDPDVGTHICAGNSDGSSSDGCQPSGTYNCNGYSGNTYSCSPPVTSSTQA  99

Query  349  ILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTA  528
             LT NDFSEGGDGG  S CD  YHDN+E +VALSTGWY GGSRC KMI+I AS+G ST A
Sbjct  100  QLTNNDFSEGGDGGGASSCDGAYHDNSELIVALSTGWYDGGSRCGKMIKITASDGTSTEA  159

Query  529  KVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            KVV ECDSMHGCD EH GQ PC NNIVDGS AVW+ L L+K LG V +TW+MA
Sbjct  160  KVVAECDSMHGCDAEHAGQPPCKNNIVDGSDAVWSALRLNKTLGVVGVTWSMA  212



>gb|KGN46853.1| hypothetical protein Csa_6G147470 [Cucumis sativus]
Length=217

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 149/217 (69%), Gaps = 5/217 (2%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M NL L    +      F     ALSSCNGPC TL+DC GQLICI GKC DDP++GTHIC
Sbjct  1    MENLGLQLFSVILSTIMFFHLCEALSSCNGPCQTLNDCQGQLICINGKCLDDPNLGTHIC  60

Query  232  RGGSTPTPGNCKPVG-----SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
             G      G     G     ++ C G+T   ++CSPP+ SST A+LT NDFS+GG GG P
Sbjct  61   SGSGGGGGGGGGGHGCHSIGNLNCKGKTFPQFKCSPPVTSSTRAVLTNNDFSKGGSGGDP  120

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            SECD  +HDN++ +VALSTGWY GGSRC +MI+I ASNGRS  AKVVDECDS++GCD  H
Sbjct  121  SECDGKFHDNSDPIVALSTGWYNGGSRCGQMIQITASNGRSVLAKVVDECDSINGCDKAH  180

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             G  PC NNIVDGS AVW+ LGLD D+G + +TW+ A
Sbjct  181  AGLPPCHNNIVDGSDAVWHALGLDIDVGEIPVTWSDA  217



>ref|XP_007219397.1| hypothetical protein PRUPE_ppa020404mg [Prunus persica]
 gb|EMJ20596.1| hypothetical protein PRUPE_ppa020404mg [Prunus persica]
Length=215

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 132/189 (70%), Gaps = 3/189 (2%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTP---TPGNCKPVGSMTCN  291
            ALSSCNG C TL+DC GQLICI  KCNDDPDVGTHIC     P   T G C P G++ CN
Sbjct  23   ALSSCNGACATLNDCDGQLICINRKCNDDPDVGTHICSKPPPPPPMTAGGCNPSGTVHCN  82

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
              +  TY CSPP+ SST A L +++F++GGDGG  +ECDE YH+N ER+V LSTGWY GG
Sbjct  83   NVSYPTYTCSPPVTSSTIAKLDISEFNKGGDGGGAAECDEQYHENTERIVGLSTGWYNGG  142

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
              C +MI I A NGRS TAKVVDECDS  GCD EH GQ PC+NN+V  S AVW  L LD 
Sbjct  143  KMCGRMIIITAGNGRSVTAKVVDECDSRVGCDAEHAGQPPCENNVVVASEAVWKALQLDV  202

Query  652  DLGRVSLTW  678
                V +TW
Sbjct  203  QGEGVQVTW  211



>gb|KCW85767.1| hypothetical protein EUGRSUZ_B02523 [Eucalyptus grandis]
Length=203

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 146/208 (70%), Gaps = 9/208 (4%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
            +I+L I      FS   +A+SSCNG C TLDDC+GQLICI G+C DDPDVGTH C    +
Sbjct  4    IIALPIAISITLFSSPSHAISSCNGSCHTLDDCTGQLICINGRCRDDPDVGTHTCPNTPS  63

Query  247  PTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            P+ G C+P G++ C G++   YRCSPP+ SST A LT+NDFSE G GGA SECD  YH N
Sbjct  64   PSDGGCRPSGTVHCQGQSFPKYRCSPPVTSSTRATLTINDFSESGGGGA-SECDGRYHKN  122

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASN-GRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            +E +VALSTGWYAGGSRC   I+I ++  GRS  AKVVDECDS++GC         C NN
Sbjct  123  SELIVALSTGWYAGGSRCGDRIKITSTKTGRSVMAKVVDECDSVNGCP-------LCRNN  175

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            IVDGS AVW+ L LD ++G   +TW+MA
Sbjct  176  IVDGSNAVWHALRLDIEVGVEDVTWSMA  203



>ref|XP_004165855.1| PREDICTED: kiwellin-like [Cucumis sativus]
Length=220

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 149/220 (68%), Gaps = 8/220 (4%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M NL L    +      F     ALSSCNGPC TL+DC GQLICI GKC DDP++GTHIC
Sbjct  1    MGNLGLQLFSVILSTIMFFHLCEALSSCNGPCQTLNDCQGQLICINGKCLDDPNLGTHIC  60

Query  232  RGGSTPTPGNCKPVG--------SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDG  387
             G      G     G        ++ C G+T   ++CSPP+ SST A+LT NDFS+GG G
Sbjct  61   SGSGGGGGGGGGGGGGHGCHSIGNLNCKGKTFPQFKCSPPVTSSTRAVLTNNDFSKGGSG  120

Query  388  GAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCD  567
            G PSECD  +HDN++ +VALSTGWY GGSRC +MI+I ASNGRS  AKVVDECDS++GCD
Sbjct  121  GDPSECDGKFHDNSDPIVALSTGWYNGGSRCGQMIQITASNGRSVLAKVVDECDSINGCD  180

Query  568  DEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              H G  PC NNIVDGS AVW+ LGLD D+G + +TW+ A
Sbjct  181  KAHAGLPPCHNNIVDGSDAVWHALGLDIDVGEIPVTWSDA  220



>ref|XP_010046440.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
Length=207

 Score =   223 bits (567),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 145/208 (70%), Gaps = 9/208 (4%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST  246
             ++L I      FS   +A+SSCNG C TLDDC+GQLICI G+C DDPDVGTH C    +
Sbjct  8    FLALPIAISITLFSSPSHAISSCNGSCHTLDDCTGQLICINGRCRDDPDVGTHTCPNTPS  67

Query  247  PTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            P+ G C+P G++ C G++   YRCSPP+ SST A LT+NDFSE G GGA SECD  YH N
Sbjct  68   PSDGGCRPSGTVHCQGQSFPKYRCSPPVTSSTRATLTINDFSESGGGGA-SECDGRYHKN  126

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASN-GRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            +E +VALSTGWYAGGSRC   I+I ++  GRS  AKVVDECDS++GC         C NN
Sbjct  127  SELIVALSTGWYAGGSRCGDRIKITSTKTGRSVMAKVVDECDSVNGCP-------LCRNN  179

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            IVDGS AVW+ L LD ++G   +TW+MA
Sbjct  180  IVDGSNAVWHALRLDIEVGVEDVTWSMA  207



>ref|XP_004165857.1| PREDICTED: kiwellin-like [Cucumis sativus]
Length=219

 Score =   215 bits (547),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 134/195 (69%), Gaps = 8/195 (4%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDV--GTHIC------RGGSTPTPGNCKPVG  276
            A+SSCN PC TL+DC GQLICI GKCN+DPDV  G+H+C       G S P   +C+P G
Sbjct  23   AISSCNDPCKTLNDCDGQLICIKGKCNNDPDVHVGSHVCSNEGSGEGSSPPLGDSCQPFG  82

Query  277  SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTG  456
               C G +   ++CSP + SST AILT  +F+  G+ GAPSECD  +H N+E VVALSTG
Sbjct  83   HKVCKGISHPQFKCSPRVTSSTRAILTNIEFNGDGENGAPSECDNKFHLNSELVVALSTG  142

Query  457  WYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWND  636
            WY  GSRC K I++ A NG+S  AKVVDECDS+ GCD  H GQ PC NNIVD + AVWN 
Sbjct  143  WYNRGSRCGKKIKVTARNGKSVLAKVVDECDSISGCDALHAGQPPCRNNIVDAAKAVWNA  202

Query  637  LGLDKDLGRVSLTWA  681
            LGLD D+G   + W+
Sbjct  203  LGLDTDVGEEPVNWS  217



>ref|XP_004145810.1| PREDICTED: ripening-related protein grip22-like [Cucumis sativus]
Length=399

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 143/194 (74%), Gaps = 5/194 (3%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPGNCKPVG-----SMT  285
            ALSSCNGPC TL+DC GQLICI GKC DDP++GTHIC G      G     G     ++ 
Sbjct  206  ALSSCNGPCQTLNDCQGQLICINGKCLDDPNLGTHICSGSGGGGGGGGGGHGCHSIGNLN  265

Query  286  CNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYA  465
            C G+T   ++CSPP+ SST A+LT NDFS+GG GG PSECD  +HDN++ +VALSTGWY 
Sbjct  266  CKGKTFPQFKCSPPVTSSTRAVLTNNDFSKGGSGGDPSECDGKFHDNSDPIVALSTGWYN  325

Query  466  GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL  645
            GGSRC +MI+I ASNGRS  AKVVDECDS++GCD  H G  PC NNIVDGS AVW+ LGL
Sbjct  326  GGSRCGQMIQITASNGRSVLAKVVDECDSINGCDKAHAGLPPCHNNIVDGSDAVWHALGL  385

Query  646  DKDLGRVSLTWAMA  687
            D D+G + +TW+ A
Sbjct  386  DIDVGEIPVTWSDA  399


 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 143/213 (67%), Gaps = 11/213 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFF-CFSLQG--NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MA LA    C+ + FF   SL G   A+SSC  PC TL +C GQLICI G+CNDDPDVGT
Sbjct  1    MAKLA----CLVSFFFLVLSLLGLSQAISSCREPCQTLKNCKGQLICINGQCNDDPDVGT  56

Query  223  HICR----GGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
             IC      G+      C+  G + C G++   ++CSP + SST AILT NDFS+GGDGG
Sbjct  57   RICSTDSDNGADGEKFRCEAFGRLHCKGKSFPQFKCSPRVTSSTRAILTNNDFSKGGDGG  116

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
             PSECD  +H N++ +VALSTGWY GGSRC K IRI A NGRS  AKVVDECD+++GCD 
Sbjct  117  DPSECDGKFHHNSQPIVALSTGWYNGGSRCGKKIRITARNGRSVLAKVVDECDTINGCDK  176

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVS  669
             H  Q PC NNIVDGS  VW+ LGLD ++   S
Sbjct  177  AHAHQPPCRNNIVDGSNGVWHALGLDINVALSS  209



>ref|XP_008465375.1| PREDICTED: kiwellin-like [Cucumis melo]
Length=221

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 139/200 (70%), Gaps = 10/200 (5%)
 Frame = +1

Query  118  NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGST---------PTPGN-CK  267
             A+S C+GPC TL+DC GQLICI G+C+DDPDVGT IC  GS          P+  + C+
Sbjct  22   QAISLCSGPCQTLNDCQGQLICINGQCSDDPDVGTRICSSGSGSGGDGGKFPPSSSDGCE  81

Query  268  PVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVAL  447
              G + C G++   ++CSP + SST AILT NDFS+GGDGG PSECD  +H N++ +VAL
Sbjct  82   AFGKLHCKGKSFPQFKCSPRVTSSTRAILTNNDFSKGGDGGDPSECDGKFHHNSQPIVAL  141

Query  448  STGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAV  627
            STGWY  GSRC + IRI A NGRS  AKVVDECDS++GCD  H  Q PC NNIVDGS  V
Sbjct  142  STGWYNRGSRCGQKIRITARNGRSVLAKVVDECDSINGCDKAHAHQPPCRNNIVDGSNGV  201

Query  628  WNDLGLDKDLGRVSLTWAMA  687
            W+ LGLD ++G   + W+ A
Sbjct  202  WHALGLDINVGEEPVIWSDA  221



>gb|KCW63132.1| hypothetical protein EUGRSUZ_G00742, partial [Eucalyptus grandis]
Length=196

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 142/211 (67%), Gaps = 17/211 (8%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M  + ++S+ +  +    S   +A+SSCNGPC TL DC GQLICI G C+DDP++G    
Sbjct  1    MEFVGMMSIALLLVVL--STNSHAISSCNGPCQTLGDCQGQLICINGMCSDDPNLGR---  55

Query  232  RGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
                       + + ++ C+G +  T+ CSPP+ SST AILT NDFS GGDGGAPS+CDE
Sbjct  56   -----------RSICNLQCDGMSYPTFTCSPPVTSSTRAILTNNDFSHGGDGGAPSQCDE  104

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMHGCDDEHGGQG  588
             YH N ER++ALSTG +   SRC KMI+I +   G S TAKVVD+CDSM+GC + H  Q 
Sbjct  105  QYHKNTERIIALSTGCFDNQSRCRKMIQITSIKTGSSVTAKVVDQCDSMNGCCESHAYQP  164

Query  589  PCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            PC NNIVDGS AVW+ LGLDK++G   +TW+
Sbjct  165  PCQNNIVDGSDAVWSALGLDKNVGDEDVTWS  195



>gb|KGN46855.1| hypothetical protein Csa_6G147490 [Cucumis sativus]
Length=219

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 134/195 (69%), Gaps = 8/195 (4%)
 Frame = +1

Query  121  ALSSCNGPCTTLDDCSGQLICIGGKCNDDPDV--GTHIC------RGGSTPTPGNCKPVG  276
            A+SSCN PC TL+DC GQLICI GKCN+DPDV  G+H+C       G S P   +C+P G
Sbjct  23   AISSCNDPCKTLNDCDGQLICIKGKCNNDPDVHVGSHVCSNEGSGEGSSPPLGDSCQPFG  82

Query  277  SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTG  456
               C G +   ++CSP + SST AILT  +F+  G+ GAPSECD  +H N+E VVALSTG
Sbjct  83   HKVCKGISHPQFKCSPRVTSSTRAILTNIEFNGDGENGAPSECDNKFHLNSELVVALSTG  142

Query  457  WYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWND  636
            WY  GSRC K I++ A NG+S  AKVVDECDS+ GCD  H GQ PC NNIVD + AVW+ 
Sbjct  143  WYNRGSRCGKKIKVTARNGKSVLAKVVDECDSISGCDALHAGQPPCRNNIVDAAKAVWDA  202

Query  637  LGLDKDLGRVSLTWA  681
            LGLD D+G   + W+
Sbjct  203  LGLDTDVGEEPVNWS  217



>gb|KCW63127.1| hypothetical protein EUGRSUZ_G00736, partial [Eucalyptus grandis]
Length=215

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 143/217 (66%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M    ++S+ +  +    +L   A+SSCNGPC TLDDC GQLICI G C+DDP +GT IC
Sbjct  1    MELAGIMSIALLLVVLSTNLP--AISSCNGPCQTLDDCRGQLICINGMCSDDPKLGTQIC  58

Query  232  RGGS------TPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              GS      T   G C P G++ C+G +  T+ CSPP+ SST AIL  NDFS+GGDGG 
Sbjct  59   GTGSGGQSVLTSDGGGCDPSGNLQCDGTSYPTFTCSPPVTSSTRAILMNNDFSQGGDGGD  118

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMHGCDD  570
            PS+C+E YH+N ER+VA STGW+     C K+ +I +   G S  AK VD+CDSM+GC+ 
Sbjct  119  PSQCNEQYHNNTERIVAPSTGWF-DNVHCGKIFKITSIKTGSSVMAKAVDQCDSMNGCNA  177

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
             H  Q PC NNIVD S A+W+ LGLDK++G   +TW+
Sbjct  178  SHAYQPPCRNNIVDSSDAMWSALGLDKNVGEEDVTWS  214



>ref|XP_010068220.1| PREDICTED: kiwellin-like [Eucalyptus grandis]
Length=216

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 143/217 (66%), Gaps = 10/217 (5%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            M    ++S+ +  +    +L   A+SSCNGPC TLDDC GQLICI G C+DDP +GT IC
Sbjct  1    MELAGIMSIALLLVVLSTNLP--AISSCNGPCQTLDDCRGQLICINGMCSDDPKLGTQIC  58

Query  232  RGGS------TPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
              GS      T   G C P G++ C+G +  T+ CSPP+ SST AIL  NDFS+GGDGG 
Sbjct  59   GTGSGGQSVLTSDGGGCDPSGNLQCDGTSYPTFTCSPPVTSSTRAILMNNDFSQGGDGGD  118

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMHGCDD  570
            PS+C+E YH+N ER+VA STGW+     C K+ +I +   G S  AK VD+CDSM+GC+ 
Sbjct  119  PSQCNEQYHNNTERIVAPSTGWF-DNVHCGKIFKITSIKTGSSVMAKAVDQCDSMNGCNA  177

Query  571  EHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
             H  Q PC NNIVD S A+W+ LGLDK++G   +TW+
Sbjct  178  SHAYQPPCRNNIVDSSDAMWSALGLDKNVGEEDVTWS  214



>ref|XP_002973365.1| hypothetical protein SELMODRAFT_99172 [Selaginella moellendorffii]
 gb|EFJ25739.1| hypothetical protein SELMODRAFT_99172 [Selaginella moellendorffii]
Length=228

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 136/225 (60%), Gaps = 19/225 (8%)
 Frame = +1

Query  61   LALISLCIFAIFFCFSL-QGNALSSCNG---PCTTLDDCSGQLICIGGK-CNDDPDVGTH  225
            +AL    I  +   FS+   + L  C G    C+T DDC GQL C  G+ C DDPD+GTH
Sbjct  1    MALRIGSIVRVLIVFSICSRDLLVECRGCGQSCSTNDDCDGQLYCGAGRTCQDDPDLGTH  60

Query  226  IC----------RGGSTPTPGNCKPVGSMTCNGETKS-TYRCSPPMKSSTPAILTLNDFS  372
            IC             S P  GN        C   T    YRCSPP+  ST AILT+NDF 
Sbjct  61   ICAGSGGGGGGGCQQSGPLKGNSAHQSDECCKANTNYPIYRCSPPVSQSTKAILTVNDFQ  120

Query  373  EGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDS  552
             GGDGG PSECDE +H N ER+VALSTGWY+GGSRC K I I A NGRSTTAKVVDECDS
Sbjct  121  AGGDGGDPSECDEKFHSNTERIVALSTGWYSGGSRCLKFISITAPNGRSTTAKVVDECDS  180

Query  553  MHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL---DKDLGRVSLTW  678
              GCD  H  Q PC NNIVDGS AVW  LG+   D   G++S+TW
Sbjct  181  TMGCDKPHAWQPPCRNNIVDGSDAVWKALGISSSDPLYGQMSITW  225



>ref|XP_010262882.1| PREDICTED: kiwellin-like [Nelumbo nucifera]
Length=210

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 124/190 (65%), Gaps = 30/190 (16%)
 Frame = +1

Query  118  NALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPTPGNCKPVGSMTCNGE  297
            +A+SSC GPC T DDC GQLIC  G C  DPD GT                         
Sbjct  51   SAISSCGGPCQTSDDCDGQLICSNGGCTTDPDAGTTE-----------------------  87

Query  298  TKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSR  477
                   SPP+ SST AILT NDFS+GGDGG PS+CD+ YH+N+  +VALSTGWYAGGSR
Sbjct  88   -------SPPVTSSTEAILTNNDFSQGGDGGGPSKCDDSYHNNSGLIVALSTGWYAGGSR  140

Query  478  CEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDL  657
            CEKMIRI   +G S TAKVVDECDS++GCD EH  Q PC NNIVD S  VWN LGL+ D 
Sbjct  141  CEKMIRITTQSGASVTAKVVDECDSVNGCDAEHANQPPCRNNIVDASDGVWNALGLNIDD  200

Query  658  GRVSLTWAMA  687
            G VS+TW+MA
Sbjct  201  GEVSVTWSMA  210



>ref|XP_004310165.1| PREDICTED: kiwellin-like [Fragaria vesca subsp. vesca]
Length=169

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = +1

Query  241  STPTPGN---CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            S P P +   C P G++ C G++   Y CSPP+ + T A+LTLNDFSEGGDGG PS CD 
Sbjct  18   SLPLPSSAQTCNPSGTLVCKGKSYPKYTCSPPVTAKTEALLTLNDFSEGGDGGGPSYCDG  77

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH N+E+VVALSTGW+   SRC KMIRI A NG++TTAKVVDECDS  GCD EH GQ P
Sbjct  78   KYHSNSEKVVALSTGWFDNKSRCGKMIRITARNGKTTTAKVVDECDSRAGCDKEHAGQPP  137

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C NNIVDGSAAVW  LGLD+D G V +TW+MA
Sbjct  138  CRNNIVDGSAAVWKALGLDQDEGVVPVTWSMA  169



>ref|XP_002976682.1| hypothetical protein SELMODRAFT_443242 [Selaginella moellendorffii]
 gb|EFJ22351.1| hypothetical protein SELMODRAFT_443242 [Selaginella moellendorffii]
Length=231

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 137/228 (60%), Gaps = 22/228 (10%)
 Frame = +1

Query  61   LALISLCIFAIFFCFSLQGNAL----SSCNGPCTTLDDCSGQLICIGGK-CNDDPDVGTH  225
            +AL    I  +    S+    L      C   C+T DDC GQL C GG+ C DDPD+GTH
Sbjct  1    MALRIGSIVRVLIVLSICSRDLLVESRGCGQSCSTNDDCDGQLYCGGGRTCQDDPDLGTH  60

Query  226  IC---RGGSTPTPGNCKPVGSMTCNGETK-----------STYRCSPPMKSSTPAILTLN  363
            IC    GG     G C+  G++  N   +             YRCSPP+  ST AILT+N
Sbjct  61   ICAGSGGGGGGGSGTCQQSGTLKGNSAHQCGECCKANTNYPIYRCSPPVSQSTKAILTVN  120

Query  364  DFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDE  543
            DF  GGDGG PSECD  +H N ERVVALSTGWY+GGSRC K I I A NGRSTTAKVVDE
Sbjct  121  DFQAGGDGGDPSECDGKFHSNTERVVALSTGWYSGGSRCLKFISITAPNGRSTTAKVVDE  180

Query  544  CDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL---DKDLGRVSLTW  678
            CDS  GCD  H  Q PC NNIVDGS AVW  LG+   D   G++S+TW
Sbjct  181  CDSTMGCDKPHAWQPPCRNNIVDGSDAVWKALGISSSDPLYGQMSITW  228



>ref|XP_002973169.1| hypothetical protein SELMODRAFT_99218 [Selaginella moellendorffii]
 gb|EFJ25543.1| hypothetical protein SELMODRAFT_99218 [Selaginella moellendorffii]
Length=231

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 135/228 (59%), Gaps = 22/228 (10%)
 Frame = +1

Query  61   LALISLCIFAIFFCFSLQGNAL----SSCNGPCTTLDDCSGQLIC-IGGKCNDDPDVGTH  225
            +AL    I  +   FS+    L      C   C+T DDC GQL C  G  C DDPD+GTH
Sbjct  1    MALRIGSIVRVLILFSICSRDLLVESRGCGQSCSTNDDCDGQLYCGAGSTCQDDPDLGTH  60

Query  226  ICRGGSTPTPG---NCKPVGSMTCNGETK-----------STYRCSPPMKSSTPAILTLN  363
            IC G      G    C+  G++  N   +             YRCSPP+  ST AILT+N
Sbjct  61   ICAGSGGGGGGDSGTCQQSGTLKGNSAHQCGECCKANTNYPIYRCSPPVSQSTKAILTVN  120

Query  364  DFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDE  543
            DF  GGDGG PSECD  +H N ERVVALSTGWY+GGSRC K I I A NG+STTAKVVDE
Sbjct  121  DFQAGGDGGDPSECDGKFHSNTERVVALSTGWYSGGSRCLKFISITAPNGKSTTAKVVDE  180

Query  544  CDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL---DKDLGRVSLTW  678
            CDS  GCD  H  Q PC NNIVDGS AVW  LG+   D   G++S+TW
Sbjct  181  CDSTMGCDKPHAWQPPCWNNIVDGSDAVWKALGISSSDSLYGQMSITW  228



>ref|XP_010109493.1| hypothetical protein L484_007513 [Morus notabilis]
 gb|EXC22904.1| hypothetical protein L484_007513 [Morus notabilis]
Length=151

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +1

Query  262  CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVV  441
            C+P G+  CNG + +TY CSPP+ SST A LT NDFSEGGDG   S CD  YHDN+  +V
Sbjct  10   CQPSGTCNCNGYSGNTYSCSPPVTSSTQAQLTNNDFSEGGDGSGASSCDGAYHDNSVLIV  69

Query  442  ALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSA  621
            ALSTGW+  GSRC KMIRI AS+G ST AKVVDECDSMHGCD EH GQ PC NNIVDGS 
Sbjct  70   ALSTGWFKEGSRCGKMIRITASDGTSTEAKVVDECDSMHGCDAEHAGQPPCTNNIVDGSD  129

Query  622  AVWNDLGLDKDLGRVSLTWAMA  687
            AVW+ LGL+KDLG V++TW++ 
Sbjct  130  AVWSALGLNKDLGVVNVTWSIV  151



>ref|XP_004251166.1| PREDICTED: kiwellin-like [Solanum lycopersicum]
Length=180

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 134/214 (63%), Gaps = 36/214 (17%)
 Frame = +1

Query  52   MANLALI-SLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHI  228
            M  LALI SLCI  IF  F     ++SSCNGPC +L+DC GQLICI GKCNDDPDVGT  
Sbjct  1    MTKLALILSLCI--IFTTFISSSYSISSCNGPCKSLNDCDGQLICIKGKCNDDPDVGTS-  57

Query  229  CRGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
                                          SPP   ST  +LTLNDFSEGGDGG PSECD
Sbjct  58   ---------------------ICGGGGSSPSPPSTGSTSGMLTLNDFSEGGDGGGPSECD  96

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRAS-NGRSTTAKVVDECDSMHGCDDEHGGQ  585
            E YHDNNERVVAL+T WY  GSRC KMIRIRA+ NG+S TAKVVDECD+  G        
Sbjct  97   EKYHDNNERVVALTTRWYDNGSRCGKMIRIRANKNGKSVTAKVVDECDTKDG--------  148

Query  586  GPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
              C NN+VDGS AVW  LGLD + GRV +TW+M 
Sbjct  149  --CKNNVVDGSIAVWRALGLDTNEGRVPITWSMV  180



>ref|XP_006593266.1| PREDICTED: putative ripening-related protein 1-like [Glycine 
max]
Length=289

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = +1

Query  256  GNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNER  435
            G+C+  G++TC       Y+CSPP+ SST AILT NDF+EGGDGG  S+CDE +HDN+E 
Sbjct  148  GSCQKSGTLTCATGEYDQYQCSPPVSSSTDAILTRNDFTEGGDGGDRSQCDEQFHDNSEL  207

Query  436  VVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDG  615
            VVALSTGW+  GSRC K+I I A NGRS TAKVVD+CDS+HGCD EH  Q PC NNIVDG
Sbjct  208  VVALSTGWFDNGSRCLKLITITAGNGRSVTAKVVDQCDSVHGCDKEHADQPPCRNNIVDG  267

Query  616  SAAVWNDLGLDKDLGRVSLTWAMA  687
            S AVW+ LGLD   G   +TW+MA
Sbjct  268  SQAVWDALGLDS--GEERVTWSMA  289



>ref|XP_008227665.1| PREDICTED: kiwellin-like [Prunus mume]
Length=173

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  277  SMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTG  456
            ++ CNG +     CSPP+ S   A LTLNDFS+G +GG   ECD  +HDNNE VVALSTG
Sbjct  33   TLVCNGLSYPQLTCSPPVASYISANLTLNDFSQGVEGGDRLECDNQFHDNNELVVALSTG  92

Query  457  WYAGGSRCEKMIRIRASN---GRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAV  627
            WY  GSRC +MI I ASN   GRS  AKVVDECDS+ GCD EH G  PC NN+VDG A V
Sbjct  93   WYDSGSRCGRMIVISASNATIGRSVAAKVVDECDSVKGCDSEHAGLPPCGNNVVDGFAGV  152

Query  628  WNDLGLDKDLGRVSLTWAMA  687
            WN LGL+KDLG V+++W MA
Sbjct  153  WNALGLNKDLGVVNISWIMA  172



>ref|XP_004986467.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
Length=182

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  20   PGAGLGVCRASGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTASTKAVLTLNSFEK  79

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   IRI A NG S  AKVVDECDS+
Sbjct  80   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIRISA-NGNSVYAKVVDECDSV  138

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVW+ LGLD+ LG V +TW+
Sbjct  139  HGCDDEHNFEPPCDNNIVDASPAVWDALGLDQSLGMVDITWS  180



>gb|KEH39370.1| Ripening related protein family [Medicago truncatula]
Length=167

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            ++NL  ++              N +SSCNGPC TL+DC+GQLICI GKCNDDPDVGT+IC
Sbjct  4    VSNLVFLASIFLFNIINIPFLTNVISSCNGPCKTLNDCAGQLICINGKCNDDPDVGTNIC  63

Query  232  RGGSTPTPG--NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
               S P+P    CK  G++  +GE+   ++CSPP+ SST A+LTLNDFSEGGD GAPS+C
Sbjct  64   TKPSPPSPSGDKCKSSGTLEYDGESFPQFKCSPPVSSSTQALLTLNDFSEGGDEGAPSQC  123

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKM  489
            DE +H  +ERVVALSTGWY GGSRC  M
Sbjct  124  DEQFHSYSERVVALSTGWYNGGSRCGIM  151



>ref|XP_008663663.1| PREDICTED: putative ripening-related protein 5 [Zea mays]
 gb|AFW59681.1| hypothetical protein ZEAMMB73_370706 [Zea mays]
Length=193

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +G DGG PSECD  YH + 
Sbjct  48   GNCEKSNDPDCCEDGKMYPQYRCSPPVTASTRAVLTLNSFEKGKDGGGPSECDNAYHSDQ  107

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E+VVALSTGW++  +RC   I+I A+NG S  AKVVDECDS+HGCDDEH  + PCDNNIV
Sbjct  108  EKVVALSTGWFSNMARCGHRIKISAANGNSVYAKVVDECDSVHGCDDEHNFEPPCDNNIV  167

Query  610  DGSAAVWNDLGLDKDLGRVSLTWA  681
            D S AVW+ LGLD+++G V +TW+
Sbjct  168  DASPAVWDALGLDQNVGMVDITWS  191



>ref|XP_003638067.1| Kiwellin [Medicago truncatula]
Length=183

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +1

Query  52   MANLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHIC  231
            ++NL  ++              N +SSCNGPC TL+DC+GQLICI GKCNDDPDVGT+IC
Sbjct  4    VSNLVFLASIFLFNIINIPFLTNVISSCNGPCKTLNDCAGQLICINGKCNDDPDVGTNIC  63

Query  232  RGGSTPTPG--NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
               S P+P    CK  G++  +GE+   ++CSPP+ SST A+LTLNDFSEGGD GAPS+C
Sbjct  64   TKPSPPSPSGDKCKSSGTLEYDGESFPQFKCSPPVSSSTQALLTLNDFSEGGDEGAPSQC  123

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKM  489
            DE +H  +ERVVALSTGWY GGSRC  M
Sbjct  124  DEQFHSYSERVVALSTGWYNGGSRCGIM  151



>ref|XP_004986465.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
 ref|XP_004986466.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
Length=182

 Score =   173 bits (438),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  20   PGAGLGVCRASGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTASTKAVLTLNSFEK  79

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  80   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIKISA-NGNSVYAKVVDECDSV  138

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVW+ LGLD+ LG V +TW+
Sbjct  139  HGCDDEHNFEPPCDNNIVDASPAVWDALGLDQSLGMVDITWS  180



>ref|XP_004986463.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
Length=191

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  29   PGAGLGVCRASGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTASTKAVLTLNSFEK  88

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  89   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIKISA-NGNSVYAKVVDECDSV  147

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVW+ LGLD+ LG V +TW+
Sbjct  148  HGCDDEHNFEPPCDNNIVDASPAVWDALGLDQSLGMVDITWS  189



>ref|XP_002448653.1| hypothetical protein SORBIDRAFT_06g030860 [Sorghum bicolor]
 gb|EES12981.1| hypothetical protein SORBIDRAFT_06g030860 [Sorghum bicolor]
Length=181

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 121/201 (60%), Gaps = 23/201 (11%)
 Frame = +1

Query  85   FAIFFCFSLQGNALSSCNGPCTTLDDC--SGQLICIGGKCNDDPDVGTHICRGGSTPTPG  258
             A+FF  +L  + ++S   P T L  C  SG L    G C    D             P 
Sbjct  1    MAMFFLVALSASHMASSLRPGTGLGTCRVSGYLPGHSGNCQKSND-------------PD  47

Query  259  NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERV  438
             C+       +G+    Y CSPP+ +ST A+LTLN F +G DGG PSECD  YH++ E+V
Sbjct  48   CCE-------DGKKYPQYHCSPPVTASTKAVLTLNSFEKGKDGGGPSECDNAYHNDEEKV  100

Query  439  VALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGS  618
            VALSTGW++  +RC   I+I A NG S  AKVVDECDS+HGCDDEH  + PCDNNIVD S
Sbjct  101  VALSTGWFSNMARCGHQIKISA-NGNSVYAKVVDECDSVHGCDDEHNFEPPCDNNIVDAS  159

Query  619  AAVWNDLGLDKDLGRVSLTWA  681
             AVWN LGLD +LG V +TW+
Sbjct  160  PAVWNALGLDLNLGMVDITWS  180



>tpg|DAA35673.1| TPA: hypothetical protein ZEAMMB73_121999 [Zea mays]
Length=225

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G   CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  63   PGAGLGTCRASGYLPGRSGNCEKSNDPDCCEDGKMYPQYRCSPPVTASTKAVLTLNSFEK  122

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH ++E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  123  GKDGGGPSECDNAYHSDSEKVVALSTGWFSNMARCGHRIKISA-NGNSVYAKVVDECDSV  181

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVWN LGLD+++G V +TW+
Sbjct  182  HGCDDEHNFEPPCDNNIVDASPAVWNALGLDQNVGMVDITWS  223



>ref|XP_007206669.1| hypothetical protein PRUPE_ppa022897mg [Prunus persica]
 gb|EMJ07868.1| hypothetical protein PRUPE_ppa022897mg [Prunus persica]
Length=167

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +1

Query  247  PTPGNCKPVGSMTCN-GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHD  423
            P+  +C P G++ C+ G+   TY CSPP+   T A LTLN+FS+GG+GGAPSECD  +HD
Sbjct  19   PSSDDCGPSGTLACDDGQNFPTYTCSPPVMPPTSAKLTLNNFSKGGEGGAPSECDNQFHD  78

Query  424  NNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
            N ERVVALSTGW++  +RC   I I A SNG S  AKVVD+CDS +GCD+EHG   PC+N
Sbjct  79   NTERVVALSTGWFSNEARCNMTIIITAVSNGMSVEAKVVDQCDSQYGCDEEHGFLPPCEN  138

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            NIVDGS AVW  L LD + G   +TW+ A
Sbjct  139  NIVDGSLAVWEALSLDTNPGSAEVTWSTA  167



>ref|XP_002448655.1| hypothetical protein SORBIDRAFT_06g030870 [Sorghum bicolor]
 gb|EES12983.1| hypothetical protein SORBIDRAFT_06g030870 [Sorghum bicolor]
Length=191

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P VG   C   G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  29   PGVGLGTCHASGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTASTKAVLTLNSFEK  88

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  89   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHQIKISA-NGNSVYAKVVDECDSV  147

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCD+EH  + PCDNNIVD S AVWN LGLD++LG V +TW+
Sbjct  148  HGCDNEHNFEPPCDNNIVDASPAVWNALGLDQNLGMVDITWS  189



>ref|XP_009389228.1| PREDICTED: putative ripening-related protein 1 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 102/147 (69%), Gaps = 3/147 (2%)
 Frame = +1

Query  253  PGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            PG+C P  S  C   GE+   YRCSPP+   T A LT+N F E  DGG PSECD  YH +
Sbjct  42   PGHCDPGYSSDCCKAGESYPQYRCSPPITGHTHAKLTVNCFEENCDGGGPSECDNSYHSD  101

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNI  606
             E VVALSTGWYAGGSRC +MIRI A NGRS  AKVVDECDS++GCDDEH  Q PC NNI
Sbjct  102  KEMVVALSTGWYAGGSRCHQMIRIHA-NGRSVLAKVVDECDSVNGCDDEHDFQPPCPNNI  160

Query  607  VDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            VD S AVW  LG+  D+G   +TW+ A
Sbjct  161  VDASPAVWKALGISTDVGLYPVTWSDA  187



>ref|XP_004986464.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
Length=244

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  29   PGAGLGVCRASGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTASTKAVLTLNSFEK  88

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  89   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIKISA-NGNSVYAKVVDECDSV  147

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVW+ LGLD+ LG V +TW+
Sbjct  148  HGCDDEHNFEPPCDNNIVDASPAVWDALGLDQSLGMVDITWS  189



>dbj|BAJ99885.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=179

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 7/150 (5%)
 Frame = +1

Query  256  GNCKPVGSMTCN-----GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
            G+ +P    +C      G+   TYRCSPP+ SST A++TLN+F EGG+GG PSECD  +H
Sbjct  31   GSLRPSRGHSCQDCCKAGQAYPTYRCSPPVSSSTRAVMTLNNFDEGGEGGDPSECDGKFH  90

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
             N+ERVVALSTGWY+GGSRC   +RIRA NGRS  AKVVDECD+++GCD EHG Q PC N
Sbjct  91   HNSERVVALSTGWYSGGSRCGNNVRIRA-NGRSVLAKVVDECDTLNGCDREHGYQPPCRN  149

Query  601  NIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
            N+VD S AVW+ LG+  +++G  ++TW+ A
Sbjct  150  NVVDASQAVWDALGITGEEVGEYNVTWSDA  179



>ref|XP_002464443.1| hypothetical protein SORBIDRAFT_01g018510 [Sorghum bicolor]
 gb|EER91441.1| hypothetical protein SORBIDRAFT_01g018510 [Sorghum bicolor]
Length=197

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 104/146 (71%), Gaps = 4/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNCK      C   GE+   +RCSPP+ + TPAILT+N F +G DGG PSECD  YHD++
Sbjct  50   GNCKKFHGSDCCRAGESYPQFRCSPPVSAKTPAILTVNSFEKGKDGGGPSECDNSYHDDS  109

Query  430  ERVVALSTGWYA--GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            E+VVALS+GW    G  RC K +R+ A NGRS  AKVVDECDS++GCDDEH  + PC  N
Sbjct  110  EKVVALSSGWLRLDGTKRCGKKVRVTAGNGRSVVAKVVDECDSVNGCDDEHNFEPPCAPN  169

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
            IVDGS AVW  LGL++D+G V +TW+
Sbjct  170  IVDGSPAVWKALGLNEDIGEVKVTWS  195



>tpg|DAA35674.1| TPA: hypothetical protein ZEAMMB73_749031 [Zea mays]
Length=191

 Score =   170 bits (430),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G   CR  G  P   GNC+      C  +G+    Y CSPP+ +ST A+LTLN F +
Sbjct  29   PGAGLGTCRASGYLPGRSGNCEKSNDPDCCEDGKMYPQYHCSPPVTASTKAVLTLNSFEK  88

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH ++E+VVALSTGW++  +RC   IRI A NG S  AKVVDECDS+
Sbjct  89   GKDGGGPSECDNAYHSDSEKVVALSTGWFSNMARCGHRIRISA-NGNSVYAKVVDECDSV  147

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVW+ LGLD+++G V +TW+
Sbjct  148  HGCDDEHNFEPPCDNNIVDASPAVWDALGLDQNVGMVDITWS  189



>emb|CBI16342.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 120/220 (55%), Gaps = 51/220 (23%)
 Frame = +1

Query  52   MAN---LALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGT  222
            MAN   + L S+C+             LSSC G C TL+DC GQLICI GKCNDDP+VGT
Sbjct  1    MANSPVVWLASVCLVFNILSLPFLALGLSSCGGSCQTLNDCEGQLICINGKCNDDPEVGT  60

Query  223  HICRGGSTPTPGNCKPV----GSMTCNG-ETKSTYRCSPPMKSSTPAILTLNDFSEGGDG  387
            HIC G S+             G++ C G + K+TY CSPP+ SSTPA+LT N+F +GGDG
Sbjct  61   HICGGNSSTPSPPSPSTCQPSGTLACKGGKPKNTYTCSPPVTSSTPAVLTNNNFEKGGDG  120

Query  388  GAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCD  567
            G PS CD  YHDN+ER+VALSTGWY GGSR                              
Sbjct  121  GGPSACDNKYHDNSERIVALSTGWYNGGSR------------------------------  150

Query  568  DEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
                          DGS AVWN LGLD ++G V +TW+MA
Sbjct  151  -------------FDGSNAVWNALGLDINIGEVDVTWSMA  177



>ref|XP_006340403.1| PREDICTED: kiwellin-like [Solanum tuberosum]
Length=198

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 110/174 (63%), Gaps = 32/174 (18%)
 Frame = +1

Query  169  GQLICIGGKCNDDPDVGTHICRGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPA  348
            GQLICI GKCNDDPDVGT IC                             SPP   STP 
Sbjct  56   GQLICIRGKCNDDPDVGTSIC---------------------GGGGGSSPSPPSTGSTPG  94

Query  349  ILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTT  525
            +LTLNDFSEGGDGG PSECDE YHDNN+RVVAL+T WY  GSRC KMIRIRA  NG+S T
Sbjct  95   MLTLNDFSEGGDGGGPSECDEKYHDNNDRVVALTTRWYDNGSRCGKMIRIRADKNGKSVT  154

Query  526  AKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            AKVVDECD   G          C NN+VDGS AVW  LGL+ D GRV +TW+MA
Sbjct  155  AKVVDECDIKDG----------CKNNVVDGSIAVWRALGLNTDEGRVPITWSMA  198



>ref|XP_002979938.1| hypothetical protein SELMODRAFT_37481, partial [Selaginella moellendorffii]
 ref|XP_002987416.1| hypothetical protein SELMODRAFT_27323, partial [Selaginella moellendorffii]
 gb|EFJ11503.1| hypothetical protein SELMODRAFT_27323, partial [Selaginella moellendorffii]
 gb|EFJ18808.1| hypothetical protein SELMODRAFT_37481, partial [Selaginella moellendorffii]
Length=163

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             GE+   Y CSP +   T AILT+NDF EGGDGGAPSECD  YHDN+E VVALSTGWYA 
Sbjct  31   EGESYPRYECSPQVTGKTKAILTVNDFEEGGDGGAPSECDNQYHDNSEPVVALSTGWYAK  90

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL-  645
            GSRC K +RI A NGR+  AKVVDECDSM+GCD +H  + PC NNIVD S  VW  LG+ 
Sbjct  91   GSRCGKFVRISA-NGRTVRAKVVDECDSMNGCDKDHAFEPPCLNNIVDASPVVWKKLGVS  149

Query  646  --DKDLGRVSLTWA  681
              D D G + +TWA
Sbjct  150  QDDDDYGYMKITWA  163



>ref|XP_004986461.1| PREDICTED: putative ripening-related protein 4-like [Setaria 
italica]
Length=198

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 102/146 (70%), Gaps = 4/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            G CK +    C   G     +RCSPP+ +STPA LTLN F +G DGG PSECD H+H ++
Sbjct  51   GKCKTLHGSDCCVAGRKYPQFRCSPPVSASTPATLTLNSFEKGKDGGGPSECDHHFHKDS  110

Query  430  ERVVALSTGWYA--GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            E VVALS+GW    G  RC KM+R+ A+NGRS  AKVVDECDS++GCD+EH  + PC NN
Sbjct  111  EMVVALSSGWLRLDGTRRCGKMVRVTAANGRSVLAKVVDECDSVNGCDNEHNFEPPCPNN  170

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
            +VDGS AVW  LGL + LG V +TW+
Sbjct  171  VVDGSPAVWKALGLKQSLGEVKVTWS  196



>ref|XP_007016800.1| Kiwellin, putative [Theobroma cacao]
 gb|EOY34419.1| Kiwellin, putative [Theobroma cacao]
Length=178

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  298  TKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSR  477
            T +  +  PP K    A LT NDFS+GGDGG PSECD  YH+N+E +VALSTGW+ G SR
Sbjct  53   THAHLQSHPPTK----ARLTNNDFSKGGDGGDPSECDRKYHNNSELIVALSTGWFKGRSR  108

Query  478  CEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDL  657
            C +MIRI ASN RS TAKVVDECDSMHGCD  H  Q PC NNIVDGS AVW+ LGL+K +
Sbjct  109  CGRMIRITASNRRSVTAKVVDECDSMHGCDKGHAYQPPCGNNIVDGSDAVWSRLGLNKAV  168

Query  658  GRVSLTWAMA  687
            G V +TW+MA
Sbjct  169  GVVDVTWSMA  178



>gb|EAY79019.1| hypothetical protein OsI_34128 [Oryza sativa Indica Group]
Length=192

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 104/146 (71%), Gaps = 4/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC+ +    C  +G+    YRCSPP+ ++T A+LTLN F +G DGG PSECD  YH + 
Sbjct  42   GNCEKINDPDCCEDGKAYPQYRCSPPVTAATGAVLTLNSFEKGKDGGGPSECDNAYHSDG  101

Query  430  ERVVALSTGWYAGGSRCEKMIRIRAS--NGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            E VVALSTGW+AG +RC   +RI AS  +GRS  AKVVDECDS+HGCD EH  + PCDNN
Sbjct  102  ELVVALSTGWFAGMARCGHRVRITASGGSGRSVVAKVVDECDSVHGCDGEHNYEPPCDNN  161

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
            IVD S AVW+ LGLDK +G   +TW+
Sbjct  162  IVDASPAVWDALGLDKSVGMEHITWS  187



>gb|EAY78861.1| hypothetical protein OsI_33966 [Oryza sativa Indica Group]
Length=185

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+    YRCSPP+ S+T  +LTLN F +G DGG PSECD  YH + E VVALSTGW+AG
Sbjct  50   DGKAYPQYRCSPPVTSATGGVLTLNSFEKGKDGGGPSECDNAYHSDGELVVALSTGWFAG  109

Query  469  GSRCEKMIRIRAS-NGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL  645
             +RC   +RI AS +GRS  AKVVDECDS+HGCDDEH  + PCDNNIVD S AVW+ LGL
Sbjct  110  MARCGHRVRITASGSGRSVVAKVVDECDSVHGCDDEHNYEPPCDNNIVDASPAVWDALGL  169

Query  646  DKDLGRVSLTWA  681
            DK +G   +TW+
Sbjct  170  DKSVGMEHITWS  181



>ref|XP_008671058.1| PREDICTED: uncharacterized protein LOC103648352 [Zea mays]
Length=387

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 111/162 (69%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G   CR  G  P   GNC+      C  +G+    YRCSPP+ +ST A+LTLN F +
Sbjct  69   PGAGLGTCRASGYLPGRSGNCEKSNDPDCCEDGKMYPQYRCSPPVTASTKAVLTLNSFEK  128

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH ++E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  129  GKDGGGPSECDNAYHSDSEKVVALSTGWFSNMARCGHRIKISA-NGNSVYAKVVDECDSV  187

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            HGCDDEH  + PCDNNIVD S AVWN LGLD+++G V +TW+
Sbjct  188  HGCDDEHNFEPPCDNNIVDASPAVWNALGLDQNVGMVDITWS  229


 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC+      C  +G+    Y CSPP+ +ST A+LTLN F +G DGG PSECD  YH ++
Sbjct  243  GNCEKSNDPDCCEDGKMYPQYHCSPPVTASTKAVLTLNSFEKGKDGGGPSECDNAYHSDS  302

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E+VVALSTGW++  +RC   IRI A NG S  AKVVDECDS+HGCDDEH  + PCDNNIV
Sbjct  303  EKVVALSTGWFSNMARCGHRIRISA-NGNSVYAKVVDECDSVHGCDDEHNFEPPCDNNIV  361

Query  610  DGSAAVWNDLGLDKDLGRVSLTWA  681
            D S AVW+ LGLD+++G V +TW+
Sbjct  362  DASPAVWDALGLDQNVGMVDITWS  385



>ref|XP_004986470.1| PREDICTED: ripening-related protein 3-like [Setaria italica]
Length=197

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 104/147 (71%), Gaps = 3/147 (2%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSS-TPAILTLNDFSEGGDGGAPSECDEHYHDN  426
            G+C P     C  +G+  +T+ CSPP+ ++ T A LTLN F++ GDGG  + C   +  +
Sbjct  51   GSCNPENDSVCCEDGKRYTTFACSPPVVTTGTRATLTLNSFADHGDGGGAASCTGTFFGD  110

Query  427  NERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNI  606
             ERVVALSTGW+  GSRC + + IRASNGRS TAKVVDECDSMHGCDDEH  + PCDNNI
Sbjct  111  GERVVALSTGWFGRGSRCRRSVVIRASNGRSVTAKVVDECDSMHGCDDEHNFEPPCDNNI  170

Query  607  VDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            VDGS AVW  LGL  D GRV +TW+ A
Sbjct  171  VDGSPAVWKALGLKTDDGRVPVTWSDA  197



>ref|XP_002467033.1| hypothetical protein SORBIDRAFT_01g018590 [Sorghum bicolor]
 gb|EER94031.1| hypothetical protein SORBIDRAFT_01g018590 [Sorghum bicolor]
Length=182

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = +1

Query  208  PDVGTHICR-GGSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ ++T A+LTLN F +
Sbjct  20   PSAGLGVCRPSGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTANTKAVLTLNSFEK  79

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  80   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIKITA-NGNSVYAKVVDECDSV  138

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
             GCD++H  + PCDNNIVD S AVW+ LGLD+++G V +TW+
Sbjct  139  EGCDEDHNFEPPCDNNIVDASPAVWDALGLDQNIGMVDITWS  180



>ref|XP_011087068.1| PREDICTED: putative ripening-related protein 1 [Sesamum indicum]
Length=187

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSPP+  +T A+LTLN F EGGDGG PSECD 
Sbjct  36   GKKPPPGQCNQENDSDCCKQGKLYTTYKCSPPVSGTTKAVLTLNSFQEGGDGGGPSECDN  95

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +N  VVALSTGWY+GGSRC   I I A NGRS TA VVDECDS  GCD++H  Q P
Sbjct  96   KYHSDNTPVVALSTGWYSGGSRCLNNITISA-NGRSVTAMVVDECDSTMGCDEDHDYQPP  154

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + +TW+ A
Sbjct  155  CPNNIVDASKAVWKALGVPEDDWGEMDITWSDA  187



>ref|XP_002979937.1| hypothetical protein SELMODRAFT_112102 [Selaginella moellendorffii]
 ref|XP_002987415.1| hypothetical protein SELMODRAFT_426266 [Selaginella moellendorffii]
 gb|EFJ11502.1| hypothetical protein SELMODRAFT_426266 [Selaginella moellendorffii]
 gb|EFJ18807.1| hypothetical protein SELMODRAFT_112102 [Selaginella moellendorffii]
Length=186

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 101/145 (70%), Gaps = 9/145 (6%)
 Frame = +1

Query  274  GSMTCN-----GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERV  438
            G ++C+     GE+   Y CSP +   T AILT+NDF EGG GG PSECD  YHDN+E V
Sbjct  42   GRLSCDECCKEGESYPQYECSPQVTGETIAILTVNDFEEGGYGGGPSECDNQYHDNSEPV  101

Query  439  VALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGS  618
            VALSTGWYA GSRC   +RI A NGR+ +AKVVDECDS++GCD EH  + PC NNIVD S
Sbjct  102  VALSTGWYAKGSRCGNFVRISA-NGRTVSAKVVDECDSVNGCDKEHTFEPPCLNNIVDAS  160

Query  619  AAVWNDLGL---DKDLGRVSLTWAM  684
             AVW  LG+   D D G + +TWAM
Sbjct  161  PAVWKALGISQDDGDYGYMKITWAM  185



>ref|XP_004954840.1| PREDICTED: putative ripening-related protein 5-like [Setaria 
italica]
Length=191

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC       C  +G+    YRCSPP+ SSTPA LTLN F +G DGG PSECD  YH ++
Sbjct  45   GNCVKSNDPDCCVDGKRYPQYRCSPPVTSSTPATLTLNSFEKGKDGGGPSECDNSYHSDD  104

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+HGCDD+H  + PC NNIV
Sbjct  105  EMVVALSTGWFSNMARCGHRIKITA-NGNSVYAKVVDECDSVHGCDDDHNFEAPCANNIV  163

Query  610  DGSAAVWNDLGLDKDLGRVSLTWA  681
            D S AVWN LGLD+  G   +TW+
Sbjct  164  DASPAVWNALGLDQSTGEQDITWS  187



>gb|EAY79011.1| hypothetical protein OsI_34120 [Oryza sativa Indica Group]
 gb|EAY79012.1| hypothetical protein OsI_34121 [Oryza sativa Indica Group]
Length=191

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 102/146 (70%), Gaps = 4/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC+      C  +G+    YRCSPP+ ++T A+LTLN F +G DGG PSECD  YH + 
Sbjct  42   GNCEKSNDPDCCEDGKAYPQYRCSPPVTAATGAVLTLNSFEKGKDGGGPSECDNAYHSDG  101

Query  430  ERVVALSTGWYAGGSRCEKMIRIRAS--NGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            E VVALSTGW+AG +RC   +RI AS   GRS  AKVVDECDS+HGCD EH  + PC NN
Sbjct  102  ELVVALSTGWFAGTARCGHRVRITASGGGGRSVVAKVVDECDSVHGCDGEHNYEAPCGNN  161

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
            IVD S AVW+ LGLDK++G   +TW+
Sbjct  162  IVDASPAVWDALGLDKNVGMEHITWS  187



>ref|XP_003571925.1| PREDICTED: ripening-related protein 3-like [Brachypodium distachyon]
Length=191

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            G C P     C  +G+   T+ CS  +   T A+LTLN F++GGDGG  SECDE +H ++
Sbjct  46   GTCNPENGSECCVDGQRYQTFACSSRVTGRTRAVLTLNSFADGGDGGGRSECDEKFHADS  105

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E VVALSTGWY GG RC K + IRA++G++TTAKVVDECDS  GCDDEH  + PC NN+V
Sbjct  106  EPVVALSTGWYDGGGRCGKRVVIRAASGKTTTAKVVDECDSTRGCDDEHNFEPPCANNVV  165

Query  610  DGSAAVWNDLGLDKDLGRVSLTWAMA  687
            DGS AVW  LGLD D G V +TW+ A
Sbjct  166  DGSPAVWKALGLDTDDGVVPITWSDA  191



>ref|XP_004231182.1| PREDICTED: uncharacterized protein LOC101261762 [Solanum lycopersicum]
Length=349

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  198  GIKPPPGQCNPENDSDCCKQGKIYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  257

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  258  QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  316

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ D D G  ++TW+ A
Sbjct  317  CPNNIVDASKAVWKALGIPDGDWGDYAITWSDA  349


 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  38   GIKPPPGQCNPENDSDCCKQGKLYTTYTCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I + A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  98   QYHSDDTPVVALSTGWYSGGDRCLNYITVSA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G   +TW+ A
Sbjct  157  CPNNIVDASKAVWEALGIPEGDWGDYDITWSDA  189



>ref|NP_001047526.2| Os02g0637000 [Oryza sativa Japonica Group]
 sp|Q6H5X0.1|RIP2_ORYSJ RecName: Full=Putative ripening-related protein 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD25081.1| ripening-related protein-like [Oryza sativa Japonica Group]
 dbj|BAD25879.1| ripening-related protein-like [Oryza sativa Japonica Group]
 gb|EAY86825.1| hypothetical protein OsI_08206 [Oryza sativa Indica Group]
 gb|EAZ23929.1| hypothetical protein OsJ_07655 [Oryza sativa Japonica Group]
 dbj|BAF09440.2| Os02g0637000 [Oryza sativa Japonica Group]
Length=192

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 103/157 (66%), Gaps = 8/157 (5%)
 Frame = +1

Query  235  GGSTPTPGNCKPVGSMTCN-----GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPS  399
            GG  P+ G  +P  S +C      G +  TY CSP    ST A++TLNDF  GGDGG PS
Sbjct  38   GGCNPS-GTLRPSRSHSCQDCCKAGRSYPTYACSPATTGSTKAVMTLNDFEAGGDGGDPS  96

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECD  +H N ERVVALSTGWYA G RC K IRI A NGRS  AKVVDECDS+HGCD EH 
Sbjct  97   ECDGKFHKNTERVVALSTGWYANGRRCNKNIRINA-NGRSVLAKVVDECDSLHGCDKEHA  155

Query  580  GQGPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
             Q PC  N+VD S AVW+ L +  +D+G   +TW+ A
Sbjct  156  YQPPCRPNVVDASQAVWDALRITGEDVGEYDITWSDA  192



>ref|XP_002452504.1| hypothetical protein SORBIDRAFT_04g027050 [Sorghum bicolor]
 gb|EES05480.1| hypothetical protein SORBIDRAFT_04g027050 [Sorghum bicolor]
Length=188

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 98/154 (64%), Gaps = 2/154 (1%)
 Frame = +1

Query  229  CRGGSTPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
            CRG     P      G     G    TYRCSPP+   T AI+TLNDFSEGGDGG PSECD
Sbjct  36   CRGDPLRAPRTGHTCGECCKPGHIYKTYRCSPPVSGDTRAIMTLNDFSEGGDGGGPSECD  95

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
              YH+N E VVALSTGWY  G RC K I+I A  GRS  AKVVDECDS+HGCD +H  Q 
Sbjct  96   GKYHNNTELVVALSTGWYDKGERCHKQIQIHA-KGRSVLAKVVDECDSLHGCDPKHAYQP  154

Query  589  PCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            PC  NIVD S AVW+ L +  D +G   +TW+ A
Sbjct  155  PCRPNIVDASQAVWDALHITGDEVGEYPITWSDA  188



>ref|XP_002467032.1| hypothetical protein SORBIDRAFT_01g018580 [Sorghum bicolor]
 gb|EER94030.1| hypothetical protein SORBIDRAFT_01g018580 [Sorghum bicolor]
Length=187

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = +1

Query  208  PDVGTHICR-GGSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSE  375
            P  G  +CR  G  P   GNC+      C  +G+    YRCSPP+ ++T A+LTLN F +
Sbjct  29   PSAGLGVCRPSGYLPGRSGNCEKSNDPDCCEDGKKYPQYRCSPPVTANTKAVLTLNSFEK  88

Query  376  GGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
            G DGG PSECD  YH + E+VVALSTGW++  +RC   I+I A NG S  AKVVDECDS+
Sbjct  89   GKDGGGPSECDNAYHSDEEKVVALSTGWFSNMARCGHRIKITA-NGNSVYAKVVDECDSV  147

Query  556  HGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLT  675
             GCD +H  + PCDNNIVD S AVWN LGLD+++G V +T
Sbjct  148  EGCDKDHNFEPPCDNNIVDASPAVWNALGLDQNIGMVDIT  187



>gb|EMT07312.1| hypothetical protein F775_16823 [Aegilops tauschii]
Length=190

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G    T+ CSP +     A LTLN F++GGDGG  SECDE +H +++ VVALSTGW+AG
Sbjct  58   DGRRYRTFACSPRVTGRPRASLTLNSFADGGDGGGRSECDEKFHPDSQMVVALSTGWFAG  117

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            G RC K + IRA+NGRS TA VVDECDS HGCD+EH  + PC NNIVDGS AVW  LGLD
Sbjct  118  GGRCGKRVVIRAANGRSATATVVDECDSKHGCDEEHNFEPPCANNIVDGSPAVWKALGLD  177

Query  649  KDLGRVSLTWAMA  687
             D G V +TW+ A
Sbjct  178  TDDGVVPVTWSDA  190



>ref|XP_011088932.1| PREDICTED: putative ripening-related protein 1 [Sesamum indicum]
Length=184

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   GE  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD+
Sbjct  33   GKKPPPGQCNQENDSDCCKAGELYTTYKCSPPVSGTTKAVLTLNSFEKGGDGGGPSECDK  92

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GGSRC   I I A NG S TA VVDECDS  GCD++H  Q P
Sbjct  93   KYHSDDTPVVALSTGWYSGGSRCLDNITISA-NGLSVTAMVVDECDSTMGCDEDHDYQPP  151

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + +TW+ A
Sbjct  152  CPNNIVDASKAVWKALGIPEDDWGELDITWSDA  184



>ref|XP_003559355.2| PREDICTED: putative ripening-related protein 5 [Brachypodium 
distachyon]
Length=189

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 117/205 (57%), Gaps = 21/205 (10%)
 Frame = +1

Query  73   SLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPT  252
            ++   A+F   +L  + ++S   P   +   SG L    G C    D             
Sbjct  6    AVATMALFLLVTLSASHIASSLRPSLGVCRASGYLPGKAGHCEKSND-------------  52

Query  253  PGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNE  432
            P  C+       +G+    Y CSPP+ SST A+LTLN F +G DGG PSECD  YH + E
Sbjct  53   PDCCE-------DGKRYPQYHCSPPVTSSTKAVLTLNSFEKGKDGGGPSECDNSYHSDKE  105

Query  433  RVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVD  612
             VVALSTGW+   +RC   I+I A NG S  AKVVDECDS++GCD+EH  + PC NNIVD
Sbjct  106  LVVALSTGWFENMARCGHRIKITA-NGNSVYAKVVDECDSVYGCDNEHNYEPPCANNIVD  164

Query  613  GSAAVWNDLGLDKDLGRVSLTWAMA  687
             S AVWN LGLD+++G   +TW+ A
Sbjct  165  ASPAVWNALGLDQNVGMEDITWSEA  189



>ref|XP_003535456.1| PREDICTED: ripening-related protein grip22-like [Glycine max]
Length=137

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +1

Query  334  SSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNG  513
            S TPAILT+NDF  G DGG PSECD +YH   +RVVALSTGWY GGSRC KM+RI A NG
Sbjct  20   SGTPAILTVNDFGPGRDGGDPSECDGNYHPLPQRVVALSTGWYNGGSRCGKMVRITARNG  79

Query  514  RSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            R+  AKVVDECDS  GCD +H  Q PC  N+VD S  VW DLGL+ D G V + W MA
Sbjct  80   RTAVAKVVDECDSTQGCDQDHANQSPCKTNVVDASETVWKDLGLNTDDGEVPIIWTMA  137



>ref|XP_006339789.1| PREDICTED: uncharacterized protein LOC102580900 [Solanum tuberosum]
Length=345

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  34   GIMPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  93

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I + A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  94   QYHSDDTPVVALSTGWYSGGDRCLNYITVSA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  152

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G   +TW+ A
Sbjct  153  CPNNIVDASKAVWEALGIPEGDWGDYDITWSDA  185


 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  194  GIKPPPGQCNPENDSDCCKQGKMYTTYTCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  253

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I + A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  254  QYHSDDTPVVALSTGWYSGGDRCLNYITVSA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  312

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G   +TW+ A
Sbjct  313  CPNNIVDASKAVWKALGIPEGDWGDYDITWSDA  345



>ref|XP_004231181.1| PREDICTED: putative ripening-related protein 5 [Solanum lycopersicum]
Length=348

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  197  GIKPPPGQCNPENDSDCCKQGKMYTTYTCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  257  QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  315

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G   +TW+ A
Sbjct  316  CPNNIVDASKAVWESLGIPEGDWGDYDITWSDA  348


 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 98/151 (65%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  37   GIKPPPGQCNTENDSDCYKKGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  97   QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWA  681
            C NNIVD S AVW  LG+   D G   +TW+
Sbjct  156  CSNNIVDASKAVWEALGIPTDDWGDYDITWS  186



>ref|XP_002979936.1| hypothetical protein SELMODRAFT_111688 [Selaginella moellendorffii]
 gb|EFJ18806.1| hypothetical protein SELMODRAFT_111688 [Selaginella moellendorffii]
Length=188

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 106/155 (68%), Gaps = 15/155 (10%)
 Frame = +1

Query  262  CKPVGSM------TCN-----GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
            C+P G +      +C+     GE+   Y CSP +  +T AILT+NDF EGGDGG PSECD
Sbjct  32   CQPFGELHAPGGHSCDECCKEGESYPQYECSPQVTGATKAILTVNDFEEGGDGGGPSECD  91

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
              YHDN+E VVALSTGWYA GSRC K +RI A NGR+ +AKVVDECDS++GCD EH  + 
Sbjct  92   NQYHDNSEPVVALSTGWYAKGSRCGKFVRISA-NGRTVSAKVVDECDSVNGCDKEHAFEP  150

Query  589  PCDNNIVDGSAAVWNDLGL---DKDLGRVSLTWAM  684
            PC NNIVD S  VW  LG+   D D G + +TWAM
Sbjct  151  PCLNNIVDASPVVWKKLGVSQDDDDYGYMKITWAM  185



>ref|XP_006339790.1| PREDICTED: putative ripening-related protein 1-like [Solanum 
tuberosum]
Length=189

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 99/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSP +  +T A+LTLN F +GGDGG PSECD 
Sbjct  38   GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPSVTGNTKAVLTLNSFQKGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NGRS  AKVVDECDS  GCDDEH  Q P
Sbjct  98   QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGRSVKAKVVDECDSTMGCDDEHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +   G   +TW+ A
Sbjct  157  CPNNIVDASKAVWKALGIPEGGWGDYDITWSDA  189



>ref|XP_011092053.1| PREDICTED: putative ripening-related protein 1 [Sesamum indicum]
Length=349

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 104/153 (68%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  +G+  +TY+CSPP+  +T A+LTLN F EGGDGG PSECD 
Sbjct  36   GKKPPPGQCNQENDSDCCKDGKLYTTYKCSPPVTGTTKAVLTLNSFEEGGDGGGPSECDN  95

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            +YH +N  VVALSTGWY+GGSRC   I + A NGRS TA VVDECDS  GCD++H  Q P
Sbjct  96   NYHSDNTPVVALSTGWYSGGSRCLNNITVSA-NGRSVTAMVVDECDSTMGCDEDHDYQPP  154

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + +TW+ A
Sbjct  155  CPNNIVDASKAVWKALGVPEDDWGELDITWSDA  187


 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+    Y+CSP + + T A+LT+N F +GGDGG PSECD  YH ++  +VALSTGW+   
Sbjct  218  GKYYDIYKCSPKVTAHTKAVLTINSFEKGGDGGGPSECDGKYHSDHIPIVALSTGWFNKM  277

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL-D  648
             RC K I I   NG+S  A VVDECDS  GCD +H  Q PCDNNIVDGS AVW  LG+  
Sbjct  278  HRCFKNITIYG-NGKSVNAMVVDECDSTKGCDADHDYQPPCDNNIVDGSKAVWEALGVPQ  336

Query  649  KDLGRVSLTWAMA  687
            KD G + + W  A
Sbjct  337  KDRGLMDIHWTDA  349



>ref|XP_002987414.1| hypothetical protein SELMODRAFT_126090 [Selaginella moellendorffii]
 gb|EFJ11501.1| hypothetical protein SELMODRAFT_126090 [Selaginella moellendorffii]
Length=176

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 106/155 (68%), Gaps = 15/155 (10%)
 Frame = +1

Query  262  CKPVGSM------TCN-----GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECD  408
            C+P G +      +C+     GE+   Y CSP +  +T AILT+NDF EGGDGG PSECD
Sbjct  20   CQPFGELHAPGGHSCDECCKEGESYPQYECSPQVTGATKAILTVNDFEEGGDGGGPSECD  79

Query  409  EHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQG  588
              YHDN+E VVALSTGWYA GSRC K +RI A NGR+ +AKVVDECDS++GCD EH  + 
Sbjct  80   NQYHDNSEPVVALSTGWYAKGSRCGKFVRISA-NGRTVSAKVVDECDSVNGCDKEHAFEP  138

Query  589  PCDNNIVDGSAAVWNDLGL---DKDLGRVSLTWAM  684
            PC NNIVD S  VW  LG+   D D G + +TWAM
Sbjct  139  PCLNNIVDASPVVWKKLGVSQDDDDYGYMKITWAM  173



>ref|XP_010940772.1| PREDICTED: putative ripening-related protein 1 [Elaeis guineensis]
Length=187

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 115/201 (57%), Gaps = 23/201 (11%)
 Frame = +1

Query  85   FAIFFCFSLQGNALSSCNGPCTTLDDCS--GQLICIGGKCNDDPDVGTHICRGGSTPTPG  258
             A FF   +    L SC    + L +CS  G L    G CN +       C         
Sbjct  6    LATFFVLLIASFNLCSCFRYSSLLGECSPSGYLRGKAGHCNRE---NYSDC---------  53

Query  259  NCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERV  438
             CKP       G+    YRCSPP+  +T A +T+N F++GGDGG PSECD  YH+++E V
Sbjct  54   -CKP-------GKMYPQYRCSPPLTGNTRATMTINSFAKGGDGGGPSECDNKYHNDDELV  105

Query  439  VALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGS  618
            VALSTGWY  GSRC K I+I A NG S  AKVVDECDS++GCDDEH  Q PC NNIVD S
Sbjct  106  VALSTGWYHHGSRCLKNIKINA-NGNSVLAKVVDECDSVNGCDDEHDFQPPCPNNIVDAS  164

Query  619  AAVWNDLGLDKDLGRVSLTWA  681
             AVW  LG+    G   +TW+
Sbjct  165  PAVWKALGIPGSDGDYEITWS  185



>ref|XP_008644747.1| PREDICTED: putative ripening-related protein 4 [Zea mays]
 gb|AFW68498.1| hypothetical protein ZEAMMB73_209635 [Zea mays]
Length=209

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNCK +    C   G     +RCSPP+ + TPA LTLN F +G DGG PSECD  YH ++
Sbjct  62   GNCKKLHGSDCCQEGHKYPQFRCSPPVSARTPATLTLNSFEKGKDGGGPSECDNRYHKDS  121

Query  430  ERVVALSTGWYA--GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
            E VVALS+GW    G  RC + +R+ A+NGRS  A+VVDECDS++GCD+EH  + PC N+
Sbjct  122  ETVVALSSGWLRLDGTRRCGQTVRVTATNGRSVLARVVDECDSVNGCDEEHNFEPPCPND  181

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
            +VDGS AVW  LG+ + LG V +TW+
Sbjct  182  VVDGSPAVWKALGIKESLGEVKVTWS  207



>ref|XP_009798418.1| PREDICTED: putative ripening-related protein 5 [Nicotiana sylvestris]
Length=349

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  198  GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  257

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A +G+S  AKVVDECDS  GCDDEH  Q P
Sbjct  258  QYHSDDTPVVALSTGWYSGGDRCLNYITISA-DGKSVKAKVVDECDSTMGCDDEHDYQPP  316

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G   +TW+ A
Sbjct  317  CPNNIVDASKAVWEALGIPEGDWGDFDITWSDA  349


 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  38   GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVMGNTKAVLTLNSFQKGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A N +S  AKVVDECDS  GCDDEH  Q P
Sbjct  98   QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NDKSVKAKVVDECDSTMGCDDEHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWA  681
            C NNIVD S AVW  LG+ + D G   +TW+
Sbjct  157  CPNNIVDASKAVWEALGIPEGDWGEYDITWS  187



>gb|EEC77096.1| hypothetical protein OsI_15510 [Oryza sativa Indica Group]
Length=178

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 104/157 (66%), Gaps = 17/157 (11%)
 Frame = +1

Query  256  GNCKPVGSMTCN-----------GETKSTYRCSPPMK-SSTPAILTLNDFSEGGDGGAPS  399
            G C P G++  +           G++  TY CSPP   SST A++TLNDF+EGGD   PS
Sbjct  26   GECNPRGAIRSSTTHRCQDCCKAGQSYPTYPCSPPTTGSSTDAVMTLNDFAEGGD---PS  82

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECDE YH N E VVALSTGWYAGGSRC K +RI A NGRS  AKVVDECDS  GCD EH 
Sbjct  83   ECDEMYHKNTELVVALSTGWYAGGSRCGKSVRINA-NGRSVVAKVVDECDSQRGCDAEHA  141

Query  580  GQGPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
             Q PC  NIVD S AVW+ LG+  +D+G   +TW+ A
Sbjct  142  YQPPCRPNIVDASQAVWDALGITGEDVGEYDITWSDA  178



>gb|EMS53907.1| hypothetical protein TRIUR3_11616 [Triticum urartu]
Length=189

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 5/159 (3%)
 Frame = +1

Query  217  GTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGD  384
            G  +CR  G  P   GNC+      C  +G+    Y CSPP+ ++T A+LTLN F +G D
Sbjct  30   GLGVCRASGYLPGKSGNCEKSNDPDCCEDGKRYPQYHCSPPVTATTKAVLTLNSFEKGRD  89

Query  385  GGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGC  564
            GG PSECD  YH + E VVALSTGW+   +RC   I+I A NG+S  AKVVDECDS++GC
Sbjct  90   GGGPSECDNSYHSDKEMVVALSTGWFKNMARCGHRIKINA-NGKSVYAKVVDECDSVYGC  148

Query  565  DDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            D++H  + PC NNIVD S AVWN LGLD+++G   +TW+
Sbjct  149  DEDHNYEPPCANNIVDASPAVWNALGLDQNVGMEGITWS  187



>ref|XP_002980355.1| hypothetical protein SELMODRAFT_26834, partial [Selaginella moellendorffii]
 gb|EFJ18615.1| hypothetical protein SELMODRAFT_26834, partial [Selaginella moellendorffii]
Length=227

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 116/227 (51%), Gaps = 44/227 (19%)
 Frame = +1

Query  133  CNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPT--------------------  252
            C   C +   C   L+C+ G+C DDPD  T+IC                           
Sbjct  1    CGKKCKSTASCKKGLVCLQGECKDDPDKETNICNKNKNKKKKQPKNPSDPPSSPPEIEAP  60

Query  253  ---------PGNCK-------PVGSMTCN-----GETKSTYRCSPPMKSSTPAILTLNDF  369
                      G C+       P  S  C      G++   ++CSPP+   T AILT+NDF
Sbjct  61   PPPLEPAPGQGQCRASGFLHAPKNSKGCKDCCQVGKSYPQFKCSPPVTKFTKAILTVNDF  120

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
              GGDGG  SECD  +H N + VVALSTGW+A G RC + + I A NG+S  A+VVDECD
Sbjct  121  QPGGDGGGASECDSKFHSNKDLVVALSTGWFAKGKRCGRFVIIHAPNGKSVRARVVDECD  180

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKD---LGRVSLTWA  681
            S+ GCD EHG   PC  N+VDGS AVW  LG+ K+    G + +TW+
Sbjct  181  SLRGCDAEHGFYPPCQPNLVDGSPAVWRALGVSKNSDKFGWMDITWS  227



>ref|XP_007051839.1| Uncharacterized protein TCM_005355 [Theobroma cacao]
 gb|EOX95996.1| Uncharacterized protein TCM_005355 [Theobroma cacao]
Length=192

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+TP PG C    +  C   GE  +TY CSPP+ ++T A LT+N F +GGDGG PS+CD 
Sbjct  40   GTTPPPGQCNQENNARCCVEGEFYTTYACSPPVSANTLATLTINSFQQGGDGGGPSKCDN  99

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH + E VVALSTGW++ GSRC K I I    G++  A VVDECDS  GCDD+H  Q P
Sbjct  100  QYHTDAEPVVALSTGWFSQGSRCNKFININGY-GKTVRALVVDECDSQVGCDDQHAYQPP  158

Query  592  CDNNIVDGSAAVWNDLGLDKDL-GRVSLTWAMA  687
            C NNIVD S AVW  LG+ + + G + +TW+ A
Sbjct  159  CRNNIVDASKAVWTALGVPESVQGELDITWSDA  191



>ref|XP_009596266.1| PREDICTED: putative ripening-related protein 1 [Nicotiana tomentosiformis]
Length=218

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  38   GTKPPPGQCNPENDSDCCKQGKMYATYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NG+S  AKVVDECDS  GCDDEH  Q P
Sbjct  98   QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGKSVKAKVVDECDSTMGCDDEHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGL  645
            C NNIVD S AVW  L +
Sbjct  157  CPNNIVDASKAVWEALDI  174



>gb|EYU32103.1| hypothetical protein MIMGU_mgv1a024967mg [Erythranthe guttata]
Length=187

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY CSPP+  ST A+LTLN F +GGDGG PSECD 
Sbjct  36   GENPPPGQCNQENDSDCCKAGDYYTTYTCSPPVSGSTKAVLTLNSFQKGGDGGGPSECDG  95

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +   VVALSTGWY+GGSRC   + I A NGR+ TA VVDECDS  GCD++H  Q P
Sbjct  96   KYHSDETPVVALSTGWYSGGSRCLNNVVISA-NGRTVTATVVDECDSTMGCDEDHDYQPP  154

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  155  CPNNIVDASKAVWKALGVPEDNWGDLDITWSDA  187



>ref|XP_010670661.1| PREDICTED: putative ripening-related protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=186

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 99/147 (67%), Gaps = 5/147 (3%)
 Frame = +1

Query  259  NCKPVGSMTCN-GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNER  435
             C P G+  C  G + +TY+CSPP+   T A LTLN F EGGDGG  S CDE +H +N  
Sbjct  41   QCDPNGADCCKAGRSYTTYKCSPPVTKRTQATLTLNSFEEGGDGGGASACDEKFHSDNTP  100

Query  436  VVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDG  615
            VVALSTGWY G SRC K I I   NG++T AKVVDECDSM+GCD+EHG Q PC NNIVD 
Sbjct  101  VVALSTGWYNGRSRCGKEIVI-TGNGKTTRAKVVDECDSMNGCDEEHGYQLPCKNNIVDA  159

Query  616  SAAVWNDLGLDKD---LGRVSLTWAMA  687
            S AVW  LG+ ++    G + +TW  A
Sbjct  160  SKAVWKALGVSRNSDLYGMMPITWTDA  186



>ref|XP_009596258.1| PREDICTED: putative ripening-related protein 5 [Nicotiana tomentosiformis]
Length=349

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  198  GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  257

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NG+S  AKVVDECDS  GCDDEH  Q P
Sbjct  258  QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGKSVKAKVVDECDSTMGCDDEHDYQPP  316

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  L + + D G   +TW+ A
Sbjct  317  CPNNIVDASKAVWEALDIPEGDWGDYDITWSDA  349


 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  38   GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I + A NG+S  AKVVDECDS  GCDDE   Q P
Sbjct  98   QYHSDDTPVVALSTGWYSGGDRCLNYITVSA-NGKSVKAKVVDECDSTMGCDDERDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWA  681
            C NNIVD S AVW  LG+ + D G   +TW+
Sbjct  157  CPNNIVDASKAVWEALGIPEGDWGDYDITWS  187



>ref|XP_004307389.1| PREDICTED: putative ripening-related protein 2-like [Fragaria 
vesca subsp. vesca]
Length=186

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TY CSPPM  +T A LTLN F  GGDGG PSECD 
Sbjct  35   GRKPPPGQCNKEDDSDCCKAGKMYPTYTCSPPMSGNTQAYLTLNSFEAGGDGGGPSECDG  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YHD+N  VVALSTGWY GGSRC K I+I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  95   QYHDDNTPVVALSTGWYNGGSRCLKNIKING-NGQSVVAMVVDECDSTEGCDADHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  154  CPNNIVDASKAVWKALGVSEDNWGGLDITWSDA  186



>ref|XP_009342497.1| PREDICTED: putative ripening-related protein 1 [Pyrus x bretschneideri]
Length=188

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 98/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+   TY CSPP+  ST A LTLN F +GGDGG PSEC
Sbjct  36   RGRKAP-PGQCNQENDSDCCKPGKMYPTYTCSPPLSGSTKATLTLNSFEKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY+ G RC K IRI   NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNQYHNDNTPVVALSTGWYSNGDRCHKQIRING-NGRSVLAMVVDECDSTEGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  154  PPCPNNIVDASKAVWKALGVPQDQWGGLDITWSEA  188



>ref|XP_007219651.1| hypothetical protein PRUPE_ppa023710mg [Prunus persica]
 gb|EMJ20850.1| hypothetical protein PRUPE_ppa023710mg [Prunus persica]
Length=185

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TYRCSPP+   T A LTLN F  GGDGG PSECD 
Sbjct  34   GRQPPPGQCNQENDSDCCVEGKMYPTYRCSPPLSRHTKAYLTLNSFEAGGDGGGPSECDN  93

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH+++ RVVALSTGWY  G RC   IRI   NGRS  A VVDECDSM GCD +H  Q P
Sbjct  94   KYHNDSNRVVALSTGWYNNGGRCHNHIRING-NGRSVVAMVVDECDSMEGCDVDHDYQPP  152

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +   G + +TW+ A
Sbjct  153  CPNNIVDASKAVWEALGVPRGQWGGLDITWSDA  185



>ref|XP_009596267.1| PREDICTED: putative ripening-related protein 5 [Nicotiana tomentosiformis]
Length=344

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  193  GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  252

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I I A NG+S  AKVVDECDS  GCDDEH  Q P
Sbjct  253  QYHSDDTPVVALSTGWYSGGDRCLNYITISA-NGKSVKAKVVDECDSTMGCDDEHDYQPP  311

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  L + + D G   +TW+ A
Sbjct  312  CPNNIVDASKAVWEALDIPEGDWGDYDITWSDA  344


 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C P     C   G+  +TY+CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  33   GIKPPPGQCNPENDSDCCKQGKMYTTYKCSPPVTGNTKAVLTLNSFQKGGDGGGPSECDN  92

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG RC   I + A NG+S  AKVVDECDS  GCDDEH  Q P
Sbjct  93   QYHSDDTPVVALSTGWYSGGDRCLNYITVSA-NGKSVKAKVVDECDSTMGCDDEHDYQPP  151

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWA  681
            C NNIVD S AVW  L + + D G   +TW+
Sbjct  152  CPNNIVDASKAVWEALDIPEGDWGEYDITWS  182



>gb|KHN01022.1| Ripening-related protein grip22 [Glycine soja]
Length=159

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  334  SSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNG  513
            S TPAILT+NDF  G DGG PSECD  Y    +RVVALSTGWY GGSRC KM+RI A NG
Sbjct  42   SGTPAILTVNDFGPGRDGGDPSECDGTYPMLPQRVVALSTGWYNGGSRCGKMVRITARNG  101

Query  514  RSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            R+  AKVVDECDS  GCD EH  Q PC  NIVD S  VW+DLGL+ D G V +TW M 
Sbjct  102  RTAVAKVVDECDSTQGCDQEHANQSPCKTNIVDASENVWHDLGLNTDDGEVPVTWTMV  159



>ref|XP_009342495.1| PREDICTED: putative ripening-related protein 1 [Pyrus x bretschneideri]
Length=188

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 98/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+   TY CSPP+  ST A LTLN F +GGDGG PSEC
Sbjct  36   RGRKAP-PGQCNQENDSDCCKPGKMYPTYTCSPPLSGSTKATLTLNSFEKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY+ G RC K IRI   NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNQYHNDNTPVVALSTGWYSNGDRCHKQIRING-NGRSVLAMVVDECDSTEGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  154  PPCPNNIVDASKAVWKALGVPEDQWGGLDITWSEA  188



>ref|XP_008804752.1| PREDICTED: uncharacterized protein LOC103717944 [Phoenix dactylifera]
Length=586

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+    YRCSPP+  +T A +T+N F +GGDGG PSECD +YH N ERVVALSTGWY  G
Sbjct  58   GQKYPQYRCSPPVTGATSARMTINSFEKGGDGGGPSECDNNYHSNKERVVALSTGWYNRG  117

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL-D  648
            SRC K IRI A NG+S  AKVVDECDS++GCD EH  Q PC NNIVD S AVW DLG+ D
Sbjct  118  SRCSKNIRINA-NGKSVLAKVVDECDSVNGCDAEHAFQPPCHNNIVDASRAVWTDLGIPD  176

Query  649  KDLGRVSLTWAMA  687
              +G   +TW+ A
Sbjct  177  SQIGDYQITWSDA  189


 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC       C  +G+    Y CSPP+  +T A +T+N F EGGDGG PSECD   H +N
Sbjct  441  GNCNTENDSECCEDGKMYDQYLCSPPVTGATSARMTINSFEEGGDGGGPSECDGQSHSDN  500

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            ERVVALSTGWY  GSRC   IRI A NG S  AKVVDECDS+HGCDDEH  Q PC NNIV
Sbjct  501  ERVVALSTGWYNQGSRCGNNIRINA-NGNSVLAKVVDECDSVHGCDDEHAFQPPCHNNIV  559

Query  610  DGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            D S AVW DLG+ D  +G   +TW+ A
Sbjct  560  DASRAVWTDLGIPDSQIGDYQITWSDA  586


 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 84/151 (56%), Gaps = 23/151 (15%)
 Frame = +1

Query  109  LQGNALSSCNGPCTTLDDCS--GQLICIGGKCNDDPDVGTHICRGGSTPTPGNCKPVGSM  282
            L  + L SC    +  + CS  GQL+   G CN + +  +  C+ G              
Sbjct  193  LASSGLGSCFHFTSLAEACSPSGQLVGKAGHCNTENN--SECCKAG--------------  236

Query  283  TCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWY  462
                +    Y CSPP+  +T A +T+N F +GGDGG PSECD  YH N ERVVALSTGW+
Sbjct  237  ----KKYPQYLCSPPVTGATSARMTINSFKKGGDGGGPSECDNRYHSNKERVVALSTGWF  292

Query  463  AGGSRCEKMIRIRASNGRSTTAKVVDECDSM  555
               SRC K IRI A NG+S  AKVVDECDS+
Sbjct  293  NHRSRCGKNIRINA-NGKSVLAKVVDECDSV  322



>ref|XP_010088340.1| hypothetical protein L484_005855 [Morus notabilis]
 gb|EXB33956.1| hypothetical protein L484_005855 [Morus notabilis]
Length=188

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 98/152 (64%), Gaps = 3/152 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTCN-GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEH  414
            G  P PG C P  S  C  GE  +TY+CSP +   T A+LTLN F +GGDGGAPSECDEH
Sbjct  38   GRNPPPGECNPEYSDCCKEGELYTTYKCSPRVSGRTNAVLTLNSFEKGGDGGAPSECDEH  97

Query  415  YHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPC  594
            YH ++  VVALSTGW+    RC + I I   NGRS  A VVDECDS  GCD +HG Q PC
Sbjct  98   YHSDDTPVVALSTGWFNHMHRCFQNITIYG-NGRSVNAMVVDECDSTAGCDSDHGYQPPC  156

Query  595  DNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             NNIVD S AVW  L + K D G + + W+ A
Sbjct  157  PNNIVDASKAVWKALKVPKSDWGELDIYWSEA  188



>gb|EYU32101.1| hypothetical protein MIMGU_mgv1a024963mg [Erythranthe guttata]
Length=188

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY CSPP+  ST A+LTLN F +GGDGG PSECD 
Sbjct  37   GENPPPGQCNQENDSDCCKAGDYYTTYTCSPPVSGSTGAVLTLNSFQKGGDGGGPSECDG  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            +YH +   VVALSTGWY+GGSRC K + I A NGR+  A VVDECDS  GCD+EH  Q P
Sbjct  97   NYHSDETPVVALSTGWYSGGSRCLKNVTISA-NGRTVIAMVVDECDSTMGCDNEHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
            C NNIVD S AVW  LG+ +D  G + ++W+
Sbjct  156  CPNNIVDASKAVWKALGVPEDNWGDLDISWS  186



>ref|XP_008789577.1| PREDICTED: putative ripening-related protein 1 [Phoenix dactylifera]
Length=190

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 118/207 (57%), Gaps = 27/207 (13%)
 Frame = +1

Query  67   LISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCS--GQLICIGGKCNDDPDVGTHICRGG  240
            L SL +  I F  SL    L SC    + L +CS  G L    G CN + D         
Sbjct  7    LASLFLLVIAFA-SLN---LCSCFHYSSLLGECSPSGYLRGKAGHCNKEHDSDC------  56

Query  241  STPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
                   CKP       G+    YRCSPP+   T A +T+N F++GGDGG PSECD  YH
Sbjct  57   -------CKP-------GKMYPQYRCSPPLTGDTRATMTINSFAKGGDGGGPSECDNKYH  102

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDN  600
             ++E VVALSTGWY+ GSRC K +RI A NG S  AKVVDECDS++GCD +H  Q PC N
Sbjct  103  SDDELVVALSTGWYSHGSRCLKNVRIHA-NGNSVLAKVVDECDSVNGCDTDHDFQPPCPN  161

Query  601  NIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            N+VD S AVW  LG+   +G   +TW+
Sbjct  162  NVVDASPAVWKALGIPGSVGDYDITWS  188



>gb|EMT20057.1| hypothetical protein F775_12209 [Aegilops tauschii]
Length=189

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 105/159 (66%), Gaps = 5/159 (3%)
 Frame = +1

Query  217  GTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGD  384
            G  +CR  G  P   GNC+      C  +G+    Y CSPP+ ++T A+LTLN F +G D
Sbjct  30   GLGVCRASGYLPGKSGNCEKSNDPDCCEDGKRYPQYHCSPPVTATTKAVLTLNSFEKGKD  89

Query  385  GGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGC  564
            GG PSECD  YH + E VVALSTGW+   +RC   I+I A NG S  AKVVDECDS++GC
Sbjct  90   GGGPSECDNAYHSDVEMVVALSTGWFKNMARCGHRIKISA-NGNSVYAKVVDECDSVYGC  148

Query  565  DDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            D++H  + PC NNIVD S AVWN LGLD+++G   +TW+
Sbjct  149  DEDHNYEPPCANNIVDASPAVWNALGLDQNVGMEGITWS  187



>ref|XP_006838535.1| hypothetical protein AMTR_s00002p00197000 [Amborella trichopoda]
 gb|ERN01104.1| hypothetical protein AMTR_s00002p00197000 [Amborella trichopoda]
Length=190

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+    YRCSPP+  +T A +T+N F++GGDGG PSECD  YHD+NE VVALSTGWY GG
Sbjct  59   GKLYPQYRCSPPIAGNTKAEMTINSFAKGGDGGGPSECDNQYHDDNEMVVALSTGWYNGG  118

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL-D  648
            SRC   I I A NGR+  AKVVDECDS++GCD +H  Q PC NNIVD S AVW  L + +
Sbjct  119  SRCLNYININA-NGRTVKAKVVDECDSVYGCDSDHDFQPPCPNNIVDASPAVWKALKIPE  177

Query  649  KDLGRVSLTWAMA  687
             ++G   +TW+ A
Sbjct  178  SEIGDYDITWSDA  190



>ref|XP_003571929.2| PREDICTED: putative ripening-related protein 5 [Brachypodium 
distachyon]
Length=345

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+    Y CSPP+ +ST A+LTLN F +G DGG PSECD  YH + E VVALSTGW+  
Sbjct  58   DGKKYPQYHCSPPVTASTKAVLTLNSFEKGKDGGGPSECDNAYHSDEEMVVALSTGWFEN  117

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
              RC   I+I A NG+S  AKVVDECDS++GCDDEH  + PCDNNIVD S AVWN LGLD
Sbjct  118  MGRCGHRIKITA-NGKSVYAKVVDECDSVYGCDDEHNYEPPCDNNIVDASPAVWNALGLD  176

Query  649  KDLGRVSLTWA  681
            +++G   +TW+
Sbjct  177  QNVGMEGITWS  187


 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+    Y CSPP+ SST A+LTLN F +G DGG PSECD  YH + E VVALSTGW+  
Sbjct  214  DGKRYPQYHCSPPVTSSTKAVLTLNSFEKGKDGGGPSECDNSYHSDKEMVVALSTGWFKN  273

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
             +RC   I+I A NG S  AKVVDECDS++GCDD+H  + PC NNIVD S AVWN LGLD
Sbjct  274  MARCGHRIKITA-NGNSVYAKVVDECDSVYGCDDDHNYEPPCANNIVDASPAVWNALGLD  332

Query  649  KDLGRVSLTWA  681
            +++G   +TW+
Sbjct  333  QNVGMEDITWS  343



>ref|XP_002464451.1| hypothetical protein SORBIDRAFT_01g018610 [Sorghum bicolor]
 gb|EER91449.1| hypothetical protein SORBIDRAFT_01g018610 [Sorghum bicolor]
Length=193

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 100/146 (68%), Gaps = 2/146 (1%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            G+C P     C  +G+  +T+ CSPP+ + T A LTLN F +G DGG  S C   + D++
Sbjct  48   GSCNPDNDSECCEDGKRYTTFACSPPVTARTRATLTLNSFEKGRDGGGASSCTGTFFDDD  107

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
             +VVALSTGW+  G RC+  I IRASNGRS TA VVDECDS+HGCD++H  + PC +NIV
Sbjct  108  VKVVALSTGWFNKGKRCKNSIVIRASNGRSVTAMVVDECDSLHGCDNDHNFEPPCASNIV  167

Query  610  DGSAAVWNDLGLDKDLGRVSLTWAMA  687
            DGS AVW  LGL+ D G V +TW+ A
Sbjct  168  DGSPAVWKALGLNTDDGEVPITWSEA  193



>ref|XP_008244907.1| PREDICTED: uncharacterized protein LOC103343014 [Prunus mume]
Length=350

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TYRCSPP+   T A LTLN F  GGDGG PSECD 
Sbjct  199  GRQPPPGQCNQENDSECCVEGKMYPTYRCSPPLSRHTKAYLTLNSFEAGGDGGGPSECDN  258

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH+++ RVVALSTGWY  G RC   IRI   NGRS  A VVDECDSM GCD +H  Q P
Sbjct  259  KYHNDSNRVVALSTGWYNNGGRCHNHIRING-NGRSVVAMVVDECDSMEGCDVDHDYQPP  317

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  318  CPNNIVDASKAVWEALGVPRDQWGGLDITWSDA  350


 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY CSPP+  ST A LTLN F  GGDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  59   GKMYPTYTCSPPLSGSTKAYLTLNSFEAGGDGGGPSECDNKYHNDNTPVVALSTGWYNNG  118

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   I I A NGRS  A VVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  119  GRCHNNITISA-NGRSVVAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  177

Query  652  D-LGRVSLTWA  681
            D  G + +TW+
Sbjct  178  DNWGGLDITWS  188



>ref|XP_010054777.1| PREDICTED: putative ripening-related protein 1 [Eucalyptus grandis]
 gb|KCW77534.1| hypothetical protein EUGRSUZ_D01854 [Eucalyptus grandis]
Length=168

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +1

Query  223  HICR--GGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGG  390
             +CR  G    T G C       C  +GE  +TY+CSPP+   T A LT+N F +GGDGG
Sbjct  10   QVCRPSGKLRGTQGKCTSDYGADCCKSGEFYTTYKCSPPVTERTKATLTINSFEKGGDGG  69

Query  391  APSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDD  570
             PSECD HYH ++  +VALSTGWY  G RC K I I   NGRS  AKVVDECDS  GCD 
Sbjct  70   GPSECDNHYHSDDTPIVALSTGWYNNGKRCFKEITIHG-NGRSMKAKVVDECDSTMGCDK  128

Query  571  EHGGQGPCDNNIVDGSAAVWNDLG-LDKDLGRVSLTWA  681
            EH  Q PC NNIVD S AVW  LG L+ D G + + W+
Sbjct  129  EHDFQPPCPNNIVDASKAVWKALGVLESDWGEMEIFWS  166



>gb|EYU32105.1| hypothetical protein MIMGU_mgv1a018691mg [Erythranthe guttata]
Length=185

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY CSPP+  +T A+LTLN F +GGDGG PSECD 
Sbjct  34   GENPPPGQCNQENDSDCCKAGDYYTTYTCSPPVSGTTKAVLTLNSFQKGGDGGGPSECDG  93

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +   VVALSTGWY+GGSRC   + I A NGR+ TA VVDECDS  GCD++H  Q P
Sbjct  94   KYHSDETPVVALSTGWYSGGSRCLNNVVISA-NGRTVTAMVVDECDSTMGCDEDHDYQPP  152

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + + G + +TW+ A
Sbjct  153  CPNNIVDASKAVWKALGVPENNWGDLDITWSDA  185



>ref|XP_009397896.1| PREDICTED: putative ripening-related protein 1 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 100/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
             G  T   G+C    +  C  NG+   TY CSP +   T A +T+N F+EGGDGG PS+C
Sbjct  34   NGQITGVSGDCNTDNNADCCVNGQMYDTYSCSPTVTGETQAHMTINSFAEGGDGGGPSKC  93

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH +NE VVALSTGWY GGSRC K I+I A NG++  AKVVDECDS+HGCD EH  Q
Sbjct  94   DGSYHSDNELVVALSTGWYDGGSRCSKNIKINA-NGQTMLAKVVDECDSLHGCDQEHAFQ  152

Query  586  GPCDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
             PC  NIVD S AVW  LG+ +  +G   +TW+
Sbjct  153  PPCAPNIVDASRAVWEALGIPESQIGDYDITWS  185



>ref|XP_006838534.1| hypothetical protein AMTR_s00002p00196350 [Amborella trichopoda]
 gb|ERN01103.1| hypothetical protein AMTR_s00002p00196350 [Amborella trichopoda]
Length=188

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            G+C P     C   G+    YRCSPP+  +T A +T+N F+EGGDGG PSECD  YHD+ 
Sbjct  43   GHCNPDNDSDCCKEGKMYPQYRCSPPITGNTKATMTINSFAEGGDGGGPSECDNQYHDDG  102

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E VVALSTGWY+ GSRC   I I A NG++  AKVVDECDS++GCD +H  Q PC NN+V
Sbjct  103  EMVVALSTGWYSNGSRCLNFISISA-NGKTVKAKVVDECDSIYGCDTDHDFQPPCPNNVV  161

Query  610  DGSAAVWNDLGLD-KDLGRVSLTWAMA  687
            D S AVW  L +   D+G   +TW+ A
Sbjct  162  DASPAVWKALNIHGSDVGDYEVTWSDA  188



>ref|XP_008664817.1| PREDICTED: ripening-related protein 3-like [Zea mays]
 tpg|DAA49518.1| TPA: hypothetical protein ZEAMMB73_027371 [Zea mays]
Length=193

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+  +T+ CSPP+ + T A LTLN F++ GDGG  S C   + D++ RVVALSTGW++ 
Sbjct  61   DGKRYTTFACSPPVTARTRATLTLNSFADHGDGGGASSCTGTFFDDDVRVVALSTGWFSR  120

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
              RC K I IRASNGRS  A VVDECDS+HGCD EH  + PC +NIVDGS AVW  LGL+
Sbjct  121  SKRCRKSIVIRASNGRSVKAMVVDECDSLHGCDTEHNFEPPCASNIVDGSPAVWKALGLN  180

Query  649  KDLGRVSLTWAMA  687
             D G V +TW+ A
Sbjct  181  TDDGEVPITWSDA  193



>ref|XP_011083325.1| PREDICTED: putative ripening-related protein 1 [Sesamum indicum]
Length=302

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P  G C    +  C   GE  +TY+CSP +  +T A+LT+N F +GGDGG PSECD 
Sbjct  151  GKKPPAGQCNQENNSDCCQAGELYTTYKCSPTVSGTTKAVLTINSFEKGGDGGEPSECDN  210

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY GGSRC K I I A NGRS TAKVVDECDS  GCD +H  Q P
Sbjct  211  KYHSDDTPVVALSTGWYNGGSRCLKNIIINA-NGRSVTAKVVDECDSTMGCDKDHDYQPP  269

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTW  678
            C NNIVD S AVW  LG+ + D G + +TW
Sbjct  270  CPNNIVDASKAVWKALGVPEDDWGELDITW  299


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = +1

Query  436  VVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDG  615
            + +LSTGWY GG RC   I I A NGR   A VVDECDS  GCD +H    PCDNNIV  
Sbjct  9    ITSLSTGWYNGGRRCLNNITIGA-NGRKVEAMVVDECDSSMGCDADHDYLPPCDNNIVGA  67

Query  616  SAAVWNDLGLD-KDLGRVSLT  675
            S AV   LG+  +D G +++T
Sbjct  68   SKAVRKALGVPLEDWGELNIT  88



>gb|KDP24047.1| hypothetical protein JCGZ_26731 [Jatropha curcas]
Length=185

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+  +TY+CSPP+   T A LTLN F+ GGDGG PSECD 
Sbjct  33   GRKPPPGQCNQEHDSDCCVNGKLYTTYKCSPPISGHTKATLTLNSFAAGGDGGGPSECDN  92

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++E VVALSTGW+A   RC   I I   NG++  AKVVDECDS  GCD EH  Q P
Sbjct  93   HYHSDDELVVALSTGWFANRKRCLNYITIYG-NGKNVKAKVVDECDSTMGCDSEHDFQPP  151

Query  592  CDNNIVDGSAAVWNDLGLD--KDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+    ++G + + W+ A
Sbjct  152  CPNNIVDASPAVWKALGISDPDNVGEMDIYWSDA  185



>ref|XP_010910199.1| PREDICTED: putative ripening-related protein 2 [Elaeis guineensis]
Length=188

 Score =   155 bits (391),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 99/158 (63%), Gaps = 17/158 (11%)
 Frame = +1

Query  262  CKPVGSM-----TCNGETKS----------TYRCSPPMKSSTPAILTLNDFSEGGDGGAP  396
            CKP G +      CN + +S           YRCSPP+  +T A +T+N F E GDGG P
Sbjct  32   CKPTGYLRGKAGKCNTKNQSECCKAEEKYPQYRCSPPVTEATHATMTINSFEEDGDGGGP  91

Query  397  SECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEH  576
            SECD  YH + +R+VALSTGWY  GSRC K IRI A NG+S  AKVVDECDS++GCD  H
Sbjct  92   SECDGKYHSDKKRIVALSTGWYKNGSRCGKKIRIHA-NGKSVLAKVVDECDSVNGCDTAH  150

Query  577  GGQGPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
              Q PCDNNIVD S AVW  L + +  +G  S+ W  A
Sbjct  151  DFQPPCDNNIVDASRAVWKALKIPRSQIGNYSIAWTDA  188



>ref|XP_002530766.1| Kiwellin, putative [Ricinus communis]
 gb|EEF31626.1| Kiwellin, putative [Ricinus communis]
Length=187

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P PG C       C   G   +TY+CSPP+  +T A LT+N F+ GGDGGAPSECD 
Sbjct  35   GTKPPPGQCNQEHDSDCCVQGRMYTTYKCSPPVTGNTKATLTINSFAPGGDGGAPSECDN  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++E VVALSTGW+   SRC   I I   NG+S  AKVVDECDS  GCD EH  Q P
Sbjct  95   KYHSDDELVVALSTGWFDNKSRCLNYITIHG-NGKSVRAKVVDECDSTMGCDSEHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLD--KDLGRVSLTWAMA  687
            C NNIVD S AVWN LG+    D+G + + W+ A
Sbjct  154  CPNNIVDASKAVWNALGVSDPDDVGAMDINWSDA  187



>ref|XP_009767996.1| PREDICTED: LOW QUALITY PROTEIN: putative ripening-related protein 
1 [Nicotiana sylvestris]
Length=172

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 98/153 (64%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP +  +T A LTLN F +GGDGG PSECD 
Sbjct  21   GIKPPPGQCNSEDDSDCCKQGKMYTTYKCSPSVTGNTRAALTLNSFQKGGDGGGPSECDN  80

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+GG+RC     I A NGR+  AKVVDECDS  GCDDEH  Q P
Sbjct  81   QYHSDDTPVVALSTGWYSGGNRCLNYFTISA-NGRNVKAKVVDECDSTMGCDDEHDYQPP  139

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVDGS  VW  LG+ + D G   +TW+ A
Sbjct  140  CRNNIVDGSKEVWEALGIPEGDWGEHDITWSDA  172



>ref|XP_002962732.1| hypothetical protein SELMODRAFT_26835, partial [Selaginella moellendorffii]
 gb|EFJ36195.1| hypothetical protein SELMODRAFT_26835, partial [Selaginella moellendorffii]
Length=227

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 115/227 (51%), Gaps = 44/227 (19%)
 Frame = +1

Query  133  CNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRGGSTPT--------------------  252
            C   C +   C   L+C+ G+C DDPD  T IC                           
Sbjct  1    CGKTCKSTASCKKGLVCLQGECKDDPDKETTICNKNKNKKKKQPKNPSDPPSSPPEIEAP  60

Query  253  ---------PGNCK-------PVGSMTCN-----GETKSTYRCSPPMKSSTPAILTLNDF  369
                      G C+       P  S  C      G++   ++CSPP+   T AILT+NDF
Sbjct  61   PPPLEPAPGQGQCRASGFLHAPKSSKGCKDCCQVGKSYPQFKCSPPVTKFTKAILTVNDF  120

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
              GGDGG  SECD  +H NN+ VVALSTGW+A G RC + + I A +G+S  A+VVDECD
Sbjct  121  QPGGDGGGASECDSKFHSNNDLVVALSTGWFAKGKRCGRFVIIHAPSGKSVRARVVDECD  180

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKD---LGRVSLTWA  681
            S+ GCD EHG   PC  N+VD S +VW  LG+ K+    G + +TW+
Sbjct  181  SLRGCDAEHGFYPPCQPNLVDASPSVWRALGVSKNSDKFGWMDITWS  227



>ref|XP_010236628.1| PREDICTED: uncharacterized protein LOC104584170 [Brachypodium 
distachyon]
Length=339

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+    YRCSPP+ ++T A+LTLN F +G DGG PSECD  YH + E VVALSTGW+  
Sbjct  208  DGKRYPQYRCSPPVTAATKAVLTLNSFEKGKDGGGPSECDNAYHSDKEMVVALSTGWFEN  267

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
              RC   I+I A NG+S  AKVVDECDS++GCD++H  + PCDNNIVD S AVWN LGLD
Sbjct  268  MHRCGHRIKISA-NGKSVYAKVVDECDSVYGCDEDHNYEPPCDNNIVDASPAVWNALGLD  326

Query  649  KDLGRVSLTWA  681
            +++G   +TW+
Sbjct  327  QNVGMEGITWS  337


 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            +G+    Y CSPP+ SST A+L LN F +G DGG PSECD  +H + E VVALSTGW+  
Sbjct  49   DGKRYPQYHCSPPVTSSTKAVLMLNSFEKGKDGGGPSECDNSFHSDKELVVALSTGWFKN  108

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
             +RC   I+I  SNG S  AKVVDECDS++GCD++H  + PC NNIVD S AVWN LGLD
Sbjct  109  MARCGHRIKI-TSNGNSVYAKVVDECDSVYGCDEDHKYELPCANNIVDASPAVWNALGLD  167

Query  649  KDLGRVSLTWA  681
            +++G   +TW+
Sbjct  168  QNVGMEDITWS  178



>ref|XP_006445077.1| hypothetical protein CICLE_v10023491mg [Citrus clementina]
 gb|ESR58317.1| hypothetical protein CICLE_v10023491mg [Citrus clementina]
 gb|KDO86113.1| hypothetical protein CISIN_1g048311mg [Citrus sinensis]
Length=186

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 103/186 (55%), Gaps = 12/186 (6%)
 Frame = +1

Query  145  CTTLDDCSGQLICIG---GKCNDDPDVGTHICRGGSTPTPGNCKPVGSMTC--NGETKST  309
            C  L  C   L+ +G   G CN    +       G  P PG C       C   G+  S 
Sbjct  8    CVVLLICVLALVSLGVEAGTCNPSGKIR------GKKPPPGQCNQENYSDCCKQGKLYSI  61

Query  310  YRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKM  489
            +RCSP +   T A LTLN F +GGDGG PSECD  YH ++E VVALSTGWY  GSRC   
Sbjct  62   FRCSPTVTGHTKATLTLNSFQKGGDGGGPSECDNQYHSDDEPVVALSTGWYNKGSRCLNY  121

Query  490  IRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVS  669
            I I   NG S  AKVVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +  G + 
Sbjct  122  INIYG-NGNSVKAKVVDECDSTMGCDSDHDYQPPCRNNIVDASKAVWEALGVPQSKGEME  180

Query  670  LTWAMA  687
            + W+ A
Sbjct  181  IYWSDA  186



>ref|XP_004306797.1| PREDICTED: putative ripening-related protein 1-like [Fragaria 
vesca subsp. vesca]
Length=346

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TY CSPPM  +T A LTLN F  GGDGG PSECD 
Sbjct  195  GRKPPPGQCNKEDDSDCCKAGKMYPTYTCSPPMSGNTQAYLTLNSFEAGGDGGGPSECDG  254

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YHD+N  VVALSTGWY GGSRC K IRI   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  255  QYHDDNTPVVALSTGWYNGGSRCLKNIRING-NGQSVVAMVVDECDSTEGCDADHDYQPP  313

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  314  CPNNIVDASKAVWKALGVSEDNWGGLDITWSNA  346


 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TY CSPPM  +T A LTLN F  GGDGG PSECD 
Sbjct  35   GRKPPPGQCNTEDDSDCCKAGKMYPTYTCSPPMSGNTQAYLTLNSFEAGGDGGGPSECDG  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YHD+N  VVALSTGWY GGSRC K IRI   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  95   QYHDDNTPVVALSTGWYNGGSRCLKNIRING-NGQSVVAMVVDECDSTEGCDADHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
            C NNIVD S AVW  LG+ +D  G + +TW+
Sbjct  154  CPNNIVDASKAVWKALGVSEDNWGGLDITWS  184



>gb|KCW71634.1| hypothetical protein EUGRSUZ_E00161, partial [Eucalyptus grandis]
Length=178

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+    Y+CSPP+   T A LTLN F++GGDGG PSECD 
Sbjct  37   GKNPPPGQCNTGDDSDCCKNGQMYPIYKCSPPVSGHTRAHLTLNSFAKGGDGGGPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  VVALSTGW+   SRC + I+I   NGRST A VVDECDS  GCD+EH  Q P
Sbjct  97   HYHSDDTPVVALSTGWFDNMSRCHRNIKIYG-NGRSTQAMVVDECDSTMGCDEEHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD  654
            CDN+IVD S AVW  LG+ KD
Sbjct  156  CDNDIVDASRAVWEALGVSKD  176



>ref|XP_008375813.1| PREDICTED: putative ripening-related protein 1 [Malus domestica]
 ref|XP_008347096.1| PREDICTED: putative ripening-related protein 1 [Malus domestica]
Length=183

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 98/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P+ G C       C   G+  +TY CSPP+   T A LTLN F  GGDGG+PSEC
Sbjct  31   RGKKAPS-GQCNTENDSDCCVKGKMYTTYTCSPPLSGHTKAYLTLNSFEAGGDGGSPSEC  89

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH+++  VVALSTGWY+GG RC   I I A NGRS  A VVDECDS  GCD EH  Q
Sbjct  90   DNKYHNDSTPVVALSTGWYSGGGRCHNNITISA-NGRSVVAMVVDECDSTMGCDAEHDYQ  148

Query  586  GPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ K D G + +TW+ A
Sbjct  149  PPCPNNIVDASKAVWEALGVRKEDWGGLDITWSDA  183



>gb|EMT18094.1| hypothetical protein F775_16043 [Aegilops tauschii]
Length=147

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +1

Query  298  TKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYA--GG  471
            ++  Y+CSPP+ + TPAILT+N F EGGDGG  S CD  YH ++E VVALSTGW    G 
Sbjct  17   SRLHYKCSPPVLAETPAILTINSFEEGGDGGGKSFCDNRYHKDSELVVALSTGWLRLDGT  76

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            +RC KMIRI   NG+S TAKVVDECDS++GCD EH  + PC NN VD S AVW  LGL+ 
Sbjct  77   NRCNKMIRING-NGQSVTAKVVDECDSVYGCDKEHNFEPPCPNNDVDASPAVWKALGLNG  135

Query  652  DLGRVSLTWA  681
            ++G   +TW+
Sbjct  136  NIGEFKVTWS  145



>ref|XP_003558011.2| PREDICTED: putative ripening-related protein 5 [Brachypodium 
distachyon]
Length=345

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  310  YRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKM  489
            Y CSPP+ SST A+LTLN F +G DGG PSECD  YH + E VVALSTGW+   +RC   
Sbjct  65   YHCSPPVTSSTKAVLTLNSFEKGKDGGGPSECDNSYHSDKELVVALSTGWFKNMARCGHR  124

Query  490  IRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVS  669
            I+I  SNG S  AKVVDECDS++GCDDEH  + PC NNIVD S AVWN LGLD+++G   
Sbjct  125  IKI-TSNGNSVYAKVVDECDSVYGCDDEHNYEPPCANNIVDASPAVWNALGLDQNVGMED  183

Query  670  LTWA  681
            +TW+
Sbjct  184  ITWS  187


 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 5/156 (3%)
 Frame = +1

Query  226  ICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
            +CR  G  P   G+C+      C  +G+    Y CSP + + T A+LTLN F +G DGG 
Sbjct  189  VCRASGYLPGKTGHCEKSNDSDCCEDGKRYPQYHCSPTVTADTKAVLTLNSFEKGKDGGG  248

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YH + E VVALSTGW+    RC   I+I A NG+S  AKVVDECDS++GCD++
Sbjct  249  PSECDNAYHSDEEMVVALSTGWFENMGRCGHRIKITA-NGKSVYAKVVDECDSVYGCDED  307

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            H  + PCDNNIVD S AVWN LGLD+++G   +TW+
Sbjct  308  HNYEPPCDNNIVDASPAVWNALGLDQNVGMEGITWS  343



>gb|KDP45133.1| hypothetical protein JCGZ_17465 [Jatropha curcas]
Length=187

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+  +TY+CSPP+   T A LTLN F+ GGDGG PSECD 
Sbjct  35   GRKPPPGQCNQEHESDCCVNGKFYTTYKCSPPVNGHTKATLTLNSFAAGGDGGGPSECDN  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +NE VVALSTGW+A   RC   I I   NG S  AKVVDECDS  GCD  H  Q P
Sbjct  95   QYHSDNELVVALSTGWFANKKRCLNYITIHG-NGNSVKAKVVDECDSTMGCDSVHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLD--KDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+    ++G +++ W+ A
Sbjct  154  CPNNIVDASPAVWKALGISDPDNVGEMNIYWSDA  187



>ref|XP_002513616.1| Kiwellin, putative [Ricinus communis]
 gb|EEF49019.1| Kiwellin, putative [Ricinus communis]
Length=187

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P PG C       C   G+  +TY+CSPP+   T A LT+N F+ GGDGGAPSECD 
Sbjct  35   GTKPPPGQCNQENDSDCCVQGKMYTTYKCSPPVTGHTKATLTVNSFAPGGDGGAPSECDN  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +NE VVALSTGW+   SRC   I I   NG+S  AKVVDECDS  GCD +H  Q P
Sbjct  95   QYHSDNELVVALSTGWFDDKSRCLNHIMIHG-NGKSVKAKVVDECDSTMGCDSDHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLD--KDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+    ++G + + W+ A
Sbjct  154  CPNNIVDASKAVWKALGVSDPDNVGEMDIYWSDA  187



>ref|XP_003571933.2| PREDICTED: putative ripening-related protein 4 [Brachypodium 
distachyon]
Length=396

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = +1

Query  226  ICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
            +CR  G  P   G+C+      C  +G+    Y CSPP+ SST A+LTLN F +G DGG 
Sbjct  240  VCRASGYLPGKAGHCEKSNDPDCCEDGKRYPQYHCSPPVTSSTKAVLTLNSFEKGKDGGG  299

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YH + E VVALSTGW+   +RC   I+I A NG S  AKVVDECDS++GCDD+
Sbjct  300  PSECDNSYHSDKELVVALSTGWFKNMARCGHRIKISA-NGNSVYAKVVDECDSVYGCDDD  358

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            H  + PC NNIVD S AVWN LGLD+++G   +TW+
Sbjct  359  HNYEPPCANNIVDASPAVWNALGLDQNVGMEDITWS  394


 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYA--  465
            G     ++CSPP+ + TPA LT+N F+ GGDGG  S CD+H+H + E VVALSTGW    
Sbjct  80   GRRYPQFKCSPPVTAKTPATLTVNSFARGGDGGGKSFCDDHFHGDRELVVALSTGWLRLD  139

Query  466  GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL  645
            G +RC + +R+ +  G+S  AKVVDECDS++GCD EH  + PC NN+VDGS  VW  LGL
Sbjct  140  GTNRCNRKVRV-SHGGKSVVAKVVDECDSVNGCDPEHNFEPPCPNNVVDGSPGVWKALGL  198

Query  646  DKDLGRVSLTWA  681
            D  +G V +TW+
Sbjct  199  DDGIGEVKVTWS  210



>ref|XP_010055145.1| PREDICTED: putative ripening-related protein 1 [Eucalyptus grandis]
Length=348

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 99/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+    Y+CSPP+   T A LTLN F++GGDGG PSECD 
Sbjct  37   GKNPPPGQCNTGDDSDCCKNGQMYPIYKCSPPVSGHTRAHLTLNSFAKGGDGGGPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  VVALSTGW+   SRC + I+I   NGRST A VVDECDS  GCD+EH  Q P
Sbjct  97   HYHSDDTPVVALSTGWFDNMSRCHRNIKIYG-NGRSTQAMVVDECDSTMGCDEEHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
            CDN+IVD S AVW  LG+ KD  G + +TW+
Sbjct  156  CDNDIVDASRAVWEALGVSKDNWGWLDITWS  186


 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+    Y+CSPP+   T A LTLN F++GGDGG PSECD 
Sbjct  197  GKNPPPGQCNTGDDSDCCKNGQMYPIYKCSPPVLGHTRAYLTLNSFAKGGDGGGPSECDN  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  VVALSTGW+   SRC + I I   NGRS  A VVDEC+S  GCD+EH  Q P
Sbjct  257  HYHSDDTPVVALSTGWFDNMSRCLRNITIYG-NGRSAQAMVVDECNSTMGCDEEHDYQPP  315

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            CDN+IVD S AVW   G+ KD  G + +TW+ A
Sbjct  316  CDNDIVDASRAVWEAPGVPKDNWGWLDITWSDA  348



>gb|EMT13241.1| hypothetical protein F775_11052 [Aegilops tauschii]
Length=383

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +1

Query  310  YRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYA--GGSRCE  483
            +RCSPP+ S T A LTLN F+ GGDGG PS CD+ YH ++E VVALSTGW    G  RC 
Sbjct  257  FRCSPPVSSKTTATLTLNSFARGGDGGGPSFCDDRYHKDSELVVALSTGWLRLDGTRRCN  316

Query  484  KMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGR  663
            KMIRI + N RS  AKVVDECDS+HGCD EH  + PC NNIVDGS AVW  LGL++++G 
Sbjct  317  KMIRI-SGNRRSVLAKVVDECDSVHGCDKEHNFEPPCANNIVDGSPAVWKALGLNENIGE  375

Query  664  VSLTWA  681
              +TW+
Sbjct  376  FKVTWS  381


 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = +1

Query  217  GTHICRG-GSTP-TPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGD  384
            G  +CR  G  P   GNC+      C  +G+    Y CSPP+ ++T A+LTLN F +G D
Sbjct  30   GLGVCRASGYLPGKSGNCEKSNDPDCCEDGKRYPQYHCSPPVTATTKAVLTLNSFEKGKD  89

Query  385  GGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGC  564
            GG PSECD  YH + E VVALSTGW+   +RC   I+I A NG+S  AKVVDECDS++GC
Sbjct  90   GGGPSECDNSYHSDKELVVALSTGWFKNMARCGHRIKITA-NGKSVYAKVVDECDSVYGC  148

Query  565  DDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLT  675
            D +H  + PC+NNIVD S AVWN LGLD+++G   +T
Sbjct  149  DADHNYEPPCNNNIVDASPAVWNALGLDQNIGMEDIT  185



>ref|XP_004306800.1| PREDICTED: putative ripening-related protein 1-like [Fragaria 
vesca subsp. vesca]
Length=346

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TY CSPP   +T A LTLN F  GGDGG PSECD 
Sbjct  195  GKKPPPGQCNQEDDSDCCKAGKMYPTYTCSPPTSGNTQAYLTLNSFEAGGDGGGPSECDG  254

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH++N  VVALSTGWY GGSRC K IRI   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  255  QYHNDNNPVVALSTGWYNGGSRCLKNIRING-NGQSVVAMVVDECDSTEGCDADHDYQPP  313

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ KD  G + +TW+ A
Sbjct  314  CPNNIVDASKAVWEALGVSKDNWGGLDITWSDA  346


 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+    Y CSPP+  +T A LTLN F +GGDGG PSECD 
Sbjct  35   GKKPPPGQCNQEDDSDCCKAGKMYPKYTCSPPISGNTKAYLTLNSFEKGGDGGGPSECDG  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH++N  VVALSTGWY GGSRC   IRI   NGRS  A VVDECDS  GCD +H  Q P
Sbjct  95   KYHNDNTPVVALSTGWYNGGSRCLNNIRING-NGRSVVAMVVDECDSTEGCDADHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
            C NNIVD S AVW  LG+ +D  G + +TW+
Sbjct  154  CPNNIVDASKAVWKALGVSEDNWGGLDITWS  184



>ref|XP_002320123.2| hypothetical protein POPTR_0014s07760g, partial [Populus trichocarpa]
 gb|EEE98438.2| hypothetical protein POPTR_0014s07760g, partial [Populus trichocarpa]
Length=173

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P P  C       C  NG+  +TY+CSPP  SST A LTLN F +GGDGGAPSECD 
Sbjct  32   GTNPPPDQCNQENDSDCCKNGKYYTTYKCSPPASSSTKATLTLNSFQKGGDGGAPSECDN  91

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+ G+RC   I I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  92   QYHSDDTPVVALSTGWYSNGNRCLNYINIHG-NGKSVKAMVVDECDSTMGCDSDHDYQPP  150

Query  592  CDNNIVDGSAAVWNDLGL  645
            C NNIVD S AVW  LG+
Sbjct  151  CPNNIVDASKAVWKALGV  168



>ref|XP_010933191.1| PREDICTED: putative ripening-related protein 1 [Elaeis guineensis]
Length=186

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 98/155 (63%), Gaps = 14/155 (9%)
 Frame = +1

Query  262  CKPVGSMTCN------------GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            CKP G +  N            G+    YRCSPP+  +T A +T+  F EGGDGG PSEC
Sbjct  33   CKPSGYVKGNFSKCIENDCCAAGKKYPQYRCSPPVTEATHATMTIKSFEEGGDGGGPSEC  92

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH +NE VVALSTGWY  GSRC + IRI A NG S  AKVVDECDS++GCD +H  Q
Sbjct  93   DGKYHSDNETVVALSTGWYHHGSRCGRNIRIHA-NGNSVLAKVVDECDSVNGCDADHDFQ  151

Query  586  GPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
             PCDNNIVD S AVW+ L +    +G   +TW+ A
Sbjct  152  PPCDNNIVDASRAVWDALKIPLSQVGDYEITWSDA  186



>ref|XP_006432702.1| hypothetical protein CICLE_v10003380mg [Citrus clementina]
 ref|XP_006471493.1| PREDICTED: putative ripening-related protein 1-like [Citrus sinensis]
 gb|ESR45942.1| hypothetical protein CICLE_v10003380mg [Citrus clementina]
Length=188

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  S +RCSPP+   T A LTLN F + GDGG PSECD 
Sbjct  38   GKKPPPGQCNKENYSDCCKQGKLYSIFRCSPPVTGHTKATLTLNSFQKDGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++E VVALSTGW+  GSRC   I +   NG+S  AKVVDECDS  GCD +H  Q P
Sbjct  98   QYHSDDEPVVALSTGWHNKGSRCLNYINVYG-NGQSVKAKVVDECDSTMGCDSDHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +  G + + W+ A
Sbjct  157  CRNNIVDASKAVWEALGVPESQGEMEIYWSDA  188



>ref|XP_003555496.1| PREDICTED: ripening-related protein grip22-like [Glycine max]
Length=159

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  334  SSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNG  513
            S TPAILT+NDF  GGDGG PSECD  YH   +RVVALSTGWY GGSRC KM+RI A NG
Sbjct  42   SGTPAILTVNDFGPGGDGGGPSECDGTYHPLPQRVVALSTGWYNGGSRCGKMVRITARNG  101

Query  514  RSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            R+  AKVVDECDS  GCD EH  Q PC  NIVD S  VW+DLGL+ D G V +TW M 
Sbjct  102  RTAVAKVVDECDSTQGCDQEHANQSPCKTNIVDASENVWHDLGLNTDDGEVPVTWTMV  159



>ref|XP_009346961.1| PREDICTED: putative ripening-related protein 2 [Pyrus x bretschneideri]
Length=188

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 96/155 (62%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY+CSPP+  ST A LTLN F + GDGG PSEC
Sbjct  36   RGRKAP-PGQCNQENDSDCCKAGKMYTTYKCSPPLSGSTKAYLTLNSFEKNGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH +N  VVALSTGWY  G RC   I I A NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNKYHSDNTPVVALSTGWYNHGKRCHNNITISA-NGRSVVAMVVDECDSTEGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  154  PPCPNNIVDASKAVWKALGVPEDNWGGLDITWSDA  188



>ref|XP_009383046.1| PREDICTED: putative ripening-related protein 1 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+    YRCSPP+ ++T A +T+ DFSEGGD  APS+CD  YH ++E VVALSTGWY  G
Sbjct  51   GKKYRQYRCSPPVTAATKAHMTIYDFSEGGDSAAPSKCDGEYHSDHEMVVALSTGWYEDG  110

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
            SRC   +RI A NGRS  AKVV ECDS++GCD+EH  Q PC NNIVD S AVW  LG  K
Sbjct  111  SRCGNTVRIDA-NGRSVLAKVVGECDSVNGCDEEHNFQPPCRNNIVDASRAVWKALGFYK  169

Query  652  DL-GRVSLTWAMA  687
               G   +TW+ A
Sbjct  170  SHNGDYDITWSDA  182



>ref|XP_003535457.1| PREDICTED: ripening-related protein grip22-like [Glycine max]
Length=157

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 90/130 (69%), Gaps = 5/130 (4%)
 Frame = +1

Query  301  KSTYRCSPPMKSS-TPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSR  477
            KS    SPP   S T A LTLN+F+ GGDGG P+ECD ++H   +RVVALSTGWY  G+R
Sbjct  32   KSKGLHSPPYNPSGTHATLTLNNFARGGDGGGPAECDGNFHPLPQRVVALSTGWYNHGAR  91

Query  478  CEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDL  657
            C KMIRI+A NGRST AKVVDECDS+HGCD  H     C  N+VD S  VW DLGL+ + 
Sbjct  92   CGKMIRIKARNGRSTLAKVVDECDSVHGCDKSHA----CKTNVVDASKTVWKDLGLNTND  147

Query  658  GRVSLTWAMA  687
            G V +TW M 
Sbjct  148  GEVPVTWTMV  157



>ref|XP_009342513.1| PREDICTED: uncharacterized protein LOC103934489 [Pyrus x bretschneideri]
Length=348

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 96/153 (63%), Gaps = 5/153 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+   TY CSPP+  ST A LTLN F +GGDGG PSEC
Sbjct  36   RGRKAP-PGQCNQENDSDCCKPGKMYPTYTCSPPLSGSTKATLTLNSFEKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY+ G RC K IRI   NGRS  A VVDECDS  GCD  H  Q
Sbjct  95   DNQYHNDNTPVVALSTGWYSNGDRCHKQIRING-NGRSVLAMVVDECDSTEGCDAGHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
             PC NNIVD S AVW  LG+ KD  G + +TW+
Sbjct  154  PPCPNNIVDASKAVWKALGVPKDQWGGLDITWS  186


 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G    TY CSPP+  ST A LTLN F +GGDGG PSECD 
Sbjct  197  GRKPPPGQCNQENDSDCCVAGRMCPTYTCSPPLSGSTKAYLTLNSFEKGGDGGGPSECDN  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH++N  VVALSTGWY  G RC + I I A NGRS  A VVDECDS+ GCD +HG Q P
Sbjct  257  KYHNDNIPVVALSTGWYNNGGRCLRNITISA-NGRSLVATVVDECDSIEGCDADHGYQPP  315

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
            C NNIVD S AVW+  G+ KD  G + +TW+
Sbjct  316  CPNNIVDASKAVWDASGVPKDNWGGLDITWS  346



>ref|XP_009373196.1| PREDICTED: putative ripening-related protein 1 [Pyrus x bretschneideri]
Length=183

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 95/155 (61%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P+ G C       C   G+  +TY CSPP+   T A LTLN F  GGDGG PSEC
Sbjct  31   RGKKAPS-GQCNTENDSDCCVKGKMYTTYTCSPPLSGHTKAYLTLNSFEAGGDGGGPSEC  89

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY GG RC   I I A NGRS  A VVDECDS  GCD  H  Q
Sbjct  90   DNKYHNDNTPVVALSTGWYNGGGRCHNNITISA-NGRSVVAMVVDECDSTMGCDAVHDYQ  148

Query  586  GPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ K D G + +TW+ A
Sbjct  149  PPCPNNIVDASKAVWEALGVRKEDWGGLDITWSDA  183



>ref|XP_007218473.1| hypothetical protein PRUPE_ppa011987mg [Prunus persica]
 gb|EMJ19672.1| hypothetical protein PRUPE_ppa011987mg [Prunus persica]
Length=188

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY+CSPP+  ST A LTLN F + GDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  57   GKMYPTYKCSPPLSGSTKAYLTLNSFEKNGDGGGPSECDNQYHNDNTPVVALSTGWYNNG  116

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   IRI   NGRS  A VVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  117  GRCHNHIRING-NGRSVVAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  175

Query  652  D-LGRVSLTWAMA  687
            D  G + +TW+ A
Sbjct  176  DNWGGLDITWSDA  188



>ref|XP_009342496.1| PREDICTED: putative ripening-related protein 1 [Pyrus x bretschneideri]
Length=189

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 97/156 (62%), Gaps = 6/156 (4%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKS-STPAILTLNDFSEGGDGGAPSE  402
            RG   P PG C       C   G+   TY CSPP+   ST A LTLN F +GGDGG PSE
Sbjct  36   RGRKAP-PGQCNKENDSDCCKAGKMYPTYTCSPPLSGGSTKAYLTLNSFEKGGDGGGPSE  94

Query  403  CDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGG  582
            CD  YH++N  VVALSTGWY+ G RC   IRI   NGRS  A VVDECDS  GCD +H  
Sbjct  95   CDNQYHNDNTPVVALSTGWYSNGDRCHNHIRING-NGRSVVAMVVDECDSTEGCDADHDY  153

Query  583  QGPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            Q PC NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  154  QPPCPNNIVDASKAVWKALGVSEDSWGGLDITWSDA  189



>ref|XP_006647576.1| PREDICTED: putative ripening-related protein 2-like [Oryza brachyantha]
Length=193

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 108/169 (64%), Gaps = 12/169 (7%)
 Frame = +1

Query  211  DVGTHICR---GGSTPTPGNCKPVGSMTCNG-----ETKSTYRCSPPMKSSTPAILTLND  366
            D G H  R   GG  P+ G  +P  S +C       ++  TY CSP +  S  A++TLN+
Sbjct  27   DGGAHRGRELAGGCKPS-GTLRPTRSHSCEDCCSARQSYPTYTCSPAITGSNNAVMTLNN  85

Query  367  FSEGGDGGA-PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDE  543
            F   G+GG+ PSECD  YH N E VVALSTGWYA   RC K IRI A NGRS  AKVVDE
Sbjct  86   FDADGEGGSDPSECDGMYHSNTELVVALSTGWYANNRRCNKNIRINA-NGRSVLAKVVDE  144

Query  544  CDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
            CDS+HGCD EHG Q PC  N+VD S AVW+ LG+  +++G  ++TW+ A
Sbjct  145  CDSLHGCDKEHGYQPPCRPNVVDASQAVWDALGITGEEVGEYNITWSDA  193



>ref|XP_007219480.1| hypothetical protein PRUPE_ppa021545mg [Prunus persica]
 gb|EMJ20679.1| hypothetical protein PRUPE_ppa021545mg [Prunus persica]
Length=190

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY+CSPP+  ST A LTLN F + GDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  59   GKMYPTYKCSPPLSGSTKAYLTLNSFEKNGDGGGPSECDNQYHNDNTPVVALSTGWYNNG  118

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   IRI   NGRS  A VVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  119  RRCHNHIRING-NGRSVVAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  177

Query  652  D-LGRVSLTWAMA  687
            D  G + +TW+ A
Sbjct  178  DNWGGLDITWSDA  190



>ref|XP_003623922.1| Ripening-related protein grip22 [Medicago truncatula]
 gb|AES80140.1| Ripening related protein family [Medicago truncatula]
Length=186

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 98/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            +G  TP+ G C       C   G+  +TY+CSP + + T A LTLN F EGGDGG PS C
Sbjct  34   KGEKTPS-GQCNQENDSDCCVQGKMYTTYKCSPSVSTHTKAYLTLNSFQEGGDGGGPSAC  92

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++  VVALSTGW+   SRC   I+I A NGRS  AKVVDECDS  GCD EH  Q
Sbjct  93   DNQYHSDDTPVVALSTGWFNNKSRCLNKIKISA-NGRSVVAKVVDECDSRAGCDKEHDYQ  151

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC+NNIVD S AVW  LG+  D  G + +TW+ A
Sbjct  152  PPCNNNIVDASKAVWKALGVPHDQWGGLDITWSDA  186



>ref|XP_010105959.1| hypothetical protein L484_017307 [Morus notabilis]
 gb|EXC06841.1| hypothetical protein L484_017307 [Morus notabilis]
Length=188

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTCN-GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEH  414
            G  P PG C P  S  C  GE  +TY+CSP +   T A+LTLN F +GGDGGAPSECDE 
Sbjct  38   GRNPPPGECNPEYSDCCKEGELYTTYKCSPRVSGRTNAVLTLNSFEKGGDGGAPSECDED  97

Query  415  YHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPC  594
            YH ++  VVALSTGW+    RC   I I   NGR   A VVDECDS  GCD +HG Q PC
Sbjct  98   YHSDDTPVVALSTGWFNHMHRCFLNITIYG-NGRRVNAMVVDECDSTAGCDSDHGYQPPC  156

Query  595  DNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             NNIVD S AVW  L + K D G + + W+ A
Sbjct  157  PNNIVDASKAVWKALKVPKSDWGELDIYWSEA  188



>ref|XP_007051837.1| Ripening-related protein 1 [Theobroma cacao]
 gb|EOX95994.1| Ripening-related protein 1 [Theobroma cacao]
Length=187

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  +G+  +TY+CSPP+ S T A LTLN F+ GGDGGAPSECD 
Sbjct  35   GKNPPPGQCNQENDSDCCKDGKWYTTYKCSPPVSSHTKATLTLNSFAAGGDGGAPSECDN  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +++ VVALSTGW+    RC K I I   NG+S  AKVVDECDS  GCD +H  Q P
Sbjct  95   QYHSDDKPVVALSTGWFNHKKRCLKYINIYG-NGKSVRAKVVDECDSTMGCDSDHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
            C N IVD S AVW  LG+ + D G + + W+
Sbjct  154  CPNYIVDASKAVWKALGVPESDWGDMDIYWS  184



>ref|XP_006445076.1| hypothetical protein CICLE_v10023417mg [Citrus clementina]
 gb|ESR58316.1| hypothetical protein CICLE_v10023417mg [Citrus clementina]
 gb|KDO86114.1| hypothetical protein CISIN_1g037386mg [Citrus sinensis]
Length=189

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C    +  C   G+  + YRCSPP+   T A LT+N F + G+GG PSECD 
Sbjct  39   GKKPPPGQCNKENNSDCCKEGKLYTIYRCSPPVTGHTKATLTINSFEKNGEGGGPSECDN  98

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +++ VVALSTGWY  GSRC   I I   NG+S  AKVVDECDS  GCD  H  Q P
Sbjct  99   KYHSDDDPVVALSTGWYNKGSRCLNYINIYG-NGKSVKAKVVDECDSTVGCDSVHDYQPP  157

Query  592  CDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
            C NNIVDGS AVW  LG+    G + + W+ A
Sbjct  158  CPNNIVDGSKAVWKALGVPTSRGELDIHWSDA  189



>ref|XP_009342515.1| PREDICTED: uncharacterized protein LOC103934491 [Pyrus x bretschneideri]
Length=348

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 97/153 (63%), Gaps = 5/153 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+   TY CSPP+  ST A LT+N F +GGDGG PSEC
Sbjct  36   RGRKAP-PGQCNQENDSDCCKPGKMYPTYTCSPPLSGSTKATLTINSFEKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY+ G RC K IRI   NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNQYHNDNTPVVALSTGWYSNGDRCHKQIRING-NGRSVLAMVVDECDSTEGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWA  681
             PC NNIVD S AVW  LG+ +D  G + +TW+
Sbjct  154  PPCPNNIVDASKAVWKALGVPEDQWGGLDITWS  186


 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 89/141 (63%), Gaps = 3/141 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G    TY CSP +  ST A LTLN F +GGDGG PSECD 
Sbjct  197  GRKPPPGQCNRENDSDCCVAGRMCPTYTCSPTLSGSTKAYLTLNSFEKGGDGGGPSECDN  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH++N  VVALSTGWY  G RC + I I A NGRS  A VVDECDS  GCD +HG Q P
Sbjct  257  KYHNDNIPVVALSTGWYNNGGRCLRNITISA-NGRSLVAMVVDECDSTEGCDADHGYQPP  315

Query  592  CDNNIVDGSAAVWNDLGLDKD  654
            C NNIVD S AVW+ LG+ KD
Sbjct  316  CPNNIVDASKAVWDALGVPKD  336



>ref|XP_011036013.1| PREDICTED: putative ripening-related protein 1 [Populus euphratica]
Length=348

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 98/153 (64%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P P  C       C   G+  +TY+CSPP+ SST A LTLN F +GGDGGAPSECD 
Sbjct  197  GTNPPPDQCNQENDSDCCKKGKYYTTYKCSPPVSSSTKATLTLNSFQKGGDGGAPSECDN  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+ G+RC   I I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  257  QYHSDDTPVVALSTGWYSKGNRCLNYINIHG-NGKSVKAMVVDECDSTMGCDSDHDYQPP  315

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + + W+ A
Sbjct  316  CPNNIVDASKAVWKALGVPESDWGEMDIYWSDA  348


 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P P  C       C   G+  +TY+CSPP+  ST A LTLN F +GGDGGAPSECD 
Sbjct  37   GTNPPPDQCNQENDSDCCKKGKYYTTYKCSPPVSRSTKATLTLNSFQKGGDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY+ G+RC   I I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYSKGNRCLNYINIHG-NGKSVKAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
            C NNIVD S AVW  LG+ + D G + + W+
Sbjct  156  CPNNIVDASKAVWKALGVPESDWGEMDIYWS  186



>gb|EMT14348.1| hypothetical protein F775_19872 [Aegilops tauschii]
Length=205

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            G C P     C  +G     ++CSPP+ + TPAILTLN F+ GGDGG  S CD  +H ++
Sbjct  59   GKCNPEHGSDCCASGHRYPQFKCSPPVSAETPAILTLNSFAAGGDGGGKSFCDNKFHPDS  118

Query  430  ERVVALSTGWYA--GGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNN  603
             RVVALS+GW    G  RC KMIRI   NGRS  AKVVDECDS++GCD EH  + PC NN
Sbjct  119  ARVVALSSGWLRLDGTRRCNKMIRING-NGRSVLAKVVDECDSVNGCDAEHNFEPPCPNN  177

Query  604  IVDGSAAVWNDLGLDKDLGRVSLTWA  681
             VDGS AVW  LGL + +G   +TW+
Sbjct  178  AVDGSPAVWKALGLKESIGEFKVTWS  203



>gb|EAY79018.1| hypothetical protein OsI_34127 [Oryza sativa Indica Group]
Length=213

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +1

Query  235  GGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSS---TPAILTLNDFSEGGDGGAPS  399
            G  T T G+C       C  +G   +TY CSPP+ +    T A+LTLN F++GGDGG+  
Sbjct  58   GAITGTSGDCNADNGSECCQDGVQYTTYACSPPVAAGGTGTAALLTLNSFADGGDGGSAP  117

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
             C   ++D+ + VVALSTGW+ G SRCEK + IRAS G S TA VVDECDS  GCD  H 
Sbjct  118  SCTGRFYDDGQLVVALSTGWFDGRSRCEKDVVIRASGGASVTAMVVDECDSQRGCDSGHN  177

Query  580  GQGPCDNNIVDGSAAVWNDLGLDKDLGRVSLTWAMA  687
             + PC NNIVDGS AVW+ LGL+KD G   +TW+ A
Sbjct  178  FEPPCRNNIVDGSPAVWDALGLNKDDGEAQITWSDA  213



>ref|XP_003605680.1| Ripening-related protein grip22 [Medicago truncatula]
 gb|AES87877.1| Ripening related protein family [Medicago truncatula]
Length=188

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             G+  +TY+CSP + + T A LTLN F EGGDGG PS CD  YH ++  VVALSTGW+  
Sbjct  56   QGKMYTTYKCSPSVSTHTKAFLTLNSFQEGGDGGGPSACDNQYHSDDTPVVALSTGWFNN  115

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
             SRC   I+I A NGRS  AKVVDECDS  GCD EH  Q PC+NNIVD S AVW  LG+ 
Sbjct  116  KSRCLNKIKISA-NGRSVVAKVVDECDSRAGCDKEHDYQPPCNNNIVDASKAVWKALGVP  174

Query  649  KD-LGRVSLTWAMA  687
             D  G + +TW+ A
Sbjct  175  HDQWGGLDITWSDA  188



>ref|XP_007219675.1| hypothetical protein PRUPE_ppa025304mg, partial [Prunus persica]
 gb|EMJ20874.1| hypothetical protein PRUPE_ppa025304mg, partial [Prunus persica]
Length=162

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY CSPP+  ST A LTLN F  GGDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  31   GKMYPTYTCSPPLSESTKAYLTLNSFEAGGDGGGPSECDNKYHNDNTPVVALSTGWYNNG  90

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   I I A NGRS  A VVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  91   GRCHNNITISA-NGRSVVAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  149

Query  652  D-LGRVSLTWAMA  687
            D  G + +TW+ A
Sbjct  150  DNWGGLDITWSDA  162



>ref|XP_008244906.1| PREDICTED: putative ripening-related protein 1 [Prunus mume]
Length=187

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 101/167 (60%), Gaps = 9/167 (5%)
 Frame = +1

Query  211  DVGTHICRG-----GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDF  369
            +V   +CR      G  P  G C       C   G+  +TY+CSP + S T A+LTLN F
Sbjct  22   EVEAQVCRPSGKIIGKKPPHGKCNTEDDSDCCFKGKIYTTYKCSPQVSSHTKAVLTLNSF  81

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
             +GGDGG PSECD+ YH ++  +VALSTGW+   SRC   I I A NGRS  A VVDECD
Sbjct  82   EKGGDGGGPSECDKKYHSDDRPIVALSTGWFNRKSRCLNNITISA-NGRSVVAMVVDECD  140

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            S  GCD+ H  Q PC +NIVD S AVW  LG+ K D G + +TWA A
Sbjct  141  STMGCDEVHDYQPPCADNIVDASRAVWEALGVPKNDWGYMDITWADA  187



>gb|KCW71633.1| hypothetical protein EUGRSUZ_E00160 [Eucalyptus grandis]
Length=188

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+    Y+CSPP+   T A LTLN F++GGDGG PSECD 
Sbjct  37   GKNPPPGQCNTGDDSDCCKNGQMYPIYKCSPPVLGHTRAYLTLNSFAKGGDGGGPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  VVALSTGW+   SRC + I I   NGRS  A VVDEC+S  GCD+EH  Q P
Sbjct  97   HYHSDDTPVVALSTGWFDNMSRCLRNITIYG-NGRSAQAMVVDECNSTMGCDEEHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            CDN+IVD S AVW   G+ KD  G + +TW+ A
Sbjct  156  CDNDIVDASRAVWEAPGVPKDNWGWLDITWSDA  188



>ref|XP_010229674.1| PREDICTED: putative ripening-related protein 5 [Brachypodium 
distachyon]
Length=182

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPM---KSSTPAILTLNDFSEGGDGGAPSECDEHYH  420
            G+C    S  C  +G+  + + CSPP     S+  A+LTLN F EG DGG+PSECD  +H
Sbjct  33   GDCDKSNSPDCCEDGKQYTQFLCSPPAVSAPSANAAVLTLNSFREGKDGGSPSECDNAFH  92

Query  421  DNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKVVDECDSMHGCDDEHGGQGPCD  597
             ++E VVALSTGW+AG +RC + +RI     G S +AKVVDECDS+HGCD EH  + PC 
Sbjct  93   ADSELVVALSTGWFAGMARCGRSVRITVVPGGGSVSAKVVDECDSVHGCDAEHNFEAPCG  152

Query  598  NNIVDGSAAVWNDLGLDKDLGRVSLTWA  681
            NN+VD S AVW+ LGLD++ G   +TW+
Sbjct  153  NNVVDASPAVWDALGLDRNQGLQDITWS  180



>ref|XP_002511839.1| Kiwellin, putative [Ricinus communis]
 gb|EEF50508.1| Kiwellin, putative [Ricinus communis]
Length=187

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY CSPP+   T A LT+N F+ GGDGG PSECD 
Sbjct  35   GRKPPPGQCNQEHDSDCCVEGKMYTTYNCSPPVTGHTKAALTINSFAPGGDGGGPSECDN  94

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++E VVALSTGW+   SRC   I I   NG+S  AKVVDECDS  GCD +H  Q P
Sbjct  95   KYHSDDELVVALSTGWFDRKSRCLNYIMIHG-NGKSVKAKVVDECDSTMGCDSDHDYQPP  153

Query  592  CDNNIVDGSAAVWNDLGLD--KDLGRVSLTWAMA  687
            C NNIVD S A+WN LG+    D+G + + W+ A
Sbjct  154  CPNNIVDASKAIWNTLGVSDPDDVGAMEIVWSDA  187



>ref|XP_002271952.2| PREDICTED: uncharacterized protein LOC100260254 [Vitis vinifera]
Length=348

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T A+LTLN F +GGDGGAPSECD 
Sbjct  197  GKKPPPGGCNQENDSDCCVQGKLYTTYKCSPAVSSHTKAVLTLNSFEKGGDGGAPSECDR  256

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  GSRC   I I A  GRS  A VVDECDS  GCD++H  Q P
Sbjct  257  KYHSDDTPVVALSTGWYNKGSRCLNNITISA-RGRSMVAMVVDECDSTMGCDEDHDYQPP  315

Query  592  CDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+   D G + +TW+ A
Sbjct  316  CPNNIVDASKAVWEALGVPLADWGELDITWSDA  348


 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T A LTLN F +  DGGAPSECD 
Sbjct  37   GKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHTKAYLTLNGFQKDEDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYNKGSRCLNNITISA-NGRSVVAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNI+D S AVW  LG+  D  G + +TW  A
Sbjct  156  CTNNIIDASRAVWKALGVPHDQWGGLDITWTDA  188



>ref|XP_003623927.1| Ripening-related protein [Medicago truncatula]
 gb|AES80145.1| Ripening related protein family [Medicago truncatula]
Length=188

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 97/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            +G   P+ G C       C   G+  +TY+CSP + + T A LTLN F EGGDGG PS C
Sbjct  36   KGEKAPS-GQCNQENDSDCCVQGKMYTTYKCSPSVSTHTKAYLTLNSFEEGGDGGGPSAC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++  VVALSTGW+   SRC   I+I A NGRS  AKVVDECDS  GCD EH  Q
Sbjct  95   DNQYHSDDTPVVALSTGWFNNKSRCLNKIKISA-NGRSVVAKVVDECDSRAGCDKEHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC+NNIVD S AVW  LG+  D  G + +TW+ A
Sbjct  154  PPCNNNIVDASKAVWKALGVPHDQWGGLDITWSDA  188



>ref|XP_002320124.1| hypothetical protein POPTR_0014s07770g [Populus trichocarpa]
 gb|EEE98439.1| hypothetical protein POPTR_0014s07770g [Populus trichocarpa]
Length=189

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 97/164 (59%), Gaps = 9/164 (5%)
 Frame = +1

Query  211  DVGTHICR-----GGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDF  369
            D+    CR      G  P P  C       C  +G+  +TY+CSP + S T A LTLN F
Sbjct  23   DIEAQQCRPSGQIRGRKPPPNQCNQENDSDCCKDGKYYTTYKCSPQVTSHTKAFLTLNSF  82

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
              GGDGG PSECD+ YH ++  V ALSTGW+   SRC   I I A NGRS  A VVDECD
Sbjct  83   EAGGDGGGPSECDKQYHSDDTPVAALSTGWFNHKSRCHNNITITA-NGRSVAAMVVDECD  141

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTW  678
            S  GCD+ H  Q PCDNNIVD S AVW  LG+ +D  G + +TW
Sbjct  142  STMGCDEVHDYQPPCDNNIVDASKAVWKALGVPEDNWGWLEITW  185



>ref|NP_001052553.1| Os04g0364800 [Oryza sativa Japonica Group]
 sp|Q7XVA8.2|RIP1_ORYSJ RecName: Full=Putative ripening-related protein 1; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAD40754.2| OSJNBa0081G05.7 [Oryza sativa Japonica Group]
 dbj|BAF14467.1| Os04g0364800 [Oryza sativa Japonica Group]
 emb|CAH66310.1| OSIGBa0135K14.7 [Oryza sativa Indica Group]
 gb|EAY93720.1| hypothetical protein OsI_15509 [Oryza sativa Indica Group]
Length=183

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 105/157 (67%), Gaps = 14/157 (9%)
 Frame = +1

Query  256  GNCKPVGSMTCN-----------GETKSTYRCSPPMK-SSTPAILTLNDFSEGGDGGAPS  399
            G C P G++  +           G++  TY CSPP   SST A++TLNDF  GGDGG PS
Sbjct  28   GECNPSGAIRSSTTHRCQDCCKAGQSYPTYTCSPPTTGSSTDAVMTLNDFDAGGDGGGPS  87

Query  400  ECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHG  579
            ECDE YH N E VVALSTGWYAGGSRC K +RI A NGRS  AKVVDECDS  GCD+EH 
Sbjct  88   ECDEMYHSNTELVVALSTGWYAGGSRCGKSVRINA-NGRSVLAKVVDECDSQRGCDEEHA  146

Query  580  GQGPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
             Q PC  N+VD S AVW+ LG+  +D+G   +TW+ A
Sbjct  147  YQPPCRPNVVDASQAVWDALGITGEDVGEYDITWSDA  183



>ref|XP_007220087.1| hypothetical protein PRUPE_ppa023816mg [Prunus persica]
 gb|EMJ21286.1| hypothetical protein PRUPE_ppa023816mg [Prunus persica]
Length=141

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY+CSPP+  +T A LTLN F + GDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  10   GKMYPTYKCSPPLSGNTKAYLTLNSFEKNGDGGGPSECDNQYHNDNTPVVALSTGWYNNG  69

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   IRI   NGRS  A VVDEC+S  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  70   GRCHNHIRING-NGRSVVAMVVDECNSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  128

Query  652  D-LGRVSLTWAMA  687
            D  G + +TW+ A
Sbjct  129  DNWGGLDITWSDA  141



>emb|CAN63234.1| hypothetical protein VITISV_026714 [Vitis vinifera]
Length=188

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S + A LTLN F +  DGGAPSECD 
Sbjct  37   GKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHSKAYLTLNGFEKDEDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  VVALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  97   HYHSDDTPVVALSTGWYNKGSRCLNNITITA-NGRSVVAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW  A
Sbjct  156  CANNIVDASRAVWKALGVPQDQWGGLDITWTDA  188



>emb|CAN61347.1| hypothetical protein VITISV_007855 [Vitis vinifera]
Length=187

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T   LTLN F +  DGGAPSECD 
Sbjct  36   GKKPPPGECNDGNDSECCXEGKFYTTYKCSPQVSSHTKGFLTLNGFDKDQDGGAPSECDN  95

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH N+  +VALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  96   HYHSNDIPIVALSTGWYNKGSRCLNNITITA-NGRSVVAMVVDECDSTMGCDKDHDYQPP  154

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            CD NIVD S AVW  LG+ D   G + +TW+ A
Sbjct  155  CDXNIVDASRAVWKALGVPDDKWGGMDITWSDA  187



>ref|XP_002529817.1| Kiwellin, putative [Ricinus communis]
 gb|EEF32566.1| Kiwellin, putative [Ricinus communis]
Length=187

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG  +P PG C       C   G+  +TY+CSPP+   T A LT+N F+ GGDGGAPSEC
Sbjct  34   RGRKSP-PGQCNRENDSDCCVQGKMYTTYKCSPPVTGHTKATLTVNSFAPGGDGGAPSEC  92

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++E VVALSTGW+   SRC   I I   NG+S  AKVVDECDS  GCD +H  Q
Sbjct  93   DNQYHSDDELVVALSTGWFDNKSRCLNYIMIHG-NGQSVKAKVVDECDSTMGCDSDHDYQ  151

Query  586  GPCDNNIVDGSAAVWNDLGL-DKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ D D +G + + W+ A
Sbjct  152  PPCPNNIVDASKAVWKALGVSDPDSVGEMDIYWSDA  187



>ref|XP_004953214.1| PREDICTED: putative ripening-related protein 2-like [Setaria 
italica]
Length=192

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKS-STPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
            G++  TYRCSPP+ S ST AI+TLNDF  GGDGG PS+CDE +H N ERVVALSTGWYAG
Sbjct  60   GKSYPTYRCSPPVVSGSTKAIMTLNDFDAGGDGGDPSKCDEKFHKNTERVVALSTGWYAG  119

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            G RC K +RI A  G+S  AKVVDECDS+HGCD EH  Q PC  N+VD S AVW+ LG+ 
Sbjct  120  GKRCGKNVRINA-KGKSVLAKVVDECDSLHGCDSEHAFQPPCRPNVVDASQAVWDALGIT  178

Query  649  KD-LGRVSLTWAMA  687
             D +G   +TW+ A
Sbjct  179  GDEVGEYGITWSDA  192



>ref|XP_003552385.1| PREDICTED: putative ripening-related protein 1-like [Glycine 
max]
 gb|KHM99391.1| Putative ripening-related protein 2 [Glycine soja]
Length=188

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 96/155 (62%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY CSPPM S+T A LTLN F +GGDGG PSEC
Sbjct  36   RGKKAP-PGQCNQENDSDCCKEGKMYTTYECSPPMSSNTKAYLTLNSFQKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++  VVALSTGW+   SRC   I I + NGRS  A VVD+CDS  GCD EH  Q
Sbjct  95   DNQYHSDDTPVVALSTGWFNHKSRCLHNITI-SGNGRSVVAMVVDQCDSRKGCDAEHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLD-KDLGRVSLTWAMA  687
             PC NNIVD S AVW  LG+   + G + +TW+ A
Sbjct  154  PPCPNNIVDASKAVWKALGVPLNEWGGLDITWSDA  188



>ref|XP_002509793.1| Kiwellin, putative [Ricinus communis]
 gb|EEF51180.1| Kiwellin, putative [Ricinus communis]
Length=188

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+  +TY CSPP+  ST A LT+N F +GG+GG PSECD+ YHD++  VVALSTGW+   
Sbjct  55   GKFYTTYTCSPPVTKSTKATLTINSFQKGGEGGGPSECDQKYHDDDTPVVALSTGWFNHK  114

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   I I   NG+ST A VVDECDS  GCD+EHG Q PC NNIVD S AVW  LG+ +
Sbjct  115  KRCHNYITIHG-NGKSTKAMVVDECDSTMGCDNEHGYQPPCANNIVDASKAVWKALGVKE  173

Query  652  DLGR---VSLTWAMA  687
              GR   + +TW  A
Sbjct  174  SDGRWGWMDITWTDA  188



>gb|KCW54414.1| hypothetical protein EUGRSUZ_I00364 [Eucalyptus grandis]
Length=155

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 95/140 (68%), Gaps = 7/140 (5%)
 Frame = +1

Query  196  CNDDPDVGTHICRGGS------TPTPGNCKPVGSMTCNGETKSTYRCSPPMKSSTPAILT  357
            C+DDPDVGT IC  G+      T     C+  G++ C+G +  T+ CSPP+ SSTPAILT
Sbjct  2    CSDDPDVGTRICGSGAGDRSVLTLDDEGCESSGNLQCDGVSYPTFACSPPVISSTPAILT  61

Query  358  LNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRA-SNGRSTTAKV  534
             NDFS GGDGG PSECD  YHD++E +VALSTGW+   S C KMI+I +   GRS TA+V
Sbjct  62   WNDFSHGGDGGDPSECDRQYHDDSELIVALSTGWFDNESHCRKMIQIASIKTGRSVTARV  121

Query  535  VDECDSMHGCDDEHGGQGPC  594
            VD  DSM+G D+ H  Q PC
Sbjct  122  VDRYDSMYGGDEIHAHQLPC  141



>ref|XP_007135042.1| hypothetical protein PHAVU_010G096700g [Phaseolus vulgaris]
 ref|XP_007135043.1| hypothetical protein PHAVU_010G096800g [Phaseolus vulgaris]
 gb|ESW07036.1| hypothetical protein PHAVU_010G096700g [Phaseolus vulgaris]
 gb|ESW07037.1| hypothetical protein PHAVU_010G096800g [Phaseolus vulgaris]
Length=188

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S+T A LTLN F +GGDGG PS CD 
Sbjct  37   GKKPPPGECNQENDSECCVQGKMYTTYKCSPAVSSNTEAQLTLNSFEKGGDGGGPSACDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGW+   SRC   + I A NG+S  A VVDECDS  GCD++H  Q P
Sbjct  97   QYHSDDTPVVALSTGWFNNSSRCLHNVTISA-NGKSVVAMVVDECDSTMGCDEDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVWN LG+  +  G + +TWA A
Sbjct  156  CSNNIVDASKAVWNALGVPHNQWGGLKITWADA  188



>gb|EMT09991.1| hypothetical protein F775_16502 [Aegilops tauschii]
Length=189

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +1

Query  298  TKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYA--GG  471
            T  T RCSPP+ + TPAILTLN F+ GGDGG  S CD  ++ + E VVALSTGW    G 
Sbjct  59   TGITARCSPPVSADTPAILTLNSFARGGDGGGKSFCDNRFYKDTELVVALSTGWLRLDGK  118

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC KMIRI   NGR+  AKVVDECDS++GCD EH  + PC  N VD S AVW  LGL +
Sbjct  119  RRCNKMIRING-NGRAVLAKVVDECDSVYGCDAEHNFEPPCPYNDVDASPAVWKALGLKE  177

Query  652  DLGRVSLTWA  681
            +LG   +TW+
Sbjct  178  ELGVFKITWS  187



>ref|XP_010096897.1| hypothetical protein L484_008096 [Morus notabilis]
 gb|EXB66351.1| hypothetical protein L484_008096 [Morus notabilis]
Length=185

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+   TY+CSP +   T A+LTLN F +GGDG APSECD 
Sbjct  34   GKKPPPGECNQENYSDCCKKGKFYKTYKCSPKVTGHTKAVLTLNSFEKGGDGAAPSECDN  93

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +N  VVALSTGW++   RC + I I   NGRS  A VVDECDS  GCD +H  Q P
Sbjct  94   QYHSDNTPVVALSTGWFSNTQRCLQNITIYG-NGRSVNAMVVDECDSTAGCDADHDYQPP  152

Query  592  CDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            C NNIVD S AVW  L + K D G + + W+ A
Sbjct  153  CPNNIVDASKAVWKALKVPKSDWGELDIYWSEA  185



>ref|XP_002302579.2| hypothetical protein POPTR_0002s16000g [Populus trichocarpa]
 gb|EEE81852.2| hypothetical protein POPTR_0002s16000g [Populus trichocarpa]
Length=188

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G+ P P  C       C  +G+  +TY+CSP + S T A LTLN F  GGDGGAPSECD 
Sbjct  37   GTNPPPDQCNQENDSDCCKDGKFYTTYKCSPLVSSHTKATLTLNSFEGGGDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  GSRC   + I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYNHGSRCLNYVNIHG-NGKSVKAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + + W+ A
Sbjct  156  CANNIVDASKAVWKALGVPESDWGEMDIYWSDA  188



>ref|XP_008376021.1| PREDICTED: LOW QUALITY PROTEIN: putative ripening-related protein 
5 [Malus domestica]
Length=345

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 97/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY+CSPP+  ST A LTLN F + GDGG PSEC
Sbjct  193  RGRKAP-PGQCNQENDSDCCKAGKMYTTYKCSPPLSGSTKAYLTLNSFEKNGDGGGPSEC  251

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY  G RC   I I A NGRS  A VVDECDS  GCD +H  Q
Sbjct  252  DNKYHNDNTPVVALSTGWYNHGKRCHNNITISA-NGRSVVAMVVDECDSTEGCDADHDYQ  310

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  311  PPCPNNIVDASKAVWKALGVPEDNWGGLDITWSDA  345


 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 95/160 (59%), Gaps = 25/160 (16%)
 Frame = +1

Query  262  CKPVG--------SMTCNGETKS----------TYRCSPPMKS-STPAILTLNDFSEGGD  384
            C+P G        S TCN E  S          TY CSPP+   ST A LTLN F + GD
Sbjct  29   CRPSGKXQRKERTSWTCNQENDSDCCKAGKMYPTYTCSPPVSGGSTKAYLTLNSFEKNGD  88

Query  385  GGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGC  564
            GG PSECD  Y+++N  VVALSTGWY+ G RC   IRI   NGRS    VVDECDS  GC
Sbjct  89   GGGPSECDNQYYNDNTPVVALSTGWYSKGDRCHNHIRING-NGRS----VVDECDSTEGC  143

Query  565  DDEHGGQGPCDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
            D +H  Q PC NNIVD S AVW  LG+ + + G + +TW+
Sbjct  144  DADHDYQPPCPNNIVDASKAVWKALGVPEYNWGGLDITWS  183



>emb|CDP09746.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 106/210 (50%), Gaps = 26/210 (12%)
 Frame = +1

Query  58   NLALISLCIFAIFFCFSLQGNALSSCNGPCTTLDDCSGQLICIGGKCNDDPDVGTHICRG  237
             +   S+C+  +    +L    L     PCT     SG++                  RG
Sbjct  4    QVQFSSICLLVLLSIIALACTILMVEAKPCTP----SGKI------------------RG  41

Query  238  GSTPTPGNCKPVGSMTCN-GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEH  414
               P    C P     C  G    TY CSPP+   T AILT+NDF +GGDGG  S CD  
Sbjct  42   KQAPR-DQCDPHTDDCCQAGRVYKTYECSPPVSKRTKAILTINDFQKGGDGGGTSACDNK  100

Query  415  YHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPC  594
            +H NN  VVALSTGW+ G  RC K I I   NGRS  A VVDECDS  GCD +HG Q PC
Sbjct  101  FHSNNTPVVALSTGWFNGLKRCHKYITI-FGNGRSARAMVVDECDSTKGCDSDHGFQPPC  159

Query  595  DNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
             N+IVD S AVW  L +  KD G + + WA
Sbjct  160  QNSIVDASEAVWKALKVPKKDWGSMEVFWA  189



>ref|XP_003555495.1| PREDICTED: ripening-related protein grip22-like [Glycine max]
Length=155

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 9/130 (7%)
 Frame = +1

Query  301  KSTYRCSPPMKSS-TPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSR  477
            KS    SPP   S T AILTLN+F+ GGDGG P+ECD  +H   +RVVALSTGWY  G+R
Sbjct  34   KSKGLHSPPYNPSGTHAILTLNNFARGGDGGGPAECDGKFHPLPQRVVALSTGWYNKGAR  93

Query  478  CEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDKDL  657
            C KMIRI+A NGRST AKVVDECDS+HGC         C  N+VD S  VW DLGL+ + 
Sbjct  94   CGKMIRIKARNGRSTLAKVVDECDSVHGC--------ACKTNVVDASKTVWKDLGLNTND  145

Query  658  GRVSLTWAMA  687
            G V +TW M 
Sbjct  146  GEVPVTWTMV  155



>gb|KHN29365.1| Putative ripening-related protein 2 [Glycine soja]
Length=188

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 94/155 (61%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY CSPPM S T A LTLN F +GGDGG PSEC
Sbjct  36   RGKKAP-PGQCNQENDSDCCKEGKMYTTYECSPPMSSHTKAYLTLNSFEKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++  VVALSTGW+    RC   I I + NGRS  A VVD+CDS  GCD +H  Q
Sbjct  95   DNQYHSDDTPVVALSTGWFDHKRRCLHNITI-SGNGRSVVAMVVDQCDSRKGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ K D G   +TW+ A
Sbjct  154  PPCPNNIVDASRAVWKALGVPKNDWGGFDITWSDA  188



>gb|KDP45134.1| hypothetical protein JCGZ_17466 [Jatropha curcas]
Length=174

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 86/139 (62%), Gaps = 3/139 (2%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C  NG+  +TY+CSPP+     A LTLN F+ GGD GAPSECD 
Sbjct  34   GRKPPPGQCNQEHESDCCVNGKFYTTYKCSPPVTGHIKATLTLNSFAPGGDDGAPSECDN  93

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH +NE VVALSTGW+A   RC   I I   NG+S  AKVVDECDS  GCD +H  Q P
Sbjct  94   HYHSDNELVVALSTGWFANKRRCLNYITING-NGKSVRAKVVDECDSTMGCDSDHDYQPP  152

Query  592  CDNNIVDGSAAVWNDLGLD  648
              NNIVD S AVW  L  D
Sbjct  153  SSNNIVDASPAVWKALVKD  171



>ref|XP_007220948.1| hypothetical protein PRUPE_ppa026116mg [Prunus persica]
 gb|EMJ22147.1| hypothetical protein PRUPE_ppa026116mg [Prunus persica]
Length=187

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +1

Query  211  DVGTHICRG-----GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDF  369
            +V   +CR      G  P  G C       C   G+  +TY+CSP + S T A+LTLN F
Sbjct  22   EVEAQVCRPSGKIIGKKPPHGKCNTEDDSDCCFKGKIYTTYKCSPQVSSHTKAVLTLNSF  81

Query  370  SEGGDGGAPSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECD  549
             +GGDGG PSECD+ YH ++  +VALSTGW+   SRC   I I A NG S  A VVDECD
Sbjct  82   EKGGDGGGPSECDKKYHSDDRPIVALSTGWFNRKSRCLNNITISA-NGSSVVAMVVDECD  140

Query  550  SMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
            S  GCD+ H  Q PC +NIVD S AVW  LG+ K D G + +TWA A
Sbjct  141  STMGCDEVHDYQPPCADNIVDASRAVWEALGVPKNDWGYMDITWADA  187



>ref|XP_010654793.1| PREDICTED: uncharacterized protein LOC100264620 [Vitis vinifera]
Length=325

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = +1

Query  220  THICRGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA  393
            T + R G  P PG C       C   G+  +TY+CSP + S T A LTLN F +  DGGA
Sbjct  8    TQVARLGKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHTKAYLTLNGFEKDEDGGA  67

Query  394  PSECDEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDE  573
            PSECD  YH ++  VVALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +
Sbjct  68   PSECDNQYHSDDTPVVALSTGWYNKGSRCLNNITITA-NGRSVVAMVVDECDSTMGCDSD  126

Query  574  HGGQGPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTW  678
            H  Q PC NNIVD S AVW  LG+ +D  G + +TW
Sbjct  127  HDYQPPCANNIVDASRAVWEALGVPRDQWGGLDITW  162


 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T A LTLN F +  DGGAPSECD 
Sbjct  174  GKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHTKAYLTLNGFEKDEDGGAPSECDN  233

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
            HYH ++  V+ALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  234  HYHSDDTPVLALSTGWYNKGSRCLNNITITA-NGRSVVAMVVDECDSTMGCDSDHDYQPP  292

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW  A
Sbjct  293  CANNIVDASRAVWKALGVPQDQWGGLDITWTDA  325



>ref|XP_006345629.1| PREDICTED: uncharacterized protein LOC102601249 [Solanum tuberosum]
Length=355

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG CK      C   G+  +TY+CSPP+   T A+LT+N F +GGDGG  SECD 
Sbjct  42   GIKPPPGKCKIGYQSECCKPGKPYTTYKCSPPISGKTKAVLTINSFQKGGDGGGKSECDN  101

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +N  VVALSTGW++G  RC + I I   NGR T A VVDECDS   CDD H  Q P
Sbjct  102  KYHSDNTPVVALSTGWFSGEKRCMRNITIYG-NGRQTNAMVVDECDSTMRCDDVHDYQPP  160

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
            CDNNIVD S AVW  LG+ +K  G++ + W+
Sbjct  161  CDNNIVDASKAVWKALGVPEKQWGQLDIFWS  191


 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  295  ETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGA--PSECDEHYHDNNERVVALSTGWYAG  468
            +  +TY+CSP + S T AILTLN F +GGDG    PS+CD  YH ++  VVALSTGWY G
Sbjct  223  KVYATYKCSPQVSSKTKAILTLNSFEKGGDGDGDGPSKCDNKYHSDDTHVVALSTGWYNG  282

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLD  648
            G RC   I I   NGRS  A VVDECDS  GCD++H  Q PC NN+V  S  VW  L + 
Sbjct  283  GGRCLSNITING-NGRSVNAMVVDECDSTMGCDEKHDYQPPCQNNLVIASQGVWRALRVP  341

Query  649  -KDLGRVSLTW  678
              + G + +TW
Sbjct  342  INEWGELDITW  352



>ref|XP_007139915.1| hypothetical protein PHAVU_008G069300g [Phaseolus vulgaris]
 gb|ESW11909.1| hypothetical protein PHAVU_008G069300g [Phaseolus vulgaris]
Length=188

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 96/155 (62%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY CSPP+ + T A LTLN F +GGDGG PSEC
Sbjct  36   RGKKAP-PGQCNQENDSDCCKAGKLYTTYECSPPLSTHTNAYLTLNSFQKGGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH ++  VVALSTGW+   SRC   I I A NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNQYHSDDTPVVALSTGWFNHKSRCLHNITISA-NGRSVVAMVVDECDSTKGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ + + G + +TW+ A
Sbjct  154  PPCPNNIVDASKAVWKALGVPQNEWGGLDITWSDA  188



>ref|XP_002320788.2| hypothetical protein POPTR_0014s07840g [Populus trichocarpa]
 gb|EEE99103.2| hypothetical protein POPTR_0014s07840g [Populus trichocarpa]
Length=188

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P P  C       C  +G+    ++CSP + SST A LTLN F +GGDGGAPSECD 
Sbjct  37   GRKPPPNQCNQENDSDCCADGKFYPIFKCSPRVTSSTKATLTLNSFQKGGDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  G+RC   I I   NG+S  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYNNGNRCLNSINIHG-NGKSVKAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWAMA  687
            C NNIVD S AVW  LG+ + D G + + W+ A
Sbjct  156  CANNIVDASKAVWKALGVPESDWGEMDIYWSDA  188



>ref|XP_008244910.1| PREDICTED: uncharacterized protein LOC103343018 [Prunus mume]
Length=348

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY CSPP+  ST A LTLN F  GGDGG PSECD  YH++N  VVALSTGWY  G
Sbjct  217  GKMYPTYTCSPPLSGSTKAYLTLNSFEAGGDGGGPSECDNKYHNDNTPVVALSTGWYNNG  276

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC   I IRA NGRS  A VVDECDS  GCD +H  Q PC NNIVD S AVW  LG+ +
Sbjct  277  GRCHNNITIRA-NGRSVVAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGVPE  335

Query  652  D-LGRVSLTWAMA  687
            D  G + +TW+ A
Sbjct  336  DNWGGLDITWSDA  348


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+   TY CSPP+  ST A LTLN F + GDGG PSEC
Sbjct  36   RGRKAP-PGQCNKENDSDCCVAGKMYPTYTCSPPLSGSTKAYLTLNSFEKNGDGGGPSEC  94

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D  YH++N  VVALSTGWY+ G RC   IRI   NGRS  A VVDECDS  GCD +H  Q
Sbjct  95   DNKYHNDNTPVVALSTGWYSNGGRCHNHIRING-NGRSVVAMVVDECDSTEGCDADHDYQ  153

Query  586  GPCDNNIVDGSAAVWNDLGLDK-DLGRVSLTWA  681
             PC NNIVD S AVW  LG+ + + G + +TW+
Sbjct  154  PPCPNNIVDASKAVWKALGVPEGNWGGLDITWS  186



>emb|CBI40342.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T A LTLN F +  DGGAPSECD 
Sbjct  37   GKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHTKAYLTLNGFQKDEDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYNKGSRCLNNITISA-NGRSVVAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNI+D S AVW  LG+  D  G + +TW  A
Sbjct  156  CTNNIIDASRAVWKALGVPHDQWGGLDITWTDA  188



>emb|CAN71973.1| hypothetical protein VITISV_009241 [Vitis vinifera]
Length=188

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 93/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG C       C   G+  +TY+CSP + S T A LTLN F +  DGGAPSECD 
Sbjct  37   GKKPPPGECNQGNDSDCCKEGKLYTTYKCSPTVSSHTKAYLTLNGFEKDEDGGAPSECDN  96

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGWY  GSRC   I I A NGRS  A VVDECDS  GCD +H  Q P
Sbjct  97   QYHSDDTPVVALSTGWYNKGSRCLNNITITA-NGRSVVAMVVDECDSTMGCDSDHDYQPP  155

Query  592  CDNNIVDGSAAVWNDLGLDKDLGR-VSLTWAMA  687
            C NNIVD S AVW  LG+ +D    + +TW  A
Sbjct  156  CANNIVDASRAVWEALGVPRDQWEGLDITWTDA  188



>gb|AES80144.2| Ripening related protein family [Medicago truncatula]
Length=189

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 97/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  232  RGGSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSEC  405
            RG   P PG C       C   G+  +TY CSP + + T A LTLN F +GGDGG PSEC
Sbjct  37   RGKKAP-PGKCNQENDSDCCVQGKMYTTYVCSPSVSTHTKAYLTLNSFQKGGDGGGPSEC  95

Query  406  DEHYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQ  585
            D+ YH ++  VVALSTGW+   SRC   I I A NGR+  A VVDECDS  GCD++H  Q
Sbjct  96   DKQYHSDDTPVVALSTGWFNHKSRCLNNITISA-NGRNVVAMVVDECDSRKGCDEQHDYQ  154

Query  586  GPCDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
             PC NNIVD S AVW  LG+ K+  G + +TW+ A
Sbjct  155  PPCPNNIVDASKAVWKALGVPKEQWGGLDITWSDA  189



>ref|XP_010933165.1| PREDICTED: putative ripening-related protein 1 [Elaeis guineensis]
Length=197

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 94/147 (64%), Gaps = 4/147 (3%)
 Frame = +1

Query  256  GNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNN  429
            GNC    +  C   G+  + Y CSP +  +T A L +N F EGGDGG PSECD  YH+++
Sbjct  43   GNCNTENNSECCRAGQNYTQYHCSPTVTGATRATLNINSFEEGGDGGGPSECDGMYHNDS  102

Query  430  ERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIV  609
            E VVALSTGWY  GSRC K I I A NG +  AKVVDECDS++GCD EH  + PC NNIV
Sbjct  103  ESVVALSTGWYNQGSRCGKYITINA-NGNAVLAKVVDECDSVNGCDAEHNFEPPCHNNIV  161

Query  610  DGSAAVWNDLGL-DKDLGRVSLTWAMA  687
              S AVW  L + D  +G   +TW+ A
Sbjct  162  AASQAVWKALKIPDSQIGEYEITWSDA  188



>ref|XP_002304490.2| hypothetical protein POPTR_0003s12630g, partial [Populus trichocarpa]
 gb|EEE79469.2| hypothetical protein POPTR_0003s12630g, partial [Populus trichocarpa]
Length=170

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = +1

Query  289  NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAG  468
             G+  +TY+CSPP+ + T  ILT+N F EGGDGG  SECD  YHD++  VVALSTGW++ 
Sbjct  36   QGKFYTTYKCSPPVSAHTKGILTINSFEEGGDGGGQSECDGRYHDDDTPVVALSTGWFSN  95

Query  469  GSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGL-  645
              RC   I I   NGRS  A VVD CDS  GCD EHG Q PC NNIVD S AVW  LG+ 
Sbjct  96   KKRCHHHITING-NGRSVKALVVDHCDSTRGCDGEHGYQPPCSNNIVDASKAVWKALGVN  154

Query  646  --DKDLGRVSLTWAMA  687
              +K+ G + +TW+ A
Sbjct  155  EKNKEWGWMDITWSDA  170



>ref|XP_007051840.1| Uncharacterized protein TCM_005356 [Theobroma cacao]
 gb|EOX95997.1| Uncharacterized protein TCM_005356 [Theobroma cacao]
Length=189

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = +1

Query  292  GETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVVALSTGWYAGG  471
            G+   TY+CSP + + T   LTLN F +G DGG PSECD+ YH N+E VVALSTGW+   
Sbjct  58   GKLYDTYKCSPEVSNHTKGFLTLNGFDKGQDGGGPSECDKRYHKNSELVVALSTGWFHKQ  117

Query  472  SRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSAAVWNDLGLDK  651
             RC K I I   NGRS  AKVVDECDS  GCDDEH  Q PCDN+IVD S AVW  LG+ K
Sbjct  118  KRCLKFINIYG-NGRSVQAKVVDECDSTMGCDDEHDYQPPCDNDIVDASDAVWEALGVSK  176

Query  652  -DLGRVSLTWAMA  687
               G + + W+ A
Sbjct  177  GQRGGMDIYWSDA  189



>ref|XP_003623897.1| Ripening-related protein [Medicago truncatula]
 gb|AES80115.1| Ripening related protein family [Medicago truncatula]
Length=189

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTCNGETK--STYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G    PG C       C  + K  +TY CSP + + T A LTLN F  GGDGG PSECD 
Sbjct  38   GKNAPPGQCNQENDSDCCVQEKMYTTYECSPAVSTYTKAYLTLNSFQNGGDGGGPSECDN  97

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH ++  VVALSTGW+   SRC K I I A NG+S  A VVDECDS  GCD+EH  Q P
Sbjct  98   QYHSDDTPVVALSTGWFNHESRCLKNITISA-NGKSVVAMVVDECDSTKGCDEEHDYQPP  156

Query  592  CDNNIVDGSAAVWNDLGLDKD-LGRVSLTWAMA  687
            C NNIVD S AVW  LG+ +D  G + +TW+ A
Sbjct  157  CPNNIVDASKAVWEALGVPQDQWGGLDITWSDA  189



>ref|XP_010321532.1| PREDICTED: putative ripening-related protein 1 [Solanum lycopersicum]
Length=186

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = +1

Query  238  GSTPTPGNCKPVGSMTC--NGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDE  411
            G  P PG CK      C   G++ +TY+CSP +   T A+LT+N F +GGDGG  SECD 
Sbjct  36   GIKPPPGKCKIGYQSECCKPGKSYTTYKCSPSISGKTKAVLTINSFQKGGDGGGKSECDN  95

Query  412  HYHDNNERVVALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGP  591
             YH +N  VVALSTGW++G  RC + I I   NGR T A VVDECDS  GCD  H  Q P
Sbjct  96   KYHSDNTPVVALSTGWFSGEKRCMQNITIYG-NGRKTNAMVVDECDSTMGCDHVHDYQPP  154

Query  592  CDNNIVDGSAAVWNDLGL-DKDLGRVSLTWA  681
            C NNIVD S AVW  LG+  K  G + + W+
Sbjct  155  CANNIVDASKAVWKALGVPKKQWGELDIFWS  185



>gb|KEH18880.1| Ripening related protein family [Medicago truncatula]
Length=192

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 90/141 (64%), Gaps = 9/141 (6%)
 Frame = +1

Query  262  CKPVGSMTCNGETKSTYRCSPPMKSSTPAILTLNDFSEGGDGGAPSECDEHYHDNNERVV  441
            CKP       G++ +T++CSP +   T A LTLN F +GGDGGAPSECD  +H +   VV
Sbjct  58   CKP-------GKSYTTFKCSPQVSHKTKATLTLNSFEKGGDGGAPSECDNKFHSDKTPVV  110

Query  442  ALSTGWYAGGSRCEKMIRIRASNGRSTTAKVVDECDSMHGCDDEHGGQGPCDNNIVDGSA  621
            ALSTGW+    RC K I I   NG+   A VVDECDS  GCD EH  Q PC NNIVD SA
Sbjct  111  ALSTGWFNNNKRCLKKITIFG-NGKKVNAMVVDECDSTQGCDAEHDFQPPCSNNIVDASA  169

Query  622  AVWNDLGL-DKDLGRVSLTWA  681
            AVW  LG+ +KD G + + W+
Sbjct  170  AVWKALGVPEKDWGEMEVFWS  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2033734698028