BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24811_g1_i1 len=1527 path=[4060:0-55 3833:56-163 43:164-191
70:192-301 180:302-334 213:335-422 301:423-660 539:661-704
583:705-764 643:765-869 748:870-874 753:875-908 787:909-1002
881:1003-1088 967:1089-1166 1045:1167-1220 1099:1221-1241
1120:1242-1310 1189:1311-1323 1202:1324-1526]

Length=1527
                                                                      Score     E

ref|XP_009593784.1|  PREDICTED: phospholipase A1-IIdelta                585   0.0      
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like           577   0.0      
ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           572   0.0      
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                570   0.0      
ref|XP_002303465.1|  lipase family protein                              569   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             567   0.0      
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   566   0.0      
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           565   0.0      
emb|CDP15943.1|  unnamed protein product                                565   0.0      
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                564   0.0      
gb|EPS65211.1|  hypothetical protein M569_09564                         563   0.0      
ref|XP_004243279.1|  PREDICTED: phospholipase A1-IIdelta                561   0.0      
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                558   0.0      
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                557   0.0      
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           557   0.0      
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           558   0.0      
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           556   0.0      
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          555   0.0      
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         553   0.0      
ref|XP_009766306.1|  PREDICTED: phospholipase A1-IIdelta-like           555   0.0      
emb|CDO98286.1|  unnamed protein product                                552   0.0      
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                549   0.0      
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             540   0.0      
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                540   0.0      
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                537   0.0      
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          535   0.0      
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           532   0.0      
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             531   0.0      
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           531   0.0      
ref|XP_003607601.1|  Feruloyl esterase A                                530   0.0      
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           530   0.0      
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           526   2e-180   
ref|XP_002518706.1|  triacylglycerol lipase, putative                   521   6e-179   Ricinus communis
gb|ACJ85535.1|  unknown                                                 520   5e-178   Medicago truncatula
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           514   3e-176   
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             514   4e-176   
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like           515   5e-176   
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                516   6e-176   Vitis vinifera
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             513   9e-176   
ref|NP_181797.1|  phospholipase A1-IIdelta                              512   2e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           510   1e-174   
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     510   1e-174   
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    508   7e-174   
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             508   8e-174   
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                508   1e-173   
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like           507   4e-173   
emb|CBI21996.3|  unnamed protein product                                509   6e-173   
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    505   1e-172   
gb|EPS65213.1|  hypothetical protein M569_09566                         504   2e-172   
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                500   1e-170   
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    496   6e-169   
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           493   1e-167   
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           489   5e-166   
gb|AAD01804.1|  lipase                                                  486   1e-164   Dianthus caryophyllus [carnation]
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             484   1e-164   
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           483   5e-164   
emb|CDY14851.1|  BnaC04g48480D                                          481   2e-163   
emb|CDY47985.1|  BnaA04g24630D                                          479   4e-163   
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           478   3e-162   
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           478   4e-162   
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   476   2e-160   
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   475   3e-160   
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             473   6e-160   
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              470   2e-158   
emb|CDY50817.1|  BnaC04g52540D                                          464   8e-157   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           462   9e-156   
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              455   1e-152   
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              442   4e-147   
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   437   3e-145   
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          434   7e-144   Sorghum bicolor [broomcorn]
emb|CDM83808.1|  unnamed protein product                                426   5e-141   
ref|NP_001044041.1|  Os01g0710700                                       426   7e-141   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63050.1|  Phospholipase A1-II 5                                   427   9e-141   
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             425   2e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   423   1e-139   
gb|ABK24664.1|  unknown                                                 420   5e-139   Picea sitchensis
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              420   2e-138   
gb|EEE55280.1|  hypothetical protein OsJ_03214                          425   4e-138   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88202.1|  predicted protein                                      417   2e-137   
dbj|BAJ85876.1|  predicted protein                                      417   2e-137   
gb|KFK37116.1|  hypothetical protein AALP_AA4G215000                    409   8e-136   
dbj|BAH56866.1|  AT2G42690                                              406   4e-134   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    388   6e-128   
ref|XP_009142882.1|  PREDICTED: phospholipase A1-IIdelta-like           372   1e-121   
ref|XP_010104409.1|  Phospholipase A1-IIdelta                           371   7e-120   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           365   6e-118   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                363   2e-117   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           360   6e-116   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                358   2e-115   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           358   4e-115   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     357   9e-115   Vitis vinifera
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                357   1e-114   
gb|ABR18391.1|  unknown                                                 356   2e-114   Picea sitchensis
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           354   1e-113   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                355   1e-113   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           355   1e-113   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           355   1e-113   
gb|ABK23399.1|  unknown                                                 353   2e-113   Picea sitchensis
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           354   3e-113   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           354   4e-113   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           352   7e-113   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            351   2e-112   
ref|XP_003593747.1|  Lipase                                             351   2e-112   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           351   2e-112   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         347   7e-111   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             347   9e-111   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   343   1e-109   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           343   2e-109   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     343   2e-109   
emb|CDO96758.1|  unnamed protein product                                343   2e-109   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              343   6e-109   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              342   8e-109   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           343   1e-108   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           341   2e-108   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           339   4e-108   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              338   3e-107   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           337   3e-107   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           337   5e-107   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           337   5e-107   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           337   5e-107   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             337   6e-107   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          336   2e-106   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              336   2e-106   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   333   2e-105   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                334   6e-105   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   331   1e-104   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           331   3e-104   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       331   3e-104   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          329   6e-104   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              328   1e-103   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              327   4e-103   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                327   4e-103   
ref|XP_009415331.1|  PREDICTED: phospholipase A1-II 5-like              326   6e-103   
ref|XP_002305750.2|  lipase class 3 family protein                      326   9e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              326   1e-102   
gb|KHN34242.1|  Phospholipase A1-IIdelta                                319   7e-102   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                325   9e-102   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           322   2e-101   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                323   2e-101   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                323   3e-101   
emb|CDM83551.1|  unnamed protein product                                320   9e-101   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    321   1e-100   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   321   2e-100   Ricinus communis
ref|XP_002316835.2|  lipase class 3 family protein                      320   2e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           321   2e-100   
ref|XP_003540985.1|  PREDICTED: phospholipase A1-IIdelta-like           314   3e-100   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    320   8e-100   
dbj|BAJ96485.1|  predicted protein                                      317   1e-99    
emb|CBI30665.3|  unnamed protein product                                315   3e-99    
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   315   7e-99    
gb|EMT15519.1|  Lipase                                                  315   1e-98    
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             311   2e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    313   3e-97    
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              310   1e-96    
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           311   1e-96    
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             309   3e-96    
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              308   6e-96    
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           308   1e-95    
gb|EMS63185.1|  Phospholipase A1-II 1                                   318   1e-95    
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          308   1e-95    Sorghum bicolor [broomcorn]
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           307   2e-95    
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    306   2e-95    
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             306   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          306   3e-95    Sorghum bicolor [broomcorn]
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           307   4e-95    
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   306   4e-95    
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    306   5e-95    
ref|NP_001152663.1|  triacylglycerol lipase precursor                   307   5e-95    Zea mays [maize]
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           305   5e-95    
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           305   8e-95    
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             306   9e-95    
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           305   9e-95    
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           304   2e-94    
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             305   2e-94    
ref|XP_002867985.1|  lipase class 3 family protein                      305   3e-94    
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    303   4e-94    
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           303   9e-94    
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           302   1e-93    
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    317   1e-93    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              302   2e-93    
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    303   2e-93    
ref|XP_009415339.1|  PREDICTED: phospholipase A1-II 5-like              301   4e-93    
gb|EMT21704.1|  Putative lipase                                         302   5e-93    
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           300   7e-93    
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     300   1e-92    Zea mays [maize]
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      299   2e-92    
gb|ABQ95989.1|  phospholipase A1                                        298   3e-92    Capsicum annuum
emb|CDY01554.1|  BnaC07g35440D                                          300   3e-92    
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           298   3e-92    
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              298   4e-92    
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   298   5e-92    
emb|CDO96757.1|  unnamed protein product                                297   6e-92    
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   298   8e-92    
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                298   1e-91    
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              298   1e-91    
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like              296   1e-91    
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           297   1e-91    
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             297   1e-91    
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              296   3e-91    
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       296   4e-91    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             296   5e-91    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151242.1|  triacylglycerol lipase                             295   6e-91    Zea mays [maize]
ref|NP_193590.1|  phospholipase A1-IIgamma                              296   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525127.1|  triacylglycerol lipase, putative                   295   7e-91    Ricinus communis
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    295   8e-91    
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    295   8e-91    
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           294   1e-90    
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          295   2e-90    Sorghum bicolor [broomcorn]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              295   2e-90    
ref|NP_001149813.1|  triacylglycerol lipase                             294   2e-90    Zea mays [maize]
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           294   2e-90    
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           294   2e-90    
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           293   2e-90    
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           293   2e-90    
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              293   8e-90    
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                293   8e-90    
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    295   1e-89    
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           291   2e-89    
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          291   3e-89    Sorghum bicolor [broomcorn]
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              291   3e-89    
emb|CDM85400.1|  unnamed protein product                                290   6e-89    
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            290   6e-89    
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           289   1e-88    
ref|XP_002525129.1|  triacylglycerol lipase, putative                   289   1e-88    Ricinus communis
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       305   1e-88    
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    293   1e-88    
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              290   2e-88    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    292   3e-88    
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              290   3e-88    
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           287   5e-88    
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    287   6e-88    
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              288   7e-88    
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            288   8e-88    
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           286   2e-87    
gb|AFK47098.1|  unknown                                                 286   2e-87    
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              287   2e-87    
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    286   2e-87    
ref|XP_003608120.1|  Lipase                                             286   2e-87    
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           286   3e-87    
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    289   4e-87    
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         288   5e-87    
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 285   8e-87    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             289   8e-87    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    288   9e-87    
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    288   1e-86    
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    290   1e-86    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    287   2e-86    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    287   2e-86    
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             283   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    287   2e-86    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    288   3e-86    
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          283   3e-86    Arabidopsis thaliana [mouse-ear cress]
emb|CDP11819.1|  unnamed protein product                                282   5e-86    
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    282   7e-86    
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                281   7e-86    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             285   7e-86    Populus trichocarpa [western balsam poplar]
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    282   9e-86    
ref|NP_001043730.2|  Os01g0651200                                       282   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    285   1e-85    
ref|NP_001043734.1|  Os01g0651800                                       282   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    285   2e-85    
gb|EMT05578.1|  hypothetical protein F775_13080                         281   2e-85    
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    281   2e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              281   3e-85    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           285   4e-85    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    283   5e-85    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             282   1e-84    
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              280   1e-84    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    283   1e-84    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    283   1e-84    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    283   1e-84    
emb|CDY10187.1|  BnaC05g04300D                                          279   1e-84    
gb|EAY99121.1|  hypothetical protein OsI_21080                          278   2e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              278   2e-84    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                282   3e-84    
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    278   4e-84    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     281   4e-84    
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    283   4e-84    
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                278   5e-84    
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    278   5e-84    
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    276   5e-84    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             281   6e-84    
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              278   8e-84    
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    278   9e-84    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         280   1e-83    
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    282   1e-83    
gb|EAY75191.1|  hypothetical protein OsI_03083                          275   1e-83    
ref|XP_003607369.1|  Lipase                                             280   2e-83    
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    276   2e-83    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    279   2e-83    
emb|CBI21954.3|  unnamed protein product                                275   2e-83    
dbj|BAJ95995.1|  predicted protein                                      276   2e-83    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     278   3e-83    
gb|EEE64775.1|  hypothetical protein OsJ_19631                          275   3e-83    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    279   3e-83    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    278   3e-83    
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              276   4e-83    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             278   4e-83    
emb|CDY57813.1|  BnaA10g28020D                                          279   4e-83    
ref|XP_002891639.1|  lipase class 3 family protein                      278   5e-83    
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    278   5e-83    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    278   5e-83    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    278   5e-83    
emb|CDX99456.1|  BnaC01g10960D                                          275   7e-83    
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           275   8e-83    
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    277   9e-83    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    277   9e-83    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             278   1e-82    
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             274   1e-82    
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             274   1e-82    
ref|XP_001781080.1|  predicted protein                                  274   1e-82    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    277   1e-82    
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                273   2e-82    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    277   2e-82    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          276   2e-82    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    275   2e-82    
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    276   2e-82    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    276   3e-82    
gb|EAY75192.1|  hypothetical protein OsI_03084                          273   3e-82    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    276   3e-82    
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    275   4e-82    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    275   4e-82    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    275   5e-82    
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           272   5e-82    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             274   5e-82    
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    276   6e-82    
ref|XP_010104408.1|  Phospholipase A1-IIdelta                           273   6e-82    
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             272   6e-82    
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           273   6e-82    
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    275   7e-82    
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    274   7e-82    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         275   8e-82    
gb|EMT15520.1|  Feruloyl esterase A                                     279   8e-82    
emb|CDX97819.1|  BnaC04g41200D                                          274   8e-82    
dbj|BAD68802.1|  lipase-like protein                                    272   9e-82    
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                272   9e-82    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    275   1e-81    
ref|XP_003608122.1|  Lipase                                             271   1e-81    
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    273   1e-81    
emb|CDX84801.1|  BnaA03g14290D                                          271   1e-81    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             274   1e-81    
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            271   1e-81    
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              271   2e-81    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    274   2e-81    
gb|EEC79153.1|  hypothetical protein OsI_19824                          276   2e-81    
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    274   2e-81    
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    273   2e-81    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     274   2e-81    
emb|CDX76515.1|  BnaA08g08850D                                          270   2e-81    
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   271   2e-81    
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             274   3e-81    
gb|EMS52156.1|  Phospholipase A1-II 2                                   270   3e-81    
emb|CDM86668.1|  unnamed protein product                                273   4e-81    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             270   4e-81    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    274   4e-81    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           270   4e-81    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    273   5e-81    
ref|NP_564590.1|  DAD1-like lipase 2                                    273   5e-81    
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       273   6e-81    
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    272   6e-81    
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           269   7e-81    
gb|AAM61647.1|  lipase-like protein                                     270   9e-81    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    272   1e-80    
emb|CDY29665.1|  BnaA04g17620D                                          272   1e-80    
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    272   1e-80    
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          268   1e-80    
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    271   2e-80    
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    271   2e-80    
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              269   2e-80    
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    271   3e-80    
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    272   3e-80    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    271   4e-80    
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    270   4e-80    
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             270   4e-80    
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           270   5e-80    
gb|ABR16123.1|  unknown                                                 271   5e-80    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    270   6e-80    
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             271   6e-80    
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    270   6e-80    
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    266   7e-80    
ref|NP_172115.1|  phospholipase A1-IIalpha                              267   7e-80    
dbj|BAJ99811.1|  predicted protein                                      270   7e-80    
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    270   8e-80    
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             270   9e-80    
emb|CDY22842.1|  BnaA06g02350D                                          270   9e-80    
emb|CDY23963.1|  BnaC03g17280D                                          266   1e-79    
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                269   1e-79    
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          266   1e-79    
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             269   1e-79    
gb|EMS51987.1|  Phospholipase A1-II 3                                   266   2e-79    
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             268   2e-79    
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    270   2e-79    
emb|CDX86530.1|  BnaC08g01730D                                          265   2e-79    
gb|EMS48809.1|  Phospholipase A1-II 6                                   267   2e-79    
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             268   2e-79    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    268   2e-79    
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             267   3e-79    
emb|CDY49813.1|  BnaC06g04560D                                          268   3e-79    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       268   3e-79    
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             268   4e-79    
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    269   4e-79    
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           265   4e-79    
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          268   6e-79    
ref|XP_002879267.1|  lipase class 3 family protein                      268   6e-79    
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    268   7e-79    
ref|NP_849603.1|  phospholipase A1-Igamma1                              267   8e-79    
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    266   1e-78    
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    266   1e-78    
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     260   2e-78    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    266   2e-78    
gb|KEH23856.1|  phospholipase A1                                        266   2e-78    
ref|NP_001056387.1|  Os05g0574100                                       263   2e-78    
ref|XP_010274489.1|  PREDICTED: phospholipase A1-IIdelta-like           255   3e-78    
gb|ACJ76846.1|  chloroplast lipase protein                              266   3e-78    
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     263   3e-78    
emb|CDY10228.1|  BnaC05g04710D                                          265   4e-78    
ref|XP_009389473.1|  PREDICTED: phospholipase A1-II 5-like              261   5e-78    
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    265   6e-78    
ref|NP_565701.1|  phospholipase A1-Igamma2                              265   6e-78    
ref|XP_010107463.1|  Phospholipase A1-IIdelta                           261   7e-78    
gb|EMT11182.1|  hypothetical protein F775_27795                         263   7e-78    
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              261   8e-78    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    264   8e-78    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    264   9e-78    
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    265   9e-78    
ref|XP_002892359.1|  lipase class 3 family protein                      264   1e-77    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    263   2e-77    
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    263   2e-77    
emb|CDM86669.1|  unnamed protein product                                264   2e-77    
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                261   3e-77    
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg             263   4e-77    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    262   5e-77    
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          262   5e-77    
ref|XP_002513514.1|  triacylglycerol lipase, putative                   261   7e-77    
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          261   1e-76    
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                   261   1e-76    
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    261   1e-76    
gb|EMT04701.1|  Lipase                                                  257   2e-76    
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          261   2e-76    
emb|CDY34061.1|  BnaC03g62710D                                          257   3e-76    
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    255   5e-76    
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              259   5e-76    
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    259   6e-76    
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   6e-76    
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         259   8e-76    
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             256   8e-76    
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           256   9e-76    
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    260   1e-75    
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   2e-75    
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    258   2e-75    
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         254   2e-75    
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     256   3e-75    
gb|EMS63790.1|  Phospholipase A1-II 7                                   258   3e-75    
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    257   4e-75    
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    256   4e-75    
emb|CDP03693.1|  unnamed protein product                                253   5e-75    
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    256   7e-75    
gb|KHN12425.1|  Phospholipase A1-Igamma1, chloroplastic                 263   9e-75    
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              252   1e-74    
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    256   1e-74    
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    256   1e-74    
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          256   2e-74    
emb|CDP09265.1|  unnamed protein product                                255   2e-74    
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein          256   2e-74    
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    254   3e-74    
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    254   3e-74    
dbj|BAJ85518.1|  predicted protein                                      256   3e-74    
ref|XP_009399031.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    254   4e-74    
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    254   5e-74    
ref|XP_008784887.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    254   6e-74    
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           251   6e-74    
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           250   7e-74    
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    253   9e-74    
ref|XP_009408789.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    253   1e-73    
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg             253   2e-73    
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    253   2e-73    
emb|CDP21091.1|  unnamed protein product                                253   2e-73    
gb|ABK96341.1|  unknown                                                 249   2e-73    
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    252   4e-73    
ref|XP_002522219.1|  hypothetical protein RCOM_1733320                  241   5e-73    
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    251   5e-73    
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    249   6e-73    
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    251   7e-73    
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    252   8e-73    
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein          251   9e-73    
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    251   9e-73    
ref|XP_001779106.1|  predicted protein                                  250   9e-73    
gb|EPS70940.1|  hypothetical protein M569_03817                         248   1e-72    
dbj|BAJ90094.1|  predicted protein                                      246   1e-72    
ref|XP_009399030.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    251   1e-72    
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           247   1e-72    
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           247   1e-72    
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    250   1e-72    
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    250   2e-72    
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           247   3e-72    
emb|CDY02287.1|  BnaA09g26150D                                          249   3e-72    
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             246   3e-72    
emb|CDY53993.1|  BnaA03g58180D                                          244   5e-72    
emb|CDY09593.1|  BnaC05g23260D                                          249   5e-72    
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    249   6e-72    



>ref|XP_009593784.1| PREDICTED: phospholipase A1-IIdelta [Nicotiana tomentosiformis]
Length=483

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/410 (69%), Positives = 331/410 (81%), Gaps = 7/410 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M TEPTWH+LLGS NWE LLDPLNL LR LILRCGDFCQATYD+FN+D NSKY GS RYG
Sbjct  1     MGTEPTWHELLGSNNWESLLDPLNLHLRRLILRCGDFCQATYDAFNNDQNSKYCGSSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             KNSFFHKVM  SA DY+V ++LYATA++   +A  LHS SRESWDRESNWIGY+AVT+D 
Sbjct  61    KNSFFHKVMFESASDYKVYSFLYATARVGAHKALFLHSLSRESWDRESNWIGYIAVTNDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-------SGdnddkeedd  907
             VS+ LGRREIY+ FRGTT + EWINV  AKP SA PLL   +        GD  + ++DD
Sbjct  121   VSENLGRREIYIAFRGTTRNYEWINVLGAKPESAGPLLHPKSLNKAELDDGDGGNVDDDD  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             +  PKVM GW  +Y S DPNS FT LSAR QLQT IE+LR KYK ENLSIT TGHSLGAS
Sbjct  181   ENAPKVMNGWLKIYVSNDPNSPFTRLSARAQLQTMIEDLREKYKDENLSITFTGHSLGAS  240

Query  726   LAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             L+ILAAFDL ENGVTDIPV+AI+FGSPQ+GNK F++ + +  NLKILH++NKID+I  YP
Sbjct  241   LSILAAFDLVENGVTDIPVSAIIFGSPQVGNKAFNERLKKFPNLKILHVKNKIDLITHYP  300

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
              +LLGYV SG+E VID RKS SLK++ NPSDWHNLQAMLH+VAGWNGE+ EFELKVKR +
Sbjct  301   SSLLGYVNSGIELVIDTRKSPSLKDTKNPSDWHNLQAMLHIVAGWNGENEEFELKVKRSL  360

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             ALVNKS   LK+E+ IPGSWW+EKNK +VL E+GEW+L  P+DED+P+PE
Sbjct  361   ALVNKSSSILKDEILIPGSWWVEKNKGVVLAEDGEWILAPPSDEDIPIPE  410



>ref|XP_006348881.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=488

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/410 (66%), Positives = 329/410 (80%), Gaps = 7/410 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M TEPTWH+LLGS NWEGLL+PL+L+LR LILRCGDFCQAT+D+FN+D  S Y GS RYG
Sbjct  1     MGTEPTWHELLGSNNWEGLLEPLHLNLRRLILRCGDFCQATHDAFNNDEYSMYCGSSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFFHKVM  SA DYQ+ ++LYATA++   +AF LHS SRESWDRESNWIGY+AVT+D 
Sbjct  61    KSSFFHKVMFKSASDYQIVSFLYATARVGAHKAFFLHSLSRESWDRESNWIGYIAVTNDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-------SGdnddkeedd  907
             +S+ LGRREIY+ FRGTT + EW+NV SA P SAEPLL   +         +      DD
Sbjct  121   MSEQLGRREIYIAFRGTTRNYEWVNVLSALPESAEPLLHPQSLNKPDPDGDNGGSNSNDD  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             +  P+VM GW  +Y S DP S +T LSAR QLQT IE+LR +YK ENLSIT TGHSLGA+
Sbjct  181   ENAPRVMNGWLKIYISSDPKSPYTRLSARAQLQTMIEDLRDRYKDENLSITFTGHSLGAT  240

Query  726   LAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             L+ILAAFDL ENGVTDIPV+AI+FGSPQ+GN+ F+  + E  NLKILH++NKID+IP YP
Sbjct  241   LSILAAFDLVENGVTDIPVSAIIFGSPQVGNRAFNDKLKEFPNLKILHVKNKIDVIPLYP  300

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
              +LLGYV SG+E VID RKS SLK+S NPSDWHNLQAMLH++AGWNGE+GEFE+KVKR +
Sbjct  301   SSLLGYVNSGIELVIDTRKSPSLKDSKNPSDWHNLQAMLHIIAGWNGENGEFEMKVKRSL  360

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             ALVNKS   LK+++ IPGSWW+EKNK +VLDE+GEW+L  P DED+P+PE
Sbjct  361   ALVNKSSSILKDDILIPGSWWVEKNKGVVLDEDGEWILAPPLDEDIPIPE  410



>ref|XP_009629724.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana tomentosiformis]
Length=453

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/453 (63%), Positives = 332/453 (73%), Gaps = 49/453 (11%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M TEP WH+LLGS NWEGLL+PLNL+LR LILRCGDFCQATYD+FN+D NSKY G+ RYG
Sbjct  1     METEPIWHELLGSNNWEGLLEPLNLNLRQLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K SFF KVML SA +Y++  +LYATA++   EA  LHS SRE+WDRESNWIGY+AVT+D 
Sbjct  61    KKSFFQKVMLQSASNYKISGFLYATARIGALEAIFLHSLSREAWDRESNWIGYIAVTTDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST------------SG-dnd  925
             V++ LGRREIYVVFRGTT + EWINV  A+P SA+ LLR  +            SG ++ 
Sbjct  121   VTQELGRREIYVVFRGTTRNYEWINVLGARPESADSLLRPKSLHKIGVNGDDGVSGDNSK  180

Query  924   dkeedddKVPKV------------------------------------MFGWHTLYTSKD  853
                 DD+  PKV                                    M GW  +Y S +
Sbjct  181   SSNADDENTPKVEDSWLKIFASSLCKPCGVNGDNSKSSSDDDENEPKIMDGWLKIYVSSN  240

Query  852   PNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVTDIP  673
             PNS FT LSAREQLQTK+EELR +YK ENLSIT TGHSLGASLA LAAFD+ ENGVTDIP
Sbjct  241   PNSPFTKLSAREQLQTKVEELRQQYKDENLSITFTGHSLGASLATLAAFDVVENGVTDIP  300

Query  672   VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHR  493
             V+AIVFGSPQ+GNK F++ + E +NLKILH++NKID+IP YP ALLGY  +G E VID R
Sbjct  301   VSAIVFGSPQVGNKAFNEKIKEYSNLKILHVKNKIDLIPLYPSALLGYANTGTELVIDSR  360

Query  492   KSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPG  313
             KS SLK+S +  DWHNLQ MLHVVAGWNGED EFEL+VKR VALVNKS  FLK+E  IPG
Sbjct  361   KSPSLKDSRDTGDWHNLQGMLHVVAGWNGEDKEFELQVKRSVALVNKSSSFLKDEYLIPG  420

Query  312   SWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             SWW+EKN+SMVLDENGEW++  P+DEDLPVPEY
Sbjct  421   SWWVEKNRSMVLDENGEWIMAPPSDEDLPVPEY  453



>ref|XP_011028053.1| PREDICTED: phospholipase A1-IIdelta [Populus euphratica]
Length=413

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/410 (65%), Positives = 334/410 (81%), Gaps = 7/410 (2%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
              +E TW ++LGS+NW+ LLDPL+LSLR LI+RCGDFCQATYD+FN+D NS+Y G+ RYGK
Sbjct  4     TSEATWPEILGSKNWDNLLDPLDLSLRKLIIRCGDFCQATYDAFNNDKNSRYCGTSRYGK  63

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
              +FFHKVML + ++YQV ++LYATA++++PEAFLLHS SR+SWDRE+NWIGY+AVTSD  
Sbjct  64    RNFFHKVMLDNPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAVTSDEQ  123

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdndd-------keeddd  904
             +K LGRREIY+ FRGTT + EW+N+  AK  SA+PLLR +TS   D         ++DDD
Sbjct  124   TKTLGRREIYIAFRGTTRNYEWVNILGAKLKSAKPLLRGATSTTRDQGSSSSSDDDDDDD  183

Query  903   KVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
             KVPKVM GW ++Y S DPNS FT LSAR QL   I+ELR +YK ++LSI  TGHSLGASL
Sbjct  184   KVPKVMLGWLSMYISDDPNSPFTKLSARAQLSVHIKELRERYKDDDLSIIFTGHSLGASL  243

Query  723   AILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +IL+AFDL ENG+TDIPV+A VFGSPQ+GNK F++   +  NLK++HI+NKID+IP YPG
Sbjct  244   SILSAFDLVENGITDIPVSAFVFGSPQVGNKEFNERFNKYPNLKVMHIKNKIDVIPHYPG  303

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
              L+GY  +G+EF ID RKS SLK+S NPSDWHNLQAMLH+VAGWNGE+ +FELKVKR +A
Sbjct  304   RLMGYASTGIEFEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEEQDFELKVKRSLA  363

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             LVNKSCEFL +E  +PG WW+EKNK MV +E+G+WVL  P++EDLPVPEY
Sbjct  364   LVNKSCEFLNDECLVPGIWWVEKNKGMVRNEDGDWVLAPPDEEDLPVPEY  413



>ref|XP_002303465.1| lipase family protein [Populus trichocarpa]
 gb|EEE78444.1| lipase family protein [Populus trichocarpa]
Length=411

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/407 (66%), Positives = 330/407 (81%), Gaps = 5/407 (1%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
              +E TW ++LGS NW+ LLDPL+LSLR LILRCGDFCQATYD+FN+D NS+Y G+ RYGK
Sbjct  4     TSEATWPEILGSRNWDNLLDPLDLSLRKLILRCGDFCQATYDAFNNDQNSRYCGTSRYGK  63

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
              +FFHKVML + ++YQV ++LYATA++++PEAFLLHS SR+SWDRE+NWIGY+AVTSD  
Sbjct  64    RNFFHKVMLDNPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAVTSDEQ  123

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeeddd-----KV  898
             +K LGRREIY+ FRGTT + EW+++  AK  SA+PLLR +TS  +D +          KV
Sbjct  124   TKTLGRREIYIAFRGTTRNYEWVDILGAKLKSAKPLLRGATSTTHDQESSSSSDDDDDKV  183

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
             PKVM GW T+Y S DPNS FT LSAR QL   I+ELR +YK ++LSI  TGHSLGASL+I
Sbjct  184   PKVMLGWLTMYISDDPNSPFTKLSARAQLLAHIKELRERYKDDDLSIIFTGHSLGASLSI  243

Query  717   LAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             L+AFDL ENG+TDIPV+A VFGSPQ+GNK F++   +  NLK+LHI+NKID+IP YPG L
Sbjct  244   LSAFDLVENGITDIPVSAFVFGSPQVGNKEFNERFNKYPNLKVLHIKNKIDVIPHYPGRL  303

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GYV +G+EF ID RKS SLK+S NPSDWHNLQAMLH+VAGWNGE+ EFELKVKR +ALV
Sbjct  304   MGYVYTGIEFEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEEQEFELKVKRSLALV  363

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             NKS EFLK+E  +PG WW+EKNK MV +E+GEWVL  P++EDLPVPE
Sbjct  364   NKSSEFLKDECLVPGIWWVEKNKGMVRNEDGEWVLAPPDEEDLPVPE  410



>ref|XP_006446810.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
 gb|ESR60050.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
Length=416

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/405 (68%), Positives = 322/405 (80%), Gaps = 7/405 (2%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS NW GLLDPL+LSLR L+LRCGDF QATYD+FN+D NSKY G+ RYGK  FF 
Sbjct  12    WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRGFFD  71

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KVML +A DYQV ++LY TA+++VPEAFL+HS SRESWDRESNWIGY+AVTSD  SKA+G
Sbjct  72    KVMLQNAPDYQVFSFLYGTARVSVPEAFLVHSLSRESWDRESNWIGYIAVTSDERSKAIG  131

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-------TSGdnddkeedddKVPKV  889
             RREIYV +RGTT + EWINV  A+  S   +L  S          D+    +DD+ VPKV
Sbjct  132   RREIYVAWRGTTRNYEWINVLGAQQASVGSILNKSKFRVEEKNDTDSSSDSDDDETVPKV  191

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             M GW T+YTS+DP S FT LSAR QL +KI+ELR +Y+GE LS+ LTGHSLGA L+IL+A
Sbjct  192   MQGWLTIYTSEDPKSSFTKLSARAQLVSKIQELRERYQGEELSVILTGHSLGACLSILSA  251

Query  708   FDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             FDL ENGVTDIPV A VFG PQ+GNK F++ +   TN+K+LH+RN ID+I  YPG LLGY
Sbjct  252   FDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVRNTIDLITHYPGRLLGY  311

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V +G E VID RKS SLK S+NPSDWHNLQAMLHVVAGWNG+DGEFELKVKR +ALVNKS
Sbjct  312   VNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDGEFELKVKRSLALVNKS  371

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             CEFLK+EL +PGSW +EKNK MV DE+GEWVL  P DEDLPVPE+
Sbjct  372   CEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPEF  416



>gb|KDO63393.1| hypothetical protein CISIN_1g014927mg [Citrus sinensis]
Length=416

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/405 (67%), Positives = 323/405 (80%), Gaps = 7/405 (2%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS NW GLLDPL+LSLR L+LRCGDF QATYD+FN+D NSKY G+ RYGK +FF 
Sbjct  12    WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KVML +A DYQV ++LY TA++++PEAFL+HS SRESWDRESNWIGY+AVTSD   KA+G
Sbjct  72    KVMLQNAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAVTSDERLKAIG  131

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-------TSGdnddkeedddKVPKV  889
             RREIYV +RGTT + EW+NV  A+  S   +L  S          D+    +DD+ VPKV
Sbjct  132   RREIYVAWRGTTRNYEWVNVLGAQQASVGSILNKSKFRVEEKNDTDSSSDCDDDETVPKV  191

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             M GW T+YTS+DPNS FT LSAR QL +KI+ELR +Y+GE LS+  TGHSLGASL+IL+A
Sbjct  192   MQGWLTIYTSEDPNSSFTKLSARAQLVSKIQELRERYQGEELSVIFTGHSLGASLSILSA  251

Query  708   FDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             FDL ENGVTDIPV A VFG PQ+GNK F++ +   TN+K+LH+RN ID+I  YPG LLGY
Sbjct  252   FDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVRNTIDLITHYPGRLLGY  311

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V +G E VID RKS SLK S+NPSDWHNLQAMLHVVAGWNG+DGEFELKVKR +ALVNKS
Sbjct  312   VNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDGEFELKVKRSLALVNKS  371

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             CEFLK+EL +PGSW +EKNK MV DE+GEWVL  P DEDLPVPE+
Sbjct  372   CEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPEF  416



>ref|XP_006468997.1| PREDICTED: phospholipase A1-IIdelta-like [Citrus sinensis]
Length=416

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/405 (67%), Positives = 323/405 (80%), Gaps = 7/405 (2%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLG+ NW GLLDPL+LSLR LILRCGDF QATYD+FN+D NSKY G+ RYGK +FF 
Sbjct  12    WPELLGNNNWNGLLDPLDLSLRKLILRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KVML +A DYQV ++LY TA++++PEAFL+HS SRESWDRESNWIGY+AVTSD   KA+G
Sbjct  72    KVMLQNAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAVTSDERLKAIG  131

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-------TSGdnddkeedddKVPKV  889
             RREIYV +RGTT + EW+NV  A+  S   +L  S          D+    +DD+ VPKV
Sbjct  132   RREIYVAWRGTTRNYEWVNVLGAQQASVGSILNKSKFRVEEKNDTDSSSDCDDDETVPKV  191

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             M GW T+YTS+DPNS FT LSAR QL +KI+ELR +Y+GE LS+  TGHSLGASL+IL+A
Sbjct  192   MQGWLTIYTSEDPNSSFTKLSARAQLVSKIQELRERYQGEELSVIFTGHSLGASLSILSA  251

Query  708   FDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             FDL ENGVTDIPV A VFG PQ+GNK F++ +   TN+K+LH+RN ID+I  YPG LLGY
Sbjct  252   FDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVRNTIDLITHYPGRLLGY  311

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V +G E VID RKS SLK S+NPSDWHNLQAMLHVVAGWNG+DGEFELKVKR +ALVNKS
Sbjct  312   VNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDGEFELKVKRSLALVNKS  371

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             CEFLK+EL +PGSW +EKNK MV DE+GEWVL  P DEDLPVPE+
Sbjct  372   CEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPEF  416



>emb|CDP15943.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/410 (67%), Positives = 329/410 (80%), Gaps = 6/410 (1%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             +  TEPTW +LLGS NWEGLLDPL+LSLR+LILRCGDFCQATYDSF +D+NSK+AGS RY
Sbjct  4     TAGTEPTWLELLGSNNWEGLLDPLDLSLRNLILRCGDFCQATYDSFVNDANSKFAGSSRY  63

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK SFF KVML +A DYQV  +LYATAQ+ VPEA LLH+RSRE+WDRESNWIGY+A T+D
Sbjct  64    GKKSFFQKVMLENASDYQVYCFLYATAQIGVPEAILLHTRSREAWDRESNWIGYIATTTD  123

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST------SGdnddkeedd  907
              VSK+LGRREIYV +RGT+ D EWI+VFSA+P SA+ L +  +      + ++D  E+++
Sbjct  124   EVSKSLGRREIYVAWRGTSRDYEWIDVFSARPESADQLFKPKSWDKKVEANEDDSDEDEE  183

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             +K  KVM+GW T+Y S+DP S FT  SAR+QL +K++ L  +YK E LSIT TGHSLGA+
Sbjct  184   EKATKVMYGWLTIYVSEDPKSSFTKTSARKQLLSKMKTLIEQYKDEKLSITFTGHSLGAA  243

Query  726   LAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             L+IL+AFDL ENGVTDIPV+AIVFGSPQ+GNK F+  + E  NLKILH++NKID+IP YP
Sbjct  244   LSILSAFDLVENGVTDIPVSAIVFGSPQVGNKAFNDRVLEFPNLKILHVKNKIDLIPLYP  303

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               LLGYV +G    ID RKS  LK+S NPSDWHNLQA+LHVV GWNG  GEFELKVKR +
Sbjct  304   SGLLGYVNTGTLLEIDTRKSPHLKDSKNPSDWHNLQAILHVVNGWNGSKGEFELKVKRSL  363

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             ALVNKS  FLKEE   P +WW+EKNK MV+DENG+W+L  P DEDLPVPE
Sbjct  364   ALVNKSSAFLKEEYLAPETWWVEKNKGMVIDENGDWILAPPADEDLPVPE  413



>gb|EYU41122.1| hypothetical protein MIMGU_mgv1a021036mg [Erythranthe guttata]
Length=418

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/411 (66%), Positives = 329/411 (80%), Gaps = 6/411 (1%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             +  +EPTW +LLGS NWE LLDPL+LSLR LILRCGDFCQATYD+FN+D NSK+ G+ RY
Sbjct  8     TRTSEPTWAELLGSNNWETLLDPLDLSLRRLILRCGDFCQATYDAFNNDVNSKFTGTSRY  67

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK SFF KVML SA +YQV  +LYATA++   EA  LHS SRESWDRESNWIGY+A TSD
Sbjct  68    GKKSFFDKVMLDSAANYQVHCFLYATAKVGTGEALFLHSLSRESWDRESNWIGYIATTSD  127

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR------SSTSGdnddkeedd  907
              +S++ GRREIYVV+RGTT + EW+NV  A+P SA+ LLR       +   ++ D ++DD
Sbjct  128   ELSRSSGRREIYVVWRGTTRNYEWVNVLGARPESAQELLRPKNWDKKTPDDNDSDDDDDD  187

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             + VP+VM GW T+Y S DPNS FT LSAR QL  KIE++R +YK E+LSITLTGHSLGAS
Sbjct  188   EGVPRVMNGWLTIYMSTDPNSSFTKLSARTQLLKKIEQIREQYKDESLSITLTGHSLGAS  247

Query  726   LAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             LAIL+AFDL ENGV +IPV+AIVFGSPQ+GNK F+  + +  NLK+LH+RNKID+IP YP
Sbjct  248   LAILSAFDLVENGVDNIPVSAIVFGSPQVGNKAFNDRVLDFANLKVLHVRNKIDLIPLYP  307

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               LLGY  +G+E V+D RKS SLK+S +P DWHNLQA+LHVVAGWNG+DGEFELKVKR +
Sbjct  308   SGLLGYRNTGIELVVDGRKSPSLKDSKSPGDWHNLQAILHVVAGWNGDDGEFELKVKRSL  367

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             ALVNKS   LK+E  IPGSWWIEKNK +VLDE+GEWVL  P+DED PVPE+
Sbjct  368   ALVNKSSAILKDEYLIPGSWWIEKNKGLVLDEDGEWVLAPPSDEDQPVPEF  418



>gb|EPS65211.1| hypothetical protein M569_09564 [Genlisea aurea]
Length=417

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/407 (67%), Positives = 317/407 (78%), Gaps = 6/407 (1%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             E +W +LLG  NW GLLDPLNL LR LILRCGDF QATYD+FN+D NS++AGS RYGK S
Sbjct  11    ESSWPELLGKNNWAGLLDPLNLDLRRLILRCGDFVQATYDAFNNDENSRFAGSSRYGKRS  70

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FF KVML  ADDY+V ++LYATA+L   +A  LHS SRESWDRESNWIGY+AVTSD+VS 
Sbjct  71    FFRKVMLEGADDYEVSSFLYATAKLGFTKALFLHSLSRESWDRESNWIGYIAVTSDSVSA  130

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS------TSGdnddkeedddKVP  895
             ALGRREIYV FRGTT + EWI+V  A+P SA+ L++ S       +  +   EEDD K  
Sbjct  131   ALGRREIYVAFRGTTRNYEWIDVLGARPESAKQLMKQSNWEKKKANAGDSSDEEDDGKTA  190

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             K+M GW T+Y S DP S FT LSAR QL  KI+ LR ++ GE+LSITLTGHSLGASLAI+
Sbjct  191   KIMKGWLTIYLSSDPKSEFTKLSARSQLLKKIQRLREQHAGESLSITLTGHSLGASLAIV  250

Query  714   AAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALL  535
             AAFDL ENGV DIPV AIVFGSPQ+GN  F + + +  NLKILH+RNKID+IP YPG +L
Sbjct  251   AAFDLVENGVADIPVAAIVFGSPQVGNGAFKRRVEKFPNLKILHVRNKIDVIPHYPGRVL  310

Query  534   GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             GY   G+EF ID+RKS SLK+S NPSDWHNLQAMLH VAGWNGE GEFELKVKR  ALVN
Sbjct  311   GYAPVGVEFQIDNRKSPSLKHSKNPSDWHNLQAMLHTVAGWNGEKGEFELKVKRSAALVN  370

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             KS   L +EL IPGSWWIEKNK M+LDENG+WVL  P DED+P PE+
Sbjct  371   KSAAILNDELLIPGSWWIEKNKGMILDENGDWVLSPPADEDMPTPEF  417



>ref|XP_004243279.1| PREDICTED: phospholipase A1-IIdelta [Solanum lycopersicum]
Length=469

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/403 (66%), Positives = 320/403 (79%), Gaps = 5/403 (1%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M  EPTWH+LLGS NWEGLL+PL+L+LR LILRCGDFCQATYD+FN+D  S Y GS RYG
Sbjct  1     MGKEPTWHELLGSNNWEGLLEPLHLNLRRLILRCGDFCQATYDAFNNDEYSMYCGSSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+S FHKVM  SA DYQ+ ++LYATA++   +A  LHS SRESWDRESNWIG++A+T+D 
Sbjct  61    KSSLFHKVMFKSASDYQIVSFLYATARVGAHKALFLHSLSRESWDRESNWIGFIAITNDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
             +S+ LGRREIY+ FRGTT + EW+NV  A+  SAEPL+ +  S        DD+  P+VM
Sbjct  121   ISEQLGRREIYIAFRGTTRNYEWVNVLGARSESAEPLICNGGS-----ICNDDENAPRVM  175

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW  +Y S DP S FT LS R QLQ  IE+LR +YK ENLSIT TGHSLGASL+ILAAF
Sbjct  176   NGWLKIYISSDPKSPFTRLSIRAQLQVMIEDLRDRYKKENLSITFTGHSLGASLSILAAF  235

Query  705   DLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             DL ENGVTDIPV+AIVFGSPQ+GN+ F+  + E  NLKILH++NKID+I  YP +LLGYV
Sbjct  236   DLVENGVTDIPVSAIVFGSPQVGNRAFNDKLKEFPNLKILHVKNKIDVITLYPSSLLGYV  295

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
              SG+E VID RKS  LK+S NPSDWHNLQAMLH++AGWNGE GEFE+KVKR +ALVNKS 
Sbjct  296   NSGIELVIDTRKSPCLKDSKNPSDWHNLQAMLHIIAGWNGEHGEFEMKVKRSLALVNKSS  355

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
               LK+E+ IPGSWW+EKNK +VLDE+GEW+L  P +ED+P+PE
Sbjct  356   SMLKDEILIPGSWWVEKNKGVVLDEDGEWILAPPLEEDIPIPE  398



>gb|EYU41119.1| hypothetical protein MIMGU_mgv1a025698mg [Erythranthe guttata]
Length=408

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/407 (66%), Positives = 325/407 (80%), Gaps = 5/407 (1%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
              EP+W +LLGS NWE LLDPL+LSLR LILRCGDFCQATYD+FN+D NSK+AGS RYGK+
Sbjct  2     AEPSWAELLGSNNWENLLDPLDLSLRRLILRCGDFCQATYDAFNNDQNSKFAGSSRYGKD  61

Query  1239  SFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             SFF KVML SA DY+VE +LYATA++ V +A  LHS SRESWDRESNWIGY+A TSD +S
Sbjct  62    SFFQKVMLDSAADYKVECFLYATAKVGVGKAMFLHSLSRESWDRESNWIGYIATTSDELS  121

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK-----VP  895
             ++ GRREIYVV+RGTT + EWI+V  A+P SA  LL+ ++   N+   ++D+      VP
Sbjct  122   RSSGRREIYVVWRGTTRNYEWIDVLGARPESAHELLQPTSDNYNNTPSDEDNDDDEHGVP  181

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             KVM GW T+Y S DPNS FT LSAR QL  KIE++  +YK E+LSITLTGHSLGASLAIL
Sbjct  182   KVMKGWLTIYVSTDPNSSFTKLSARTQLLKKIEQIIEQYKDESLSITLTGHSLGASLAIL  241

Query  714   AAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALL  535
             + FDL ENGV DIPV+AIVFGSPQIGN  F+K +    NLK+LH++NKID+IP YP AL 
Sbjct  242   SGFDLVENGVRDIPVSAIVFGSPQIGNHAFNKRLLRYPNLKVLHVKNKIDLIPRYPSALF  301

Query  534   GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             GY  +G+E  +D+RKS SLK+S NPSDWHNLQA+LHVVAGWNG DGEFELKVKR +ALVN
Sbjct  302   GYKDTGIELEVDNRKSPSLKDSKNPSDWHNLQAILHVVAGWNGADGEFELKVKRSLALVN  361

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             KS   LK+E  +PGSWW+EKN+ +VLDE+G+WVL   +DED PVPE+
Sbjct  362   KSSAILKDEYLVPGSWWVEKNRGLVLDEDGDWVLAPTSDEDHPVPEF  408



>ref|XP_011082995.1| PREDICTED: phospholipase A1-IIdelta [Sesamum indicum]
Length=402

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/407 (68%), Positives = 325/407 (80%), Gaps = 8/407 (2%)
 Frame = -1

Query  1425  MAT---EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSC  1255
             MAT   EPTW +LLGS+NWEGLLDPL+LSLR LILRCGDFCQATYD+FN+D NSKYAGS 
Sbjct  1     MATTVAEPTWGELLGSKNWEGLLDPLDLSLRRLILRCGDFCQATYDAFNNDENSKYAGSS  60

Query  1254  RYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
             RYGK SFF KVML SA DYQV+ +LYATA++ + EA  LHSRSRE+WDRESNWIGY++ T
Sbjct  61    RYGKKSFFSKVMLESASDYQVQCFLYATAKVGIIEAIFLHSRSREAWDRESNWIGYISTT  120

Query  1074  SDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVP  895
             +D VS+ALGRREIYV +RGTT D EWI+VF AKP SA+ LL+        D +ED++KVP
Sbjct  121   TDEVSRALGRREIYVAWRGTTRDYEWIDVFGAKPDSAKELLQPGGE----DDDEDEEKVP  176

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             KVM GW  LY S DPNS FT  SAR QLQ KI+EL   Y+ E+LSITLTGHSLG  LA L
Sbjct  177   KVMDGWLKLYVSSDPNSPFTKFSARNQLQKKIKELLKLYENESLSITLTGHSLGGCLATL  236

Query  714   AAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALL  535
             +AFDL ENGV +IPV+AIVFGSPQ+G+K+F++ M +  NLK+LH+RN+ID+IP YP   L
Sbjct  237   SAFDLVENGVNNIPVSAIVFGSPQVGDKVFNERMRQYPNLKVLHVRNRIDLIPLYPSEFL  296

Query  534   GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             GY  +G++  ID+RKS SLK+S NPSDWHNLQAMLHVVAGWNG   EFELKVKR +ALVN
Sbjct  297   GYKNTGIQLEIDNRKSPSLKDSKNPSDWHNLQAMLHVVAGWNGPHEEFELKVKRSLALVN  356

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             KS   LK+E  IPGSWW+EKNK +V DENGEW   +P DED PVPE+
Sbjct  357   KSSSILKDEYLIPGSWWVEKNKGLVRDENGEWTWPAP-DEDQPVPEF  402



>ref|XP_006350025.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=412

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/412 (66%), Positives = 327/412 (79%), Gaps = 8/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M  EPTWH+LLGS++W+GLL PLNL LR LILRCGDFCQATYD+FN+D NSKY G+ RYG
Sbjct  1     MEKEPTWHELLGSKDWDGLLQPLNLPLRRLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF+KVML S+ DY++  +LYATA++   EA  LHS SRESWDRESNWIGY+A+T+D 
Sbjct  61    KSSFFNKVMLESSTDYKIYCFLYATAKIGALEAIFLHSLSRESWDRESNWIGYIAITTDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLL--RSSTSGdnddkeedddKVP-  895
             VS+ LGRRE+YVVFRGT    EWINV  A+P SA+PLL  +S   G N+  +E +D+   
Sbjct  121   VSRKLGRREVYVVFRGTARSYEWINVLGARPDSADPLLHPKSLQKGVNNKNDEGEDEDED  180

Query  894   ----KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
                 KVM GW  +Y S +P S FT LSAREQLQ KI++LR++YK ENLSIT TGHSLGAS
Sbjct  181   EDEVKVMDGWLKIYVSSNPKSPFTRLSAREQLQAKIQKLRNEYKDENLSITFTGHSLGAS  240

Query  726   LAILAAFDLCENGV-TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             LA+LA+FD+ ENGV  DIPV+AIVFGSPQ+GNK F++ + +  NL ILH++NKID+IP Y
Sbjct  241   LAVLASFDVVENGVPADIPVSAIVFGSPQVGNKAFNERIKKFPNLNILHVKNKIDLIPLY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P AL GYV SG++ VID RKS SLK+S    DWHNLQ MLHVVAGWNGED +FELKVKR 
Sbjct  301   PSALFGYVNSGIDLVIDSRKSPSLKDSKVAGDWHNLQGMLHVVAGWNGEDKKFELKVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             VALVNKS   LK+E  IPGSWWIEKNK MV+D+NGEW+L  P++EDLPVPEY
Sbjct  361   VALVNKSSSLLKDEYLIPGSWWIEKNKGMVIDKNGEWILAPPSEEDLPVPEY  412



>ref|XP_004303191.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=453

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/413 (65%), Positives = 311/413 (75%), Gaps = 13/413 (3%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             P W  L+G  NW GLLDPL++ LR LILRCGDFCQ TYD+FN+D+NSKYAGS RYG  +F
Sbjct  41    PAWSALVGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYGHANF  100

Query  1233  FHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             F KVML  A +Y++ ++LYATAQ++VPEAFLLHS SRESWDRESNWIGYVAVT+D  SK+
Sbjct  101   FDKVMLQDAANYEIASFLYATAQVSVPEAFLLHSLSRESWDRESNWIGYVAVTTDQYSKS  160

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK---------  901
             +GRREIYV +RGTT + EW+NV  A+ VSAE LL+   +   +                 
Sbjct  161   IGRREIYVAWRGTTRNYEWVNVLGAELVSAEQLLKPENNNTVNKDLTQTGAEVSSSDEEE  220

Query  900   ----VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
                 +PKVM GW ++YTS D  S FT LSAR+QL TKI ELR KYKGE LSI LTGHSLG
Sbjct  221   EDDKIPKVMRGWLSMYTSDDSKSAFTKLSARDQLVTKINELREKYKGEKLSIALTGHSLG  280

Query  732   ASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             ASLA+++ FDL ENGVTDIPV A VFG PQ+GNK F   ++   NL+I+HI+N IDMIP 
Sbjct  281   ASLAVVSGFDLVENGVTDIPVAAFVFGCPQVGNKAFKTRISTHPNLRIMHIKNTIDMIPH  340

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YPG LLGY   G + VID RKS  LK+S +P DWHNLQAMLHVVAGWNGE+GEFELKVKR
Sbjct  341   YPGRLLGYRNIGTDVVIDTRKSPYLKDSKDPGDWHNLQAMLHVVAGWNGEEGEFELKVKR  400

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
              VALVNKSC+FLK E  +P  WW+EKNK MV DENGEWVL  P DEDLPVPEY
Sbjct  401   SVALVNKSCDFLKTECSVPALWWVEKNKGMVRDENGEWVLAPPADEDLPVPEY  453



>ref|XP_004251807.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum lycopersicum]
Length=410

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/410 (66%), Positives = 327/410 (80%), Gaps = 6/410 (1%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M  E TWH+LLGS++W+GLL PLNL LR LILRCGDFCQATYD+FN+D NSKY G+ RYG
Sbjct  1     MEKEATWHELLGSKDWDGLLQPLNLPLRRLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML S+ DY++  +LYATA++   EA  LHS SRESWDRESNWIGY+AVT+D 
Sbjct  61    KSSFFDKVMLESSTDYKIYCFLYATAKIGALEAIFLHSLSRESWDRESNWIGYIAVTTDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLL-----RSSTSGdnddkeedddK  901
             VS+ LGRRE+YVVFRGT+ + EW+NV  A+P SA+ LL     +   +  ND+ E++D+ 
Sbjct  121   VSRKLGRREVYVVFRGTSRNYEWVNVLGARPDSADSLLHPKSLQKGINNKNDEDEDEDED  180

Query  900   VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
               KVM GW  +Y S +P S FT LSAREQLQ KIE+LR++YK ENLSIT TGHSLGASLA
Sbjct  181   EIKVMDGWLKIYVSSNPKSSFTRLSAREQLQAKIEKLRNEYKDENLSITFTGHSLGASLA  240

Query  720   ILAAFDLCENGV-TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +LA+FD+ ENGV  DIPV+AIVFGSPQ+GNK F++ + + +NL ILH++NKID+I  YP 
Sbjct  241   VLASFDVVENGVPVDIPVSAIVFGSPQVGNKAFNERIKKFSNLNILHVKNKIDLITLYPS  300

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
             AL GYV SG+E VID RKS SLK+S +  DWHNLQ MLHVVAGWNGED +FELKVKR VA
Sbjct  301   ALFGYVNSGIELVIDSRKSPSLKDSKDMGDWHNLQGMLHVVAGWNGEDKKFELKVKRSVA  360

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             LVNKS  FLK++  IPGSWWIEKN+ MV D+NGEW+L  P+DEDLPVPEY
Sbjct  361   LVNKSSSFLKDDYLIPGSWWIEKNRGMVFDKNGEWILAPPSDEDLPVPEY  410



>ref|XP_007048713.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92870.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=420

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/412 (65%), Positives = 324/412 (79%), Gaps = 12/412 (3%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EP+W QLLGS+NW+ LL P+NLSLR  ILRCGDFCQATYD+FN+D NSK+ G+ RYGK +
Sbjct  8     EPSWQQLLGSKNWDSLLHPINLSLRKHILRCGDFCQATYDAFNNDQNSKFCGTSRYGKPT  67

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FF KVML SA DY+VE++LYATA++++PEAFLLHS+SRESWDRESNWIGY+A TSD  ++
Sbjct  68    FFDKVMLESASDYRVESFLYATARVSLPEAFLLHSKSRESWDRESNWIGYIATTSDERTE  127

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-----SSTSGdnddkeedddKV--  898
             ALGRREIYVV+RGTT D EW+NV  AK  SA+PLLR     SST+ + DD     D    
Sbjct  128   ALGRREIYVVWRGTTRDYEWVNVLGAKLESAKPLLRVNENTSSTNKEKDDTSSSSDSDDD  187

Query  897   ----PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGA  730
                 PKVM GW T+Y S DP S FT +SAR QL  KI+EL+ +YK ENLSI  TGHSLGA
Sbjct  188   SEKKPKVMLGWLTIYISDDPKSPFTKVSARTQLLGKIKELKERYKNENLSIVFTGHSLGA  247

Query  729   SLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             SL++++AFD+ ENGV  DIPV A VFG PQ+GNK FD+ M +  N+ +LHI+N ID+IP 
Sbjct  248   SLSVISAFDVAENGVADDIPVAAFVFGCPQVGNKAFDERMKKYPNVSVLHIKNSIDLIPH  307

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YP  LLGYV +G E VID RKS SLK+S NPSDWHNLQAMLH+VAGWNGE+GEF+LKVKR
Sbjct  308   YPSRLLGYVNTGTELVIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEEGEFKLKVKR  367

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
              +ALVNKSC FLK+E  +P SWW+EKNK +V +E+GEWV+    DED+P+PE
Sbjct  368   SLALVNKSCAFLKDECLVPESWWVEKNKGLVRNEDGEWVMAPQTDEDMPIPE  419



>gb|KDP47123.1| hypothetical protein JCGZ_22119 [Jatropha curcas]
Length=416

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 321/404 (79%), Gaps = 8/404 (2%)
 Frame = -1

Query  1401  QLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFHKV  1222
             ++LGS +W+ LL+PL+L LR LILRCGDFCQATYD+FN+D NS Y G+ RYGKNSFFHKV
Sbjct  13    EILGSNDWKNLLEPLDLDLRKLILRCGDFCQATYDAFNNDQNSPYCGTSRYGKNSFFHKV  72

Query  1221  MLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALGRR  1042
             ML  A++Y V ++LY TA++++PEAFLLHS+SRESWDRESNWIGY+AVTSD  +K +GRR
Sbjct  73    MLEDAENYTVSSFLYGTARVSLPEAFLLHSQSRESWDRESNWIGYIAVTSDEYTKVIGRR  132

Query  1041  EIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTS--------GdnddkeedddKVPKVM  886
             EIY+ FRGTT + EW+++  AK  SA+PLL+ S++          + D E D +K PKVM
Sbjct  133   EIYIAFRGTTRNYEWVDILGAKLTSAKPLLKGSSNEFKENNNSSSDSDSEGDHEKFPKVM  192

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW T+YTS D  S FT +SAR+QL TKI ELR KYK E+LSI  TGHSLGASL+ILAAF
Sbjct  193   LGWITIYTSDDSRSPFTKISARDQLLTKITELREKYKDEDLSIIFTGHSLGASLSILAAF  252

Query  705   DLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             D+ ENG+TDIPV A VFGSPQ+GNK F++   +  NLK+LHIRNKID+IP YPG L+GY 
Sbjct  253   DIVENGITDIPVAAFVFGSPQVGNKAFNERFKKYGNLKVLHIRNKIDVIPHYPGRLMGYQ  312

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
              +G E  ID RKS SLK+S NPSDWHNLQAMLH+VAGWNGED  F+L+VKR +ALVNKSC
Sbjct  313   YTGTELEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEDKAFKLQVKRSLALVNKSC  372

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             EFLK+E  +PGSWWIEKNK MV  E+GEW L  P++ED PVPEY
Sbjct  373   EFLKDECMVPGSWWIEKNKGMVRGEDGEWALVPPDEEDKPVPEY  416



>ref|XP_009766306.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana sylvestris]
Length=470

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/470 (60%), Positives = 327/470 (70%), Gaps = 66/470 (14%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             M TE TWH+LLGS NWEGLL+PLNL+LR LILRCGDFCQATYD+FN+D NSKY G+ RYG
Sbjct  1     METETTWHELLGSNNWEGLLEPLNLNLRQLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K SFF KVML SA +Y++  +LYATA+++   A  LHS SRE+WDRESNWIGY+AVT+D 
Sbjct  61    KKSFFQKVMLESASNYKISGFLYATARISALGAIFLHSLSREAWDRESNWIGYIAVTTDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST------SGdnddkeeddd  904
             VS+ LGRREIYV FRGTT + EWINV  A+P SA+ LLR  +      +GDN      DD
Sbjct  121   VSQELGRREIYVAFRGTTRNYEWINVLGARPESADSLLRPKSLQKIGVNGDNSKSSNGDD  180

Query  903   KV---------------PKVMFGWHTLYTS------------------------------  859
              V               PKV  GW  ++ S                              
Sbjct  181   GVSGDNSKNSKDDDENEPKVEDGWFKIFASSLCKPLLRPKSLQKSGVNGDNSKSSSDDDE  240

Query  858   ---------------KDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
                             +PNS FT LSAREQLQ KIEELR +YK ENLSIT TGHSLGASL
Sbjct  241   NEPKVMDGWLKIYVSSNPNSPFTKLSAREQLQAKIEELRQQYKDENLSITFTGHSLGASL  300

Query  723   AILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             A LAAFD+ ENGVTDIPV+AIVFGSPQ+GNK F++ + E +NL ILH++NKID+I  YP 
Sbjct  301   ATLAAFDVVENGVTDIPVSAIVFGSPQVGNKAFNEKIKEYSNLNILHVKNKIDLITLYPS  360

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
             ALLGY  +G E VID RKS SLK+S +  DWHNLQ MLHVVAGWNGED EFELKVKR VA
Sbjct  361   ALLGYANTGTELVIDSRKSPSLKDSRDTGDWHNLQGMLHVVAGWNGEDKEFELKVKRSVA  420

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             LVNKS  FLK+E  IPGSWW+EKN+SMVLDENGEW+L  P+DEDLPVPEY
Sbjct  421   LVNKSSSFLKDEYLIPGSWWVEKNRSMVLDENGEWILAPPSDEDLPVPEY  470



>emb|CDO98286.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/413 (66%), Positives = 318/413 (77%), Gaps = 8/413 (2%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S   EP W +LLGS  WEGLLDPL+ SLR LILRCGDFCQATYD+FN+D NSK+ GS RY
Sbjct  5     STGGEPAWPELLGSNGWEGLLDPLDDSLRGLILRCGDFCQATYDAFNNDQNSKFCGSSRY  64

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK SFF KVML S  +YQV  ++YATAQ+   +A  L S SRESWDRESNWIGY+AVT+D
Sbjct  65    GKKSFFEKVMLESGSNYQVIGFIYATAQIGAHKAIFLRSLSRESWDRESNWIGYIAVTTD  124

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR--------SSTSGdnddkee  913
               S+A+GRRE+Y+ FRGTT + EWI+V  A   SAEPLLR          +   +D   +
Sbjct  125   EYSQAIGRREVYIAFRGTTRNYEWIDVLGAGLKSAEPLLRPKAWKKREDGSVSTSDSDGD  184

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
             D++K+PKVM GW  +Y S DP S FT LSAREQL  KIEELR+ Y+GE+LSIT TGHSLG
Sbjct  185   DEEKMPKVMQGWLKIYVSSDPKSPFTYLSAREQLLAKIEELRNLYEGEDLSITFTGHSLG  244

Query  732   ASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             ASL+ILAAFDL ENG+ DIPV AIVFGSPQ+GNK F+  + +  NLK+LH+RNKID+IP 
Sbjct  245   ASLSILAAFDLVENGLHDIPVAAIVFGSPQVGNKTFNNRLKQFPNLKVLHVRNKIDLIPH  304

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YP  LLGY  SG+E VID RKS  LK+S NPSDWHNLQAMLHVVAGWN   G+FELKVKR
Sbjct  305   YPSHLLGYHNSGIELVIDTRKSPFLKDSKNPSDWHNLQAMLHVVAGWNAAHGDFELKVKR  364

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
              +ALVNKSC FLK+E  +P SWWIEKNK MVLDENG W++ +P DEDLPVPE+
Sbjct  365   SLALVNKSCGFLKDECLVPESWWIEKNKGMVLDENGGWIVATPADEDLPVPEH  417



>ref|XP_010052794.1| PREDICTED: phospholipase A1-IIdelta [Eucalyptus grandis]
 gb|KCW89651.1| hypothetical protein EUGRSUZ_A01923 [Eucalyptus grandis]
Length=452

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/415 (65%), Positives = 319/415 (77%), Gaps = 14/415 (3%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             E TW +LLGS +WEGLL+PL++ LR LILRCGDF QATYD+F +D NSKY G  RYGK  
Sbjct  38    ESTWAELLGSGDWEGLLEPLDIGLRRLILRCGDFIQATYDTFINDENSKYCGCSRYGKAD  97

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FF KVM+ +  DY+V A+LY TA+++  E FL HS+SRE+WDRESNWIGY+AVT+D VS 
Sbjct  98    FFQKVMMENGSDYEVVAFLYGTARVSSKEYFLFHSQSREAWDRESNWIGYIAVTTDEVSA  157

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeeddd---------  904
              LGRREIY+ +RGTT + EWIN+  AK  S E LL ++  G+++  EE+           
Sbjct  158   QLGRREIYIAWRGTTRNYEWINILGAKRKSIESLLSTNGGGEHEPGEEEARNDSSSSDDD  217

Query  903   -----KVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHS  739
                  KVPKVM GW+T+YT+ DP S FT LSAR QL TKI ELR KYKGE+LSITLTGHS
Sbjct  218   DRDDEKVPKVMLGWYTIYTTDDPKSPFTKLSARTQLLTKINELREKYKGEDLSITLTGHS  277

Query  738   LGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
             LGASL+IL+ FD+ ENGV DIPV+A VFGSPQ+GNK F +      NLK LHIRN ID+I
Sbjct  278   LGASLSILSGFDIVENGVRDIPVSAFVFGSPQVGNKAFAERCKSYPNLKFLHIRNTIDLI  337

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P YP  LLGYV SG+E  ID RKS +LK+S NPSDWHNLQAMLH+VAGWNGEDGEFELKV
Sbjct  338   PHYPSKLLGYVYSGVELEIDTRKSPNLKDSKNPSDWHNLQAMLHIVAGWNGEDGEFELKV  397

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             KR +ALVNKSC+FLK E  +P SWW+EKNK MVLDE+GEWV+GS  DEDLPVPE+
Sbjct  398   KRSLALVNKSCDFLKPECLVPPSWWVEKNKGMVLDEDGEWVMGSLADEDLPVPEF  452



>ref|XP_007217233.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
 gb|EMJ18432.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
Length=455

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/429 (64%), Positives = 319/429 (74%), Gaps = 24/429 (6%)
 Frame = -1

Query  1428  SMATEPT---WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGS  1258
             SMAT  T   W +LLG+ NW GLLDPL+L+LR LILRCGDFCQATYD+FN+D NSKY GS
Sbjct  27    SMATSETQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGS  86

Query  1257  CRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAV  1078
              RYGK SFF KV+L  A  YQV  +LYATA+++VPEA LLHS+SRESWDRESNWIGY+AV
Sbjct  87    SRYGKASFFDKVVLQDASSYQVSCFLYATAEVSVPEALLLHSQSRESWDRESNWIGYIAV  146

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedd---  907
             T+DAVSKA+GRREIYV +RGT  + EW+NV  A   SA  LLRS  S  +   ++ D   
Sbjct  147   TTDAVSKAIGRREIYVAWRGTIRNYEWVNVLGADLDSAAALLRSHESNPSLTNDQTDGGH  206

Query  906   ----------------dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYK  775
                             +KVPKVM GW ++YTS D  S FT LSAR+QL TKI+ELR KYK
Sbjct  207   GSNSSSSSDDGKGEDDEKVPKVMRGWLSMYTSSDSKSPFTKLSARDQLLTKIKELRQKYK  266

Query  774   GENLSITLTGHSLGASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTN  598
              E  SIT+TGHSLGASL+IL+AFDL ENGV  DIPV A VFG P++GNK     +    N
Sbjct  267   DEKQSITITGHSLGASLSILSAFDLVENGVADDIPVAAFVFGCPEVGNKALKNRIQSYPN  326

Query  597   LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVA  418
             LKILH RN ID+IP YPG LLGY   G E VID RKS  LK S NPSDWHNLQ MLHVVA
Sbjct  327   LKILHTRNTIDLIPHYPGRLLGYRDIGTELVIDTRKSKFLKESNNPSDWHNLQGMLHVVA  386

Query  417   GWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDE-NGEWVLGSPN  241
             GWNG++GEFEL+VKR VALVNKS +FLK E ++P SWW+EKNK +VLDE +GEW+L  P+
Sbjct  387   GWNGKEGEFELRVKRSVALVNKSSDFLKTEFYVPASWWVEKNKGVVLDESSGEWLLAPPS  446

Query  240   DEDLPVPEY  214
             DEDLPVPE+
Sbjct  447   DEDLPVPEF  455



>ref|XP_008228927.1| PREDICTED: phospholipase A1-IIdelta [Prunus mume]
Length=455

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/421 (66%), Positives = 319/421 (76%), Gaps = 19/421 (5%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             T+  W +LLG+ NW GLLDPL+L+LR LILRCGDFCQATYD+FN+D NSKY GS RYGK 
Sbjct  35    TQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGSSRYGKA  94

Query  1239  SFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             SFF KV+L  A  YQV  +LYATAQ++VPEA LLHS+SRESWDRESNWIGY+AVT+DAVS
Sbjct  95    SFFDKVVLQDASSYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDAVS  154

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRS-----------------STSGd  931
             KA+GRREIYV +RGT  + EWINV  A   SA  LLRS                  +S  
Sbjct  155   KAIGRREIYVAWRGTIRNYEWINVLGADLDSAAVLLRSHESNPSLTNDQTDGGHGGSSNS  214

Query  930   nddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITL  751
             +D K+EDD+K PKVM GW ++YTS DP S FT LSAR+QL TKI+ELR KYK E  SIT+
Sbjct  215   DDGKDEDDEKDPKVMRGWLSMYTSSDPKSPFTKLSARDQLLTKIKELRQKYKDEKQSITI  274

Query  750   TGHSLGASLAILAAFDLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRN  574
             TGHSLGASL+IL+AFDL EN V D IPV A VFG PQ+GNK     +    NLKILH +N
Sbjct  275   TGHSLGASLSILSAFDLVENEVADDIPVAAFVFGCPQVGNKALKIRIQSYPNLKILHTKN  334

Query  573   KIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE  394
              ID+IP YPG LLGY   G E VID RKS  LK S NPSDWHNLQ ML+VVAGWNG++GE
Sbjct  335   TIDLIPHYPGHLLGYRDIGTELVIDTRKSKFLKESDNPSDWHNLQGMLNVVAGWNGKEGE  394

Query  393   FELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDE-NGEWVLGSPNDEDLPVPE  217
             FEL+VKR VALVNKS +FLK E ++P SWW+EKNK MVLDE +GEWVL  P+DEDLPVPE
Sbjct  395   FELRVKRSVALVNKSSDFLKTEFYVPASWWVEKNKGMVLDESSGEWVLAPPSDEDLPVPE  454

Query  216   Y  214
             +
Sbjct  455   F  455



>ref|XP_010276983.1| PREDICTED: phospholipase A1-IIdelta [Nelumbo nucifera]
Length=428

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/423 (63%), Positives = 317/423 (75%), Gaps = 23/423 (5%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EPTW +LLGS+ WEGLLDPLNLSLR LILRCGD CQATYD+FN D  SKY GS RYGK S
Sbjct  7     EPTWAELLGSKQWEGLLDPLNLSLRRLILRCGDLCQATYDAFNSDPRSKYCGSSRYGKRS  66

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FF KV    A DY+V A+LYAT+++ VP+AFLLHS SRE+WDRESNWIGY+AVTSD VSK
Sbjct  67    FFEKVKFQPASDYEVAAFLYATSRVDVPQAFLLHSLSREAWDRESNWIGYIAVTSDHVSK  126

Query  1056  -ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddke------------  916
               LGRREIYV +RGTT + EWI+V  AKP S + LL S T      +             
Sbjct  127   KVLGRREIYVAWRGTTRNYEWIDVADAKPKSIKSLLNSQTQDHTQQQSHWYDLILDRVHD  186

Query  915   ---------edddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENL  763
                      E++D+ PKVM GW T+YTS DP S FT LSAR Q  TK++EL  +YK E L
Sbjct  187   NGSGDSSDEEEEDRTPKVMKGWFTIYTSNDPKSPFTKLSARAQFVTKMKELVEQYKDEEL  246

Query  762   SITLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILH  583
             S+TLTGHSLGA LAIL+AFD+ ENG++ IPV AIVFG PQ+GNK FD+ + + +NL+ILH
Sbjct  247   SLTLTGHSLGACLAILSAFDVVENGLS-IPVAAIVFGCPQVGNKAFDQRIKKFSNLRILH  305

Query  582   IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGE  403
             ++N ID+IP YP   LGY  +G E VID RKS SLK+S NPSDWHNLQAMLHVVAGWNG 
Sbjct  306   VKNAIDLIPHYPSRALGYHYTGTELVIDTRKSPSLKDSKNPSDWHNLQAMLHVVAGWNGA  365

Query  402   DGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPV  223
             D EFELKVKR +ALVNKSC++LKEEL +P SWW+EKNK MVL++N EW L  P ++D+PV
Sbjct  366   DKEFELKVKRTIALVNKSCDYLKEELLVPPSWWVEKNKGMVLNQNEEWELTPPFEDDIPV  425

Query  222   PEY  214
             PE+
Sbjct  426   PEF  428



>ref|XP_007048712.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92869.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=411

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/409 (65%), Positives = 318/409 (78%), Gaps = 6/409 (1%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             + A EP+W +L+GS +WE LLDPLNLSLR L+LRCGDFCQATYDSF +D NSKY G+ RY
Sbjct  3     TTAQEPSWEELIGSNDWESLLDPLNLSLRKLLLRCGDFCQATYDSFVNDQNSKYCGTSRY  62

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK++ F KVML SA DY +  +LYATA+++VPE+ LLHS SRESWDRESNWIGY+AVTSD
Sbjct  63    GKSTLFEKVMLDSASDYVITNFLYATARVSVPESLLLHSHSRESWDRESNWIGYIAVTSD  122

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-----SSTSGdnddkeeddd  904
               SKALGRREIYVV+RGTT D EW+NVF  KP SAE LL      S  +       ++  
Sbjct  123   ERSKALGRREIYVVWRGTTRDYEWVNVFKGKPESAECLLNDKFGDSEQNKQGKSSNDESQ  182

Query  903   KVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
             + P VMFGW TLYTS DP S FT LSAR+QL  KI +LR +YK EN +I  TGHSLGASL
Sbjct  183   QTPNVMFGWLTLYTSDDPKSPFTKLSARKQLLGKIMKLREQYKDENPTIVFTGHSLGASL  242

Query  723   AILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             A+L+AFD  EN + DIPVTA VFG PQ+G+K F++ +    NLKILH +N ID+IP YPG
Sbjct  243   AVLSAFDTVENCIHDIPVTAFVFGCPQVGDKAFNERLKRHLNLKILHTKNTIDVIPRYPG  302

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
              LLGYV +G E +ID RKS SLK+S N  DWHNLQAMLH+VAGWNG+DGEFELKVKR +A
Sbjct  303   ELLGYVNTGTELIIDTRKSPSLKDSKNNGDWHNLQAMLHIVAGWNGKDGEFELKVKRSLA  362

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             LVNKSC FLK+EL +PGSWW+EKNK ++  E+GEW++ +P+DEDL VPE
Sbjct  363   LVNKSCAFLKDELLVPGSWWVEKNKGLIKTEDGEWIM-APSDEDLLVPE  410



>ref|XP_008343100.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/405 (65%), Positives = 315/405 (78%), Gaps = 6/405 (1%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
              W +LLGS NW+GLLDPL+L+LR  ILRCG+FCQATYD+FN+D NSKY GS RYGK+SFF
Sbjct  13    AWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFF  72

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              KVML  A +YQV  +LYATAQ++VPEA LLHS+SRESWDRESNWIGY+AVT+D VSKA+
Sbjct  73    DKVMLQDAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDEVSKAI  132

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdndd-----keedddKVPKVM  886
             GRREIYV +RGT  + EWIN   A+  S E +L SS +  + +      +ED+++VPK M
Sbjct  133   GRREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXDKDDDEDEEEVPKAM  192

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW T+Y S DP S FT  SAR QL TKI ELR+KYK E LSIT+TGHSLGASL++L+AF
Sbjct  193   RGWLTMYISNDPKSPFTKTSARVQLVTKINELRNKYKDEKLSITMTGHSLGASLSVLSAF  252

Query  705   DLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             DL ENGV+DIP+   VFG P IGNK   + +    NLKILHI+N ID+IP YP  ++GY 
Sbjct  253   DLAENGVSDIPIAVFVFGCPHIGNKALKRRIERHPNLKILHIKNTIDVIPHYPVHVMGYR  312

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
             K G E +ID RKS  LK S NP DWHNL+ MLHVVAGWNGE+G+FEL+VKR VALVNKS 
Sbjct  313   KVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGDFELRVKRSVALVNKSS  372

Query  345   EFLKEELFIPGSWWIEKNKSMVLDEN-GEWVLGSPNDEDLPVPEY  214
             +FLKEE  +P  WW+EKN+ MVLDE+ GEWVL SP+DEDLPVPE+
Sbjct  373   DFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPEF  417



>ref|XP_007132834.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132835.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132836.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04828.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04829.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04830.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
Length=414

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/413 (62%), Positives = 313/413 (76%), Gaps = 9/413 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MA++PTW +LLG  NW GLLDPL+ +LR LILRCGDF QATYD+FN+D NS + GS RYG
Sbjct  1     MASQPTWAELLGHNNWAGLLDPLHPALRSLILRCGDFIQATYDAFNNDKNSPFCGSSRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K SFF KVML +AD Y V A+LYATA+++VPEAFLLHS SRE+WDRESNWIGYVAVTS+ 
Sbjct  61    KTSFFRKVMLDNADHYDVTAFLYATARVSVPEAFLLHSLSREAWDRESNWIGYVAVTSER  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkee---------  913
              SK LGRREIYVV+RGTT D+EWINVF A   SA  LL + +  +   +++         
Sbjct  121   RSKELGRREIYVVWRGTTRDMEWINVFGAGQESASVLLNAESVKELKARKKDGSSSSDDD  180

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
             ++   PKVM GW T+YTS DP S FT  SAR Q+ + ++ L  +YK EN S+ + GHSLG
Sbjct  181   ENSGTPKVMLGWLTIYTSDDPKSPFTKSSARTQVVSHVKSLVERYKSENPSVVIMGHSLG  240

Query  732   ASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             A+L+I++ FDL ENGVTDIPVTAIVFGSPQ+GN+ F+  +    NL +LH+ N ID+IP 
Sbjct  241   ATLSIVSGFDLVENGVTDIPVTAIVFGSPQVGNRAFNNRLKRLGNLNVLHVTNVIDLIPH  300

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YPG LLGY  +G+E VID RKS SLK S NPSDWHNLQAMLHVVAGWNG    FELKVKR
Sbjct  301   YPGKLLGYEHTGVELVIDTRKSPSLKESKNPSDWHNLQAMLHVVAGWNGAREGFELKVKR  360

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
              +ALVNKSC FLK+E  +P SWW+EKNK MV  E+GEWV  +P++ED PVPE+
Sbjct  361   SLALVNKSCSFLKDECGVPESWWVEKNKGMVKREDGEWVSNAPDEEDRPVPEH  413



>ref|XP_008353849.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/405 (65%), Positives = 314/405 (78%), Gaps = 6/405 (1%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
              W +LLGS NW+GLLDPL+L+LR  ILRCG+FCQATYD+FN+D NSKY GS RYGK+SFF
Sbjct  13    AWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFF  72

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              KVML  A +YQV  +LYATAQ++VPEA LLHS+SRESWDRESNWIGY+AVT+D VSKA+
Sbjct  73    DKVMLQDAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDEVSKAI  132

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdndd-----keedddKVPKVM  886
             GRREIYV +RGT  + EWIN   A+  S E +L SS +  + +      +ED+++VPK M
Sbjct  133   GRREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXDKDDDEDEEEVPKAM  192

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW T+Y S DP S FT  SAR QL TKI ELR+KYK E LSIT+TGHSLGASL++L+AF
Sbjct  193   RGWLTMYISNDPKSPFTKTSARVQLVTKINELRNKYKDEKLSITMTGHSLGASLSVLSAF  252

Query  705   DLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             DL ENGV+DIP+   VFG P IGNK   + +    NLKILHI+N ID IP YP  ++GY 
Sbjct  253   DLAENGVSDIPIAVFVFGCPHIGNKALKRRIERHPNLKILHIKNTIDXIPHYPVHVMGYR  312

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
             K G E +ID RKS  LK S NP DWHNL+ MLHVVAGWNGE+G+FEL+VKR VALVNKS 
Sbjct  313   KVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGDFELRVKRSVALVNKSS  372

Query  345   EFLKEELFIPGSWWIEKNKSMVLDEN-GEWVLGSPNDEDLPVPEY  214
             +FLKEE  +P  WW+EKN+ MVLDE+ GEWVL SP+DEDLPVPE+
Sbjct  373   DFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPEF  417



>ref|XP_003607601.1| Feruloyl esterase A [Medicago truncatula]
 gb|AES89798.1| phospholipase A1 [Medicago truncatula]
Length=442

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/423 (63%), Positives = 318/423 (75%), Gaps = 20/423 (5%)
 Frame = -1

Query  1428  SMATEPT------WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKY  1267
             S +T+PT      W+QLLG+ NWE LL+PL+L+LR+LILRCGDF Q TYDSFN+D NS Y
Sbjct  19    SSSTQPTTINQETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQNSIY  78

Query  1266  AGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGY  1087
              GS RYGK SFF+KVML +   Y V ++LYATA+++VPEAF+LHS SRESWDRESNWIGY
Sbjct  79    CGSSRYGKTSFFNKVMLENPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRESNWIGY  138

Query  1086  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-----------  940
             +AV+SD  S+ LGRREIYVV+RGTT DLEWINVF A P SA  LL + +           
Sbjct  139   IAVSSDERSRELGRREIYVVWRGTTRDLEWINVFGAAPESASGLLSAKSLREFNLPNNNN  198

Query  939   --SGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGEN  766
                G +   +EDD  VPK+M GW T+YTS DP S FT  S R Q+   ++ L +KYK EN
Sbjct  199   KDDGSSSSDDEDDKSVPKIMKGWLTIYTSDDPKSPFTKTSVRTQVLNIVKSLLNKYKNEN  258

Query  765   LSITLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKIL  586
              S+ L GHSLGASL+I++AFDL ENGVTDIPVTA VFGSPQ+GNK F+    +  NLK+L
Sbjct  259   PSVVLVGHSLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNDRFKKFQNLKVL  318

Query  585   HIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG  406
             H+RN ID+IP YPG LLGY  +G E VID RKSTSLK+S NPSDWHNLQAMLH+VAGWNG
Sbjct  319   HVRNVIDLIPHYPGKLLGYEYTGTELVIDTRKSTSLKDSKNPSDWHNLQAMLHIVAGWNG  378

Query  405   EDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
              DGEFE+KVKR +ALVNKSC++LKEE  +P SWW+  NK MV  E+ EWV  +P  EDLP
Sbjct  379   SDGEFEVKVKRSLALVNKSCDYLKEECHVPASWWVATNKGMVRREDEEWV-DAPEKEDLP  437

Query  225   VPE  217
             VPE
Sbjct  438   VPE  440



>ref|XP_004505480.1| PREDICTED: phospholipase A1-IIdelta-like [Cicer arietinum]
Length=480

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/415 (63%), Positives = 312/415 (75%), Gaps = 14/415 (3%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
              TEPTW+QLLG+ NWEGLL+P N+ LR+LILRCGDF Q TYD+FN+D NS Y GS RYGK
Sbjct  65    TTEPTWNQLLGTNNWEGLLNPPNIHLRNLILRCGDFIQTTYDAFNNDQNSIYCGSSRYGK  124

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             +SFFHKVML +   Y V  +LYATA+++VPEAF+L SRSRESWDRESNWIGY+AV+SD  
Sbjct  125   SSFFHKVMLENPTHYTVVTFLYATARVSVPEAFILRSRSRESWDRESNWIGYIAVSSDER  184

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-------------SGdndd  922
             +K LGRREIYVV+RGTT D EWINVF A P SA  LL + T             S  +  
Sbjct  185   TKELGRREIYVVWRGTTRDYEWINVFGAAPESASGLLSAKTLSEFNLSNNKNGDSSSSSS  244

Query  921   keedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGH  742
              +EDD+ +PKVM GW T+YTS DP S FT  S R Q+   I+ L + YK EN S+ L GH
Sbjct  245   DDEDDNNMPKVMKGWLTIYTSDDPKSPFTKTSVRTQVLNSIKSLVTLYKDENPSVVLVGH  304

Query  741   SLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDM  562
             SLGASL+I++AFDL ENGVTDIPVTA VFGSPQ+GNK F++   +  NLK+LH+RN ID+
Sbjct  305   SLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNERFKKFQNLKVLHVRNVIDL  364

Query  561   IPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELK  382
             IP YPG LLGY  +G+E  ID RKS SLK+S  P DWHNLQAMLH+VAGWNG  G FE+K
Sbjct  365   IPHYPGKLLGYEYTGVELEIDTRKSPSLKDSKTPGDWHNLQAMLHIVAGWNGSGGVFEMK  424

Query  381   VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             VKR +ALVNKSC+FLKEE  +PGSWW+EKNK  V  E+GEWV   P +EDLP PE
Sbjct  425   VKRSLALVNKSCDFLKEECHVPGSWWVEKNKGFVRREDGEWV-DQPAEEDLPAPE  478



>ref|XP_008348571.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=442

 Score =   526 bits (1356),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 276/422 (65%), Positives = 324/422 (77%), Gaps = 17/422 (4%)
 Frame = -1

Query  1428  SMATE-----PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYA  1264
             +MAT+       W QLLGS NW+GLLDPL+L+L  LILRCGDFCQATYD+FN+D NSKY 
Sbjct  21    TMATDQAVDHSAWAQLLGSNNWDGLLDPLDLNLLTLILRCGDFCQATYDAFNNDQNSKYC  80

Query  1263  GSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYV  1084
             GS RYGK+SFF KVML  A +YQV  +LYATAQ++VPEA LLHS SRESWDRESNWIGY+
Sbjct  81    GSSRYGKHSFFDKVMLQDAANYQVSCFLYATAQVSVPEALLLHSLSRESWDRESNWIGYI  140

Query  1083  AVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddk-----  919
             AVTSD VS+A+GRREIYV +RGTTT+ EW+NV  A+  SA  LLR   +   D       
Sbjct  141   AVTSDQVSQAIGRREIYVAWRGTTTNYEWVNVLGAELESAASLLRPDPTSAKDQTDGGRS  200

Query  918   ------eedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSI  757
                   ++D++KVPKVM GW ++YTS  P S FT LSAR+Q++ KI +LR KYK ENLS 
Sbjct  201   STSSSDDDDNEKVPKVMRGWLSMYTSDXPKSPFTKLSARDQIRAKINDLRKKYKNENLSJ  260

Query  756   TLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIR  577
             ++TGHSLGASLAIL+AFDL ENGV+DIPV A VFGSPQ+GNK F   + +  NLKILH R
Sbjct  261   SVTGHSLGASLAILSAFDLVENGVSDIPVAAFVFGSPQVGNKAFKARIEKYPNLKILHTR  320

Query  576   NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDG  397
             N ID+IP YP  LLGYV  G E VID RKS  LK S +  DWHNLQ MLHVVAGWNGE+G
Sbjct  321   NTIDLIPLYPSPLLGYVDVGTELVIDSRKSPFLKESKDAGDWHNLQGMLHVVAGWNGEEG  380

Query  396   EFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDE-NGEWVLGSPNDEDLPVP  220
             EF+L+VKR VALVNKS  FLK+E F+P SWW+EKNK MVLDE +GEWVL  P+DEDLPVP
Sbjct  381   EFKLRVKRSVALVNKSSNFLKKECFVPASWWVEKNKGMVLDESSGEWVLAPPSDEDLPVP  440

Query  219   EY  214
             E+
Sbjct  441   EF  442



>ref|XP_002518706.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF43631.1| triacylglycerol lipase, putative [Ricinus communis]
Length=417

 Score =   521 bits (1343),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 258/410 (63%), Positives = 317/410 (77%), Gaps = 9/410 (2%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             + TW +LLG  NWE LLDPL+L+LR LILRCGD CQATYDSFN+D NSKY G+ RYGK++
Sbjct  8     QATWSELLGQNNWENLLDPLDLNLRKLILRCGDLCQATYDSFNNDQNSKYCGASRYGKHN  67

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FF KVM   A++YQV ++LY TA++++PEAF+LHS+SRESWDRESNWIGY+AVT+D  SK
Sbjct  68    FFQKVMFEEAENYQVSSFLYGTARVSLPEAFILHSQSRESWDRESNWIGYIAVTTDEYSK  127

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST---------SGdnddkeeddd  904
             A GRR+IY+  RGTT + EW+N+  AK  SA  LL+ S+         S  + D ++D++
Sbjct  128   ATGRRDIYIALRGTTRNYEWVNILGAKLQSANHLLQGSSNNLDQEMKNSASSSDSDDDNE  187

Query  903   KVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
             KVPKVM GW T+Y S DP S FT LS R+QL +K+ EL  +YK +NLSI LTGHSLGASL
Sbjct  188   KVPKVMQGWLTIYVSDDPKSPFTKLSLRKQLLSKLNELIEQYKDDNLSILLTGHSLGASL  247

Query  723   AILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +ILAAFDL ENGV DIPV A+VFGSPQ+GNK F+    + +NLK+LHI+N+ID IP YPG
Sbjct  248   SILAAFDLVENGVADIPVAALVFGSPQVGNKAFNDRFKKHSNLKVLHIKNQIDAIPHYPG  307

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
              LLGY  +G E  ID RKS SLK S NPSDWHNLQAMLH+VAGWNG+   FELKVKR +A
Sbjct  308   RLLGYEYTGTELEIDTRKSPSLKGSKNPSDWHNLQAMLHIVAGWNGDKEPFELKVKRSLA  367

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             LVNKSC FLK+E  +PGSWW+EKN+ MV  ++GEW L   ++ED PVPEY
Sbjct  368   LVNKSCAFLKDECLVPGSWWVEKNRGMVRGDDGEWTLAPADEEDRPVPEY  417



>gb|ACJ85535.1| unknown [Medicago truncatula]
Length=435

 Score =   520 bits (1339),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 310/410 (76%), Gaps = 19/410 (5%)
 Frame = -1

Query  1428  SMATEPT------WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKY  1267
             S +T+PT      W+QLLG+ NWE LL+PL+L+LR+LILRCGDF Q TYDSFN+D NS Y
Sbjct  19    SSSTQPTTINQETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQNSIY  78

Query  1266  AGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGY  1087
              GS RYGK SFF+KVML +   Y V ++LYATA+++VPEAF+LHS SRESWDRESNWIGY
Sbjct  79    CGSSRYGKTSFFNKVMLENPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRESNWIGY  138

Query  1086  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-----------  940
             +AV+SD  S+ LGRREIYVV+RGTT DLEWINVF A P SA  LL + +           
Sbjct  139   IAVSSDERSRELGRREIYVVWRGTTRDLEWINVFGAAPESASGLLSAKSLREFNLPNNNN  198

Query  939   --SGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGEN  766
                G +   +EDD  VPK+M GW T+YTS DP S FT  S R Q+   ++ L +KYK EN
Sbjct  199   KDDGSSSSDDEDDKSVPKIMKGWLTIYTSDDPKSPFTKTSVRTQVLNIVKSLLNKYKNEN  258

Query  765   LSITLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKIL  586
              S+ L GHSLGASL+I++AFDL ENGVTDIPVTA VFGSPQ+GNK F+    +  NLK+L
Sbjct  259   PSVVLVGHSLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNDRFKKFQNLKVL  318

Query  585   HIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG  406
             H+RN ID+IP YPG LLGY  +G E VID RKSTSLK+S NPSDWHNLQAMLH+VAGWNG
Sbjct  319   HVRNVIDLIPHYPGKLLGYEYTGTELVIDTRKSTSLKDSKNPSDWHNLQAMLHIVAGWNG  378

Query  405   EDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
              DGEFE+KVKR +ALVNKSC++LKEE  +PGSWW+ KNK MV   + EWV
Sbjct  379   SDGEFEVKVKRSLALVNKSCDYLKEECHVPGSWWVAKNKGMVGRGDAEWV  428



>ref|XP_010506105.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=410

 Score =   514 bits (1324),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 249/412 (60%), Positives = 308/412 (75%), Gaps = 10/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML S  DY+V ++LYATA++T+P+  LL S+SR++WDRESNW GY+AVTSD 
Sbjct  61    KSSFFEKVMLESPSDYEVTSFLYATARVTLPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-------SSTSGdnddkeedd  907
              +KALGRREIYV  RGT+ + EW+NV  A+  SA+PLLR       +   G   D + +D
Sbjct  121   RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             ++  KVM GW T+YTS  P S+FT LS R QL   I+EL  KYK E  SI LTGHSLGA+
Sbjct  181   EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQLLASIKELLLKYKDEKPSIVLTGHSLGAT  240

Query  726   LAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              A+LAA+D+ EN    D+PVTAIVFG PQ+GNK F        NLKILH+RN ID++  Y
Sbjct  241   EAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHVRNTIDLLTRY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG LLGYV  G+ FVID +KS  LKNS NP DWHNLQAMLHVVAGWNG+ GEF+L VKR 
Sbjct  301   PGGLLGYVDMGINFVIDTKKSPFLKNSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSCEFLK+E  +PGSWW+EKNK ++ +E+GEW++    +E  PVPE+
Sbjct  361   IALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVPEF  410



>ref|XP_006411537.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
 gb|ESQ52990.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
Length=416

 Score =   514 bits (1324),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 254/418 (61%), Positives = 310/418 (74%), Gaps = 16/418 (4%)
 Frame = -1

Query  1425  MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             MAT  T W +LLGS+NW+ LL+P + SLR LILRCGDFCQATYD+F +D NSKY G+ RY
Sbjct  1     MATTATPWEELLGSKNWDTLLEPFDQSLRQLILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK+SFF KVML SA DY+V ++LYATA++ +P+  LLHS+SR+SWDRESNW GY+AVTSD
Sbjct  61    GKSSFFDKVMLESASDYEVTSFLYATARVALPQGLLLHSQSRDSWDRESNWFGYIAVTSD  120

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRS-------STSGdnddkeed  910
               +KALGRREIYV  RGT+ + EWINV  A+  SA+PLL         S SG        
Sbjct  121   ERTKALGRREIYVALRGTSRNYEWINVLGARLTSADPLLHGPEQNASGSDSGVVGAASTY  180

Query  909   ddKVP-----KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTG  745
                       KVM GW T+YTS++P S FT LS R QL  K++EL  KYK E  S+ LTG
Sbjct  181   SSDSEDEEGCKVMLGWLTIYTSENPESEFTRLSLRLQLLAKMKELLLKYKDEKPSVVLTG  240

Query  744   HSLGASLAILAAFDLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKI  568
             HSLGA+ A++AA+D+ ENG  D +PVTAIVFG PQ+GNK F   +T   NLKILH+RNKI
Sbjct  241   HSLGATEAVIAAYDIAENGSNDDVPVTAIVFGCPQVGNKEFKDEVTRHKNLKILHVRNKI  300

Query  567   DMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFE  388
             D++  YPG LLGYV  G  FVID +KS  LK+S +P DWHNLQAMLH+VAGWNG+ GEF+
Sbjct  301   DLLTRYPGGLLGYVDIGTNFVIDTKKSPYLKDSKSPGDWHNLQAMLHIVAGWNGKKGEFK  360

Query  387   LKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             L VKR +ALVNKSCEFLK+E  +PGSWW+EKNK M+ DENGEWV+ SP +E+ PVPE+
Sbjct  361   LMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVI-SPVEEE-PVPEF  416



>ref|XP_008362525.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=441

 Score =   515 bits (1326),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 267/422 (63%), Positives = 319/422 (76%), Gaps = 17/422 (4%)
 Frame = -1

Query  1428  SMATEPT--------WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNS  1273
             SMAT  T        W +LLGS NW+ LLDPL+L+LR LILRCG+FCQATYD+FN+D NS
Sbjct  20    SMATYQTADHPAAAAWSELLGSNNWDXLLDPLDLNLRTLILRCGNFCQATYDAFNNDQNS  79

Query  1272  KYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWI  1093
             KY GS RYGK+SFF KVML  A +YQV  +LYATAQ++VPEA LL S+SRESWDRESNWI
Sbjct  80    KYCGSSRYGKHSFFDKVMLQDAANYQVSCFLYATAQVSVPEALLLKSKSRESWDRESNWI  139

Query  1092  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkee  913
             GY+AVT+D VSK +GRREIYV +RGT  + EWINV  A+  SAE +L SS +   +  + 
Sbjct  140   GYIAVTTDEVSKVIGRREIYVAWRGTIRNYEWINVMGAELESAEIILGSSHASLANGHQN  199

Query  912   --------dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSI  757
                     DD+KVPKVM GW T+Y S DP S FT  SAR QL TKI ELR+KYK E LSI
Sbjct  200   HDDKDDDEDDEKVPKVMRGWLTMYISNDPKSPFTKTSARVQLVTKINELRNKYKDEKLSI  259

Query  756   TLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIR  577
             T+TGHSLGASL++L+AFDL ENGV+DIP+   VFG P IGNK   + +    NLKILHI+
Sbjct  260   TMTGHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIETHPNLKILHIK  319

Query  576   NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDG  397
             N ID+IP YP  ++GY K G E +ID RKS  LK S NPSDWHNL+ +LHVVAGWNGE+G
Sbjct  320   NTIDVIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPSDWHNLEGILHVVAGWNGEEG  379

Query  396   EFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDE-NGEWVLGSPNDEDLPVP  220
             EF+L+VKR VALVNKSC+FLKEE  +P  WW+EKN+ MVLD+ +GEWVL  P+DEDLP P
Sbjct  380   EFDLRVKRSVALVNKSCDFLKEECHVPAVWWVEKNRXMVLDKSSGEWVLSPPSDEDLPAP  439

Query  219   EY  214
             E+
Sbjct  440   EF  441



>ref|XP_002281095.2| PREDICTED: phospholipase A1-IIdelta [Vitis vinifera]
Length=470

 Score =   516 bits (1329),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 319/441 (72%), Gaps = 13/441 (3%)
 Frame = -1

Query  1515  RITISLRLHANILIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHL  1336
             R++I  +L  N L+        K+ +   +  ++P+  Q+LGS NWEGLL+PLNLSLR L
Sbjct  29    RLSIPPKLSRNSLL----ALSFKAPVTMGTSQSQPSLDQILGSNNWEGLLEPLNLSLREL  84

Query  1335  ILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTV  1156
             I+RCGDFCQ TYDSF +D NS+Y G+CRYG      KVML  A DY+V AYLYATA+++V
Sbjct  85    IIRCGDFCQVTYDSFINDQNSRYCGACRYGMKFLLEKVMLIGASDYEVSAYLYATARVSV  144

Query  1155  PEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAK  976
             PEAF+LHS SRESWDRESNWIGY+AVT+D VS+A GRREIYV +RGTT D EW++V  A+
Sbjct  145   PEAFILHSMSRESWDRESNWIGYIAVTTDEVSRARGRREIYVAWRGTTRDYEWVDVLGAE  204

Query  975   PVSAEPLLRSSTSGdnddkeedddKVP-------KVMFGWHTLYTSKDPNSRFTTLSARE  817
               SAE LLR      N++     D          KVM GW T+YTS DP S FT  SAR+
Sbjct  205   LESAEELLRPQEGIKNEEGSSSSDSDDEDDEKNVKVMRGWFTIYTSGDPRSPFTKASARK  264

Query  816   QLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVT--DIPVTAIVFGSPQ  643
             Q Q+ I+ L +KYK E +SI +TGHSLGASLA+L++FD+ EN +   D+ V+AIVFG P+
Sbjct  265   QFQSNIKRLMNKYKDEKVSIIVTGHSLGASLAVLSSFDIVENEIVPPDVIVSAIVFGCPE  324

Query  642   IGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMN  463
             IGN+ F+  + + +NL ILH+RN ID+IP YP  +LGYVK+G E VID RKS  LK+S +
Sbjct  325   IGNRAFNNQIKQHSNLHILHVRNTIDLIPHYPSMILGYVKTGTELVIDTRKSPDLKDSKD  384

Query  462   PSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSM  283
             P DWHNLQAM+HVV+GWNG + EFELKVKR +ALVNKSC FLK+E  +P SWW+EKNK M
Sbjct  385   PGDWHNLQAMVHVVSGWNGPNAEFELKVKRSLALVNKSCNFLKDECLVPASWWVEKNKGM  444

Query  282   VLDENGEWVLGSPNDEDLPVP  220
             +   +GEWV  SP +ED PVP
Sbjct  445   MRKADGEWVTESPAEEDRPVP  465



>ref|XP_002881867.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58126.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   513 bits (1322),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 250/413 (61%), Positives = 308/413 (75%), Gaps = 11/413 (3%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML SA  Y+V  +LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD 
Sbjct  61    KSSFFDKVMLESASAYEVANFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS--------TSGdnddkeed  910
              +KALGRREIY+  RGT+ + EW+NV  A+P SA+PLL             G   D + +
Sbjct  121   RTKALGRREIYIAMRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSAGVVEGTTFDSDSE  180

Query  909   ddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGA  730
             D++  KVM GW T+YTS  P S+FT LS R QL  KI+EL  KYK E  SI LTGHSLGA
Sbjct  181   DEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLGA  240

Query  729   SLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             + A+LAA+D+ ENG + D+PVTAIVFG PQ+GNK F   +    NLKILH+RN ID++  
Sbjct  241   TEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMRHKNLKILHVRNTIDLLTR  300

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YPG LLGYV  G  FVID +KS  LK S NP DWHNLQA+LH+VAGWNG+ GEF+L VKR
Sbjct  301   YPGGLLGYVDMGTNFVIDTKKSPFLKESRNPGDWHNLQAILHIVAGWNGKKGEFKLMVKR  360

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
              +ALVNKSCEFLK+E  +PGSWW+EKNK ++ +E+GEWVL    +E  PVPE+
Sbjct  361   SIALVNKSCEFLKDECLVPGSWWVEKNKGLIKNEDGEWVLAPVEEE--PVPEF  411



>ref|NP_181797.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
 sp|Q9SJI7.1|PLA20_ARATH RecName: Full=Phospholipase A1-IIdelta [Arabidopsis thaliana]
 gb|AAD21737.1| putative lipase [Arabidopsis thaliana]
 gb|AAK93675.1| putative lipase [Arabidopsis thaliana]
 gb|AAL85087.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15382.1| putative lipase [Arabidopsis thaliana]
 gb|AEC10156.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
Length=412

 Score =   512 bits (1319),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 255/415 (61%), Positives = 314/415 (76%), Gaps = 14/415 (3%)
 Frame = -1

Query  1425  MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             MAT  T W +LLGS+NW+ +LDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RY
Sbjct  1     MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK+SFF KVML +A DY+V  +LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD
Sbjct  61    GKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSD  120

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS--------TSGdnddkee  913
               SKALGRREIY+  RGT+ + EW+NV  A+P SA+PLL             G   D + 
Sbjct  121   ERSKALGRREIYIALRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSGGVVEGTTFDSDS  180

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
             +D++  KVM GW T+YTS  P S+FT LS R QL  KI+EL  KYK E  SI LTGHSLG
Sbjct  181   EDEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLG  240

Query  732   ASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLF-DKLMTEKTNLKILHIRNKIDMI  559
             A+ A+LAA+D+ ENG + D+PVTAIVFG PQ+GNK F D++M+ K NLKILH+RN ID++
Sbjct  241   ATEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHK-NLKILHVRNTIDLL  299

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
               YPG LLGYV  G+ FVID +KS  L +S NP DWHNLQAMLHVVAGWNG+ GEF+L V
Sbjct  300   TRYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMV  359

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             KR +ALVNKSCEFLK E  +PGSWW+EKNK ++ +E+GEWVL    +E  PVPE+
Sbjct  360   KRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWVLAPVEEE--PVPEF  412



>ref|XP_010104406.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00251.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=400

 Score =   510 bits (1313),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/405 (60%), Positives = 301/405 (74%), Gaps = 13/405 (3%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             +EPTW +LLG+ NW+GLLDPL+L+LR LILRCGDFCQ TYD+FN D NSKY G+ RYGK+
Sbjct  6     SEPTWEELLGANNWDGLLDPLDLALRKLILRCGDFCQVTYDAFNSDQNSKYCGASRYGKS  65

Query  1239  SFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             S F  V  P+A  Y V ++LYATA+++VPEA LLHSRSR+SWDRESNW+GY+AVT+D+VS
Sbjct  66    SIFRAVFFPNASSYDVVSFLYATARISVPEALLLHSRSRDSWDRESNWMGYIAVTTDSVS  125

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
             ++L RREI+V +RGT  D EWINV  A   SA+PLL   ++  +           KVM G
Sbjct  126   RSLSRREIHVAWRGTIRDYEWINVLGADQDSAKPLLNKDSTDHDA----------KVMRG  175

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             W T+YTS + NS F   SAR QL T+I++L  KYK E LS+ ++GHSLGA+LA+L+AFDL
Sbjct  176   WLTIYTSNNLNSPFVKTSARVQLLTRIKQLVEKYKQEKLSVVISGHSLGAALAVLSAFDL  235

Query  699   CENGVT--DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
              ENGV     PVTA VFG PQ+GN+ F ++  +  NLKILH +N ID+IP YPG L G+V
Sbjct  236   VENGVVSESFPVTAFVFGCPQVGNEEFKEIAEKHRNLKILHTKNTIDLIPHYPGMLFGFV  295

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
               G E VID RKS  L  S+ P DWHNLQ MLHVVAGWNG D EFE+KVKR  ALVNKS 
Sbjct  296   DMGEELVIDSRKSPHLNESLFPGDWHNLQGMLHVVAGWNGGDKEFEMKVKRSFALVNKSS  355

Query  345   EFLKEELFIPGSWWIEKNKSMVLDE-NGEWVLGSPNDEDLPVPEY  214
              FLK++  +P SWW EKNK MVLDE +GEW+L  P+DEDLPVPE+
Sbjct  356   GFLKDDYLVPESWWAEKNKGMVLDESSGEWILAPPDDEDLPVPEF  400



>ref|XP_010508539.1| PREDICTED: phospholipase A1-IIdelta isoform X1 [Camelina sativa]
 ref|XP_010508540.1| PREDICTED: phospholipase A1-IIdelta isoform X2 [Camelina sativa]
 ref|XP_010508541.1| PREDICTED: phospholipase A1-IIdelta isoform X3 [Camelina sativa]
Length=410

 Score =   510 bits (1313),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 247/412 (60%), Positives = 306/412 (74%), Gaps = 10/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML SA DY+V ++LYATA++ +P+  LL S+SR++WDRESNW GY+AVTSD 
Sbjct  61    KSSFFEKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-------TSGdnddkeedd  907
              +KALGRREIYV  RGT+ + EW+NV  A+  SA+PLLR           G   D + +D
Sbjct  121   RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSGVVEGTTFDSDSED  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             ++  KVM GW T+YTS  P S+FT LS R QL   I+ L  KYK E  SI LTGHSLGA+
Sbjct  181   EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQLLASIKGLLLKYKDEKPSIVLTGHSLGAT  240

Query  726   LAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              A+LAA+D+ EN    D+PVTAIVFG PQ+GNK F        NLKILH+RN ID++  Y
Sbjct  241   EAVLAAYDIAENASNDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHVRNTIDLLTRY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG LLGYV  G+ FVID +KS  LK+S NP DWHNLQAMLH+VAGWNG+ GEF+L VKR 
Sbjct  301   PGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHIVAGWNGKKGEFKLMVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSCEFLK+E  +PGSWW+EKNK ++ +E+GEWV+    +E  PVPE+
Sbjct  361   IALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWVIAPVEEE--PVPEF  410



>ref|XP_010517807.1| PREDICTED: phospholipase A1-IIdelta-like isoform X2 [Camelina 
sativa]
Length=410

 Score =   508 bits (1309),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 247/412 (60%), Positives = 307/412 (75%), Gaps = 10/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +  +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTTSCEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML SA DY+V ++LYATA++ +P+  LL S+SR++WDRESNW GY+AVTSD 
Sbjct  61    KSSFFDKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-------SSTSGdnddkeedd  907
              +KALGRREIYV  RGT+ + EW+NV  A+  SA+PLLR       +   G   D + +D
Sbjct  121   RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             ++  KVM GW T+YTS  P S+FT LS R QL   I+EL  KYK E  SI LTGHSLGA+
Sbjct  181   EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQLLASIKELLLKYKDEKPSIVLTGHSLGAT  240

Query  726   LAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              A+LAA+D+ EN    D+PVTAIVFG PQ+GNK F        NLKILH+RN ID++  Y
Sbjct  241   EAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHVRNTIDLLTRY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG LLGYV  G+ FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ GEF+L VKR 
Sbjct  301   PGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSCEFLK+E  +PGSWW+EKNK ++ +E+GEW++    +E  PVPE+
Sbjct  361   IALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVPEF  410



>ref|XP_006294314.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
 gb|EOA27212.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
Length=410

 Score =   508 bits (1308),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 247/412 (60%), Positives = 306/412 (74%), Gaps = 10/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTASWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML SA DY+V  +LYATA++++P+  LL S+SR+SWDRESNW GY+AVTSD 
Sbjct  61    KSSFFDKVMLESASDYEVTNFLYATARVSLPQGLLLSSQSRDSWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-------TSGdnddkeedd  907
              +KALGRREIYV  RGT+ + EW+NV   +  SA+PLLR           G   D + +D
Sbjct  121   RTKALGRREIYVALRGTSRNYEWVNVLGFRSTSADPLLRGPEQDGSGVVEGTTFDDDSED  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             ++  +VM GW T+YTS  P S+FT LS R QL   I+EL  KYK E  SI LTGHSLGA+
Sbjct  181   EEGCRVMLGWLTIYTSTHPESKFTNLSLRSQLLASIKELLLKYKDEKPSIVLTGHSLGAT  240

Query  726   LAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              A+LAA+D+ EN    D+PVTAIVFG PQ+GNK F        NL+ILH+RN ID++  +
Sbjct  241   EAVLAAYDIAENASNDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLRILHVRNTIDLLTRF  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG LLGYV  G+ FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ GEF+L VKR 
Sbjct  301   PGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSCEFLK+E  +PGSWW+EKNK M+ +E+GEWV+    +E  PVPE+
Sbjct  361   IALVNKSCEFLKDECLVPGSWWVEKNKGMIRNEDGEWVIAPVEEE--PVPEF  410



>ref|XP_009142078.1| PREDICTED: phospholipase A1-IIdelta [Brassica rapa]
Length=413

 Score =   508 bits (1308),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 248/403 (62%), Positives = 297/403 (74%), Gaps = 11/403 (3%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYDSF +D NSKY G+ RYG
Sbjct  1     MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDSFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML +A DYQV ++LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD 
Sbjct  61    KSSFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLL---RSSTSGdnddkeedddKVP  895
              SK+LGRREIYV  RGT+ + EWINV  A+P SA+PLL     + SG    +        
Sbjct  121   RSKSLGRREIYVALRGTSRNYEWINVLGARPTSADPLLTGPEQNGSGSKVVETLSTHGSD  180

Query  894   -------KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSL  736
                    KVM GW T+YTS    S+FT +S R QL TKI+EL  KYK E  SI LTGHSL
Sbjct  181   SEDEEGCKVMLGWLTIYTSDHAESKFTKMSLRLQLLTKIKELLLKYKDEKPSIVLTGHSL  240

Query  735   GASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
             GA+ A+LAA+D+ EN  + D PVT IVFG PQ+GNK F   +T   NLKILH+RN ID++
Sbjct  241   GATEAVLAAYDIAENASSDDYPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHVRNTIDLL  300

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
               YPG LLGYV  G  FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ G+F+L V
Sbjct  301   TRYPGGLLGYVDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKKGDFKLMV  360

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLG  250
             KR +ALVNKSCEFLK+E  +PGSWW+EKNK M+ DENGEWV+ 
Sbjct  361   KRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  403



>ref|XP_008343102.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=438

 Score =   507 bits (1306),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 265/419 (63%), Positives = 317/419 (76%), Gaps = 14/419 (3%)
 Frame = -1

Query  1428  SMATEPT--------WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNS  1273
             SMAT  T        W +LLGS NW+ LLDPL+L+LR LILRCG+FCQATYD+FN+D NS
Sbjct  20    SMATYQTADHPAAAAWSELLGSNNWDXLLDPLDLNLRTLILRCGNFCQATYDAFNNDQNS  79

Query  1272  KYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWI  1093
             KY GS RYGK+SFF KVML  A +YQV  +LYATAQ++VPEA LL S SRESWDRESNWI
Sbjct  80    KYCGSSRYGKHSFFDKVMLQDAANYQVSCFLYATAQVSVPEALLLXSXSRESWDRESNWI  139

Query  1092  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdndd---  922
             GY+AVT+D VSK +GRREIYV +RGT  + EWIN   A+  S E +L SS +  + +   
Sbjct  140   GYIAVTTDEVSKXIGRREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXD  199

Query  921   --keedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLT  748
                +ED+++VPK M GW T+Y S DP S FT  SAR QL TKI ELR+KYK E LSIT+T
Sbjct  200   KDDDEDEEEVPKAMRGWLTMYISNDPKSPFTKTSARVQLVTKINELRNKYKDEKLSITMT  259

Query  747   GHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKI  568
             GHSLGASL++L+AFDL ENGV+DIP+   VFG P IGNK   + +    NLKILHI+N I
Sbjct  260   GHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIEXHPNLKILHIKNTI  319

Query  567   DMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFE  388
             D+IP YP  ++GY K G E +ID RKS  LK S NP DWHNL+ MLHVVAGWNGE+G+FE
Sbjct  320   DVIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGDFE  379

Query  387   LKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDEN-GEWVLGSPNDEDLPVPEY  214
             L+VKR VALVNKS +FLKEE  +P  WW+EKN+ MVLDE+ GEWVL SP+DEDLPVPE+
Sbjct  380   LRVKRSVALVNKSSDFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPEF  438



>emb|CBI21996.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   509 bits (1310),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 311/434 (72%), Gaps = 20/434 (5%)
 Frame = -1

Query  1515  RITISLRLHANILIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHL  1336
             R++I  +L  N L+        K+ +   +  ++P+  Q+LGS NWEGLL+PLNLSLR L
Sbjct  63    RLSIPPKLSRNSLL----ALSFKAPVTMGTSQSQPSLDQILGSNNWEGLLEPLNLSLREL  118

Query  1335  ILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTV  1156
             I+RCGDFCQ TYDSF +D NS+Y G+CRYG      KVML  A DY+V AYLYATA+++V
Sbjct  119   IIRCGDFCQVTYDSFINDQNSRYCGACRYGMKFLLEKVMLIGASDYEVSAYLYATARVSV  178

Query  1155  PEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAK  976
             PEAF+LHS SRESWDRESNWIGY+AVT+D VS+A GRREIYV +RGTT D EW++V  A+
Sbjct  179   PEAFILHSMSRESWDRESNWIGYIAVTTDEVSRARGRREIYVAWRGTTRDYEWVDVLGAE  238

Query  975   PVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIE  796
                ++                      KVM GW T+YTS DP S FT  SAR+Q Q+ I+
Sbjct  239   LDDSDDEDDEKNV--------------KVMRGWFTIYTSGDPRSPFTKASARKQFQSNIK  284

Query  795   ELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVT--DIPVTAIVFGSPQIGNKLFD  622
              L +KYK E +SI +TGHSLGASLA+L++FD+ EN +   D+ V+AIVFG P+IGN+ F+
Sbjct  285   RLMNKYKDEKVSIIVTGHSLGASLAVLSSFDIVENEIVPPDVIVSAIVFGCPEIGNRAFN  344

Query  621   KLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNL  442
               + + +NL ILH+RN ID+IP YP  +LGYVK+G E VID RKS  LK+S +P DWHNL
Sbjct  345   NQIKQHSNLHILHVRNTIDLIPHYPSMILGYVKTGTELVIDTRKSPDLKDSKDPGDWHNL  404

Query  441   QAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGE  262
             QAM+HVV+GWNG + EFELKVKR +ALVNKSC FLK+E  +P SWW+EKNK M+   +GE
Sbjct  405   QAMVHVVSGWNGPNAEFELKVKRSLALVNKSCNFLKDECLVPASWWVEKNKGMMRKADGE  464

Query  261   WVLGSPNDEDLPVP  220
             WV  SP +ED PVP
Sbjct  465   WVTESPAEEDRPVP  478



>ref|XP_010517806.1| PREDICTED: phospholipase A1-IIdelta-like isoform X1 [Camelina 
sativa]
Length=410

 Score =   505 bits (1301),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 246/412 (60%), Positives = 306/412 (74%), Gaps = 10/412 (2%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MAT  +  +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RYG
Sbjct  1     MATTTSCEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             K+SFF KVML SA DY+V ++LYATA++ +P+  LL S+SR++WDRESNW GY+AVTSD 
Sbjct  61    KSSFFDKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-------SSTSGdnddkeedd  907
              +KALGRREIYV  RGT+ + EW+NV  A+  SA+PLLR       +   G   D + +D
Sbjct  121   RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
             ++  KVM GW T+YTS  P S+FT LS R QL   I+ L  KYK E  SI LTGHSLGA+
Sbjct  181   EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQLLASIKGLLLKYKDEKPSIVLTGHSLGAT  240

Query  726   LAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              A+LAA+D+ EN    D+PVTAIVFG PQ+GNK F        NLKILH+RN ID++  Y
Sbjct  241   EAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHVRNTIDLLTRY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG LLGYV  G+ FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ GEF+L VKR 
Sbjct  301   PGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSCEFLK+E  +PGSWW+EKNK ++ +E+GEW++    +E  PVPE+
Sbjct  361   IALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVPEF  410



>gb|EPS65213.1| hypothetical protein M569_09566 [Genlisea aurea]
Length=410

 Score =   504 bits (1299),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 299/402 (74%), Gaps = 0/402 (0%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             T  +W ++LG ++W+GLLDPL+ SLR  ILRCGD CQATYD+FN+D NS YAGSCRYGK 
Sbjct  6     TAVSWEEILGGKDWDGLLDPLDDSLRLFILRCGDLCQATYDAFNNDENSGYAGSCRYGKK  65

Query  1239  SFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             SFF KV  P+ DDY V   LYA A+++  EA    S+SRESWDRESNWIG++AVT D VS
Sbjct  66    SFFRKVTFPNPDDYYVAGNLYAAARVSRLEALFFRSKSRESWDRESNWIGFIAVTGDDVS  125

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
             + LGRREIYVV+RGTT   EWI+   AKP  A+ LLR + + D      DD+ VPKVM G
Sbjct  126   RTLGRREIYVVWRGTTRSYEWIDDMGAKPARADVLLRGNENRDAMIAGNDDEAVPKVMIG  185

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             W ++YT+ DP S FT LSAR+Q++ +I EL ++Y+ E LSI LTGHSLG SLA+L+AFDL
Sbjct  186   WLSVYTTSDPKSAFTALSARDQVRKRISELINQYENERLSIILTGHSLGGSLAVLSAFDL  245

Query  699   CENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKS  520
              ENGV+ IPV A+ FG P++GN+ F   +    NLKIL +RN  D IP YP AL+GY  S
Sbjct  246   VENGVSGIPVAAVTFGCPRVGNRAFKDRIGHYPNLKILQVRNTTDRIPLYPTALMGYHHS  305

Query  519   GLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEF  340
             G++F +D+RKS  LK+S +  D HNLQAMLH VAGW G DG FEL+VKR +ALVNKS E 
Sbjct  306   GVDFEVDNRKSPFLKSSGSFLDRHNLQAMLHAVAGWQGRDGGFELRVKRSLALVNKSAEI  365

Query  339   LKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             L++E  IPGSWW+EKNK MVLD++GEWVL  P +ED PVPE+
Sbjct  366   LRDEYMIPGSWWVEKNKGMVLDDSGEWVLAPPAEEDRPVPEF  407



>ref|XP_010525104.1| PREDICTED: phospholipase A1-IIdelta [Tarenaya hassleriana]
Length=407

 Score =   500 bits (1288),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 251/411 (61%), Positives = 309/411 (75%), Gaps = 11/411 (3%)
 Frame = -1

Query  1425  MAT---EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSC  1255
             MAT   EP+W + LGS+NWE LLDPL+ +LR +ILRCGDFCQATYD+F++D NSKY G+ 
Sbjct  1     MATPKAEPSWGEHLGSKNWENLLDPLDQTLRTIILRCGDFCQATYDAFDNDENSKYCGAS  60

Query  1254  RYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
             RYGK+SFF KVML SA DY V ++LYATA+++VP+AF+LHS S+E WDRESNW GY+AVT
Sbjct  61    RYGKSSFFDKVMLDSASDYNVYSFLYATARISVPKAFILHSLSKECWDRESNWFGYIAVT  120

Query  1074  SDAVSKALGRREIYVVFRGTTT---DLEWINVFSAKPVSAEPLLRSSTSGdnddkeeddd  904
             SD  SK LGRREIYV +   +T    LE  N       + + +  +   G +D   +D+ 
Sbjct  121   SDERSKNLGRREIYVAYHSPSTRNSTLENSNRLMHG--AGQDVTDAIVIGGSDSDSDDES  178

Query  903   KVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
              VPKVM GW T+YTS +P SRFT LS R QL  KI+EL  KYK EN S+ +TGHSLGA+ 
Sbjct  179   GVPKVMSGWFTIYTSHNPKSRFTNLSLRSQLLIKIKELMEKYKDENPSVIVTGHSLGATE  238

Query  723   AILAAFDLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             AILA+FDL EN V D +PVTAIVFG PQ+GNK F+  +    NLKILH+RNKID++  YP
Sbjct  239   AILASFDLAENAVADTVPVTAIVFGCPQVGNKEFNDQVMRHKNLKILHVRNKIDLLTRYP  298

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
             G  L YV +G++FVID RKS  LKNS  P DWHNLQAMLHVVAGWNG+ GEF L VKR +
Sbjct  299   GPFLHYVDTGIDFVIDTRKSPYLKNSKTPGDWHNLQAMLHVVAGWNGKKGEFHLMVKRSL  358

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             ALVNKSCEFLK+E  IPGSWW+EKNK M+ +E+GEW++ SP++E  PVPE+
Sbjct  359   ALVNKSCEFLKDEYLIPGSWWVEKNKGMIKNEDGEWIMASPDEE--PVPEF  407



>gb|KFK37117.1| hypothetical protein AALP_AA4G215100 [Arabis alpina]
Length=414

 Score =   496 bits (1277),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 246/417 (59%), Positives = 305/417 (73%), Gaps = 16/417 (4%)
 Frame = -1

Query  1425  MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             MAT  T W +LLGS+NW+ LLDPL+LSLR LILRCGDFCQA+YD+F  D  SKY G+ RY
Sbjct  1     MATTTTSWEELLGSKNWDTLLDPLDLSLRQLILRCGDFCQASYDAFVKDQKSKYCGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK+SFF KVML SA DY+V  +LYATA++ +P+  LLHS+S +SWDRESN+ GY+AVTSD
Sbjct  61    GKSSFFDKVMLESASDYEVTTFLYATARVDLPKGLLLHSQSTDSWDRESNFFGYIAVTSD  120

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-----SSTSGdnddkeeddd  904
               +KA+GRREIYV  RGT+ + EWINV  A+P SAEPLL       S SG         D
Sbjct  121   ERTKAIGRREIYVAMRGTSRNHEWINVLGARPTSAEPLLHGPDENGSGSGVVGAATSTYD  180

Query  903   KVP------KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGH  742
                      KVM GW T+YTS  P S+FT +S R QL  KI+EL  KYK E  SI LTGH
Sbjct  181   SDSEDEEGCKVMLGWLTIYTSHHPGSKFTKVSLRAQLLGKIKELLLKYKDEKPSIVLTGH  240

Query  741   SLGASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKID  565
             SLGA+ A++A +D+ EN    D+P++AIVFGSPQ+GN+ F   +T+  NLKILH+RNKID
Sbjct  241   SLGATEAVIAGYDIAENASKDDVPISAIVFGSPQVGNREFRNEVTKHKNLKILHVRNKID  300

Query  564   MIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFEL  385
              +  YPG LLGYV  G+ FVID +KS  LK+SMNP DWHNLQAMLHVVAGWNG+  EF+L
Sbjct  301   FLTRYPGGLLGYVDIGVNFVIDTKKSPYLKDSMNPGDWHNLQAMLHVVAGWNGKR-EFKL  359

Query  384   KVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
              V R +ALVNKSCE+LK+E  +PG+WW++KN  M+ +E+GEWV+GS  +E  P PE+
Sbjct  360   MVNRSIALVNKSCEYLKDEFLVPGTWWVDKNNGMIKNEDGEWVIGSVEEE--PEPEF  414



>ref|XP_010525149.1| PREDICTED: phospholipase A1-IIdelta-like [Tarenaya hassleriana]
Length=414

 Score =   493 bits (1269),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 249/412 (60%), Positives = 303/412 (74%), Gaps = 8/412 (2%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             + A EPTW  LLG  NWEGLL+PLN+SLR L+LR GDFCQATYD+F +D NS + G  RY
Sbjct  2     AAAEEPTWEDLLGRNNWEGLLNPLNVSLRRLVLRAGDFCQATYDAFVNDPNSAFCGVSRY  61

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK SFF KVML  AD Y V ++LYATA+++  EAF L S SR+SWDRE+NWIGYVAVTSD
Sbjct  62    GKPSFFRKVMLDDADHYDVVSFLYATARVSDHEAFFLKSMSRDSWDRETNWIGYVAVTSD  121

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLL---RSSTSGdnddkeedddKV  898
             A +  +GRREIYVVFRGTT + EWINV  AK  S + LL     +  G  D   +DDD  
Sbjct  122   ARTAEIGRREIYVVFRGTTRNYEWINVLGAKLTSLKCLLTGGDGNCGGGGDGLADDDDDG  181

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
             PK M GW T+YT+ +P S+FT +SAR QL  KI+EL  KYK E  SI LTGHSLG +LA 
Sbjct  182   PKAMLGWVTIYTTANPRSQFTKMSARSQLLRKIQELLEKYKDEKPSIVLTGHSLGGTLAT  241

Query  717   LAAFDLCEN---GVTDIPVTAIVFGSPQIGNK-LFDKLMTEKTNLKILHIRNKIDMIPEY  550
             L AFDL EN   G  ++PVTAIVFGSP++GNK L D++   K NL+ILH++N+ID+I  Y
Sbjct  242   LGAFDLAENVTGGDDNVPVTAIVFGSPKVGNKELADRIKLNK-NLRILHVKNQIDLITRY  300

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             PG +LGYV  G +  ID RKS  LK S +P DWHNLQAMLHV AGWNGE  EFE++VKR 
Sbjct  301   PGRILGYVSVGTKLKIDTRKSPFLKESHHPGDWHNLQAMLHVAAGWNGEREEFEMRVKRS  360

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSC+ LKEE  +P  WW+EKNK ++  E+GEWV+ +P+DEDLPV E+
Sbjct  361   IALVNKSCDLLKEECLVPPCWWVEKNKGLLKAEDGEWVMATPHDEDLPVAEF  412



>ref|XP_010689863.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=423

 Score =   489 bits (1258),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 245/412 (59%), Positives = 296/412 (72%), Gaps = 14/412 (3%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             PTW  LLGS NWEGLLDPLN  LRHLI+RCGDFCQ TYD+F +D NS Y G  RYGK+S 
Sbjct  13    PTWKNLLGSHNWEGLLDPLNDELRHLIIRCGDFCQVTYDTFINDPNSAYCGCSRYGKSSL  72

Query  1233  FHKVMLPSA-DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
               K   P   D Y V ++LYATA+++VPEAFLL S SRE WDRESNW+GY+AV++D VS+
Sbjct  73    LRKTTFPGGWDKYDVVSFLYATARVSVPEAFLLKSLSRERWDRESNWMGYIAVSNDTVSR  132

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSST-----------SGdnddkeed  910
              +GRREIYV +RGTT   EWI+V  AK  SA+PLLR                D+ D E+ 
Sbjct  133   EMGRREIYVAWRGTTRSYEWIDVLGAKLQSAKPLLREGAFDHHENGEDGSDNDDSDNEDH  192

Query  909   ddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGA  730
               K+PKVM GW T+YTS DP S FT LSAR QL  KI++L  KY+ ENLSI  TGHSLGA
Sbjct  193   HHKLPKVMRGWLTIYTSDDPKSPFTKLSARSQLSNKIKQLIDKYRDENLSIIFTGHSLGA  252

Query  729   SLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             +L+ L+AFD+ EN  T+IPVTAIVFG P++GNK F +      NLK+LH+RN +DMIP Y
Sbjct  253   TLSTLSAFDIVENLTTEIPVTAIVFGCPKVGNKHFKERFDSYPNLKVLHVRNTLDMIPHY  312

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P  L+ YV  G E  ID RKS  LK+S +P DWHNLQAMLHVV GW+G   +FEL ++R 
Sbjct  313   PPRLMHYVHLGTELNIDTRKSHYLKHSKHPGDWHNLQAMLHVVNGWHGIKRQFELIIQRS  372

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSC++LKEE  IP SWW+EKNK MVL+E GEWVL  P  E+ P+PE+
Sbjct  373   IALVNKSCDYLKEECLIPPSWWVEKNKGMVLNEEGEWVLACP--EEAPIPEF  422



>gb|AAD01804.1| lipase [Dianthus caryophyllus]
Length=447

 Score =   486 bits (1252),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/434 (56%), Positives = 302/434 (70%), Gaps = 36/434 (8%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             PTW +LLGS  W GLL+PLN  LR L+LRCGDFCQ TYD+F +D NS Y GS RYGK   
Sbjct  15    PTWPELLGSNAWAGLLNPLNDELRELLLRCGDFCQVTYDTFINDQNSSYCGSSRYGKADL  74

Query  1233  FHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
              HK   P  AD + V AYLYATA+++VPEAFLL SRSRE WDRESNWIGYV V++D  S+
Sbjct  75    LHKTAFPGGADRFDVVAYLYATAKVSVPEAFLLKSRSREKWDRESNWIGYVVVSNDETSR  134

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR------------------------  949
               GRRE+YVV+RGT  D EW++V  A+  SA PLLR                        
Sbjct  135   VAGRREVYVVWRGTCRDYEWVDVLGAQLESAHPLLRTQQTTHVEKVENEEKKSIHKSSWY  194

Query  948   ---------SSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIE  796
                      S++       ++DDD  PKVM GW T+YTS+DP S FT LSAR QLQTK++
Sbjct  195   DCFNINLLGSASKDKGKGSDDDDDDDPKVMQGWMTIYTSEDPKSPFTKLSARTQLQTKLK  254

Query  795   ELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKL  616
             +L +KYK E LSIT  GHSLGA+L++++AFD+ EN  T+IPVTA+VFG P++GNK F +L
Sbjct  255   QLMTKYKDETLSITFAGHSLGATLSVVSAFDIVENLTTEIPVTAVVFGCPKVGNKKFQQL  314

Query  615   MTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQA  436
                  NL +LH+RN ID+IP YP  L+GYV  G+E  ID RKST LK+S NPSDWHNLQA
Sbjct  315   FDSYPNLNVLHVRNVIDLIPLYPVKLMGYVNIGIELEIDSRKSTFLKDSKNPSDWHNLQA  374

Query  435   MLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
             +LHVV+GW+G  GEF++  KR VALVNKSC+FLKEE  +P +WW+ +NK MVL+++GEWV
Sbjct  375   ILHVVSGWHGVKGEFKVVNKRSVALVNKSCDFLKEECLVPPAWWVVQNKGMVLNKDGEWV  434

Query  255   LGSPNDEDLPVPEY  214
             L  P  E+ P PE+
Sbjct  435   LAPP--EEDPTPEF  446



>ref|XP_006411539.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
 gb|ESQ52992.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
Length=396

 Score =   484 bits (1246),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 294/405 (73%), Gaps = 16/405 (4%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPSWEELLGQDNWQNLLEPLDQSLRRLILRAGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y+V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVTSD  + 
Sbjct  63    FFHKVMLDDARHYEVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK    + LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTPVKELLMDGEDG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +PNS FT LSAR QL +KI+EL  +YK E  SI LTGHSLGA++A LAAFD+ 
Sbjct  171   FTIYTTANPNSPFTKLSARSQLLSKIKELLEQYKDEKPSIVLTGHSLGATIATLAAFDMA  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN     +D+ PVTAIVFGSP++GNK F   +    N++ILH++N+ID+I  YP  ++GY
Sbjct  231   ENITSSYSDVRPVTAIVFGSPRVGNKEFSNRINRHNNVRILHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G +  ID R S  LK + +P DWHNLQAMLHVVAGWNG++G++E+KV R +ALVNKS
Sbjct  291   VNIGTKLKIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWNGKNGKYEMKVNRNIALVNKS  350

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             C  LKEE  +P  WWIEKNK M   E+G+WV+ +P+DED+PV E+
Sbjct  351   CALLKEECLVPECWWIEKNKGMFKTEDGDWVMATPDDEDMPVVEF  395



>ref|XP_010507708.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   483 bits (1242),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 294/405 (73%), Gaps = 16/405 (4%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPTWEELLGRDNWQNLLEPLDHSLRQLILRTGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVTSD  + 
Sbjct  63    FFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK  S + LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGHG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +PNS FT +SAR QL TKI+EL   YK E  SI  TGHSLGA++A LAAFD+ 
Sbjct  171   FTIYTTANPNSPFTKMSARSQLLTKIKELLELYKDEKPSIVFTGHSLGATVATLAAFDIA  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN   G +D+ PVTAIVFGSP++GN+ F + +    N+++LH++N+ID+I  YP  ++GY
Sbjct  231   ENVTSGYSDVPPVTAIVFGSPRVGNREFSERIKRHNNVRVLHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G +  ID R S  LK + +P DWHNLQAMLHVVAGWNG++G+FE+KV R +ALVNKS
Sbjct  291   VNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWNGKNGKFEMKVNRNIALVNKS  350

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             C  LKEE  +P  WW+EKNK M+  E+G+WV+ +P+DED PV E+
Sbjct  351   CSLLKEECLVPECWWVEKNKGMLKTEDGDWVIATPDDEDKPVVEF  395



>emb|CDY14851.1| BnaC04g48480D [Brassica napus]
Length=378

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/393 (60%), Positives = 283/393 (72%), Gaps = 26/393 (7%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F+              
Sbjct  1     MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDAFS--------------  46

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
               SFF KVML +A DYQV ++LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD 
Sbjct  47    --SFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  104

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
              SK+LGRREIYV  RGT+ + EWINV  A+P SA+PLL       +           KVM
Sbjct  105   RSKSLGRREIYVALRGTSRNYEWINVLGARPTSADPLLTGPVQNGSGS---------KVM  155

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW T+YTS    S+FT +S R QL TK++EL  KYK E  SI LTGHSLGA+ A+LAA+
Sbjct  156   LGWLTIYTSDHAESKFTKMSLRLQLLTKMKELLLKYKDEKPSIVLTGHSLGATEAVLAAY  215

Query  705   DLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             D+ EN  +D +PVT IVFG PQ+GNK F   +T   NLKILH+RN ID++  YPG LLGY
Sbjct  216   DIAENASSDDVPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHVRNTIDLLTRYPGGLLGY  275

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G  FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ GEF+L VKR +ALVNKS
Sbjct  276   VDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKKGEFKLMVKRSIALVNKS  335

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLG  250
             CEFLK+E  +PGSWW+EKNK M+ DENGEWV+ 
Sbjct  336   CEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  368



>emb|CDY47985.1| BnaA04g24630D [Brassica napus]
Length=378

 Score =   479 bits (1234),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 236/393 (60%), Positives = 282/393 (72%), Gaps = 26/393 (7%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYDSF+              
Sbjct  1     MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDSFS--------------  46

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
               SFF KVML +A DYQV ++LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD 
Sbjct  47    --SFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  104

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
              +KALGRREIYV  RGT+ + EWINV  A+P SA+PLL       +           KVM
Sbjct  105   RTKALGRREIYVALRGTSRNYEWINVLGARPTSADPLLTGPEQNGSGS---------KVM  155

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW T+YTS    S+FT +S R QL TKI+EL  KYK E  SI LTGHSLGA+ A+LAA+
Sbjct  156   LGWLTIYTSDHAESKFTKMSLRLQLLTKIKELLLKYKDEKPSIVLTGHSLGATEAVLAAY  215

Query  705   DLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             D+ EN  +D  PVT IVFG PQ+GNK F   +T   NLKILH+RN ID++  YPG LLGY
Sbjct  216   DIAENASSDDYPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHVRNTIDLLTRYPGGLLGY  275

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G  FVID +KS  LK+S NP DWHNLQAMLHVVAGWNG+ G+F+L VKR +ALVNKS
Sbjct  276   VDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKKGDFKLMVKRSIALVNKS  335

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLG  250
             CEFLK+E  +PGSWW+EKNK M+ DENGEWV+ 
Sbjct  336   CEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  368



>ref|XP_010413021.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   478 bits (1231),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 229/405 (57%), Positives = 292/405 (72%), Gaps = 16/405 (4%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPTWEELLGLDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSTYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y V ++LYAT++++  EAF L S SRESWDRE+NWIGY+AVTSD  + 
Sbjct  63    FFHKVMLDDARHYDVVSFLYATSRVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK  S + LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGHG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +PNS FT +SAR QL TKI+EL   YK E  SI  TGHSLGA++A LAAFD+ 
Sbjct  171   FTIYTTANPNSPFTKMSARSQLLTKIKELLELYKDEKPSIVFTGHSLGATVATLAAFDIA  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN   G +D+ PVTAIVFGSP++GN+ F   +    N ++LH++N+ID+I  YP  ++GY
Sbjct  231   ENVTSGYSDVPPVTAIVFGSPRVGNREFSDRIKRHNNARVLHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G +  ID R S  LK + +P DWHNLQAMLHVVAGWNG++G+FE+KV R +ALVNKS
Sbjct  291   VNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWNGKNGKFEMKVNRNIALVNKS  350

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             C  L+EE  +P  WW+EKNK M+  E+G+WV+ +P+DED P+ E+
Sbjct  351   CSLLREECLVPECWWVEKNKGMLKTEDGDWVIATPDDEDKPIIEF  395



>ref|XP_010512889.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   478 bits (1230),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 292/405 (72%), Gaps = 16/405 (4%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPTWEELLGLDNWQNLLEPLDHSLRKLILRAGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVTSD  + 
Sbjct  63    FFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK  S + LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGDG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +PNS FT +SAR QL TKI+EL   YK E  SI  TGHSLGA++A LAAFD+ 
Sbjct  171   FTIYTTANPNSPFTKMSARSQLLTKIKELLELYKDEKPSIVFTGHSLGATVATLAAFDIA  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN   G +D+ PVTAIVFGSP++GN+ F   +    N+++LH++N+ID+I  YP  ++GY
Sbjct  231   ENVTSGYSDVPPVTAIVFGSPRVGNREFSDRVKRHNNVRVLHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G +  ID R S  LK + +P DWHNLQAMLHVVAGWNG++G+FE+KV R +ALVNKS
Sbjct  291   VNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWNGKNGKFEMKVNRNIALVNKS  350

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             C  LKEE  +P  WW+EKNK M+  E+G+WV+ + +DED PV E+
Sbjct  351   CSLLKEECLVPKCWWVEKNKGMLKTEDGDWVMATLDDEDKPVVEF  395



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   476 bits (1224),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 230/410 (56%), Positives = 301/410 (73%), Gaps = 12/410 (3%)
 Frame = -1

Query  1431  QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCR  1252
             +++   P+W +LLGS++W GLLDPL+LSLR L+L+CGD CQ TYDSF++D +SKY GSCR
Sbjct  4     KAVTRSPSWPELLGSKHWSGLLDPLDLSLRRLLLQCGDMCQVTYDSFDNDPHSKYCGSCR  63

Query  1251  YGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
             YG+ +   KV+ P A  Y V  Y YATAQ+ +P+ F L S +R++W +ESNW+GYVAV++
Sbjct  64    YGRRTLLDKVLFPYAASYSVSGYFYATAQVGLPDHFFLFSYARDAWSKESNWMGYVAVST  123

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             DA ++A GRREIYV +RGT   LEW++V   + +  + +L S      ++++      PK
Sbjct  124   DAAARATGRREIYVAWRGTIRTLEWVDVLEPELLPVDSILSSKKEATAEEEK------PK  177

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             VM GW  +YTS +PNS + T SAREQL  KI+EL   YK E+LSI   GHSLGA+LAIL+
Sbjct  178   VMKGWFVIYTSSNPNSSYNTQSAREQLVAKIKELVEVYKDESLSIVCVGHSLGAALAILS  237

Query  711   AFDLCENGVTDI------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             AFD+ ENG++ +      PV A+VFGSPQIGNK F+  + +  NL++LH+RNKID+IP Y
Sbjct  238   AFDIVENGLSKVGDKEEFPVCAMVFGSPQIGNKAFNDRLEKLPNLRVLHVRNKIDLIPLY  297

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P  LLG+V +G    ID RKS  LK+S  P DWHNLQ +LHVVAGWNG++GEFELKVKR 
Sbjct  298   PSGLLGFVNTGTVLEIDTRKSPYLKDSRFPGDWHNLQGILHVVAGWNGDEGEFELKVKRS  357

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             V LVNKS E+LK+E  +PGSWW+EKNK MVL+E+GEWVL +P DED PVP
Sbjct  358   VGLVNKSSEYLKDEYLVPGSWWVEKNKGMVLEEDGEWVLAAPTDEDAPVP  407



>ref|XP_008807980.1| PREDICTED: phospholipase A1-II 5 [Phoenix dactylifera]
Length=450

 Score =   475 bits (1223),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 293/407 (72%), Gaps = 11/407 (3%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A  P+W  LLGS  W GLLDPL+LSLR L+L+CGDFCQ TYDSFN D +SKY GSCRY K
Sbjct  6     AATPSWQDLLGSNQWAGLLDPLDLSLRRLLLQCGDFCQVTYDSFNSDQHSKYCGSCRYSK  65

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             ++   +V  PSA D+ V  YLYAT+Q+ +P+ FLL SRS E+W +ESNWIGY+AV+SDA 
Sbjct  66    SNLLSRVFFPSAADFSVAEYLYATSQIDLPDGFLLFSRSDEAWSKESNWIGYIAVSSDAA  125

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             +   GRREIYV +RGT   LEW++VF  + V  + +L S+  G  DD E     VPKVM 
Sbjct  126   ALKTGRREIYVAWRGTIRTLEWVDVFQPELVPIDSILSSTQKGSADDDE-----VPKVMK  180

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             GW+ +YTS +P S F   SAR+QL  +I  L  +YK E+LSI   GHSLGASLAIL+AFD
Sbjct  181   GWYVIYTSSNPKSPFNKESARDQLLARIRALVEQYKNESLSIICVGHSLGASLAILSAFD  240

Query  702   LCENGVTDI------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             + ENG++ I       V A+VFGSPQIGNK F+  + +  NL++L ++NKID+IP YP  
Sbjct  241   MVENGLSKIGENSHVQVCAMVFGSPQIGNKAFNDRLEKLPNLRVLRVKNKIDLIPLYPSG  300

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             LLGY  +G E V+D RKS  LK+S NPSDWHNLQ +L  VAGWNGEDGEFE KVKR +AL
Sbjct  301   LLGYAYTGEELVVDARKSPYLKDSKNPSDWHNLQGILQAVAGWNGEDGEFEFKVKRSIAL  360

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             VNKS E+LK+E  IPGSWW+E+NK MV  E+G+W L  P  EDLPVP
Sbjct  361   VNKSSEYLKDEYLIPGSWWVEQNKGMVPGEDGDWYLAPPAAEDLPVP  407



>ref|XP_002881868.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58127.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   473 bits (1216),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 232/410 (57%), Positives = 293/410 (71%), Gaps = 21/410 (5%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EPTW +LLG +NW+ +L+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPTWEELLGRDNWQNILEPLDHSLRQLILRTGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y+V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVTSD  + 
Sbjct  63    FFHKVMLDDARHYEVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK  S + LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGDG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +PNS FT +SAR QL TKI+EL   YK EN SI  TGHSLGA++A LAAFD+ 
Sbjct  171   FTIYTTANPNSPFTKMSARSQLLTKIKELLEIYKDENPSIVFTGHSLGATIATLAAFDIG  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN   G  ++ PVTAIVFGSP++GN+ F   +    N++ILH++N+ID+I  YP  ++GY
Sbjct  231   ENVTSGYGNVPPVTAIVFGSPRVGNREFWDRIKGHNNVRILHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQ-----AMLHVVAGWNGEDGEFELKVKRCVA  364
             V  G +  ID R S  LK + +P DWHNLQ     AMLHVVAGWNG++G+FE+KV R +A
Sbjct  291   VNIGTKLKIDSRVSPFLKETHHPGDWHNLQASHSIAMLHVVAGWNGKNGKFEMKVNRNIA  350

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             LVNKSC  LKEE  +P  WW+EKNK M+  E G+WV+ +P+DED PV E+
Sbjct  351   LVNKSCALLKEECLVPECWWVEKNKGMLKTEGGDWVMATPDDEDKPVVEF  400



>ref|XP_010925003.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=449

 Score =   470 bits (1210),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/429 (57%), Positives = 301/429 (70%), Gaps = 18/429 (4%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A  P W +LLGS +W GLLDPLNLSLR L+L+CGD CQ TYDSFN D +SKY GSCRY K
Sbjct  6     AATPPWQELLGSNHWAGLLDPLNLSLRRLLLQCGDLCQVTYDSFNSDQHSKYCGSCRYSK  65

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             ++   KV  PSA D+ V  YLYAT+Q+ +P   LL S S E+W +ESNWIGYVAV+SDA 
Sbjct  66    STLLSKVFFPSAADFSVVEYLYATSQIGLPNDLLLFSLSDEAWSKESNWIGYVAVSSDAA  125

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             +   GRREIYV +RGT   LEW++V   + V  + +L S+  G  DD+E     +PKVM 
Sbjct  126   ALQTGRREIYVAWRGTIRTLEWVDVAMPELVPIDSILSSTQKGSADDEE-----IPKVMK  180

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             GW+ +YTS DP SRF   SAR QL   I++L  ++K E++SI   GHSLGASLAIL+AFD
Sbjct  181   GWYMIYTSSDPQSRFNKESARNQLLANIKQLVERHKNESVSIICVGHSLGASLAILSAFD  240

Query  702   LCENGVTDI------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             + ENG++ I       V A+VFGSPQIGNK F+  + +  NL++LH +NKID+IP+YP  
Sbjct  241   IVENGLSKIGENSYVQVCAMVFGSPQIGNKAFNGRLEKLPNLRVLHTKNKIDLIPKYPSG  300

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             LLGY  +G+E V+D RKS  LK+S NPSDWHNLQ +L  VAGWNGEDGEFE KVKR VAL
Sbjct  301   LLGYAYTGVELVVDARKSPYLKDSKNPSDWHNLQGILQAVAGWNGEDGEFEFKVKRSVAL  360

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPV-PEY*GQTILTG*G  184
             VNKS E+LK+E  IPGSWW+EKNK MVL  +GEW L SP  ED PV P +         G
Sbjct  361   VNKSSEYLKDEYLIPGSWWVEKNKGMVLGADGEWYLASPAPEDFPVLPSF------KAAG  414

Query  183   SVSKTVLIT  157
              V+ T ++T
Sbjct  415   DVASTAVVT  423



>emb|CDY50817.1| BnaC04g52540D [Brassica napus]
Length=392

 Score =   464 bits (1194),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 225/405 (56%), Positives = 288/405 (71%), Gaps = 20/405 (5%)
 Frame = -1

Query  1416  EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNS  1237
             EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ RYGK S
Sbjct  3     EPSWEELLGQDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  1236  FFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             FFHKVML  A  Y V ++LYATA+++  EAF L S SRESWDRE+NWIGY+ VTSD  + 
Sbjct  63    FFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYITVTSDERTA  122

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              +GRREIYVVFRGTT + EW+NV  AK  S E LL     G            P+VM GW
Sbjct  123   EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVEELLMDGRDG------------PEVMLGW  170

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              T+YT+ +P+S FT +SAR QL TKI EL   YK E  SI LTGHSLGA++A LAA DL 
Sbjct  171   FTIYTTANPDSPFTKMSARSQLLTKIRELLELYKDEKPSIVLTGHSLGATIATLAALDLA  230

Query  696   EN---GVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             EN   G +D+ PVTAIVFGSP++GN+ F   +    N++ILH++N+ID+I  YP  ++GY
Sbjct  231   ENVTSGSSDVTPVTAIVFGSPRVGNREFLNRINRHDNVRILHVKNEIDLITRYPAKIMGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
             V  G +  ID R S  LK + +P DWHNLQA    +AGWNG++ ++E+KV R +ALVNKS
Sbjct  291   VNIGTKLKIDTRVSPYLKETHHPGDWHNLQA----IAGWNGKNQKYEMKVNRSIALVNKS  346

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             C  LKEE  +P  WW+EKNK M+ +E+G+WV+ +P+DED+PV E+
Sbjct  347   CALLKEECLVPECWWVEKNKGMLKNEDGDWVMATPHDEDMPVVEF  391



>ref|XP_010689845.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=426

 Score =   462 bits (1190),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 233/412 (57%), Positives = 286/412 (69%), Gaps = 14/412 (3%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             PTW  LLGS NW+ LLDPLN  LR LILRCGDFCQ TYD+F +D NS Y G+ RY K   
Sbjct  16    PTWQHLLGSHNWDHLLDPLNEDLRRLILRCGDFCQVTYDTFINDPNSAYCGASRYAKADL  75

Query  1233  FHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
               K   P  +D Y V  +LYATA+++VPEAFL  S SRE WDRESNWIGY+AV++D VS 
Sbjct  76    LKKTAFPGGSDKYDVVGFLYATARVSVPEAFLFKSMSRERWDRESNWIGYIAVSNDEVSN  135

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS-----------TSGdnddkeed  910
              +GRREIYV +RGTT + EWI+V  AK  SA PLL                 +++D +E 
Sbjct  136   EIGRREIYVAWRGTTRNYEWIDVLGAKLQSAMPLLSEGGDHDHNENGEDDEDEDEDHDEH  195

Query  909   ddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGA  730
               ++PKVM GW T+YTS D  S FT LSAR Q+  KI++L  +YK E LSI LTGHSLGA
Sbjct  196   GHRLPKVMKGWLTIYTSDDEKSPFTKLSARAQISNKIKQLIDQYKDEELSIILTGHSLGA  255

Query  729   SLAILAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             +L++++AFD+ EN   +IPV+AIVFG P++GNK F   +    NLKILH+RN ID IP Y
Sbjct  256   TLSVISAFDIVENITREIPVSAIVFGCPKVGNKSFKNRVNLHPNLKILHVRNVIDTIPLY  315

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P  L+GYV  G E  ID RKS  LK+S +  DWHNLQAMLH+V GW G   EF L ++R 
Sbjct  316   PARLMGYVHIGTELEIDSRKSPYLKHSRHVGDWHNLQAMLHIVNGWQGIKEEFRLVIERS  375

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             +ALVNKSC++LKEE  +P SWW+EKNK MVL+E GEWVL  P  E+ PVPE+
Sbjct  376   IALVNKSCDYLKEECLVPPSWWVEKNKGMVLNERGEWVLAGP--EEGPVPEF  425



>ref|XP_010925002.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=440

 Score =   455 bits (1171),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 227/407 (56%), Positives = 291/407 (71%), Gaps = 11/407 (3%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A  P+W +LLGS +W GLLDPL+LSLR L+L+CGD CQ TYDSFN D +SKY GSCRY K
Sbjct  6     AATPSWQELLGSNHWAGLLDPLDLSLRRLLLQCGDLCQVTYDSFNSDKHSKYCGSCRYSK  65

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             ++  +KV  PSA D+ V  YLYAT+Q+ +P+ FLL      +W ++SNWIGY+AV+SDA 
Sbjct  66    STLLNKVFFPSAADFSVVDYLYATSQIGLPDDFLLFPICDGAWSKDSNWIGYIAVSSDAA  125

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             +   GRREIYV +RGT   LEW++V   + V  + +L S+           DD+VPKVM 
Sbjct  126   ALKNGRREIYVAWRGTIRPLEWVDVAMPQLVPIDSILSSTQR-----CWAHDDEVPKVMK  180

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             GW+ +YTS DP S F   SAR+QL  KI++L  +YK E++SI   GHSLGASLA L+AFD
Sbjct  181   GWYIIYTSSDPQSPFNKQSARDQLLPKIKQLVERYKNESVSIICVGHSLGASLATLSAFD  240

Query  702   LCENGVTDI------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             + ENG++ I       V A+VFGSPQIGNK F   +    NL++LH +NKID+IP+YP  
Sbjct  241   IVENGLSKIGENNHAQVCAMVFGSPQIGNKAFKDRLERLPNLRVLHTKNKIDLIPQYPSG  300

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             LLGYV +G+E V+D RKS  LK+S N  DWHNLQ +L  VAGWNGEDGEF+ +V+R +AL
Sbjct  301   LLGYVFAGVELVVDTRKSPYLKDSTNTGDWHNLQGILQAVAGWNGEDGEFKFQVERSIAL  360

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             VNKSC++LK+E  IPG WW+EKNK MVL+E+GEW L  P  EDLP+P
Sbjct  361   VNKSCDYLKDEYLIPGLWWVEKNKGMVLEEDGEWYLAPPAAEDLPLP  407



>ref|XP_004969721.1| PREDICTED: phospholipase A1-II 5-like [Setaria italica]
Length=459

 Score =   442 bits (1136),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 214/400 (54%), Positives = 275/400 (69%), Gaps = 13/400 (3%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             +W +LLGS++W+GLLDPL+L+LR LIL CGD CQ TYDSFN DS+SKY GSCRY +++ F
Sbjct  22    SWPELLGSKHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGSCRYSRSTLF  81

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              + + P+A D    AYLY T+Q + P   ++ S SRE+W +ESNWIGYV+V++DA + A 
Sbjct  82    ARTLFPAAADVTPAAYLYGTSQASFPGGVMVFSLSREAWSKESNWIGYVSVSTDAAAAAT  141

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             G+R IYV  RGT   LEW++V     V  + +L     G +           +VM GW+ 
Sbjct  142   GQRVIYVALRGTIRTLEWVDVLKPDLVFPDAILPEGHPGAHA----------RVMKGWYL  191

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS D  S F   SAR+QL   +  L ++YKGE+LS+  TGHSLGASLA LAAFD+  N
Sbjct  192   IYTSSDERSPFNKHSARDQLVAAVRGLAARYKGESLSVVCTGHSLGASLATLAAFDIAAN  251

Query  690   GV--TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSG  517
             GV   D+PVTAIVFGSPQIGN  F +   E  NL+ LH+RNK D+IP YP  LLGY   G
Sbjct  252   GVCGADVPVTAIVFGSPQIGNPEFKERFDELPNLRALHVRNKPDLIPLYPSGLLGYANVG  311

Query  516   LEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEF  340
                 +D +KS  LK N+ N  D+HNLQA+LH VAGWNG+DGEF+L+V R VALVNKSC F
Sbjct  312   DVLPVDSKKSPYLKENTTNVGDYHNLQAILHTVAGWNGKDGEFKLQVHRSVALVNKSCAF  371

Query  339   LKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             LK++  +P SWW+E+NK MV+ E G W L  P +E+LPVP
Sbjct  372   LKDDNLVPESWWVERNKGMVIGETGLWQLEPPAEENLPVP  411



>ref|XP_003569665.1| PREDICTED: phospholipase A1-II 5 [Brachypodium distachyon]
Length=471

 Score =   437 bits (1125),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/426 (51%), Positives = 281/426 (66%), Gaps = 18/426 (4%)
 Frame = -1

Query  1470  SAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSF  1291
             S  + +  + +   +  T P W +LLGS +W+GLLDPLNL+LR LIL CGD CQ TYDSF
Sbjct  4     SQGVLLSSALVGAGANGTTPAWPELLGSAHWDGLLDPLNLTLRRLILLCGDLCQVTYDSF  63

Query  1290  NHDSNSKYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWD  1111
             N DS+SKY G+CR+ + + F +   P+A D  V A LYATAQ ++P   +++S SRE+W 
Sbjct  64    NSDSHSKYCGTCRFSRATLFSRTQFPAAADVSVAANLYATAQTSLPAGLMVYSLSREAWS  123

Query  1110  RESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGd  931
             +ESNWIGYVAV++DA + A G+R IYV  RGT  +LEW++V     V+ + +L  S    
Sbjct  124   KESNWIGYVAVSTDAAAAATGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAILPESDPAR  183

Query  930   nddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYK---GENLS  760
                         +VM GW+ +YTS D  S F+  SAR+QL   + EL +KYK   GE+LS
Sbjct  184   GHA---------RVMKGWYVIYTSSDERSPFSKYSARDQLLAAVRELVAKYKGKVGESLS  234

Query  759   ITLTGHSLGASLAILAAFDLCENGVTD-----IPVTAIVFGSPQIGNKLFDKLMTEKTNL  595
             I  TGHSLGASLA L AFD+  NGV+      +PV AIVFGSPQ+GN  F K   E  NL
Sbjct  235   IVCTGHSLGASLATLCAFDMVVNGVSKVGDAHVPVAAIVFGSPQVGNPEFKKRFDELPNL  294

Query  594   KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVA  418
             + LH+RNK D+IP YP  LLGY   G    +D +KS  LK ++ N  D+HNLQ +LH VA
Sbjct  295   RALHVRNKPDLIPLYPSNLLGYANVGDVLSVDSKKSPHLKPDTTNVGDYHNLQGILHTVA  354

Query  417   GWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPND  238
             GWNG+DGEF+L+V R VALVNKS  FLK+E  +P SWW+EKNK MVL   GEW L  P +
Sbjct  355   GWNGKDGEFKLQVNRSVALVNKSSAFLKDENLVPESWWVEKNKGMVLGVTGEWQLEQPAE  414

Query  237   EDLPVP  220
             E+LPVP
Sbjct  415   ENLPVP  420



>ref|XP_002458388.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
 gb|EES03508.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
Length=473

 Score =   434 bits (1116),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 218/419 (52%), Positives = 282/419 (67%), Gaps = 22/419 (5%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             +W +LLGS +WEGLLDPL+L+LR LIL CGD CQ TYDSFN D +SKY+GSCRY +++ F
Sbjct  22    SWPELLGSAHWEGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDPHSKYSGSCRYSRSTLF  81

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              + + P+A D    AYLYAT+Q + P   ++ S SRE+W +ESNWIGYV+V++DA + A 
Sbjct  82    ARTLFPAAADISPAAYLYATSQSSFPGGIMVFSLSREAWSKESNWIGYVSVSTDAAAAAT  141

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             G+R IYV +RGT   LEW++V   + VS + +L                   +VM GW+ 
Sbjct  142   GQRVIYVAWRGTIRTLEWVDVLKPELVSPDAILPEGDPSRGQA---------RVMEGWYL  192

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKY--KGENLSITLTGHSLGASLAILAAFDLC  697
             +YTS D  S F+  SAREQL   + EL ++Y  K E+LSI  TGHSLGASLA L AFD+ 
Sbjct  193   IYTSSDERSPFSRYSAREQLLAAVRELVARYKDKDESLSIVCTGHSLGASLATLCAFDIA  252

Query  696   ENGVT-----DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
              NGV+     DIPVTAIVFGSPQIGN  F K   E  NL+ LH+RN  D+IP YP  LLG
Sbjct  253   VNGVSRVGGADIPVTAIVFGSPQIGNPEFKKRFEELPNLRALHVRNTPDLIPLYPSGLLG  312

Query  531   YVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             Y  +G    +D +KS  +K +S N  D+HNLQ +LH VAGWNG+DGEF+L+V+R VALVN
Sbjct  313   YANAGDVLAVDSKKSPYVKDDSTNLGDYHNLQGILHTVAGWNGKDGEFKLQVQRSVALVN  372

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY*GQTILTG*GSV  178
             KS  FLK++  +P SWW+E+NK MV+ E G W L  P +E+LPVP      ++TG G V
Sbjct  373   KSSAFLKDDNLVPESWWVERNKGMVIGETGLWELEPPAEENLPVP-----PVVTGNGKV  426



>emb|CDM83808.1| unnamed protein product [Triticum aestivum]
Length=462

 Score =   426 bits (1096),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 271/404 (67%), Gaps = 15/404 (4%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN D++SKY G+CR+ + + 
Sbjct  22    PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDAHSKYCGTCRFSRATL  81

Query  1233  FHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             F +   P+A D  V A LYATA   +P   ++HS SRE+W +ESNWIGYVAV++DA + A
Sbjct  82    FSRTQFPAAADVSVAANLYATAATWLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
              G+R IYV  RGT  +LEW++V     V+ + +L                   +VM GW+
Sbjct  142   TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAILPEGDPARGHA---------RVMKGWY  192

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              +YTS D  S F+  SAR+QL   + EL +KYKGE+LSI  TGHSLGASLA L AFD+  
Sbjct  193   VIYTSTDERSPFSKYSARDQLLATVRELVAKYKGESLSILCTGHSLGASLATLCAFDMVA  252

Query  693   NGVTDI-----PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             NGV+ +     PVTAIVFGSPQ+GN  F K   E   L+ LH+RNK D+IP YP  LLGY
Sbjct  253   NGVSKVGDAHFPVTAIVFGSPQVGNPEFKKRFDELPGLRALHVRNKPDLIPLYPSNLLGY  312

Query  528   VKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
                G E  ++ +KS  ++ ++ N  D+HNLQ +LH VAGWNGE GEF+L+V R VALVNK
Sbjct  313   ANVGDELSVNSKKSPHVRPDTTNVGDYHNLQGILHTVAGWNGEKGEFKLQVNRSVALVNK  372

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             S  FLK++  +P SWW+E+NK MVL   GEW L  P +E+LPVP
Sbjct  373   SSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEQPAEENLPVP  416



>ref|NP_001044041.1| Os01g0710700 [Oryza sativa Japonica Group]
 sp|Q5NAI4.1|PLA5_ORYSJ RecName: Full=Phospholipase A1-II 5 [Oryza sativa Japonica Group]
 dbj|BAD81525.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05955.1| Os01g0710700 [Oryza sativa Japonica Group]
 dbj|BAG91498.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96630.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   426 bits (1095),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 270/402 (67%), Gaps = 15/402 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN DS+SKY G+CR+ +++   
Sbjct  20    WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRSTLLD  79

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P+A D  V AYLYAT+  T     +++S SRE+W +ESNWIGYVAV++DA + A G
Sbjct  80    RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  139

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             +R IYV +RGT   LEW++V     V  + +L     G             +VM GW+ +
Sbjct  140   QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDILPEGHPGRGRS---------RVMKGWYLI  190

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             Y+S D  S F+  SAR+Q+   + EL ++Y+ E+L +  TGHSLGASLA L AFD+  NG
Sbjct  191   YSSTDERSPFSKYSARDQMLAAVRELVARYRNESLGVVCTGHSLGASLATLCAFDIVVNG  250

Query  687   VTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             V+       IPVTA+VFGSPQIGN  F K   E+ NL+ LH+RN  D+IP YP  LLGY 
Sbjct  251   VSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNLRALHVRNMPDLIPLYPSGLLGYA  310

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
               G    +D +KS  +K   +P D+HNLQ +LH VAGWNG+DGEF+L+VKR VALVNKS 
Sbjct  311   NVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAGWNGKDGEFKLQVKRSVALVNKSS  370

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
              FLK+   +P SWW+E+NK MVL +NGEW L  P +E+LPVP
Sbjct  371   GFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEENLPVP  412



>gb|EMS63050.1| Phospholipase A1-II 5 [Triticum urartu]
Length=510

 Score =   427 bits (1099),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 211/414 (51%), Positives = 274/414 (66%), Gaps = 20/414 (5%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             P W +LLGS +W+GLLDPL+L+LR L+L CGD CQ TYDSFN D +SKY G+CR+ + + 
Sbjct  70    PAWPELLGSAHWDGLLDPLDLTLRRLVLLCGDLCQVTYDSFNSDPHSKYCGTCRFSRATL  129

Query  1233  FHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             F +   P+A D  V A LYATA   +P   ++HS SRE+W +ESNW+GYVAV++DA + A
Sbjct  130   FSRTQFPAAADVSVAANLYATAATWLPPGLMVHSLSREAWSKESNWVGYVAVSTDAAAAA  189

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
              G+R IYV  RGT  +LEW++V     V+ + +L                   +VM GW+
Sbjct  190   TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAILPEGDPARGHA---------RVMKGWY  240

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              +YTS D  S F+  SAR+QL   + EL +KYKGE+LSI  TGHSLGASLA L AFD+  
Sbjct  241   VIYTSTDERSPFSKYSARDQLLAAVRELVAKYKGESLSIVCTGHSLGASLATLCAFDMVA  300

Query  693   NGVTDI-----PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             NGV+ +     PVTAIVFGSPQ+GN  F K   E   L+ LH+RNK D+IP YP  LLGY
Sbjct  301   NGVSKVGDAHFPVTAIVFGSPQVGNPEFRKRFDELPGLRALHVRNKPDLIPLYPSNLLGY  360

Query  528   VKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
                G E  ++ +KS  ++ ++ N  D+HNLQ +LH VAGWNGE GEF+L+V R VALVNK
Sbjct  361   ANVGDELSVNSKKSPHVRPDTTNVGDYHNLQGILHTVAGWNGEKGEFKLQVNRSVALVNK  420

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY*GQTILTG  190
             S  FLK++  +P SWW+E+NK MVL   GEW L  P +E+LPVP      +LTG
Sbjct  421   SSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEQPAEENLPVPP-----VLTG  469



>sp|B8A8C9.1|PLA5_ORYSI RecName: Full=Phospholipase A1-II 5 [Oryza sativa Indica Group]
 gb|EEC71366.1| hypothetical protein OsI_03470 [Oryza sativa Indica Group]
Length=465

 Score =   425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 270/402 (67%), Gaps = 15/402 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN DS+S+Y GSCR+ + +   
Sbjct  20    WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSRYCGSCRFSRATLLD  79

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P+A D  V AYLYAT+  T     +++S SRE+W +ESNWIGYVAV++DA + A G
Sbjct  80    RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  139

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             +R IYV +RGT   LEW++V     V  + +L     G             +VM GW+ +
Sbjct  140   QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDILPEGHPGRGRS---------RVMKGWYLI  190

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             Y+S D  S F+  SAR+Q+   + EL ++Y+ E+LS+  TGHSLGASLA L AFD+  NG
Sbjct  191   YSSTDERSPFSKYSARDQMLAAVRELVARYRNESLSVVCTGHSLGASLATLCAFDIVVNG  250

Query  687   VTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             V+       IPVTA+VFGSPQIGN  F K   E+ NL+ LH+RN  D+IP YP  LLGY 
Sbjct  251   VSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNLRALHVRNTPDLIPLYPSGLLGYA  310

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
               G    +D +KS  +K   +P D+HNLQ +LH VAGW+G+DGEF+L+VKR VALVNKS 
Sbjct  311   NVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAGWDGKDGEFKLQVKRSVALVNKSS  370

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
              FLK+   +P SWW+E+NK MVL +NGEW L  P +E+LPVP
Sbjct  371   GFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEENLPVP  412



>ref|XP_008675114.1| PREDICTED: phospholipase A1-II 5 [Zea mays]
 tpg|DAA57900.1| TPA: hypothetical protein ZEAMMB73_499727 [Zea mays]
Length=469

 Score =   423 bits (1088),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/392 (53%), Positives = 268/392 (68%), Gaps = 15/392 (4%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             +W +LLGS +WEGLLDPL+L+LR LIL CGD CQ TYDSFN D++SKY GSCRY +++ F
Sbjct  22    SWPELLGSAHWEGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDTHSKYCGSCRYSRSTLF  81

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              + + P+A D    AYLYAT+Q + P   ++ S SRE+W++ESNWIGYV+V++DA + A 
Sbjct  82    ARTLFPAAADIFPAAYLYATSQSSFPGGIMVFSLSREAWNKESNWIGYVSVSTDAAAAAT  141

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             G+R IYV +RGT   LEW++V   + VS + +L                   +VM GW+ 
Sbjct  142   GQRVIYVAWRGTIRTLEWVDVLKPELVSPDAILPEGDPARGHA---------RVMEGWYL  192

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS D  S F+  SAREQL   + EL ++YKGE+LSI  TGHSLGASLA L+AFD   N
Sbjct  193   IYTSSDERSPFSKYSAREQLLAAVRELVARYKGESLSIVCTGHSLGASLATLSAFDFAVN  252

Query  690   GVT-----DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             GV+     DIPVTAIVFGSPQIGN  F K   E  NL+ LH+RN  D+IP YP  LLGY 
Sbjct  253   GVSRVGGADIPVTAIVFGSPQIGNPEFKKRFEELPNLRALHVRNMPDVIPLYPSGLLGYA  312

Query  525   KSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
              +G    +D +KS  +K +S N  D+HNLQ +LH VAGWNG+DGEF+L+V R VALVNKS
Sbjct  313   NAGDLLAVDSKKSPYVKHDSTNVGDYHNLQGILHTVAGWNGKDGEFKLQVHRSVALVNKS  372

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
               FL ++  +P SWW+E+NK MV+ E G W L
Sbjct  373   SAFLTDDNLVPESWWVERNKGMVIGETGLWQL  404



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   420 bits (1079),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 267/414 (64%), Gaps = 17/414 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  + GS+NWEGLL+PL+  LR  IL  GD  QATYD+FN D +SK+ GS RYGK  FF 
Sbjct  11    WRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYGKKDFFQ  70

Query  1227  KVMLPSADD---YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L + DD   Y+V  +LYAT++L +P+AF+L S SRE+W RESNWIGYVAV +D   +
Sbjct  71    KVSLATGDDEWNYEVTRFLYATSRLELPQAFMLKSLSREAWSRESNWIGYVAVATDRGKQ  130

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV-------  898
              LGRREI V +RGT  DLEW +VF+  PVS  P+L      D+D      D+V       
Sbjct  131   RLGRREIVVAWRGTIRDLEWSDVFNPIPVSIAPILSQEQRHDHDHDHHWYDRVLHLVDEE  190

Query  897   -PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
              PKVM GW  +YTS DP S FT  SAREQ   +I+ L   YK E LSITL GHSLGA+LA
Sbjct  191   EPKVMNGWFVIYTSTDPKSPFTKSSAREQFLAEIKRLVELYKDEELSITLVGHSLGAALA  250

Query  720   ILAAFDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
             IL+ FD+ ++G+T      +IPVTA V G P +GN  F K       L++L I N  D+I
Sbjct  251   ILSGFDIVQSGLTSVPGKPNIPVTAFVVGCPGVGNAAFKKRFEALPGLRVLRIVNLPDLI  310

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P YPG LL     G    ID RKS  LK+S NPSDWHNLQA LH+VAGW G     + + 
Sbjct  311   PHYPGKLLMSEHVGSHLEIDTRKSPFLKDSKNPSDWHNLQAQLHIVAGWQGPKNPLKFEG  370

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
              R VALVNKSC+FLKEE  IP SWW+EKNK M+ D  G W L  P ++DLP PE
Sbjct  371   NRSVALVNKSCDFLKEECLIPASWWVEKNKGMIQDLKGMWALADPPEDDLPKPE  424



>ref|XP_006644603.1| PREDICTED: phospholipase A1-II 5-like [Oryza brachyantha]
Length=455

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 270/402 (67%), Gaps = 15/402 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS NW+GLLDPL+L+LR LIL CGD CQ TYDSFN DS+SKY G+CR+ + + F 
Sbjct  17    WPELLGSANWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRATLFA  76

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P+A D  V A LYAT+Q T     +++S SRE+W +ESNWIGYVAV++DA + A G
Sbjct  77    RTQFPAAGDLSVAANLYATSQATSFPGSMVYSLSREAWSKESNWIGYVAVSNDAAAAAAG  136

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             +R IYVV+RGT   LEW++V     V  + +L                   +VM GW+ +
Sbjct  137   QRVIYVVWRGTIRSLEWVDVLKPDLVDHDGILPEGHQARGRS---------RVMKGWYLI  187

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS D  S F+  SAR+Q+   + EL ++Y+ E+LSI  TGHSLGASLA L AFD+  NG
Sbjct  188   YTSTDERSPFSKYSARDQMLAAVRELVARYRDESLSIVCTGHSLGASLATLCAFDIVVNG  247

Query  687   VTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             V+       +PV A+VFGSPQIGN  F K   ++ NL+ LH+RN  D+IP YP  LLGY 
Sbjct  248   VSKLRDGAHVPVAAVVFGSPQIGNPEFKKQFEQQPNLRALHVRNMPDLIPLYPSGLLGYA  307

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
               G    +D +KS  +K+  +P D+HNLQ +LH VAGWNG++ EF+L+V R VALVNKS 
Sbjct  308   NVGQVLEVDSKKSPYVKHDTSPGDYHNLQGILHTVAGWNGKNREFKLQVNRSVALVNKSS  367

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
              FLK+   +P SWW+E+NK MVL +NGEW L +P +E+LPVP
Sbjct  368   GFLKDSNLVPESWWVERNKGMVLGQNGEWQLEAPAEENLPVP  409



>gb|EEE55280.1| hypothetical protein OsJ_03214 [Oryza sativa Japonica Group]
Length=647

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 270/402 (67%), Gaps = 15/402 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN DS+SKY G+CR+ +++   
Sbjct  202   WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRSTLLD  261

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P+A D  V AYLYAT+  T     +++S SRE+W +ESNWIGYVAV++DA + A G
Sbjct  262   RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  321

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             +R IYV +RGT   LEW++V     V  + +L     G             +VM GW+ +
Sbjct  322   QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDILPEGHPGRGRS---------RVMKGWYLI  372

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             Y+S D  S F+  SAR+Q+   + EL ++Y+ E+L +  TGHSLGASLA L AFD+  NG
Sbjct  373   YSSTDERSPFSKYSARDQMLAAVRELVARYRNESLGVVCTGHSLGASLATLCAFDIVVNG  432

Query  687   VTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             V+       IPVTA+VFGSPQIGN  F K   E+ NL+ LH+RN  D+IP YP  LLGY 
Sbjct  433   VSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNLRALHVRNMPDLIPLYPSGLLGYA  492

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSC  346
               G    +D +KS  +K   +P D+HNLQ +LH VAGWNG+DGEF+L+VKR VALVNKS 
Sbjct  493   NVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAGWNGKDGEFKLQVKRSVALVNKSS  552

Query  345   EFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
              FLK+   +P SWW+E+NK MVL +NGEW L  P +E+LPVP
Sbjct  553   GFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEENLPVP  594



>dbj|BAJ88202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/404 (52%), Positives = 274/404 (68%), Gaps = 15/404 (4%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN DS+SKY G+CR+ K + 
Sbjct  22    PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDSHSKYCGTCRFSKATL  81

Query  1233  FHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             F +   P+A D  V A LYATA  ++P   ++HS SRE+W +ESNWIGYVAV++DA + A
Sbjct  82    FSRTQFPAAADISVAANLYATAATSLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
              G+R IYV  RGT  +LEW++V     V+ + +L                   +VM GW+
Sbjct  142   TGQRVIYVALRGTIRNLEWVDVLKPDLVTPDTILPEGDPASGHA---------RVMNGWY  192

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              +YTS D  S F+  SAR+QL   + EL +KYKGE+LSI  TGHSLGASLA L AFD+  
Sbjct  193   VIYTSTDERSPFSKYSARDQLLAAVRELVAKYKGESLSIVCTGHSLGASLATLCAFDMVV  252

Query  693   NGVTDI-----PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             NGV+ +     PVTAIVFGSPQ+GN  F K   E  NL++LH+RNK D+IP YP  LLGY
Sbjct  253   NGVSKVRDAHFPVTAIVFGSPQVGNPEFKKRFDELPNLRVLHVRNKPDLIPLYPSNLLGY  312

Query  528   VKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
                G    ++ +KS  ++ ++ N  D+HNLQ +LH VAGWNGE GEF+L+V R VALVNK
Sbjct  313   ANVGDVLSVNSKKSPHVRSDTTNVGDYHNLQGILHTVAGWNGEKGEFKLQVNRSVALVNK  372

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             S  FLK++  +P SWW+E+NK MVL   GEW L  P++E+LPVP
Sbjct  373   SSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEEPSEENLPVP  416



>dbj|BAJ85876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   417 bits (1072),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/404 (52%), Positives = 274/404 (68%), Gaps = 15/404 (4%)
 Frame = -1

Query  1413  PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN DS+SKY G+CR+ K + 
Sbjct  22    PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDSHSKYCGTCRFSKATL  81

Query  1233  FHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             F +   P+A D  V A LYATA  ++P   ++HS SRE+W +ESNWIGYVAV++DA + A
Sbjct  82    FSRTQFPAAADISVAANLYATAATSLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
              G+R IYV  RGT  +LEW++V     V+ + +L                   +VM GW+
Sbjct  142   TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDTILPEGDPASGHA---------RVMNGWY  192

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              +YTS D  S F+  SAR+QL   + EL +KYKGE+LSI  TGHSLGASLA L AFD+  
Sbjct  193   VIYTSTDERSPFSKYSARDQLLAAVRELVAKYKGESLSIVCTGHSLGASLATLCAFDMVV  252

Query  693   NGVTDI-----PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             NGV+ +     PVTAIVFGSPQ+GN  F K   E  NL++LH+RNK D+IP YP  LLGY
Sbjct  253   NGVSKVRDAHFPVTAIVFGSPQVGNPEFKKRFDELPNLRVLHVRNKPDLIPLYPSNLLGY  312

Query  528   VKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
                G    ++ +KS  ++ ++ N  D+HNLQ +LH VAGWNGE GEF+L+V R VALVNK
Sbjct  313   ANVGDVLSVNSKKSPHVRSDTTNVGDYHNLQGILHTVAGWNGEKGEFKLQVNRSVALVNK  372

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVP  220
             S  FLK++  +P SWW+E+NK MVL   GEW L  P++E+LPVP
Sbjct  373   SSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEEPSEENLPVP  416



>gb|KFK37116.1| hypothetical protein AALP_AA4G215000 [Arabis alpina]
Length=346

 Score =   409 bits (1050),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 247/342 (72%), Gaps = 13/342 (4%)
 Frame = -1

Query  1425  MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             MAT  T W +LLGS+NW+ LLDPL+LSLR LILRCGDFCQ TYD+F +D NSKY G+ RY
Sbjct  1     MATTTTSWEELLGSKNWDTLLDPLDLSLRQLILRCGDFCQVTYDAFVNDENSKYCGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK+S F KVML SA  Y V ++LYATA++++PE  LLHS+SR++WDRESNW GY+AVTSD
Sbjct  61    GKSSLFDKVMLESASHYVVTSFLYATARVSLPEGLLLHSQSRDAWDRESNWFGYIAVTSD  120

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR-----SSTSGdnddkeeddd  904
               SKALGRREIYV  RGT+ + EWINV  A+P SAEPLL+     SS SG          
Sbjct  121   ERSKALGRREIYVALRGTSRNYEWINVLGARPTSAEPLLKGPEQTSSGSGVVGAGTTTFG  180

Query  903   KVP------KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGH  742
                      KVM GW T+YTS   +S+FT LS R QL  KI+EL  KYK E  SI LTGH
Sbjct  181   SDSEDEEGCKVMLGWLTIYTSDHADSKFTKLSLRAQLLAKIKELLLKYKDEKPSIVLTGH  240

Query  741   SLGASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKID  565
             SLGA+ A++AA+D+ ENG   D+P+TAIVFG PQ+GN+ F   +T   NLKILH+RNKID
Sbjct  241   SLGATEAVIAAYDIAENGSNGDVPITAIVFGCPQVGNREFRDEVTSHKNLKILHVRNKID  300

Query  564   MIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQ  439
             ++  YPG LLGYV  G+ FVID +KS  LK+S NP DWHNLQ
Sbjct  301   LLTRYPGGLLGYVDIGVNFVIDTKKSPYLKDSRNPGDWHNLQ  342



>dbj|BAH56866.1| AT2G42690 [Arabidopsis thaliana]
Length=384

 Score =   406 bits (1043),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 254/343 (74%), Gaps = 12/343 (3%)
 Frame = -1

Query  1425  MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             MAT  T W +LLGS+NW+ +LDPL+ SLR LILRCGDFCQATYD+F +D NSKY G+ RY
Sbjct  1     MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             GK+SFF KVML +A DY+V  +LYATA++++PE  LL S+SR+SWDRESNW GY+AVTSD
Sbjct  61    GKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSD  120

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSS--------TSGdnddkee  913
               SKALGRREIY+  RGT+ + EW+NV  A+P SA+PLL             G   D + 
Sbjct  121   ERSKALGRREIYIALRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSGGVVEGTTFDSDS  180

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
             +D++  KVM GW T+YTS  P S+FT LS R QL  KI+EL  KYK E  SI LTGHSLG
Sbjct  181   EDEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLG  240

Query  732   ASLAILAAFDLCENGVT-DIPVTAIVFGSPQIGNKLF-DKLMTEKTNLKILHIRNKIDMI  559
             A+ A+LAA+D+ ENG + D+PVTAIVFG PQ+GNK F D++M+ K NLKILH+RN ID++
Sbjct  241   ATEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHK-NLKILHVRNTIDLL  299

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAML  430
               YPG LLGYV  G+ FVID +KS  L +S NP DWHNLQ  +
Sbjct  300   TRYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQVRI  342



>gb|KFK37118.1| hypothetical protein AALP_AA4G215200 [Arabis alpina]
Length=329

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 242/340 (71%), Gaps = 16/340 (5%)
 Frame = -1

Query  1221  MLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALGRR  1042
             ML  A  Y+V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVTSD  +  +GRR
Sbjct  1     MLDDARHYKVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERTAEIGRR  60

Query  1041  EIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTLYT  862
             EIYVVFRGTT + EWINV  AK  S + LL     G            P+VM GW T+YT
Sbjct  61    EIYVVFRGTTRNYEWINVMGAKLTSVKELLLDGEDG------------PEVMLGWFTIYT  108

Query  861   SKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN---  691
             + +P+S FT LSAR QL TKI+EL   YK E  SI LTGHSLGA++A LAAFDL EN   
Sbjct  109   TANPDSPFTKLSARSQLITKIKELLETYKDEKPSIVLTGHSLGATIATLAAFDLAENVTN  168

Query  690   GVTDIP-VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGL  514
               +D+P VTAIVFGSP++GNK F   +    N++ILH++N+ID+I  YP  ++GYV  G 
Sbjct  169   SYSDVPPVTAIVFGSPRLGNKKFSDRINGHNNVRILHVKNEIDLITRYPAKIMGYVNIGT  228

Query  513   EFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLK  334
             +  ID R +  LK + +P DWHNLQAMLHVVAGWNG++G+FELKV R +ALVNKSC  LK
Sbjct  229   KLKIDTRVTPFLKETHHPGDWHNLQAMLHVVAGWNGKNGKFELKVNRNIALVNKSCALLK  288

Query  333   EELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPEY  214
             EE  +P  WW+EKNK M+ +ENG+WV+ +P+DED PV E+
Sbjct  289   EECLVPECWWVEKNKGMLKNENGDWVMATPDDEDKPVVEF  328



>ref|XP_009142882.1| PREDICTED: phospholipase A1-IIdelta-like [Brassica rapa]
Length=336

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/337 (55%), Positives = 232/337 (69%), Gaps = 16/337 (5%)
 Frame = -1

Query  1434  FQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSC  1255
             +  +  EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F +D NS Y G+ 
Sbjct  8     YHQIMAEPSWEELLGQDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSIYCGAS  67

Query  1254  RYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
             RYGK SFFHKVML  A  Y V ++LYATA+++  EAF L S SRESWDRE+NWIGY+AVT
Sbjct  68    RYGKPSFFHKVMLDDARHYDVVSFLYATARVSNHEAFFLSSMSRESWDRETNWIGYIAVT  127

Query  1074  SDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVP  895
             SD  +  +GRREIYVVFRGTT + EW+NV  AK  S E LL     G            P
Sbjct  128   SDERTAEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVEELLMDGRDG------------P  175

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             +VM GW T+YT+ +P+S FT +S R QL TKI EL   YK E  SI LTGHSLGA++A L
Sbjct  176   EVMLGWFTIYTTANPDSPFTKMSGRSQLLTKIRELLELYKDEKPSIVLTGHSLGATIATL  235

Query  714   AAFDLCENGV---TDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             AA DL EN     +D+ PVTAIVFGSP++GN+ F   +    N++ILH++N+ID+I  YP
Sbjct  236   AAVDLAENVTSCSSDVTPVTAIVFGSPRVGNREFLNRINRHDNVRILHVKNEIDLITRYP  295

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQA  436
               ++GYV  G +  ID R S  LK + +P DWHNLQA
Sbjct  296   AKIMGYVNIGTKLKIDTRVSPFLKETHHPGDWHNLQA  332



>ref|XP_010104409.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00254.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=432

 Score =   371 bits (953),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 205/411 (50%), Positives = 271/411 (66%), Gaps = 18/411 (4%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDP-LNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSF  1234
             +W +LLGS NWE LL+P LNLSLR  ILRCG+FC+ATYD+FN +  S   G+ RYG+ +F
Sbjct  15    SWEELLGSNNWEALLEPELNLSLREFILRCGNFCEATYDAFNSNPISPNCGNSRYGEETF  74

Query  1233  FHKVMLPSADDYQVEAYLYATAQL--TVPEAFLLHSRSR-ESWDRESNWIGYVAVTSDAV  1063
             FH V+L  A +YQV A+LYAT+ +  T  + FL  + +  E WDR+SNW+G+VAVT+D +
Sbjct  75    FHDVVLQDASNYQVVAFLYATSGIGDTKKKLFLFSANTELEPWDRQSNWMGFVAVTTDKI  134

Query  1062  SKALGRREIYVVFRGTTTDLEWI-NVFSAKPVSAEPLLRS--STSGdnddkeedddKVPK  892
             S+A+GRRE+YVV+RGT T  EW  N+F   P  A+PLL S   T+   +         PK
Sbjct  135   SQAIGRREVYVVWRGTITTSEWTSNLFQTGPEPAKPLLASDRQTTDRPNFFGIPLKDEPK  194

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  GW ++YTS + NS +TT SAR+QL   I+E+R KYKGE LS+ +TGHSLG S+A L+
Sbjct  195   VHGGWLSIYTSTNLNSIYTTASARDQLHRAIQEIRKKYKGEKLSVVVTGHSLGGSMATLS  254

Query  711   AFDLCENGVT--DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             AFD+ EN +   D+ V+A+VFG PQ+GN  F +L+     LKILHI N  D +P+ P  +
Sbjct  255   AFDIAENKIAGDDVLVSAVVFGCPQVGNVEFKELVDSNPKLKILHIHNIRDKVPDTPDWI  314

Query  537   LG-YVK-SGLEFVIDHRKSTSLKN-SMNP----SDWHNLQAMLHVVAGWNGEDGEFEL-K  382
                Y+     +  ID  +S  LK+ S+ P     D HNL+A LHVVA WNG+  +F+  K
Sbjct  315   FPVYIPIQTADLEIDTNRSPYLKSKSILPLETAGDAHNLEANLHVVAWWNGQFKKFDTPK  374

Query  381   VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDEN-GEWVLGSPNDED  232
             VKR +ALVNKSC FL E L +P  WW+EKNK M  DE+ GEWV   P   D
Sbjct  375   VKRSLALVNKSCRFLVESLKVPEFWWVEKNKGMEYDESTGEWVFDKPPPAD  425



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   365 bits (938),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 189/403 (47%), Positives = 253/403 (63%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGSCRY K SFF 
Sbjct  34    WRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSFFS  93

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  94    KVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  153

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I +V+RGT   LEW+N      V A  +   +T              PKV  GW+
Sbjct  154   LGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-------------PKVHQGWY  200

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F   SAR Q+ +++  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  201   SIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVT  260

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG        +   PVTAIVF SP++G+  F K+ +   +L  + IRN++D++P YP  L
Sbjct  261   NGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP--L  318

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  NPS WHNL+A LH VAG  G  G F L+V R +ALV
Sbjct  319   VGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALV  378

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+EL +P SW IEKNK M    +G W L    ++D 
Sbjct  379   NKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDDF  421



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   363 bits (933),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 252/403 (63%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGSCRY K SFF 
Sbjct  9     WRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSFFS  68

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  69    KVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      V A  +   +T              PKV  GW+
Sbjct  129   LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-------------PKVHQGWY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F   SAR Q+ +++  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  176   SIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVT  235

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG        +   PVTAIVF SP++G+  F K+ +   +L  + IRN++D++P YP  L
Sbjct  236   NGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP--L  293

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  NPS WHNL+A LH VAG  G  G F L+V R +ALV
Sbjct  294   VGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALV  353

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+EL +P SW IEKNK M    +G W L    ++D 
Sbjct  354   NKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEEDDF  396



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   360 bits (925),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 256/414 (62%), Gaps = 26/414 (6%)
 Frame = -1

Query  1440  IHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAG  1261
             I+  S+A +  W QL G  NW GLL PL++ LR  I+  G+  QATYD+FN +  SK+AG
Sbjct  18    INRSSIANK--WRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAG  75

Query  1260  SCRYGKNSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGY  1087
             SCRY KN FF KV L + +   Y V  Y+YAT+++ VPEAF++ S SRE+W +ESNWIGY
Sbjct  76    SCRYAKNDFFSKVYLENGNPFKYNVTKYIYATSEMDVPEAFIIKSFSREAWSKESNWIGY  135

Query  1086  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedd  907
             V V+SD     LGRR+I + +RGT   LEW+N  +   VSA  L  ++            
Sbjct  136   VGVSSDEGKDVLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLFGNNIID---------  186

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
                PKV  GW+++YTS+DP S F   SAR Q+ +++  L  KYK E +SIT+TGHSLGA+
Sbjct  187   ---PKVHQGWYSIYTSEDPRSPFNKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAA  243

Query  726   LAILAAFDLCENG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNK  571
             +A L A D+  NG        +   PVTAIVF SP++G+  F K+ +++ +L  L IRN+
Sbjct  244   IATLNAVDIVTNGYNKPNDSSIKASPVTAIVFASPRVGDTNFQKVFSDQKDLSTLRIRNE  303

Query  570   IDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEF  391
             +D++P YP   +GY   G E  ID  KS  LK+  NP  WHNL+A LH VAG  G    F
Sbjct  304   LDIVPNYP--FIGYSDVGEELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVAGTQGSKRGF  361

Query  390   ELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             +L+V R ++LVNK+ + LK+E  +P SW + +NK MV   +G W L  P D D 
Sbjct  362   KLEVNRDISLVNKTLDVLKDEYLVPISWRVVENKGMVQQPDGSWKLVDPEDGDF  415



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 250/403 (62%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGS RY K SFF 
Sbjct  9     WRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSFFS  68

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  69    KVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      V A  +   +T              PKV  GW+
Sbjct  129   LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-------------PKVHQGWY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F   SAR Q+ +++  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  176   SIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVT  235

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG        +   PVTAIVF SP++G+  F K+ +   +L  + IRN++D++P YP  L
Sbjct  236   NGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP--L  293

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  NPS WHNL+A LH VAG     G F+L+V R +ALV
Sbjct  294   VGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALV  353

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+E  +P SW  EKNK MV   +G W L    D+D 
Sbjct  354   NKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHEDDDF  396



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   358 bits (920),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 250/403 (62%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGS RY K SFF 
Sbjct  36    WRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSFFS  95

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  96    KVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  155

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      V A  +   +T              PKV  GW+
Sbjct  156   LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-------------PKVHQGWY  202

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F   SAR Q+ +++  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  203   SIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDIVT  262

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG        +   PVTAIVF SP++G+  F K+ +   +L  + IRN++D++P YP  L
Sbjct  263   NGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNYP--L  320

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  NPS WHNL+A LH VAG     G F+L+V R +ALV
Sbjct  321   VGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSKGGFKLEVHRDIALV  380

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+E  +P SW  EKNK MV   +G W L    D+D 
Sbjct  381   NKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHEDDDF  423



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 186/396 (47%), Positives = 247/396 (62%), Gaps = 17/396 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  S++AGS RY K  FF 
Sbjct  23    WRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKKDFFS  82

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV +   +   Y V  YLYAT+++ VP+ F+L S SRE+W +ESNW+GYVAV +D     
Sbjct  83    KVGIDIGNPFKYYVTKYLYATSEIQVPDGFILKSLSREAWSKESNWMGYVAVATDEGKAV  142

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    VSA  +L  +               PKV  GW+
Sbjct  143   LGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGG------------EPKVHQGWY  190

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S F+  SAR+Q+  ++  L  ++K E +SI+LTGHSLGA++A L A D+  
Sbjct  191   SIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVA  250

Query  693   NGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSG  517
             NG+    PVTA+VF SP++G+  F KL +   NL++L +RN  D+IP YP  LLGY   G
Sbjct  251   NGLNQGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNYP--LLGYSDVG  308

Query  516   LEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFL  337
              E  +D RKS  LK+  N S WHNL+A LH VAG  G  G F L+V R +ALVNKS + L
Sbjct  309   EELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDAL  368

Query  336   KEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              +E  +P SW  EKNK MV   +G W L    ++DL
Sbjct  369   NDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  404



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 253/422 (60%), Gaps = 25/422 (6%)
 Frame = -1

Query  1488  ANILIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQ  1309
             A  L+    +F LK  +   S +    W  L G  NW+GLLDPL++ LR  I+  G+  Q
Sbjct  14    ATRLVLLTRMFGLKKKMD-SSHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQ  72

Query  1308  ATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLH  1135
             ATYD+FN +  SKYAGS RY + SFF +V L   +   Y V  ++YAT+Q+ VPEAFL+ 
Sbjct  73    ATYDAFNTEKASKYAGSSRYARKSFFSRVCLEKGNAFKYNVTKFVYATSQIQVPEAFLIK  132

Query  1134  SRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPL  955
             S SRESW +ESNW+GYVAV +D    ALGRR+I + +RGT   LEW+N      VSA  L
Sbjct  133   SLSRESWCKESNWMGYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKL  192

Query  954   LRSSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYK  775
             L                  PKV  GW+++YTS D  S F   SAR Q+  ++  L  ++K
Sbjct  193   LGEDGD-------------PKVHEGWYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFK  239

Query  774   GENLSITLTGHSLGASLAILAAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDK  619
              E +SIT+TGHSLGA++A L A D+  NGV           PVTAIVF SP++G+  F+K
Sbjct  240   DEEISITITGHSLGAAIATLNAVDIVANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEK  299

Query  618   LMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQ  439
             + +   +++ L +RN +D++P YP   LGY   G E  ID RKS  LK+    + WHNL+
Sbjct  300   VFSGHKDVRALRVRNALDVVPNYP-IPLGYSNVGEELAIDTRKSKYLKSPGGLASWHNLE  358

Query  438   AMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW  259
               LH VAG  G  G F+L+VKR +ALVNKS + LKEE  IP SW  EKNK M   ++G W
Sbjct  359   GYLHGVAGTQGSKGGFKLEVKRDIALVNKSADDLKEEYLIPASWRCEKNKCMTQLDDGSW  418

Query  258   VL  253
             VL
Sbjct  419   VL  420



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 252/404 (62%), Gaps = 14/404 (3%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L GS+ WEGL DPL+  LR  IL  GD CQATYD+F  D  SKYAGS RYG   FF 
Sbjct  10    WRLLQGSQRWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHFFE  69

Query  1227  KVML---PSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
              + L   P+   Y +  ++YAT+ + VPEAF+  S SRE   RESNW+GYVA  +D    
Sbjct  70    DLGLTKRPTEWGYSLSKFIYATSTIKVPEAFIRTSLSREGGSRESNWMGYVAHVTDTGKT  129

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
               GRR+I V +RGT   LEW+N F     S   LL   T G + + ++      +V  GW
Sbjct  130   QYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQT-GLDRETDKVLRNDARVQRGW  188

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGEN-LSITLTGHSLGASLAILAAFDL  700
               +YTS+D  S F   SAREQ+  +++ L  KYK E  +SIT TGHSLGA+LA L AFD+
Sbjct  189   FDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFDI  248

Query  699   CENGVTD-------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
               NG+         IPVTAIVF SP++GN  F K++ +  +L++L + N  D++P +P  
Sbjct  249   VINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLVPLHP--  306

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
              LGYV+ G+E  +D  KS  LKN  + S WHNL+A LH VAG  G++G F+L+V R +AL
Sbjct  307   FLGYVEVGVELPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGAFKLEVDRDIAL  366

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             VNKS ++LK+E  +P SWW+EKNK MV   +G W++  P DEDL
Sbjct  367   VNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHWLMAKPPDEDL  410



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 259/404 (64%), Gaps = 27/404 (7%)
 Frame = -1

Query  1434  FQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSC  1255
              QS+AT   W  L G  NW+ LLDPL++ LR  I++ G+  QATYD+FN +  S +AGS 
Sbjct  2     LQSIATR--WKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSS  59

Query  1254  RYGKNSFFHKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVA  1081
             RY K +FF K+ L  A+ Y+  V  +LYAT+++ VP+AF++ S SRE+W RESNW+GYVA
Sbjct  60    RYSKANFFSKLGLEKANPYKYNVTKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVA  119

Query  1080  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK  901
             V +D     LGRR+I + +RG+   LEWIN F+   VSA  +L +               
Sbjct  120   VATDEGKAVLGRRDILIAWRGSVQALEWINDFNFILVSASGILGTKND------------  167

Query  900   VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
              P V  GW ++YTS DP S + T SAR+Q+  +++ L  ++K E +SIT+TGHSLGA+L 
Sbjct  168   -PNVHQGWLSIYTSDDPRSAYNTTSARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALG  226

Query  720   ILAAFDLCENGVT---DIP-----VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKID  565
              L A D+  NGV    D P     VTA +FG P++G+  F K+++   NL++L +RN +D
Sbjct  227   TLNAVDIVANGVNKPKDHPEKACLVTAFLFGCPRVGDANFQKVVSSLENLRLLRVRNSLD  286

Query  564   MIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFEL  385
             ++P YP  L+GY   G E VID R+S+ LK+S++P +WHN++  LH VAG  G  G F+L
Sbjct  287   LVPNYP--LVGYSDVGQELVIDTRQSSFLKSSVDPGNWHNMEGYLHGVAGTQGTKGGFKL  344

Query  384   KVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             +V R ++LVNKS + LK+E  +P  WW EKNK M+  E+G W L
Sbjct  345   EVGRDISLVNKSTDALKDEYLVPMMWWCEKNKGMIQGEDGSWKL  388



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/402 (46%), Positives = 244/402 (61%), Gaps = 24/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G   W+GLLDPLN+ LR  I+  G+  QATYD+FN +  SKYAGS RY + +FF 
Sbjct  40    WKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFS  99

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   +   Y V  ++YAT+Q+ VPEAFL+ S SRESW +ESNW+ Y+AV +D     
Sbjct  100   KVGLEKGNPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMAYIAVATDEGKAV  159

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +L                  PKV  GW+
Sbjct  160   LGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGD-------------PKVHQGWY  206

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR Q+  ++  L  +YK E +SIT+TGHSLGA++A L+A D+  
Sbjct  207   SIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVA  266

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG+           PVTAIVF SP++GN  F+K+ +   +L+ L IRN +D++P YP  L
Sbjct  267   NGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-IL  325

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY   G E  ID +KS  LK+      WHN++  LH VAG  G  G F+L+VKR +ALV
Sbjct  326   LGYSDVGEELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALV  385

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             NKS + LKEE  IP SW  EKNK M   E+G WVL    ++D
Sbjct  386   NKSVDALKEEYLIPASWRCEKNKCMTQLEDGSWVLKDHEEDD  427



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/419 (45%), Positives = 256/419 (61%), Gaps = 26/419 (6%)
 Frame = -1

Query  1479  LIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATY  1300
             LI +    V K   +  S+A +  W  L G +NWEGLLDPLN+ LR  I+  G+  QATY
Sbjct  17    LILTKCFGVKKKKRNMGSIAEK--WKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATY  74

Query  1299  DSFNHDSNSKYAGSCRYGKNSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRS  1126
             D+FN +  SKYAGS RYG+   F KV L + +   Y V  +LYAT+Q+ VP+AF++ S S
Sbjct  75    DAFNGEKASKYAGSSRYGRKDLFAKVSLENGNPFKYSVTKFLYATSQVDVPDAFIVKSLS  134

Query  1125  RESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRS  946
             RE+W +ESNW+GYVAV +D     LGRR+I + +RGT   LEWIN F  + VSA  +L  
Sbjct  135   REAWSKESNWMGYVAVATDEGKAELGRRDIVIAWRGTVRTLEWINDFEFRLVSASKILGD  194

Query  945   STSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGEN  766
                             PKV  GW+++YTS+D  SRF   SAR+Q+ ++IE L  +YK E 
Sbjct  195   KAGD------------PKVHQGWYSIYTSEDQRSRFNKTSARQQVLSEIERLVEQYKDEE  242

Query  765   LSITLTGHSLGASLAILAAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMT  610
             +SIT+TGHSLGA++A L A D+  N             PVTAI+F SP++G+  F  L +
Sbjct  243   ISITITGHSLGAAIATLNAVDIVSNRYNKPKHHPHKPCPVTAIIFASPRVGDSDFRNLFS  302

Query  609   EKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAML  430
                +L+ L +RN +D++P YP  ++ Y   G E  ID  KS+ LK+  N S WHNL+  L
Sbjct  303   SYKDLRALRVRNALDIVPNYP--IIEYSDVGEELKIDTSKSSYLKSPGNISSWHNLEGYL  360

Query  429   HVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             H +AG  G  G F+L+V R +ALVNK+ + LK+E  +P SW  EKNK MV  E+G W L
Sbjct  361   HGLAGTQGSKGGFKLEVHRDIALVNKTMDGLKDEYLVPESWRCEKNKGMVQLEDGSWKL  419



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 245/402 (61%), Gaps = 24/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G   W+GLLDPLN+ LR  I+  G+  QATYD+FN +  SKYAGS RY + +FF 
Sbjct  40    WKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFS  99

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   +   Y V  ++YAT+Q+ +PEAFL+ S SRESW +ESNW+ Y+AV +D     
Sbjct  100   KVGLEKGNPFKYNVTKFVYATSQIPIPEAFLIKSLSRESWCKESNWMAYIAVATDEGKAV  159

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +L                  PKV  GW+
Sbjct  160   LGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGD-------------PKVHQGWY  206

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR Q+  ++  L  +YK E +SIT+TGHSLGA++A L+A D+  
Sbjct  207   SIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDIVA  266

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG+           PVTAIVF SP++GN  F+K+ +   +L+ L IRN +D++P YP  L
Sbjct  267   NGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-IL  325

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY   G E  ID +KS  LK+    + WHN++  LH VAG  G  G F+L+VKR +ALV
Sbjct  326   LGYSDVGEELKIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALV  385

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             NKS + LKEE  IP SW  E+NK M   E+G WVL    D+D
Sbjct  386   NKSVDALKEEYLIPASWRCEENKCMTQLEDGSWVLKDHEDDD  427



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/404 (47%), Positives = 251/404 (62%), Gaps = 14/404 (3%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L GS+ WEGL DPL+  LR  IL  GD CQATYD+F  D  SKYAGS RYG   FF 
Sbjct  10    WRLLQGSQLWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHFFD  69

Query  1227  KVML---PSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
              + L   P+   Y +  ++YAT+ + VPEAF+  S SRE   RESNW+GYVA  +D    
Sbjct  70    DLGLTKRPTEWGYSLSKFIYATSTIKVPEAFITTSLSREGGSRESNWMGYVAHVTDTGKT  129

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
               GRR+I V +RGT   LEW+N F     S   LL   T G + + ++      +V  GW
Sbjct  130   QYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQT-GLDRETDKVLRNDVRVQRGW  188

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGEN-LSITLTGHSLGASLAILAAFDL  700
               +YTS+D  S F   SAREQ+  +++ L  KYK E  +SIT TGHSLGA+LA L AFD+
Sbjct  189   FDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHSLGATLATLCAFDI  248

Query  699   CENGVTD-------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
               NG+         IPVTAIVF SP++GN  F K++ +  +L++L + N  D++P +P  
Sbjct  249   VINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLRVTNNPDLVPLHP--  306

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
              LGYV+ G+E  +D  KS  LKN  + S WHNL+A LH VAG  G++G F+L+V R +AL
Sbjct  307   FLGYVEVGVELRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQGKNGAFKLEVDRDIAL  366

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             VNKS ++LK+E  +P SWW+EKNK MV   +G W +  P DEDL
Sbjct  367   VNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHWFMAKPPDEDL  410



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   354 bits (909),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 189/427 (44%), Positives = 257/427 (60%), Gaps = 26/427 (6%)
 Frame = -1

Query  1482  ILIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQAT  1303
             +++ +  + V K     +S+A +  W  L G  NWEGLLDPL++ LR  I+  G+  QAT
Sbjct  26    LILLTRMLGVKKKMDSSRSIAKK--WKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQAT  83

Query  1302  YDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSR  1129
             YD+FN +  SKYAGS RY + +FF KV L  A+   Y V  ++YAT+Q+ VPEAFL+ S 
Sbjct  84    YDAFNTEKTSKYAGSSRYARKNFFSKVGLEKANPFKYNVTKFVYATSQIQVPEAFLIKSL  143

Query  1128  SRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLR  949
             SRESW +ESNW+ YVAV +D    ALGRR+I + +RGT   LEW++      VSA  +L 
Sbjct  144   SRESWCKESNWMAYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNILS  203

Query  948   SSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGE  769
                              PKV  GW+++YTS D +S F   SAR Q+  ++  L  +YK E
Sbjct  204   EEGD-------------PKVHQGWYSIYTSNDSHSPFNKTSARHQVIEEVRRLVEQYKDE  250

Query  768   NLSITLTGHSLGASLAILAAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLM  613
              +SIT+TGHSLGA++A L+A D+  NG+           PVTAI+F SP++GN  F+K+ 
Sbjct  251   EISITITGHSLGAAIATLSAIDIVANGLNRPKDLPNKACPVTAILFASPRVGNSNFEKVF  310

Query  612   TEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAM  433
             +   +L+ L +RN +D++P YP    GY   G E  ID +KS  LK+    + WHN++  
Sbjct  311   SGYKDLRALRVRNALDVVPNYP-IFFGYSDVGEELTIDTQKSKYLKSPGGVASWHNMEGY  369

Query  432   LHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             LH VAG  G    F+L+VKR +ALVNKS + LKEE  IP SW  EKNK M   E+G WVL
Sbjct  370   LHGVAGTQGSKRGFKLEVKRDIALVNKSTDALKEEYLIPASWRCEKNKCMTQLEDGSWVL  429

Query  252   GSPNDED  232
                 D D
Sbjct  430   MDHEDGD  436



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   354 bits (908),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/406 (46%), Positives = 249/406 (61%), Gaps = 27/406 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  SK+AGS RY + SFF 
Sbjct  45    WKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSSRYARKSFFS  104

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V L  A+   Y V  +LYAT+Q+ VPEAF++ S SRE+W +ESNWIGYVAV +D     
Sbjct  105   RVGLEKANAFRYNVTKFLYATSQIQVPEAFIVKSLSREAWSKESNWIGYVAVATDEGKAL  164

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +L                   KV  GW+
Sbjct  165   LGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNILGEEADA-------------KVHQGWY  211

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D +S F   SAR Q+  ++  L  +YK E +SIT+TGHSLGA++A L+A D+  
Sbjct  212   SIYTSDDSHSPFNKTSARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLSAVDIVA  271

Query  693   NGV-----------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             NG+           +  PVTA VF  P++G+  F KL +   NL++L + N +D++P YP
Sbjct  272   NGINKPKDQTANKLSSCPVTAFVFACPRVGDSNFKKLFSSYNNLRVLRVSNALDIVPNYP  331

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               L+GY + G E  ID RKS+ LK+  +   WHNL+  LH VAG  G  G F+L+VKR +
Sbjct  332   -FLVGYSEVGEELGIDSRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSKGGFKLEVKRDI  390

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             ALVNKS + LKEE  +P SW  EK+K MV  E+G W L    +ED 
Sbjct  391   ALVNKSHDALKEEYLVPVSWRCEKDKGMVQMEDGSWQLMDHEEEDF  436



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   352 bits (902),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 254/409 (62%), Gaps = 26/409 (6%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             + +  W  L G ENW+ LLDPL++ LR  I+  G+  QATYD+F  +  SK+AGS RY +
Sbjct  4     SIDKRWRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSRYAR  63

Query  1242  NSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
               FF KV L   +   YQV  +LYAT+++ VPEAF++ S SRE+W RESNW+GYVAV +D
Sbjct  64    ADFFSKVGLVKTNPFKYQVTKFLYATSRIEVPEAFIIKSLSREAWSRESNWMGYVAVATD  123

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I V +RGT  DLEW++ FS   VSA  +L  +               PKV
Sbjct  124   EGKAVLGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTND-------------PKV  170

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               GW ++YTS DP S F   SAR+Q+ +++  L   +K E +SIT+TGHSLGA+L  L A
Sbjct  171   HQGWLSIYTSDDPRSPFNKASARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNA  230

Query  708   FDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
              D+  +G+            VTAI+F SP++G+  F ++ +   NL++L +RN +D++P 
Sbjct  231   ADIVAHGLNKPRNHPHRACLVTAILFASPRVGDDNFQEVFSGLENLRLLRVRNALDVVPN  290

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YP  LLGY   G E  ID RKS  +K S NPS WHNL+  LH VAG  G  G F+L+V R
Sbjct  291   YP--LLGYSDVGEELAIDFRKSKFIKASANPSLWHNLECYLHGVAGTQGAKGGFKLEVGR  348

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
              +ALVNK+ + LK+E  +P SWW EKNK MV  ++G W L   ++ED P
Sbjct  349   DIALVNKTTDALKDEHLVPVSWWCEKNKGMVQRDDGTWKL-MDHEEDYP  396



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/402 (46%), Positives = 244/402 (61%), Gaps = 24/402 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S +    W  L G  NW+GLLDPL++ LR  I+  G+  QATYD+FN +  SKYAGS RY
Sbjct  4     SHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRY  63

Query  1248  GKNSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
              + +FF +V L   +   Y V  ++YAT+Q+ VPEAFL+ S SRESW +ESNW+GYVAV 
Sbjct  64    ARKNFFSRVGLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAVA  123

Query  1074  SDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVP  895
             +D    ALGRR+I + +RGT   LEW+N      VS   LL                  P
Sbjct  124   TDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLLGEDGD-------------P  170

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             KV  GW+++YTS D  S F   SAR Q+  ++  L  ++K E +SIT+TGHSLGA++A L
Sbjct  171   KVHEGWYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATL  230

Query  714   AAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
              A D+  NGV           PVTAIVF SP++G+  F+K+ +   +++ L +RN +D++
Sbjct  231   NAVDIVANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRTLRVRNALDVV  290

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P YP   LGY   G E  ID RKS  LK+    + WHNL+  LH VAG  G  G F+L+V
Sbjct  291   PNYP-IPLGYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEV  349

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             KR +ALVNKS + L+EE  IP SW  EKNK M   ++G WVL
Sbjct  350   KRDIALVNKSADDLEEEYLIPASWRCEKNKCMTQLDDGSWVL  391



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 249/403 (62%), Gaps = 22/403 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G  +W GLLDPL++ LR  I+  G+  QATYD+FN +  SK+AGSCRY KN FF 
Sbjct  24    WQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAKNDFFS  83

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  ++YAT+++ VPEAF++ S SRE+W +ESNWIG+VAV +D     
Sbjct  84    KVFLENGNPFKYSVTKFIYATSEINVPEAFIIKSLSREAWSKESNWIGFVAVANDEGKDV  143

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +  +S +             PKV  GW+
Sbjct  144   LGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVFGNSNN----------INDPKVHQGWY  193

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F+  SAR Q+ +++  L  KYK E +SIT+TGHSLGA++A L A D+  
Sbjct  194   SIYTSEDPRSPFSKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVDIVT  253

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTAIVF SP++G+  F KL +   +L  L IRN++D++P YP   
Sbjct  254   NGFNKPSDPSLKASPVTAIVFASPRVGDTNFQKLFSSYKDLSTLRIRNELDIVPNYP--F  311

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  N   WHNL+A LH VAG  G    F+L+V R +ALV
Sbjct  312   IGYSDVGEELKIDTRKSMYLKSPGNILSWHNLEAYLHGVAGTQGSKRVFKLEVNRDIALV  371

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+E  +P SW + +NK MV   +G W L    D++ 
Sbjct  372   NKTLDGLKDEYLVPVSWRVVENKGMVQQLDGSWKLIDHEDDEF  414



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 241/403 (60%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR +I+  G+  QATYD+F+ +  S++AGS RY K  FF 
Sbjct  21    WRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFFS  80

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+++ VP+AFL+   SRE+W +ESNWIGYVAV +D    A
Sbjct  81    KVGLDNGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKAA  140

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR++ V +RGT   LEW++ F    VSA  +L  +               PKV  GW+
Sbjct  141   LGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVLGKAND-------------PKVQKGWY  187

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++Y S DP S F   SAR Q+  +I  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  188   SIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDIVA  247

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             N             PVTA  F SP++G+  F KL +E  +L++L +RN +D++P YP  L
Sbjct  248   NAFNKPIGHQTNGCPVTAFAFASPRVGDSNFRKLFSELADLRVLRVRNALDIVPNYP--L  305

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY   G E  +D RKS  LK+  N S WH L+  LH  AG  G +G FEL V R VAL+
Sbjct  306   LGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAAGTQGTNGGFELMVDRDVALI  365

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NKS + LK E  +P SWW  KNK MV   +G W L     +DL
Sbjct  366   NKSLDALKVEYLVPASWWCPKNKGMVQQADGSWKLMDHEADDL  408



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 181/395 (46%), Positives = 241/395 (61%), Gaps = 24/395 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NW+ LL+PL++ LR  I+  G+  QATYD+FN    SK+AGS  Y KN FF 
Sbjct  10    WKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSSLYAKNGFFS  69

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   + Y+  V  + YAT+Q+ +PEAF++ S SRE+W +ESNW+GY+AV +D  +  
Sbjct  70    KVGLDKGNPYKYTVTKFFYATSQIQLPEAFIVKSLSREAWSKESNWMGYIAVATDEGTAV  129

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW++      VSA  LL  S +             PKV  GWH
Sbjct  130   LGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLLGESGND------------PKVHQGWH  177

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S F   SAR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+  
Sbjct  178   SVYTSDDPLSPFNKSSARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVDIIA  237

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTAIVF SP++G+  F K+ +    L+ L I N +D++P YP  L
Sbjct  238   NGFNKSKTFPNKACPVTAIVFASPRVGDSGFKKVFSGYKELRALRIHNNLDIVPNYP--L  295

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY + G E VID  KS  LK+  N S WHNL+  LH VAG  G  G F+L++ R +ALV
Sbjct  296   IGYAEVGEELVIDTTKSNYLKSPGNVSSWHNLEGYLHGVAGTQGSKGGFKLEINRDIALV  355

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NKS + LK+E  +P SW I+KNK MV   +G W L
Sbjct  356   NKSLDGLKDEYLVPPSWRIQKNKGMVQQSDGSWKL  390



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   347 bits (891),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 181/403 (45%), Positives = 250/403 (62%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  +W+GL++PL++ LR  I+  G+  QA YD+F  +  SKYAG  RY K +FF 
Sbjct  37    WRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEKVSKYAGCSRYAKRNFFS  96

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT+ + +PEAF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  97    KVGLMNGNAFTYSVTKFLYATSSIDLPEAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  156

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +   +T              PKV  GW+
Sbjct  157   LGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTD-------------PKVHQGWY  203

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S F   SAR Q+ ++++ L   YK E +SI++TGHSLGA++A L+A D+  
Sbjct  204   SIYTSEDPLSPFNKSSARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDIVA  263

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG        +   PVTAIVF  P++G+  F K+ +   +LK + IRN++D++P YP  L
Sbjct  264   NGYNKPSDPSLKASPVTAIVFACPRVGDTNFRKVFSGYKDLKTIRIRNELDIVPNYP--L  321

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  LK+  NP  WHNL+  LH VAG  G  G F+L+V R +AL+
Sbjct  322   VGYSDVGEELKIDTRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSKGGFKLEVNRDIALL  381

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+EL +P SW IEKNK MV   +G W L    D+D 
Sbjct  382   NKTLDALKDELLVPVSWRIEKNKGMVQQNDGSWKLMDHEDDDF  424



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 243/394 (62%), Gaps = 23/394 (6%)
 Frame = -1

Query  1404  HQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFHK  1225
              +L G +N +GL DPL++ LR  IL  G+  QATYD+F  +  S+YAG CRY +  FF K
Sbjct  10    RELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCRYARRDFFDK  69

Query  1224  VMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
             V   +     Y+V  + YAT+ + VPEAFL+ S SRE+W +ESNW+GYVAV +D   K L
Sbjct  70    VATSTDQQSLYRVTKFFYATSSIDVPEAFLIKSLSREAWSKESNWMGYVAVATDEGKKVL  129

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR++ V +RGT   LEWIN      VSA  +L   +SG+           P+V  GW +
Sbjct  130   GRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGN-----------PQVHRGWLS  178

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS DP S +   SAR+Q+ ++I  L  +YK E  SIT+TGHSLGA+LA L A D+  N
Sbjct  179   IYTSNDPRSPYNKDSARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAADIASN  238

Query  690   GVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALL  535
             G+         + PVTA VF SP++G+  F +  ++   L++L IRN  D++P YP  LL
Sbjct  239   GLNKSNAHPNKNSPVTAFVFASPRVGDSDFREAFSKIPELRLLRIRNVPDLVPNYP--LL  296

Query  534   GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             GY   G+E  ID RKS  LK+  N S WHNL+A LH VAG  G    F+L+V R VALVN
Sbjct  297   GYDDVGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTRGGKKGFKLEVDRDVALVN  356

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             KS + LK+E  +P SW +EKNK MV   +G W L
Sbjct  357   KSMDALKDEYLVPASWRVEKNKGMVKGADGHWRL  390



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 180/403 (45%), Positives = 238/403 (59%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR +I+  G+  QATYD+F+ +  S++AGS RY K  FF 
Sbjct  21    WRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFFS  80

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   +   Y V  +LYAT+++ VP+AFL+   SRE+W +ESNWIGYVAV +D    A
Sbjct  81    KVGLDKGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKTA  140

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT   LEWI+ F    VSA  +L  +               PKV  GW+
Sbjct  141   LGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVLGEAND-------------PKVHQGWY  187

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++Y S DP S F   SAR Q+  +I  L   YK E +SIT+TGHSLGA++A L A D+  
Sbjct  188   SIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDITA  247

Query  693   NG--------VTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             N             PVTAI F SP++G+  F K+ +E  +L+ L +RN +D++P YP  L
Sbjct  248   NAFNKPIGHQTNGCPVTAITFASPRVGDSNFRKVFSELADLRALRVRNALDIVPNYP--L  305

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  +D RKS  LK+  N S WH L+  LH VAG  G +  FEL V     L+
Sbjct  306   IGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVAGTQGTNDGFELMVDHDATLI  365

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK+ + LK+E  +P SWW  KNK MV   +G W L     +DL
Sbjct  366   NKALDALKDEYLVPASWWCPKNKGMVQQADGSWKLMDYEADDL  408



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 248/411 (60%), Gaps = 26/411 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S +    W  L G ++WE LLDPLN+ LR  IL  G+  QA YD+F  +  SK+AG CRY
Sbjct  18    SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  77

Query  1248  GKNSFFHKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
              +  FF KV L   + Y+  V  +LYAT+Q+ VP+AF++ S SRE+W +ESNWIGYVAV 
Sbjct  78    ARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVA  137

Query  1074  SDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVP  895
             +D     LGRR+I + +RGT   LEW+N F    VSA  +L                  P
Sbjct  138   TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGD-------------P  184

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             +V  GW+++YTS D  S F  +SAR+Q+  +++ L   YK E +SIT+TGHSLGA++A L
Sbjct  185   RVHQGWYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATL  244

Query  714   AAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
              A D+  NG+           PVTAIVF SP++G+  F +  +E  +L+ L IRN  D++
Sbjct  245   NAVDIVANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV  304

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P YP  +L Y + G+E  I+ RKS  LK+  + S WHNL+  LH VAG  G  G F+L++
Sbjct  305   PSYP--ILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEI  362

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW-VLGSPNDEDL  229
              R V+LVNK  + LK+E  +P SW  EKNK MV  E+G W ++    D DL
Sbjct  363   NRDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEEDNDL  413



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 246/403 (61%), Gaps = 24/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ +W+GLLDPL+  LR  I+  G+  QATYDSFN +  S+YAGSC Y K   F 
Sbjct  8     WKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKKDLFA  67

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y+V  YLYAT+ + +P+AF++ S SRE+W +ESNW+GYVAV +D    A
Sbjct  68    KVGLQNGNPFKYRVTKYLYATSSIQLPDAFIVKSFSREAWSKESNWMGYVAVATDEGKVA  127

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N      VSA  +   +               PKV  GW+
Sbjct  128   LGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIFTENDDD------------PKVHQGWY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YT+ D  S F  +SAR+Q+  +I  L  ++KGE +SIT+TGHSLGA++A L A D+  
Sbjct  176   SIYTTDDSRSPFNKISARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVDIVA  235

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTA V+ SP++G++ F+K+ +++ NLK+L IRN +D++P YP  L
Sbjct  236   NGFNKSVQNPGKACPVTAFVYASPRVGDQGFEKVFSQQQNLKVLRIRNSLDVVPNYP--L  293

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY   G +  ID  KS  LK+  N S WH+L+  +H +AG  G  G F+L   R VALV
Sbjct  294   LGYADVGEQLGIDTTKSKYLKSPGNLSSWHSLECYMHGIAGTQGLQGGFKLVANRDVALV  353

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK  + LK+E  +P SWW  +NK MV   +G W L    D+D 
Sbjct  354   NKHMDALKDEHCVPVSWWCIQNKGMVQQSDGSWKLEDHEDDDF  396



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   343 bits (879),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 173/396 (44%), Positives = 245/396 (62%), Gaps = 18/396 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ NWEGLLDPL+  LR  ++R G+  QA  D+FN +  SKYAG+CRY K +FF 
Sbjct  49    WRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRYSKKNFFS  108

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +  +  ++   Y+V  Y+YAT+ + VPEA  + S SRE+W +ESNW G+VAV +D    A
Sbjct  109   RTGIEISNPFKYEVTKYIYATSAVQVPEALFIKSLSREAWSKESNWAGFVAVATDKGKIA  168

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I +V+RG+   LEW N F    VSA  +    +              PKV  GW+
Sbjct  169   LGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIFGEKSD-------------PKVHHGWY  215

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR+Q+  +++ L  +YK E +SIT+TGHS+GAS+A L A D+  
Sbjct  216   SIYTSDDSRSLFNKESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDIVF  275

Query  693   NGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSG  517
             NG+    PVTA +F SP++G++ F +  ++  NL+ L IRN  D++P YP  L GY   G
Sbjct  276   NGINKGFPVTAFLFASPRVGDENFKRTFSKLENLRALRIRNAPDLVPSYP--LFGYSDVG  333

Query  516   LEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFL  337
             +E  ID RKS  LK+  + S +HN    LH +AG  G  G F+L+V+R ++L+NK  + L
Sbjct  334   VELAIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDAL  393

Query  336   KEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             K+E  +P SWW+EKN  MV  +NG W+L    D+D 
Sbjct  394   KDEYGVPTSWWVEKNNGMVQQQNGTWILVDHEDDDF  429



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   342 bits (878),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 171/400 (43%), Positives = 248/400 (62%), Gaps = 18/400 (5%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             T   W  L G+ NWEGLLDPL+  LR  ++R G+  QA  D+FN +  SKYAGSCRY K 
Sbjct  47    TAERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCRYSKK  106

Query  1239  SFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
             + F +  +  ++   Y+V  Y+YAT+ + VP+A  + S SRE+W +ESNW+G+VAV +D 
Sbjct  107   NLFSRTGIEISNPFKYEVTKYIYATSSVQVPDALFIKSLSREAWSKESNWVGFVAVATDK  166

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
                ALGRR+I +V+RG+   +EW N F    VS+  +    +              PKV 
Sbjct  167   GKIALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIFGEKSD-------------PKVH  213

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW+++YTS D  S F   SAR+Q+  +++ L  +YK + ++IT+TGHS+GA++A L A 
Sbjct  214   HGWYSIYTSDDSRSPFNKGSARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAG  273

Query  705   DLCENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             D+  NG+    PVTA +F SP++G++ F K  ++  NL+ L IRN  D++P YP  L GY
Sbjct  274   DIVFNGINKGFPVTAFLFASPRVGDENFKKTFSKLENLRALRIRNDPDIVPNYP--LFGY  331

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
                G+E VID RKS  LK+  + S +HN    LH +AG  G  G F+L+V+R ++L+NK 
Sbjct  332   SDVGVELVIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKY  391

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              + LK+E  +P SWW+EKNK MV  +NG W+L    D+D 
Sbjct  392   LDALKDEYGVPTSWWVEKNKGMVQQQNGSWILVDHEDDDF  431



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 248/411 (60%), Gaps = 26/411 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S +    W  L G ++WE LLDPLN+ LR  IL  G+  QA YD+F  +  SK+AG CRY
Sbjct  58    SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  117

Query  1248  GKNSFFHKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVT  1075
              +  FF KV L   + Y+  V  +LYAT+Q+ VP+AF++ S SRE+W +ESNWIGYVAV 
Sbjct  118   ARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVA  177

Query  1074  SDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVP  895
             +D     LGRR+I + +RGT   LEW+N F    VSA  +L                  P
Sbjct  178   TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGD-------------P  224

Query  894   KVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAIL  715
             +V  GW+++YTS D  S F  +SAR+Q+  +++ L   YK E +SIT+TGHSLGA++A L
Sbjct  225   RVHQGWYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATL  284

Query  714   AAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
              A D+  NG+           PVTAIVF SP++G+  F +  +E  +L+ L IRN  D++
Sbjct  285   NAVDIVANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV  344

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P YP  +L Y + G+E  I+ RKS  LK+  + S WHNL+  LH VAG  G  G F+L++
Sbjct  345   PSYP--ILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSKGGFKLEI  402

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW-VLGSPNDEDL  229
              R V+LVNK  + LK+E  +P SW  EKNK MV  E+G W ++    D DL
Sbjct  403   NRDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEEDNDL  453



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   341 bits (874),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/396 (47%), Positives = 243/396 (61%), Gaps = 22/396 (6%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
              W  L G  NWEGLLDPL+++LR  I+R G+  QA+YD+FN  + SKYAGS RY K  FF
Sbjct  12    NWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDFF  71

Query  1230  HKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
              KV L       Y+V  +LYAT+ + +P AF+  S SRE+W +ESN+IGYVAV  D    
Sbjct  72    TKVGLAMGKPYKYRVTKFLYATSGIDLPSAFMFKSLSREAWSKESNFIGYVAVAEDESVA  131

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             ALGRR+I + +RGT   LEW+N      VSA  ++  S   D+          PKV  GW
Sbjct  132   ALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDD----------PKVHQGW  181

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++YTS DP S F   SAR Q+  +IE L  +YK E +SIT+TGHSLGA+LA L A D+ 
Sbjct  182   YSVYTSDDPKSPFNKTSARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNAIDIV  241

Query  696   ---ENGVTDIP-----VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
                +N   D P     VTAI+F SP++G+  F K+  +  NLK+L + N +D++P YP  
Sbjct  242   VNNKNKPKDNPQKQCLVTAIIFASPRVGDSNFKKIFPKYDNLKLLRVHNTLDIVPNYP--  299

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             LLGY   G E +ID  KS  LK     S+WHN++A LH VAG  G    F+L V R +AL
Sbjct  300   LLGYSDVGQELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVAGTQGSKNGFKLVVDRDIAL  359

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VNKS + LK+E  IP +WW  KNK MV   +G W+L
Sbjct  360   VNKSMDNLKDEYLIPVAWWSLKNKGMVQQSDGSWLL  395



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   339 bits (870),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/396 (44%), Positives = 247/396 (62%), Gaps = 19/396 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ NWEGLLDPL+  LR  ++  G+  QA  D+FN+D  SKYAG  RY K + F 
Sbjct  12    WRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRYSKKNLFS  71

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV +  ++   Y+V  Y+YAT+ + VPEAF++ S S E+W +ESNWIG+VAV +D    A
Sbjct  72    KVGIEISNPFKYEVTKYVYATSSIQVPEAFIIKSLSGEAWSKESNWIGFVAVATDEGEVA  131

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +R T   +EW N F    VSA  +   ++              PKV  GW+
Sbjct  132   LGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIFGENSD-------------PKVHHGWY  178

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S F   SAR+Q+  ++E L  +YK E +SIT+TGHS+GAS+A L A D+  
Sbjct  179   SMYTSNDPRSLFNKASARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDMVF  238

Query  693   NGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTN-LKILHIRNKIDMIPEYPGALLGYVKS  520
             NG+    PVTA +F SP++G++ F+K  +E  N L+ L +RN  D+IP YP   +GY   
Sbjct  239   NGINKGFPVTAFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPHYP--FIGYSDV  296

Query  519   GLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEF  340
             G+E ++D RKS  LK+  +   WHNL+  LH VAG  G    F+L+V+R ++LVNK  + 
Sbjct  297   GVELIMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSKEGFKLEVERDISLVNKHMDT  356

Query  339   LKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             LK+E  +P SWW+ +NK MV  +NG W+L    DED
Sbjct  357   LKDEYGVPVSWWVVENKGMVQQQNGSWILMDHEDED  392



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 168/396 (42%), Positives = 247/396 (62%), Gaps = 18/396 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ +WEGLL+PL+  LR  ++  G+  QAT D+FN +  SKYAGSCRY K +   
Sbjct  34    WRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRYSKKNLLS  93

Query  1227  K--VMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +  + +P+  +Y+V  Y+YAT+ + VPEA  + S SRE+W +ESNW+G+VAV +D    A
Sbjct  94    RAGIEMPNPFNYEVTKYIYATSSVQVPEALFIKSLSREAWSKESNWVGFVAVATDEGKMA  153

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RG+   +EW N F    VSA  +    +             +PKV  GW+
Sbjct  154   LGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIFGQKS-------------IPKVHHGWY  200

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR+Q+  +++ L  +YK E ++IT+TGHS+GA++A L A D+  
Sbjct  201   SVYTSSDSRSPFNKASARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDIVF  260

Query  693   NGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSG  517
             N      PVTA +F SP++G++ F K  ++  NL+ L +RN  D++P YP  LLGY   G
Sbjct  261   NEFNKGFPVTAFLFASPRVGDENFKKTFSKLVNLRALRVRNAPDIVPNYP--LLGYSDVG  318

Query  516   LEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFL  337
             ++  ID  KST LK+  + S WHN+   LH VAG  G  G F+L+V+  +++VNK  + L
Sbjct  319   VQLDIDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLEVQHDISVVNKYLDAL  378

Query  336   KEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             K+E  +P SWW+EKNK MV  ++G W+L    D+DL
Sbjct  379   KDEYGVPASWWVEKNKGMVQQQDGSWILMDHEDDDL  414



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 250/404 (62%), Gaps = 25/404 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G E W+ LLDPL++ LR  I+  G+  QATYD+F  +  SK+AGS RY K  FF 
Sbjct  8     WRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRYAKRDFFS  67

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L +A+ Y+  V  +LYAT+++ VPEAF++ S SRE+W RESNW+GYVAV +D    A
Sbjct  68    KVGLVNANPYKYNVTKFLYATSRMDVPEAFIIKSLSREAWSRESNWMGYVAVATDEGKAA  127

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RG+   LEWI+ FS   VSA  +L  +               P V  GW 
Sbjct  128   LGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTID-------------PFVHQGWL  174

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP + F   SAR+Q+ +++  L  +YK E +SIT+TGHSLGA+L  L A D+  
Sbjct  175   SIYTSDDPRAPFNRTSARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDIVA  234

Query  693   NGVT---DIP-----VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG     D P     VTA +F SP++G+  F KL++   NL++L +RN +D++P YP  L
Sbjct  235   NGFNRPKDRPDKACLVTAFLFASPRVGDDKFQKLLSSLENLRLLRVRNALDIVPNYP--L  292

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E VID +KST LK+  N S  HNL+  LH VAG  G  G F+L+V+R +ALV
Sbjct  293   IGYSDVGQELVIDTQKSTFLKSPANLSVSHNLEGYLHGVAGTQGSKGGFKLEVERDIALV  352

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
             NKS + L++E  +  SW  EKNK MV   +G W L    ++  P
Sbjct  353   NKSIDGLRDEYLVLASWRCEKNKGMVQGADGSWKLMDHEEDYYP  396



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   337 bits (864),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 245/405 (60%), Gaps = 26/405 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G +NW+ LLDPL++ LR  IL  GD  QATYDSFN +  SK+AG   + + + F 
Sbjct  9     WRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLFS  68

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V L  A+ Y+  +  +LYAT+ + V EAFLL S SRE+W++ESNWIGY+AV +D    A
Sbjct  69    RVGLAIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKAA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    V A+ L  +S                KV  GW 
Sbjct  129   LGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDS-------------KVHKGWL  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+D  S F T SAR+Q+ ++IE+L  +++ E++SIT+TGHSLGA+L  L A D+  
Sbjct  176   SIYTSQDARSPFNTNSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIA  235

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             N +           PVT  +FGSP +G++ F K       L +L  RNK D++P+YP  L
Sbjct  236   NQINRGKKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDYP--L  293

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
              GY K G E +ID RKS  LK+      WH+L+A LH VAG  G +G F L+VKR +A V
Sbjct  294   TGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFTLEVKRDIARV  353

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGS-PNDEDLP  226
             NK+   LKEE  +P SWW  +NK MV D +G W L     DE+ P
Sbjct  354   NKALNALKEEYLVPESWWCAQNKGMVQDADGFWKLDDHETDEEEP  398



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   337 bits (865),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 178/405 (44%), Positives = 246/405 (61%), Gaps = 25/405 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR  ++  G+  QA YD+FN +  SKYAG   Y K  FF 
Sbjct  27    WRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYAKKDFFS  86

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   + Y+  V  + YAT+Q+ VPEAF++   SRE+W +ESNW+GYVAV +D     
Sbjct  87    KVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAV  146

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RG+   LEW+N      VSAE +     + D           PKV  GW+
Sbjct  147   LGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDD-----------PKVHQGWY  195

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR+Q+  +I  L  +YK E +SIT+TGHSLGA+LA L A D+  
Sbjct  196   SIYTSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAA  255

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTAI+F SP++G+  F K+++   +L++L IRN++D++P+YP  L
Sbjct  256   NGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYP--L  313

Query  537   LGYVKSGLEFVIDHRKSTSLKN-SMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             +GY   G E  ID   S  LKN + N S WHNL+  LH VAG  G  G F+L+V R ++L
Sbjct  314   IGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISL  373

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW-VLGSPNDEDL  229
             VNK+ + LK++  +P SW I KNK MV   +G W ++    D+D+
Sbjct  374   VNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEKDDDI  418



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   337 bits (864),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 174/399 (44%), Positives = 246/399 (62%), Gaps = 19/399 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGL+DPLN  LR  I+  G+  QA+YD+FN +  SK AG+ RY KN+ F 
Sbjct  16    WMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSKNNLFT  75

Query  1227  KVMLPSADD---YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L    +   Y+V  YLYAT+ + VPEAF++ S SRESW +ESNWIG++AV +D    
Sbjct  76    KVGLDKDHNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGKI  135

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             ALGRREI + +RGT   L+W+N      VSA  + R +T              P++  GW
Sbjct  136   ALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTD-------------PQIHRGW  182

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++YTS+DP S F   S R+Q+  +++ L  +YK E +SIT+TGHS+GA++  L A D+ 
Sbjct  183   YSIYTSEDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDIV  242

Query  696   ENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKS  520
              NG      VTAI+F SP++G+  F    ++  NL+IL + N +D+IP YP  L+ Y + 
Sbjct  243   VNGFNKGCLVTAILFASPRVGDSSFVNAFSKLENLRILRVTNCLDIIPNYP--LIDYSEI  300

Query  519   GLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEF  340
             G+E  ID  KS  LK   +   WH+L+A +H VAG+ G +G F+L+V+R ++LVNK    
Sbjct  301   GVELAIDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGANGGFKLEVRRDISLVNKHLNA  360

Query  339   LKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPV  223
             LK+E  +P  WW+EKN  MV  ++G W L    D+D  V
Sbjct  361   LKDEYCVPTCWWVEKNNGMVQQDDGSWKLMDHEDDDDSV  399



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   337 bits (865),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 178/405 (44%), Positives = 246/405 (61%), Gaps = 25/405 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR  ++  G+  QA YD+FN +  SKYAG   Y K  FF 
Sbjct  27    WRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKYAGDSIYAKKDFFS  86

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   + Y+  V  + YAT+Q+ VPEAF++   SRE+W +ESNW+GYVAV +D     
Sbjct  87    KVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAV  146

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RG+   LEW+N      VSAE +     + D           PKV  GW+
Sbjct  147   LGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDD-----------PKVHQGWY  195

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F   SAR+Q+  +I  L  +YK E +SIT+TGHSLGA+LA L A D+  
Sbjct  196   SIYTSDDQRSPFNKTSARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAVDIAA  255

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTAI+  SP++G+  F K+++   +L++L IRN++D++P+YP  L
Sbjct  256   NGFNKPGGQPNKACPVTAIILASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKYP--L  313

Query  537   LGYVKSGLEFVIDHRKSTSLKN-SMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             +GY   G E  ID  KS  LKN + N S WHNL+  LH VAG  G  G F+L+V R ++L
Sbjct  314   IGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRKGGFQLEVNRDISL  373

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW-VLGSPNDEDL  229
             VNK+ + LK++  +P SW I KNK MV   +G W ++    D+D+
Sbjct  374   VNKTMDNLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEKDDDI  418



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/402 (45%), Positives = 238/402 (59%), Gaps = 24/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W  LLDPL++ LR  I+  G+  QATYD+FN++  SK+AGS  YGK  FF 
Sbjct  26    WKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKFAGSSLYGKEDFFS  85

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   +   YQV  +LYAT+Q+ +PEAF++ S SRE+W +ESNWIGYVAV +D     
Sbjct  86    KVNLEKGNPYRYQVTKFLYATSQIQLPEAFIVKSSSREAWSKESNWIGYVAVATDEGKDV  145

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEWIN      VS E +                    KV  GW+
Sbjct  146   LGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIFGHERRDI------------KVHEGWY  193

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+D  S +   SAR+Q+  ++  L  ++K E +SIT+TGHSLGA+LA L A D+  
Sbjct  194   SIYTSEDSRSPYNKSSARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAIDIVA  253

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTA +F SP++G+  F K  T   +L+ L + N +D++P YP  L
Sbjct  254   NGYNRPKSQSRKASPVTAFLFASPRVGDSDFKKAFTGFKDLRALRVGNALDVVPNYP--L  311

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID RKS  L +  N S WHNL+A LH VAG  G  G F L V R +ALV
Sbjct  312   VGYSDVGEELAIDTRKSKYLNSPGNLSSWHNLEAYLHGVAGTQGSKGGFALVVNRDIALV  371

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             NKS + LK+E  +P SW IEKNK MV  E+G W L     +D
Sbjct  372   NKSIDGLKDEYLVPVSWRIEKNKGMVQQEDGSWKLMDHEGQD  413



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/396 (43%), Positives = 244/396 (62%), Gaps = 17/396 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ +WEGLLDPL+  LR  I+  G   QAT D+FN +  SKYAGSCRY K +   
Sbjct  45    WRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKISKYAGSCRYSKKNLLS  104

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V +  ++   Y+V  Y+YAT+ + VPEA ++ S SRE+W +ESNW+G+VAV +D    A
Sbjct  105   QVGIEMSNPFKYEVTKYIYATSSVQVPEALIIKSLSREAWSKESNWVGFVAVATDEGKVA  164

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RG+   +EW N F    VSA  +     S            +PKV  GW+
Sbjct  165   LGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIFGHQKS------------IPKVHHGWY  212

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S F+  SAR Q+  +++ L  +YK E ++IT+TGHS+GA++A L A D+  
Sbjct  213   SVYTSNDSRSPFSKASARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDMVF  272

Query  693   NGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSG  517
             NG     PVTA +F SP++G++   K  ++  NL+ L +RN  D++P YP  LLGY   G
Sbjct  273   NGFNKGFPVTAFLFASPRVGDENLKKTFSKLENLRTLRVRNAPDIVPNYP--LLGYSDVG  330

Query  516   LEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFL  337
             ++  ID  KS  LK+  + S WHN+   LH VAG  G  G F+L+V+  +++VNK    L
Sbjct  331   VQLDIDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLQVQHDISVVNKYLGAL  390

Query  336   KEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             K+E  +P SWW+EKNK MV  ++G W+L    D+DL
Sbjct  391   KDEYGVPASWWVEKNKGMVQQQDGSWILMDHEDDDL  426



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 241/395 (61%), Gaps = 23/395 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G +NW+ LLDPL++ LR  IL  G+  +ATYD+F  +  S+YAG CRY +  FF 
Sbjct  9     WRELNGKDNWKDLLDPLDIDLRRNILLYGEMAEATYDAFITEKKSRYAGDCRYARRDFFD  68

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV + +     Y+V  + YAT+ + VP+AFL+ S SRE+W +ESNW+GYVAV +D   K 
Sbjct  69    KVAISTGQHSLYRVTKFFYATSSIDVPDAFLIRSLSREAWSKESNWMGYVAVATDEGKKV  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR++ V +RGT   LEWIN      VSA  +L    SGD           P+V  GW 
Sbjct  129   LGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGD-----------PQVHRGWL  177

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S +   SAR Q+  +I  L  +Y  E  SIT+TGHSLGA+LA L A D+  
Sbjct  178   SIYTSDDPRSPYNKDSARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAADIAS  237

Query  693   NGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG+           PV A VF SP++G+  F +  +    L++L IRN  D++P YP  L
Sbjct  238   NGLNKSNARPNKSSPVAAFVFASPRVGDSDFREAFSNIPELRLLRIRNVPDLVPNYP--L  295

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY   G+E  ID RKS  LK+  N S WHNL+A LH VAG NG  G F+L+V R VALV
Sbjct  296   LGYDDIGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTNGGKGRFKLEVDRDVALV  355

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NK  + LK+E  +P SWW+EKNK MV   +G W L
Sbjct  356   NKGLDALKDEYLVPASWWVEKNKGMVKGADGHWRL  390



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   334 bits (857),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 243/402 (60%), Gaps = 25/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G +NW+ LLDPL++ LR  IL  GD  QATYDSFN +  SK+AG   + + + F 
Sbjct  90    WRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLFS  149

Query  1227  KVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V L  A+ Y+  +  +LYAT+ + V EAFLL S SRE+W++ESNWIGY+AV +D    A
Sbjct  150   RVGLSIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKAA  209

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    V A+ L  ++                KV  GW 
Sbjct  210   LGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLFGAANDS-------------KVHKGWL  256

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+D  S F   SAR+Q+ ++IE+L  +++ E++SIT+TGHSLGA+L  L A D+  
Sbjct  257   SIYTSQDARSPFNINSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDIIA  316

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             N +           PVTA +FG P +G++ F K       L +L  RNK D++P+YP  L
Sbjct  317   NRINKGKKQPQKPCPVTAFLFGCPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDYP--L  374

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
              GY K G E +ID RKS  LK+      WH+L+A LH VAG  G +G F L+VKR +A V
Sbjct  375   TGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFMLEVKRDIARV  434

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             NK+   LKEE  +PGSWW  +NK MV D +G W L     E+
Sbjct  435   NKALNALKEEYLVPGSWWCAQNKGMVQDADGFWKLDDHETEE  476



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/400 (43%), Positives = 246/400 (62%), Gaps = 20/400 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGL+DPL+ +LR  I+  G+  QA+YD+FN +  SK AG+ RY +N+FF 
Sbjct  24    WMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSRNNFFT  83

Query  1227  KVMLPSADD----YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             KV L    +    Y+V  YLYAT+ + VPEAF++ S SRESW +ESNWIG++AV +D   
Sbjct  84    KVGLDKDHNNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGK  143

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
              ALGRREI + +RGT   L+W+N      VSA  + R +T              P++  G
Sbjct  144   IALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTE-------------PQIHRG  190

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             W+++YTS DP S F   S R+Q+  +++ L  +YK E +SIT+TGHS+GA++  L A D+
Sbjct  191   WYSIYTSDDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDI  250

Query  699   CENGVTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVK  523
               NG      VTAI+F SP++G+  F    ++  NL+IL + N +D+IP YP  L+ Y +
Sbjct  251   VVNGFNKGCLVTAILFASPRVGDSNFVNAFSKLENLRILRVTNCLDIIPNYP--LIDYSE  308

Query  522   SGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCE  343
              G+E  ID  KS  LK   +   WH+L+A +H VAG+ G +G F+L+V R ++L+NK   
Sbjct  309   IGVELGIDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGANGGFKLEVGRDISLLNKHLN  368

Query  342   FLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPV  223
              LK+E  +P  WW+EKN  MV  ++G W L    D+D  V
Sbjct  369   ALKDEYCVPTCWWVEKNNGMVQQDDGYWKLMDHEDDDDSV  408



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/408 (42%), Positives = 251/408 (62%), Gaps = 27/408 (7%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY K 
Sbjct  40    SENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQ  99

Query  1239  SFFHKVMLPSAD----DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
              FF K+ L         Y+V  +LYAT+Q+ VP+AF++ S SRE+W +ESNWIGYVAV +
Sbjct  100   DFFAKIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVGT  159

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             D  +  LGRR++ + +RGT   LEW++ F    VSA  +   S+               K
Sbjct  160   DEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSD-------------VK  206

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             +  GW+++YTS D  S FT  S R Q+  +++ L  +YK E +SI  TGHSLGA+LA L 
Sbjct  207   IHQGWYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLN  266

Query  711   AFDLCENGVT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             AFD+  N +          PVT+ VF SP++G+  F +  +E  ++ +L ++N +D++P 
Sbjct  267   AFDMAANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPN  326

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED-GEFELKVK  376
             YP  ++GY + G E  ID RKS  LK+  + S WHNL+A LH VAG  G++ G F L+++
Sbjct  327   YP--IIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRLEIE  384

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             R +AL+NKS + LK+E  +P +W   +NK MV   +G W L    ++D
Sbjct  385   RDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEEDD  432



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/411 (42%), Positives = 252/411 (61%), Gaps = 27/411 (7%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S  +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY
Sbjct  43    SGKSENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRY  102

Query  1248  GKNSFFHKVMLPSAD----DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVA  1081
              K  FF K+ L         Y+V  +LYAT+Q+ VP+AF++ S SRE+W +ESNWIGYVA
Sbjct  103   SKQDFFAKIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVA  162

Query  1080  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK  901
             V +D  +  LGRR++ + +RGT   LEW++ F    VSA  +   S+             
Sbjct  163   VGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSD------------  210

Query  900   VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
               K+  GW+++YTS D  S FT  S R Q+  +++ L  +YK E +SI  TGHSLGA+LA
Sbjct  211   -VKIHQGWYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALA  269

Query  720   ILAAFDLCENGVT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDM  562
              L AFD+  N +          PVT+ VF SP++G+  F +  +E  ++ +L ++N +D+
Sbjct  270   TLNAFDMAANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDV  329

Query  561   IPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED-GEFEL  385
             +P YP  ++GY + G E  ID RKS  LK+  + S WHNL+A LH VAG  G++ G F L
Sbjct  330   VPNYP--IIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNKGGFRL  387

Query  384   KVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             +++R +AL+NKS + LK+E  +P +W   +NK MV   +G W L    ++D
Sbjct  388   EIERDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEEDD  438



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   329 bits (843),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 187/402 (47%), Positives = 247/402 (61%), Gaps = 25/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G +NWEGLLDPL+L LR L+L  GD  QA YD+FNH+  SKYAGSCRY K  FF 
Sbjct  10    WRILQGRDNWEGLLDPLDLDLRRLLLLYGDMAQAAYDAFNHERVSKYAGSCRYAKRDFFS  69

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +  +Y +  ++YAT+ + VPEAFL+ S SRE+W +ESNW+G+VAV +D   K 
Sbjct  70    KVNLVNGNPFEYTITKFIYATSSVQVPEAFLIRSLSREAWSKESNWMGFVAVATDNGKKQ  129

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR++ + +RGT   LEW+  F    VSA P+   S  GD+           KV  GW 
Sbjct  130   LGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPI---SGGGDDA----------KVHRGWF  176

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S +   SAREQ+ +++  L   YK E +SIT+TGHSLGA+L  L A D+  
Sbjct  177   SIYTSDDSKSPYNNTSAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDIVA  236

Query  693   NGV--------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG         T IPVT IVF SP++GN  F K       LK+L + N +D++P YP  L
Sbjct  237   NGTNIPKGRPGTQIPVTGIVFASPRVGNTEFKKRFEGSQGLKLLRVTNALDIVPNYP--L  294

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             + Y   G+   ID RKS  LK+ + PS  HNL+  LH VAG  G+ G F+L++ R +ALV
Sbjct  295   ISYDDVGVNLGIDTRKSDFLKSPVGPSGVHNLEIYLHGVAGTQGKKGGFKLEIPRDIALV  354

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             NKS + LK +  +P SW +EKNK MV   +G W L    +ED
Sbjct  355   NKSLDVLKVDYTVPASWKVEKNKGMVQLPDGSWKLMDHENED  396



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/407 (43%), Positives = 243/407 (60%), Gaps = 23/407 (6%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
              W QL G ENW+GLL+PL+ +LR  I++ G+  QATYD+F  +  SKYAGS RY K + F
Sbjct  7     NWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRYSKENLF  66

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              +V L   + Y +  Y YAT+   +PEAF++ S SRE+W +ESN++G+VAV +D     L
Sbjct  67    KRVGL-DPEMYHITKYFYATSSFPLPEAFMIRSWSREAWSKESNFMGFVAVATDKGKAVL  125

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR+I + +RGT   LEW+N      V A  +  +  S             P V  GW++
Sbjct  126   GRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNS-------ILPLLKPLVHQGWNS  178

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS DP S F   SAR+Q+  +++ L  KYK E +SIT+TGHSLGA+LA L A D+  N
Sbjct  179   VYTSDDPRSPFNKASARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALATLNAVDIVYN  238

Query  690   GVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             G+       + PVTA VF SP +G+  F    ++  NL IL I N +D++P+YP   +GY
Sbjct  239   GINKKSNGKEFPVTAFVFASPNVGDLNFRAAFSKLKNLHILRIDNLLDIVPKYPP--IGY  296

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED-------GEFELKVKRC  370
             +  G   VID  KS  +K+  N   WHNL+A +H VAG  G         GEF+L+V R 
Sbjct  297   IDVGQVLVIDTAKSDYVKSPGNILTWHNLEAYMHGVAGTQGVGILPGELLGEFKLEVNRD  356

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             +ALVNKS + LKEE  +P +WW+EKN  MV   +  WVL    D +L
Sbjct  357   IALVNKSMDALKEEYGVPANWWVEKNNGMVQRADRSWVLMDREDYEL  403



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   327 bits (838),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 240/398 (60%), Gaps = 23/398 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G ENW+GLL+PL+++LR  I++ G+  QATYD+F  D  SKYAGS RY K + F 
Sbjct  8     WEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRYSKENLFA  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L   + Y V  Y YAT+   +PEAF++ S SRE+W +ESN++GYVAV +D     LG
Sbjct  68    KVGL-DPEMYHVTKYFYATSSFPLPEAFMVKSWSREAWSKESNFMGYVAVATDKGKAVLG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   LEW+N      V A  +     S             P V  GW ++
Sbjct  127   RRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGGGNS-------ILPLFKPLVHQGWKSI  179

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S F   SAR+Q+  ++++L  KYK E +SIT+TGHSLGA++A L A D+  NG
Sbjct  180   YTSDDPKSPFNKASARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVATLNAVDIVYNG  239

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
                     + PVTA VF SP +G+  F    ++  NL IL + N +D++P+YP   +GY+
Sbjct  240   FNKTSNGKEFPVTACVFASPNVGDLNFRVAFSKLKNLHILRVDNIVDIVPKYPP--IGYI  297

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED-------GEFELKVKRCV  367
               G   VID  KS  LK+  N   WHNL+A LH VAG  G         G+F+L+V R +
Sbjct  298   DVGEVLVIDTAKSDYLKSPGNLQTWHNLEAYLHGVAGTQGVGILIGEFFGDFKLEVDRDI  357

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             ALVNKS + LK E  +P +WW+EKNK MV  ++  WVL
Sbjct  358   ALVNKSTDALKGEYGVPANWWVEKNKGMVQKKDKTWVL  395



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   327 bits (839),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 182/403 (45%), Positives = 240/403 (60%), Gaps = 25/403 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+  WEGLLDPL+L LR  I+  G+  QA YD+FN +  SKYAGS RY K + F 
Sbjct  32    WKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSEKASKYAGSSRYAKENLFS  91

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV +  A+   Y+V  Y YAT+   VP+AF+L S SRE+W RESNWIGYVAV +D    A
Sbjct  92    KVGIEQANPFKYRVTKYFYATSSTKVPDAFILKSWSREAWSRESNWIGYVAVATDEGKSA  151

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    VSA  +   +               P V  GW+
Sbjct  152   LGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIFGGNDE-------------PNVHLGWY  198

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S F   SAR Q+ T++  L  +YK E +S+T+TGHSLGA+++ L A D+  
Sbjct  199   SIYTSDDPRSPFNKTSARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDIVV  258

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTA +F SP++G+  F K ++   NL IL + N  D++P YP   
Sbjct  259   NGYNRPRDMPDKACPVTAFLFASPRVGDYKFRKFLSTLQNLHILRVTNARDIVPTYP--F  316

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             + Y + G E  ID  KS  LK+  N + WHNL+A LH VAG  G  G F+L+V R +ALV
Sbjct  317   VNYAEVGQELPIDTDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGSRGGFKLEVNRDIALV  376

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             NK  + LK+E  +P SWW EK+K MV  E+G W L    D+D 
Sbjct  377   NKHLDGLKDEYCVPVSWWCEKHKGMVQQEDGSWKLMDHEDDDF  419



>ref|XP_009415331.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   326 bits (835),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 179/398 (45%), Positives = 241/398 (61%), Gaps = 42/398 (11%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A  P+W +LLGSE+W GLLDPL+ SLR  +L+CGD CQ T DSF  D +SKY G CRY  
Sbjct  7     AETPSWPELLGSEHWSGLLDPLDQSLRVFLLQCGDMCQVTGDSFIGDDHSKYRGMCRYRP  66

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             ++   +V  P A +Y V+ YLYA +Q +  +             +ESNW+GY+AV+ DA 
Sbjct  67    STLLDQVFFPYAANYDVKEYLYAMSQNSSNKT------------KESNWMGYIAVSKDAY  114

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             +K  GRREIYVV+RGT    EW   F+   V  +P  R                   VM 
Sbjct  115   TKRTGRREIYVVWRGTGRPSEWCEDFTTGLVPLDPDKRDVM----------------VMQ  158

Query  882   GWHTLYTSKDPNSRF--TTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             GW+ +YT KD +S+F     SAREQL +K++EL   YK E+LSI   G+SLG +LAIL++
Sbjct  159   GWNDIYTLKDSDSQFPCNATSAREQLLSKLKELVELYKNESLSIVCVGYSLGGALAILSS  218

Query  708   FDLCENGVTDI--------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             FD+   G++ I        PV A+VF +P++GNK F+K   E  NL+ L +RN  D++P 
Sbjct  219   FDMVNKGLSKIEGKAEEYFPVCAVVFENPKVGNKAFNKRFEELPNLRALRVRNTRDIVPL  278

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             +P +   YV +G    ID   S  L NS+N    H+LQ +LH +AGW  + GEF L+VKR
Sbjct  279   WPIS-TDYVDTGSFLEIDANMSPYLNNSVNN---HDLQVVLHTLAGWTSKGGEFHLEVKR  334

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW  259
              +ALVNK   +LK+E  IP +WW+EKNK MVL E+GEW
Sbjct  335   SLALVNKGGGYLKDESQIPEAWWVEKNKGMVLSEDGEW  372



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   326 bits (835),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 243/393 (62%), Gaps = 23/393 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NW+ LLDPL+  LRH I+  G+  QATYDSFN    SKYAGS  Y K+ FF+
Sbjct  9     WKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSLYAKDEFFN  68

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V L   +   Y+V  +LYAT+Q+ + EAF++ S SRE+W +ESNW+G+VAV++D    A
Sbjct  69    RVHLEKGNPFKYRVTKFLYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGKVA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    VSA  +L  S +             PKV  GW+
Sbjct  129   LGRRDIVIAWRGTIQILEWVNDFEFNLVSASKILGESGN-------------PKVHQGWY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S +   SAR+Q+  ++  L  ++K E +SIT+TGHSLGA+LA L A D+  
Sbjct  176   SIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVA  235

Query  693   NGVTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
             NG          PVTA++F SP++G+  F K+ +   +LK L + N +D++P+YP   +G
Sbjct  236   NGFNKSHENKGCPVTAMLFASPRVGDSNFKKVFSRYMDLKALRVHNVLDVVPKYP--FIG  293

Query  531   YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
             Y   G E +ID  KS  LK+  N S WHNL+A LH VAG  G  G FEL   R +AL+NK
Sbjct  294   YADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSKGGFELVANRDIALINK  353

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             + + LK+E  +P SW I++NK MV   +G W L
Sbjct  354   TTDGLKDEYLVPASWRIQENKGMVQQADGSWKL  386



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/395 (46%), Positives = 238/395 (60%), Gaps = 26/395 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL+L LR  ++  G   QATYD+FN ++ SK+AGS RY KN  F 
Sbjct  25    WKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYDTFNSENASKFAGSSRYAKNDLFS  84

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
              V +   +   Y+V  Y YAT+   VP+AF++ S SRE+W +ESNW+GYVAV +D    A
Sbjct  85    NVGMDKGNPFKYRVTKYFYATSSAQVPDAFIVPSWSREAWSKESNWMGYVAVATDEGKSA  144

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT  +LEW+N F    V A  +   +               PKV FGWH
Sbjct  145   LGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIFGGNDD-------------PKVHFGWH  191

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S F+  SAR Q+  ++  L  +YK E +SIT+TGHSLGA+++ + A D+  
Sbjct  192   SIYTSDDPKSPFSKNSARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDIVV  251

Query  693   NGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTA VF  P++G+  F   +    NL IL +RN  D++P+YP   
Sbjct  252   NGYNRPQGMLHKHCPVTAFVFACPRVGDNNFRDFVLNLQNLHILRVRNARDIVPKYP--F  309

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             + YV  G E  ID  KS+ LK   N S WHNL+A LH VAG  G +G F+L+V R +ALV
Sbjct  310   IDYVDVGEELAIDTDKSSYLKEG-NLSSWHNLEAYLHGVAGTRGSEGGFKLEVNRDIALV  368

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NK  + LK+E  +P SWW EKNK MV   +G WVL
Sbjct  369   NKHMDALKDEFCVPVSWWCEKNKGMVQQADGSWVL  403



>gb|KHN34242.1| Phospholipase A1-IIdelta [Glycine soja]
Length=275

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 197/273 (72%), Gaps = 10/273 (4%)
 Frame = -1

Query  1005  LEWINVFSAKPVSAEPLLRSST----------SGdnddkeedddKVPKVMFGWHTLYTSK  856
             +EWINVF A  V A  LL + +             +   EEDD + PKVM GW T+YTS 
Sbjct  1     MEWINVFGAGQVDASGLLSAKSLKELKDGNKDGSSSSSDEEDDPRKPKVMSGWLTIYTSD  60

Query  855   DPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVTDI  676
             +P S FT  SAR QLQ  ++ L   Y  EN S+ + GHSLGA+L+I++AFDL ENGVT+ 
Sbjct  61    NPKSPFTKSSARTQLQAHVKSLLQHYSSENPSLVIVGHSLGATLSIVSAFDLVENGVTEA  120

Query  675   PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDH  496
             PVTAIVFGSPQ+GNK F++      NLK+LH++N ID+IP YPG LLGY   G E VID 
Sbjct  121   PVTAIVFGSPQVGNKAFNERFNMFPNLKVLHVKNVIDLIPHYPGKLLGYEYMGTELVIDT  180

Query  495   RKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIP  316
             RKS SLK+S NP DWHNLQAMLHVVAGWNG+  EFE++VKR VALVNKSCEFLKEE  +P
Sbjct  181   RKSPSLKDSRNPGDWHNLQAMLHVVAGWNGKKEEFEMRVKRSVALVNKSCEFLKEEYGVP  240

Query  315   GSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             GSWW+EKNK MV  E+GEWVL +P++ED+PV E
Sbjct  241   GSWWVEKNKGMVKREDGEWVLDAPDEEDVPVLE  273



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   325 bits (833),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 248/408 (61%), Gaps = 26/408 (6%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY K 
Sbjct  46    SENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQ  105

Query  1239  SFFHKVMLPSAD----DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
              FF K+ L         Y+V  +LYAT+Q+ VP+AF++ S SRE+W +ESNWIGYVAV++
Sbjct  106   DFFAKIGLGKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVST  165

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             D  +  LGRR++ + +RGT   LEWI+ F    VSA  +   S+               K
Sbjct  166   DEGAAELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIFGESSD-------------VK  212

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             +  GW+++YTS D  S FT  S R Q+  +++ L  +YK E +SI  TGHSLGA+LA L 
Sbjct  213   IHQGWYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLN  272

Query  711   AFDLCENGVT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
             A D+  N +          PVT+ VF  P++G+  F +  +E  ++ +L ++N +D++P 
Sbjct  273   AVDIAANKLNIAAATGQAYPVTSFVFACPRVGDSEFKRAFSEYKDVHVLRVKNAMDVVPN  332

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED-GEFELKVK  376
             YP   +GY + G E  ID RKS  LK+  + S WHNL+  LH VAG  G++ G F L+++
Sbjct  333   YP-MFIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEGYLHGVAGTQGKNKGGFRLEIE  391

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             R +AL+NKS + LK+E  +P +W   +NK MV   +G W L    ++D
Sbjct  392   RDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQTDGSWKLMDHEEDD  439



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/401 (44%), Positives = 249/401 (62%), Gaps = 24/401 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NW+ LLDPL+  LRH I+  G+  QATYDSFN    SKYAG   Y K+ FF+
Sbjct  9     WKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSLYAKDEFFN  68

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V L   +   Y+V  ++YAT+Q+ + EAF++ S SRE+W +ESNW+G+VAV++D    A
Sbjct  69    RVHLEKGNPFKYRVTKFVYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGKVA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    VSA  +L  S +             PKV  GW+
Sbjct  129   LGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKILGESGN-------------PKVHQGWY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS D  S +   SAR+Q+  ++  L  ++K E +SIT+TGHSLGA+LA L A D+  
Sbjct  176   SIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDIVA  235

Query  693   NGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
             NG          PVTA++F SP++G+  F K+ +   +LK + I N +D++P+YP   +G
Sbjct  236   NGFNMSHENKGCPVTAMLFASPRVGDSNFKKVFSGYMDLKAIRIHNFLDVVPKYP--FIG  293

Query  531   YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
             Y   G E +ID  KS  LK+  N S WHNL+A LH VAG  G  G FEL V R +AL+NK
Sbjct  294   YADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGFKGGFELVVNRDIALINK  353

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             + + LK+E  +P SW I++NK MV + +G W L   ++ED+
Sbjct  354   TIDGLKDEYLVPVSWRIQENKGMVQEADGSWKL-EDHEEDV  393



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/407 (44%), Positives = 243/407 (60%), Gaps = 23/407 (6%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             + +  W  L G  +W+ LLDPL+  LR  I+  G+  QATYD FN    SKYAGS  Y K
Sbjct  21    SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKYAGSSLYAK  80

Query  1242  NSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             + FF KV L   +   Y+V  +LYAT+Q+ +PEAF++ S SRE+W +ESNWIG+VAV +D
Sbjct  81    DDFFTKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATD  140

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I + +RGT   LEW+N F    VSA  +L  S               PKV
Sbjct  141   EGKTTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKILGESGD-------------PKV  187

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               GW+++YTS D  S +   SAR+Q+  +I  L  KY  E +SIT+ GHSLGA++A L A
Sbjct  188   HQGWYSIYTSDDSRSPYNKNSARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNA  247

Query  708   FDLCENGVTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG          PVTAI+F SP++G+  F K+ +   +L+ L I N +D++P YP
Sbjct  248   VDIVANGFNQSQKNKRCPVTAILFASPRVGDSNFKKVFSGYKDLRALRIHNVLDVVPSYP  307

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               L+GY   G E VID  KS  LK+  N S WHNL+  LH VAG  G  G F+L+V R +
Sbjct  308   --LIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDI  365

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
             ALVNK+ + LK+E  +P SW +++NK MV   +G W L    ++ +P
Sbjct  366   ALVNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDVEEDFIP  412



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 249/407 (61%), Gaps = 25/407 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G+ NW+GLLDPL+L LR  I+  G   QATYD+FN +  SKYAGS RY K++   
Sbjct  30    WKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSSRYSKDNLLS  89

Query  1227  KVMLPSAD--DYQVEAYLYATAQLT-VPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV +  A+   Y+V  Y+YAT+ LT VP+AF+L S SRE+W +ESNWIGYVAV +D    
Sbjct  90    KVGVDKANPFKYRVTKYVYATSSLTEVPDAFILRSWSREAWTKESNWIGYVAVATDEGKL  149

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             ALGRR+I + +RGT   LEWIN F    V A  +  ++  GD+          P+V  GW
Sbjct  150   ALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQ---------PRVHLGW  200

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++YTS DP S F   SAR Q+  +++ L  +YK E  SIT+TGHSLGA++  L A D+ 
Sbjct  201   YSIYTSDDPRSPFNKTSARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLNASDIV  260

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTE---KTNLKILHIRNKIDMIPEY  550
              N             PVT   F SP++G+  F K+++      NL IL +RN  D++P+Y
Sbjct  261   VNKYNKPNDMPDKSCPVTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKDIVPKY  320

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P   + Y + G+E VID  KS+ LK+  N S WH+L+  LH VAG  G  G F+L+V R 
Sbjct  321   P--FIDYSEVGVELVIDTDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGSRGGFKLEVNRS  378

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             +ALVNK  + LK+E  +P SWW E+NKSMV  ++G W L    D+D 
Sbjct  379   LALVNKHMDGLKDEYCVPVSWWCERNKSMVQSDDGSWELIDHEDDDF  425



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   320 bits (821),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 247/408 (61%), Gaps = 16/408 (4%)
 Frame = -1

Query  1452  LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNS  1273
             + S   F ++A    W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S
Sbjct  1     MSSLRGFGNIARR--WRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRS  58

Query  1272  KYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWI  1093
             +YAGSC + +  F  +V + + + Y++  ++YA   +++P+ F++   S+ +W ++SNW+
Sbjct  59    RYAGSCLFRRKDFLSRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWM  118

Query  1092  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkee  913
             G+VAV +D   + LGRR++ V +RGT   LEW++      V A  ++R  ++ D      
Sbjct  119   GFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAND------  172

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
                  P+V  GW ++YTS DP SR+   SAR Q+  ++E L+  YK E  SIT+TGHSLG
Sbjct  173   -----PRVHGGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLG  227

Query  732   ASLAILAAFDLCENGVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIP  556
             A+LA ++A D+  NG     PV+A VFGSP++GN  F K      +L++L +RN  D++P
Sbjct  228   AALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVP  287

Query  555   EYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVK  376
              +P   LGY  +G E +ID  +S  +K+  NP  WH+++  +H VAG  G +G FEL+V 
Sbjct  288   NWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVD  345

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             R +ALVNK  + LKEE  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  346   RDIALVNKHEDALKEEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   321 bits (822),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/397 (45%), Positives = 239/397 (60%), Gaps = 26/397 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NW+GLL PL+  LR  I+  G+  QATYD+FN ++ SKYAGS  Y +  FF 
Sbjct  9     WRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSRQDFFS  68

Query  1227  KVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L   +    YQV  +LYAT+Q+ VP++FL+   SRE   +ESNW+GYVAVT+D  ++
Sbjct  69    KVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTE  128

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEWIN F    V A+ +    + G             +V  GW
Sbjct  129   LLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGV------------QVHQGW  176

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++YTS D  S F   SAR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  177   YSIYTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAADIV  236

Query  696   ENGVT------DIP--VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG        D P  VTA VF SP++GN  F KL +   +L+ L +RN  D++P YP  
Sbjct  237   ANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYPP-  295

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG-EDGEFELKVKRCVA  364
              LGY   G E  ID RKS  LK   +   +HNL+A LH VAG  G    EF+L+VKR ++
Sbjct  296   -LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKEFKLQVKRDIS  354

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             L+NKS + LK+E  +PGSW + KNK MV  ++G W L
Sbjct  355   LINKSIDALKDEYMVPGSWRVLKNKGMVQQDDGSWKL  391



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/404 (44%), Positives = 243/404 (60%), Gaps = 26/404 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+ LLDPL++ LRH I+  G+  QA YD+FN    SK AGS  Y K +FF 
Sbjct  32    WKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSLYTKEAFFS  91

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   YQV  +LYAT+Q+ +PEAF++ S SRE+W +ESNW+GYVAV +D     
Sbjct  92    KVGLENGNPYKYQVTKFLYATSQIQLPEAFIIKSLSREAWSKESNWMGYVAVATDEGKAV  151

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEW+N F    V A  +   S                KV  GW+
Sbjct  152   LGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIFGESND-------------RKVHQGWY  198

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS DP S +   SAR+Q+  ++  L  +YK E +SIT+ GHSLGA++A L A D+  
Sbjct  199   SVYTSDDPRSPYNKSSARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADIVA  258

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG            PVTAIVF SP++G+  F K+ +   +L++L + N +D++P YP  L
Sbjct  259   NGFNKSKSWPNKPCPVTAIVFASPRVGDSDFKKVFSGYKDLRVLRVHNLLDVVPNYP--L  316

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G E  ID  KS  LK+  N S WHNL+  LH VAG  G  G F+L+V R +ALV
Sbjct  317   IGYADVGEELTIDTTKSKYLKSPGNVSSWHNLEGYLHGVAGTQGSTGGFKLEVNRDIALV  376

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
             NKS + LK+E  +P SW I+KNK M+   +G W L   ++ED P
Sbjct  377   NKSLDGLKDEYLVPTSWRIQKNKGMIQQADGSWKL-MDHEEDAP  419



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 175/407 (43%), Positives = 244/407 (60%), Gaps = 23/407 (6%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             + +  W  L G  +W+ LLDPL+  LR  I+  G+  QATYDSFN    SKYAGS  Y K
Sbjct  21    SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKYAGSSLYAK  80

Query  1242  NSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
             + FF KV L   +   Y+V  +LYAT+Q+ +PEAF++ S SRE+W +ESNWIG+VAV +D
Sbjct  81    DDFFSKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATD  140

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I + +RGT   LEW+N F    VSA  +L  S               PKV
Sbjct  141   EGKTTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKILGESGD-------------PKV  187

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               GW+++YTS D  S++   SAR+Q+  ++  L  KY  E +SIT+ GHSLGA++A L A
Sbjct  188   HQGWYSIYTSDDSRSQYNKNSARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNA  247

Query  708   FDLCENGVTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG          PVTA++F SP++G+  F ++ +   +L+ L I N  D++P YP
Sbjct  248   VDIVANGFNQSQKNKRCPVTAMLFASPRVGDSNFKRVFSGYKDLRALRIHNVRDVVPNYP  307

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               L+GY   G E VID  KS  LK+  N S WHNL+  LH VAG  G  G F+L+V R +
Sbjct  308   --LIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPKGGFKLEVNRDI  365

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
             AL+NK+ + LK+E  +P SW +++NK MV   +G W L    ++ +P
Sbjct  366   ALLNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDLEEDFIP  412



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   321 bits (822),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/406 (42%), Positives = 241/406 (59%), Gaps = 28/406 (7%)
 Frame = -1

Query  1428  SMATEP---TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGS  1258
             SMA+ P    W  L G  +W+  L+PL+L LR  I+  G+  QATYD+FN ++ SKYAGS
Sbjct  21    SMASRPLGKRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGS  80

Query  1257  CRYGKNSFFHKVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGY  1087
               Y +  FF KV L        YQV  +LY+T+Q++VP++FL+   SRE W +ESNWIGY
Sbjct  81    SIYSRQDFFSKVGLEKGHPYCKYQVTKFLYSTSQISVPDSFLVFPVSREGWTKESNWIGY  140

Query  1086  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedd  907
             VAV +D   + LGRR+I V +RGT   LEWIN F    ++A+ +   +  G         
Sbjct  141   VAVATDQGKQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVG-------  193

Query  906   dKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGAS  727
                  V  GW+++YTS+D  S F   SAR+Q+  +I  L  KYK E +SIT+ GHSLGA+
Sbjct  194   -----VHQGWYSIYTSEDERSPFNKASARDQVLREIRRLVEKYKDEEISITICGHSLGAA  248

Query  726   LAILAAFDLCENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNK  571
             L+ L+A D+  NG            PVT   F SP++G+  F +L +   +L+ L IRN 
Sbjct  249   LSTLSAADIVANGYNRPKNLPDKSCPVTVFAFASPRVGDSDFKRLFSGLDDLRALRIRNL  308

Query  570   IDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEF  391
              D++P YP   +GY + G E V+D RKS  LK+  NP+ +H ++  LH +AG  G   +F
Sbjct  309   PDVVPIYP--PIGYSEVGEELVMDTRKSPYLKSPGNPTLFHTMEVYLHGIAGTRGTKSDF  366

Query  390   ELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             +L+++R +ALVNK  + LK+E  +PGSW   KNK M    +G W L
Sbjct  367   KLEIERDIALVNKPIDGLKDEFMVPGSWRALKNKGMAQQNDGSWKL  412



>ref|XP_003540985.1| PREDICTED: phospholipase A1-IIdelta-like, partial [Glycine max]
Length=268

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 178/227 (78%), Gaps = 0/227 (0%)
 Frame = -1

Query  897  PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
            PKVM GW T+YTS +P S FT  SAR QLQ  ++ L   Y  EN S+ + GHSLGA+L+I
Sbjct  40   PKVMSGWLTIYTSDNPKSPFTKSSARTQLQAHVKSLLQHYSSENPSLVIVGHSLGATLSI  99

Query  717  LAAFDLCENGVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
            ++AFDL ENGVT++PVTAIVFGSPQ+GNK F++      NLK+LH++N ID+IP YPG L
Sbjct  100  VSAFDLVENGVTEVPVTAIVFGSPQVGNKAFNERFNMFPNLKVLHVKNVIDLIPHYPGKL  159

Query  537  LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
            LGY   G E VID RKS SLK+S NP DWHNLQAMLHVVAGWNG+  EFE++VKR VALV
Sbjct  160  LGYEYMGTELVIDTRKSPSLKDSRNPGDWHNLQAMLHVVAGWNGKKEEFEMRVKRSVALV  219

Query  357  NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
            NKSCEFLKEE  +PGSWW+EKNK MV  E+GEWVL +P++ED+PV E
Sbjct  220  NKSCEFLKEEYGVPGSWWVEKNKGMVKREDGEWVLDAPDEEDVPVLE  266



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   320 bits (820),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 253/456 (55%), Gaps = 79/456 (17%)
 Frame = -1

Query  1431  QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCR  1252
              S+AT   W +L G +NW+ LLDPL++ LR +I+  G+  QATYD+FN +  S +AGS R
Sbjct  3     DSIATR--WRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSR  60

Query  1251  YGKNSFFHKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAV  1078
             Y K +FF  + L   + Y+  +  +LYAT+++ VP+AF++ S SRE+W RESNW+GYVAV
Sbjct  61    YSKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAV  120

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV  898
              +D     LGRR+I + +RG+   LEWI+ F    VSA  +LR+ T              
Sbjct  121   ATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDA------------  168

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
              KV  GW ++YTS DP S + T SAR+Q+  +++ L  ++K E ++IT+TGHSLGA+L I
Sbjct  169   -KVHQGWLSIYTSDDPRSPYNTTSARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGI  227

Query  717   LAAFDLCENGV---TDIP-----VTAIVFGSPQIGNKLFDK---LMTEKTNLKILHIRNK  571
             L A D+  NG+   TD P     VTA +FG P +G+  F     ++    +L++L IRN 
Sbjct  228   LNAVDIVANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNA  287

Query  570   IDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG-----  406
             ID++P YP  ++GY + G E VI+   S  LK S  P  WHNL+  LH +AG  G     
Sbjct  288   IDVVPNYP-PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLP  346

Query  405   ---------------------------------------------EDGEFELKVKRCVAL  361
                                                          E GEF+L VKR + L
Sbjct  347   ATTNKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITL  406

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VNK  + LK+E  +P  WW EKNK MV +++G W L
Sbjct  407   VNKVMDALKDEFHVPAKWWCEKNKGMVQEDDGSWKL  442



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/393 (40%), Positives = 240/393 (61%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  14    WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFLS  73

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y++  ++YA   +++P+ F++   S+ +W ++SNW+G+VAV +D   + LG
Sbjct  74    RVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLG  133

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   LEW++        A  ++R  ++ D           P+V  GW ++
Sbjct  134   RRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADD-----------PRVHGGWLSV  182

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP SR+   SAR Q+  ++E L+  YK E  SIT+TGHSLGA+LA ++A D+  NG
Sbjct  183   YTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNG  242

Query  687   VTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F K      +L++L +RN  D++P +P   LGY  +G E
Sbjct  243   YNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK--LGYSDAGTE  300

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  +S  +K+  NP  WH+++  +H VAG  G +G FEL+V R +ALVNK  + LK+
Sbjct  301   LMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKK  360

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  361   EYSIPSSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/394 (44%), Positives = 229/394 (58%), Gaps = 36/394 (9%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  S++AGS RY K  FF 
Sbjct  8     WRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKKDFFS  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV +   + ++     Y T                    +ESNW+GYVAV +D     LG
Sbjct  68    KVGIDIGNPFK----YYVTKYF-----------------KESNWMGYVAVATDEGKAVLG  106

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   LEW+N F    VSA  +L  +               PKV  GW+++
Sbjct  107   RRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGG------------EPKVHQGWYSI  154

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S F+  SAR+Q+  ++  L  ++K E +SI+LTGHSLGA++A L A D+  NG
Sbjct  155   YTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVDIVANG  214

Query  687   VTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
             +    PVTA+VF SP++G+  F KL +   NL++L +RN  D+IP YP  LLGY   G E
Sbjct  215   LNQGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNYP--LLGYSDVGEE  272

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
               +D RKS  LK+  N S WHNL+A LH VAG  G  G F L+V R +ALVNKS + L +
Sbjct  273   LGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDALND  332

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             E  +P SW  EKNK MV   +G W L    ++DL
Sbjct  333   EYLVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  366



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   315 bits (808),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/395 (42%), Positives = 236/395 (60%), Gaps = 26/395 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G ++W+GLLDPL++ LR  ++  G+  QA YD F     S++AG+  Y +++   
Sbjct  9     WRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPLYARSNILQ  68

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L    +  Y+V  + YAT+ + VP+AF++ S SR++W ++SNW+GYVAV +D  +  
Sbjct  69    KVALSQGQERLYRVTKFFYATSGVQVPDAFIIKSLSRQAWSKDSNWMGYVAVATDEGAAQ  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR++ V +RGT   LEWIN      V A  +L SS+              P V  GW 
Sbjct  129   LGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGSSS--------------PLVHRGWL  174

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS+DP S ++  SAR Q+  ++  L  +YK E  SIT+TGHSLGA++A L A D+  
Sbjct  175   SIYTSEDPKSPYSKSSARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDIVA  234

Query  693   NGV--------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             N          T  PVTA VF SP++G+  F KL +   +L++L +RN  D++P YP  +
Sbjct  235   NSFNRSSNPSSTGCPVTAFVFASPRVGDFEFQKLFSGTPDLRLLRVRNAPDLVPNYP--I  292

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             + YV  G+E  ID RKS  LK   + + WHNL+  LH  AG  G  G F+L + R VALV
Sbjct  293   IPYVDVGVELAIDTRKSEYLKAPGDLTTWHNLECYLHGTAGAQGRRGGFKLAIDRDVALV  352

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NKS + LK+E  +P SWW+EKNK M+   +G + L
Sbjct  353   NKSTDALKDEYLVPDSWWVEKNKGMMKGADGHYKL  387



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/408 (39%), Positives = 246/408 (60%), Gaps = 16/408 (4%)
 Frame = -1

Query  1452  LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNS  1273
             + S   F ++A    W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S
Sbjct  1     MSSLRGFGNIARR--WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRS  58

Query  1272  KYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWI  1093
             +YAGSC + +  F  +V + + + Y++  ++YA   +++P+ F++   S+ +W ++SNW+
Sbjct  59    RYAGSCLFRRKDFLSRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWM  118

Query  1092  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkee  913
             G+VAV +D   + LGRR++ V +RGT   LEW++        A  ++R  ++ D      
Sbjct  119   GFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSAND------  172

Query  912   dddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLG  733
                  P+V  GW ++YTS DP SR+   SAR Q+  +++ L+  YK E  SIT+TGHSLG
Sbjct  173   -----PRVHGGWLSVYTSTDPGSRYNEQSARYQVLDEVKRLQDLYKQEETSITITGHSLG  227

Query  732   ASLAILAAFDLCENGVTDI-PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIP  556
             A+LA ++A D+  NG     PV+A VFGSP++GN  F K      +L++L +RN  D++P
Sbjct  228   AALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFRKAFDSAEDLRLLRVRNSPDVVP  287

Query  555   EYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVK  376
              +P   LGY  +G E +ID  +S  +K+  NP  WH+++  +H VAG  G +G FEL+V 
Sbjct  288   NWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVD  345

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             R +ALVNK  + LK+E  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  346   RDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 237/393 (60%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GLLDPL++ LR+ I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  14    WRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFLS  73

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y +  ++YA   +++P+AF++ S S+ +W ++SNW+G+VAV +D   + LG
Sbjct  74    RVDVSNPNLYVITKFIYAMCTVSLPDAFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLG  133

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++R  ++ D           P V  GW ++
Sbjct  134   RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADD-----------PCVHGGWLSV  182

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S++   SAR Q+  +I+ L+  Y+ E  SIT+TGHSLGA+LA + A D+  NG
Sbjct  183   YTSADPESQYNKQSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINATDIVSNG  242

Query  687   VT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F K      +L++L IRN  D++P +P   LGY  +G E
Sbjct  243   YNKSCPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWPK--LGYSDAGTE  300

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  KS  LK   NP  WH+++  +H VAG  G +G F+L++ R +ALVNK  + LK 
Sbjct  301   LMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHEDALKN  360

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV   +G W L    D+D
Sbjct  361   EYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  393



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 180/463 (39%), Positives = 253/463 (55%), Gaps = 86/463 (19%)
 Frame = -1

Query  1431  QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCR  1252
              S+AT   W +L G +NW+ LLDPL++ LR +I+  G+  QATYD+FN +  S +AGS R
Sbjct  3     DSIATR--WRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSR  60

Query  1251  YGKNSFFHKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAV  1078
             Y K +FF  + L   + Y+  +  +LYAT+++ VP+AF++ S SRE+W RESNW+GYVAV
Sbjct  61    YSKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAV  120

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV  898
              +D     LGRR+I + +RG+   LEWI+ F    VSA  +LR+ T              
Sbjct  121   ATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDA------------  168

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQT-------KIEELRSKYKGENLSITLTGHS  739
              KV  GW ++YTS DP S + T SAR+Q  T       +++ L  ++K E ++IT+TGHS
Sbjct  169   -KVHQGWLSIYTSDDPRSPYNTTSARQQSITVKFQVLEEVKRLVEEFKDEEINITITGHS  227

Query  738   LGASLAILAAFDLCENGV---TDIP-----VTAIVFGSPQIGNKLFDK---LMTEKTNLK  592
             LGA+L IL A D+  NG+   TD P     VTA +FG P +G+  F     ++    +L+
Sbjct  228   LGAALGILNAVDIVANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLR  287

Query  591   ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGW  412
             +L IRN ID++P YP  ++GY + G E VI+   S  LK S  P  WHNL+  LH +AG 
Sbjct  288   LLRIRNAIDVVPNYP-PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGT  346

Query  411   NG--------------------------------------------------EDGEFELK  382
              G                                                  E GEF+L 
Sbjct  347   QGSSVLPATTNKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLV  406

Query  381   VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VKR + LVNK  + LK+E  +P  WW EKNK MV +++G W L
Sbjct  407   VKRDITLVNKVMDALKDEFHVPAKWWCEKNKGMVQEDDGSWKL  449



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   310 bits (795),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 233/415 (56%), Gaps = 29/415 (7%)
 Frame = -1

Query  1455  VLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSN  1276
             VL +      +AT   W ++ G + W GLLDPLN+ LR  I+R G+  QAT D+F  D  
Sbjct  9     VLLAVTILTDVATAQRWREISGRDQWSGLLDPLNIELRREIIRYGELAQATSDAFIGDPA  68

Query  1275  SKYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNW  1096
             S YAG+ RYG  +FF+KV       Y+V  +LYAT+   + +AF+       +W  ESNW
Sbjct  69    SPYAGASRYGPGTFFYKVQAADPGAYRVTRFLYATSSARLRDAFMTRPVPAGAWSTESNW  128

Query  1095  IGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddke  916
             +GYVAV +D  ++ALGRR++ V +RGT   +EW +      V A  ++     G      
Sbjct  129   MGYVAVATDGAARALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGVVGPGGRG------  182

Query  915   edddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSL  736
                     V  G+ +LYTSK+  SRF   SAREQ+ T++  L   YK EN S+TLTGHSL
Sbjct  183   -------SVHRGFLSLYTSKNSTSRFNKQSAREQVLTEVRRLLDTYKDENCSVTLTGHSL  235

Query  735   GASLAILAAFDLCENGVT----------DIPVTAIVFGSPQIGNKLFDKLMTEKTN-LKI  589
             GA+L+ L A D+  NG+            +PVTAI+FGSP++G++ F K +      + +
Sbjct  236   GAALSTLNAIDIVANGINALRSSSGDNITVPVTAILFGSPRVGDEQFKKALDSMAGAVSL  295

Query  588   LHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGW  412
             L +RN  D++P   P     Y   G+E ++D  KS  LK    P+ WHNL+  LH VAG 
Sbjct  296   LRVRNAPDIVPTILPTPF--YRDVGVELLVDTLKSPYLKTPAGPAQWHNLECYLHAVAGT  353

Query  411   N--GEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
                G+D  F L+V R VALVNK  + LK E  +P SWW E NK MV +  G WVL
Sbjct  354   QGPGDDAGFSLEVDRDVALVNKEEDALKGEYPVPASWWAENNKGMVKNATGHWVL  408



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 235/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+GLL PL+  LR  I+  G+  QA YD+FN ++ SKYAG+  Y +  FF 
Sbjct  39    WRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRKDFFA  98

Query  1227  KVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+++ VPEAFLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  99    KVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYVAVTDDQGTA  158

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I + +RG+   LEW++ F    V+A+ +     +              ++  GW
Sbjct  159   VLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQV------------QIHQGW  206

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             H++Y S+D  S F   +AR+Q+  ++  L  KYK E +SI++ GHSLGA+LA L A D+ 
Sbjct  207   HSIYMSEDERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATDIV  266

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++GN  + KL +   ++++L +RN  D++P YP  
Sbjct  267   ANGYNRPKSRLGKSCPVTAFVFASPRVGNSEYKKLFSGLEDIRVLRVRNLPDVVPIYPP-  325

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FELKVKRCV  367
              LGY + G EF ID RKS  +K   N + +H L++ LH VAG  G      F L VKR +
Sbjct  326   -LGYAEVGDEFPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSADLFRLDVKRDI  384

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK++  IPG W + KNK MV  ++G WVL
Sbjct  385   GLVNKSVDGLKDQYMIPGHWRVLKNKGMVQQDDGSWVL  422



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 232/404 (57%), Gaps = 30/404 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NWEG+LDPL++ LR  IL  G   QATYD+FN +  S +AG+CRY K  FF 
Sbjct  10    WRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNCRYAKRDFFS  69

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L   +   Y+V  +LYAT++ T  + F L   S++ W  ESNWIGYVAV +D    A
Sbjct  70    KVGLEHGNPFKYEVTEFLYATSKATASKQFALKLFSKDEWGMESNWIGYVAVATDEGKAA  129

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW+      P+   PL+                   ++  G++
Sbjct  130   LGRRDIVVAWRGTVQGSEWVQDLHI-PLDPAPLIFRDARA-------------ELHNGFY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS +P+S  T  SAR Q+  ++  L  KYK E +SI++TGHSLGA+LA L A D+  
Sbjct  176   SVYTSNNPDSHITQTSARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDIAA  235

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              G+           PVTA +F SP++GN  F K+ +E  +L+ L IRNK D +P+ P   
Sbjct  236   QGLNKPKDQPHRVFPVTAFLFASPRVGNSHFGKIFSEYKHLRALRIRNKKDQVPKLP---  292

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +G    G E VID RKS  LK  ++    HNL+A LH VAG  G+ G F L+V R +AL+
Sbjct  293   IGLAVVGQELVIDTRKSKYLKEGVSA---HNLEAYLHGVAGTQGKKGGFNLEVNRDIALL  349

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLP  226
             NK  + LK+E  +P  W + +NK MV   +G W L   N++ +P
Sbjct  350   NKGMDALKDEYLVPVEWRVHENKGMVQQSDGTWKLFDHNEDVIP  393



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   308 bits (789),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/393 (39%), Positives = 233/393 (59%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  14    WRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + D Y++  ++YA   +++P+ F++ S S+ +W R+SNW+G+VAV +D   + LG
Sbjct  74    RVDVSNPDLYEITKFVYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLG  133

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++   ++             P V  GW ++
Sbjct  134   RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSA-----------INPCVHGGWLSV  182

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YT+ DP S++   SAR Q+  +++ ++  YK E  SIT+TGHSLGA+LA + A D+  NG
Sbjct  183   YTTADPGSQYNQESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAIDIVSNG  242

Query  687   VT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F K      +L++L +RN  D++P++P   LGY   G E
Sbjct  243   YNKSCPVSAFVFGSPRVGNPDFQKAFDSAADLRLLRVRNSPDVVPKWPK--LGYNDVGTE  300

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  +S  LK   NP  WH+++  +H VAG  G  G F+L V R +ALVNK  + LK 
Sbjct  301   LMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSSGGFKLLVDRDIALVNKHEDALKN  360

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  361   EYSIPTSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/397 (43%), Positives = 236/397 (59%), Gaps = 30/397 (8%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  NW+GLLDPL++ LR  I+  G   QATYD+FN +  SKYAG+ RY K  FF 
Sbjct  9     WRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSRYPKKDFFS  68

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V+ +LYAT++ +  EAFLL S S++SW ++SNWIGYVAV +DA  +A
Sbjct  69    KVGLENGNPFRYDVKKFLYATSKASDAEAFLLKSFSKDSWSKQSNWIGYVAVATDAGKEA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW+  F      A  +    +S              +V  G++
Sbjct  129   LGRRDIVVAWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSA-------------QVHHGFY  175

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKY--KGENLSITLTGHSLGASLAILAAFDL  700
             +LYTS +P S+FT  SAR Q+  ++  L  +Y  K E +SI++TGHSLGA+LA L A D+
Sbjct  176   SLYTSSNPGSKFTDTSARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAVDI  235

Query  699   CENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
                G+           PVTA  +  P++G+  F++      +L+ L IRN  D++P  P 
Sbjct  236   AAQGLNIPKNQPQKAFPVTAFAYACPRVGDSSFEETFNGYKDLRSLRIRNVTDIVPITP-  294

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
               LG+   G E VID RKS  LK+ ++    HNL+A LH VAG  GE G F L+V R +A
Sbjct  295   -FLGFSDVGEELVIDTRKSKYLKSGVSA---HNLEAYLHGVAGTQGEKGGFNLEVNRDIA  350

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             LVNKS + LK+E  +P +W +++NK MV   +G W +
Sbjct  351   LVNKSMDALKDEYLVPVAWRVQENKGMVQQSDGSWKI  387



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   318 bits (816),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 241/393 (61%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  417   WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFLS  476

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y++  ++YA   +++P+ F++   S+ +W ++SNW+G+VAV +D   + LG
Sbjct  477   RVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLG  536

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   LEW++      V A  ++R  ++ D           P+V  GW ++
Sbjct  537   RRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHD-----------PRVHGGWLSV  585

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP SR+   SAR Q+  ++E L+  YK E  SIT+TGHSLGA+LA ++A D+  NG
Sbjct  586   YTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISATDIVSNG  645

Query  687   VTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F K      +L++L +RN  D++P +P   LGY  +G E
Sbjct  646   YNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK--LGYSDAGTE  703

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  +S  +K+  NP  WH+++  +H VAG  G +G FEL+V R +ALVNK  + LK+
Sbjct  704   LMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALKK  763

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  764   EYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  796



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 174/442 (39%), Positives = 245/442 (55%), Gaps = 40/442 (9%)
 Frame = -1

Query  1494  LHANILIFSAAIFVLKSFIHFQSMAT------EPTWHQLLGSENWEGLLDPLNLSLRHLI  1333
             +H   L+ SA + +  + +   + +T      + +W +L G +NW+GLLDPL+  LR  +
Sbjct  1     MHRFFLLVSALVAIATTTLSADTTSTIAAAQSQRSWAELSGRDNWDGLLDPLDADLRRAV  60

Query  1332  LRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSADD---YQVEAYLYAT--A  1168
             +R G+  QAT D+F  D  S YAG+ RY   +F H+   P   D   Y V  +LYAT  A
Sbjct  61    IRYGELAQATSDAFIGDPASPYAGASRYAPGAFLHRTQAPGGSDPDAYAVTRFLYATSSA  120

Query  1167  QLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINV  988
             ++ VP+ F+       +W  ESNW+GYVAV +DA +  LGRR+I V +RGT   +EW + 
Sbjct  121   RVPVPDTFITRPAPPGAWSAESNWMGYVAVATDAGAARLGRRDIVVAWRGTKRAVEWADD  180

Query  987   FSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQ  808
                  V A  ++                  P V  G+ ++Y S++  SRF   SAREQ+ 
Sbjct  181   LDITLVPATGVVGPGPG----------WSQPAVHRGFLSVYASRNSTSRFNKQSAREQVL  230

Query  807   TKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENGVT---------DIPVTAIVF  655
             +++  L   YKGEN SITLTGHSLGA+LA L A D+  NG+           +PV AIVF
Sbjct  231   SEVRRLLDAYKGENCSITLTGHSLGAALATLTAIDIVANGLNVRGGSNSNDTVPVAAIVF  290

Query  654   GSPQIGN----KLFDKLMTEKTNLKILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRK  490
             GSP++G+    K F+   T     ++L +RN  D++P   P A   Y   G+E ++D RK
Sbjct  291   GSPRVGDDQFKKAFESPSTPGGGARLLRVRNAPDIVPTILPAAF--YRDVGVELLLDTRK  348

Query  489   STSLKN-SMNPSDWHNLQAMLHVVAGWNGE-DGE-FELKVKRCVALVNKSCEFLKEELFI  319
             S  LK     P+ WHNL+  LH VAG  G  DG  F L+V R VALVNK  + L +E  +
Sbjct  349   SPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDGAGFRLEVDRDVALVNKEVDALSDEYPV  408

Query  318   PGSWWIEKNKSMVLDENGEWVL  253
             P +WW+E NK M  D++G WVL
Sbjct  409   PAAWWVEGNKGMTRDKSGRWVL  430



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 243/408 (60%), Gaps = 21/408 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W QL G  NWEGLL+PL+L LR  I++ G+  + TYD+F  ++ SKYAG+ RY
Sbjct  3     SMAEK--WEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F KV L     Y+V  + YAT+ + +P AFL+ S SRE+W++ESN++GY+AV +D
Sbjct  61    SMENLFAKVGL-DPSKYRVTKFFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 ALGRR+I + +RGT   LEW+N      +    +  +                P V
Sbjct  120   EGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGNG--------GLVPLFKPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++++YT+++P S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A
Sbjct  172   HHGFYSIYTTENPRSKFNQYSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG+       + PVTA VF SP++G+  F    ++   L IL I N +D++P+YP
Sbjct  232   VDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQMAFSKLKTLHILRIHNLLDIVPKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKR  373
                LGY+  G E +ID  KS  LK   +   WHNL+  +H VAG  G      F+L+V R
Sbjct  292   P--LGYIDVGEELIIDTTKSPYLKLPGDVLTWHNLECYMHGVAGTQGLGLLTGFKLEVNR  349

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              +AL NKS   LK+E  IP +WW EK+K M+  E+G W+L    D DL
Sbjct  350   DLALANKSSGALKDEYCIPANWWTEKHKGMIQQEDGTWLLLDREDYDL  397



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/393 (39%), Positives = 235/393 (60%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GLLDPL++ LR+ I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  17    WRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFLS  76

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y +  ++YA   + +P+ F++ S S+ +W ++SNW+G+VAV +D   + LG
Sbjct  77    RVDVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLG  136

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++R  ++ D           P V  GW ++
Sbjct  137   RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADD-----------PCVHGGWLSV  185

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S++   SAR Q+  +I+ L+  Y+ E  SIT+TGHSLGA+LA ++A D+  NG
Sbjct  186   YTSADPESQYNKQSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSNG  245

Query  687   VT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+  VFGSP++GN  F K      +L++L IRN  D++P +P   LGY  +G E
Sbjct  246   YNKSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPK--LGYSDAGTE  303

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  +S  LK   NP  WH+++  +H VAG  G +G F+L++ R ++LVNK  + LK 
Sbjct  304   LMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALKN  363

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV   +G W L    D+D
Sbjct  364   EYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  396



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   306 bits (785),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/396 (41%), Positives = 237/396 (60%), Gaps = 25/396 (6%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A    W +L G ++W+GLLDPL+  LR  ++  G+  QAT D+F  ++ S +AG+CRY +
Sbjct  8     AVAERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYSR  67

Query  1242  NSFFHKVMLPS--ADDYQVEAYLYATAQLT-VPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
             + F  K    +  A  Y+V A+ YATA    VP  F++        +RESNW+GYVAV +
Sbjct  68    DRFLEKAQASTQLAGLYEVTAFFYATAGAGGVPAPFMVR-------NRESNWMGYVAVAT  120

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             DA   ALGRR++ V +RGT   +EW+N      VSA  +L +                P+
Sbjct  121   DAGVAALGRRDVVVAWRGTVRPMEWLNDLDFTLVSAAGVLGAGGR----------SPAPR  170

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  GW ++YT+ DP S+++ LSAREQ+  +I+ L  KYK E  SIT+ GHSLGA++A L 
Sbjct  171   VHRGWLSIYTASDPASKYSKLSAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLN  230

Query  711   AFDLCENGVTD---IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             A D+  NG+      PVTA+ F  P++G+  F KL  E   L++L + N  D++P+YP  
Sbjct  231   AADIVSNGLNQHGACPVTAVAFACPRVGDSGFRKLFDELPGLRLLRVCNSPDVVPKYP--  288

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
              +GY   G+E  +D R+S  LK+  N + WH+L+  +H VAG  G+ G F+L+V R VAL
Sbjct  289   PMGYADVGVELPVDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGKRGGFKLEVDRDVAL  348

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VNK+ + LKEE  +P SW ++++K MV   +G W L
Sbjct  349   VNKNVDALKEEYHVPPSWSVQRDKGMVRGADGHWKL  384



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/393 (38%), Positives = 234/393 (60%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GL+DPL+L LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  14    WKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y++  ++YA   +++P+ F++ S S+ +W R+SNW+G+VAV +D   + LG
Sbjct  74    RVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLG  133

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++   ++ +           P V  GW ++
Sbjct  134   RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATN-----------PCVHGGWLSV  182

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S++   SAR Q+  +++ ++  YK E  SI++TGHSLGA+LA + A D+  NG
Sbjct  183   YTSADPGSQYNKESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAIDIVSNG  242

Query  687   VT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F +      +L++L +RN  D++P++P   LGY   G E
Sbjct  243   YNRSCPVSAFVFGSPRVGNPDFQEAFDSAADLRLLRVRNSPDVVPKWPK--LGYSDVGTE  300

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
               ID  +S  LK+  NP  WH+++  +H VAG  G  G FEL V R +ALVNK  + LK 
Sbjct  301   LRIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSSGGFELAVDRDIALVNKHEDALKN  360

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  +P SWW+ +NK MV  ++G W L    D+D
Sbjct  361   EFAVPSSWWVVQNKDMVKGKDGRWHLADHEDDD  393



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/398 (43%), Positives = 234/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  39    WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+Q+ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  99    KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  159   LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQV------------QIHQGW  206

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             + +Y S+D  S FT  +AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  207   YLIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIV  266

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   +L++L  RN  D+IP YP  
Sbjct  267   ANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYPP-  325

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              +GY + G E  ID RKS  +K+  N + +H L+A LH VAG  G  +  EF L VKR +
Sbjct  326   -IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDI  384

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK MV  ++G W L
Sbjct  385   GLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNL  422



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 235/394 (60%), Gaps = 15/394 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GL+DPL+L LR  I+  G+  QATY   N +  S+YAGSC + +  F  
Sbjct  14    WKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y++  ++YA   +++P+ F++ S S+ +W R+SNW+G+VAV +D   + LG
Sbjct  74    RVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKELLG  133

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++   ++ +           P V  GW ++
Sbjct  134   RRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAAN-----------PCVHGGWLSV  182

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP S++   SAR Q+  +++ ++  YK E  SIT+TGHSLGA+LA + A D+  NG
Sbjct  183   YTSADPGSQYNKESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINATDIVSNG  242

Query  687   VTD--IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGL  514
                   PV+A VFGSP++GN  F K      +L++L +RN  D++P++P   LGY   G 
Sbjct  243   YNRSCCPVSAFVFGSPRVGNLDFQKAFDSAADLRLLRVRNSPDVVPKWPK--LGYSDVGT  300

Query  513   EFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLK  334
             E +ID  +S  LK   NP  WH+++  +H VAG  G  G FEL V R VALVNK  + L+
Sbjct  301   ELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSSGGFELLVDRDVALVNKHEDALR  360

Query  333   EELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
              E  +P SWW+ +NK MV  ++G W L    ++D
Sbjct  361   NEFAVPPSWWVVQNKGMVKGKDGRWHLADHEEDD  394



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   306 bits (785),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 233/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  21    WRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGASIYSRKDFFA  80

Query  1227  KVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A+    Y+V  +LYAT+Q+ VP++FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  81    KVGLEKANPYTKYKVTKFLYATSQIHVPDSFLLFPVSREGWTKESNWMGYVAVTDDQGTA  140

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V A+ +                    ++  GW
Sbjct  141   VLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKV------------QIHQGW  188

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S D  S F   +AR+Q+  +I  L  KYK E +SI++ GHSLGA+LA L A D+ 
Sbjct  189   YSIYMSDDQRSPFNKANARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAADIV  248

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   +L++L IRN  D++P YP  
Sbjct  249   ANGYNRPKNRPDKSCPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRIRNLPDVVPIYPP-  307

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FELKVKRCV  367
              LGY + G E  ID+RKS  +K+  N S +HNL+  LH VAG  G      F L VKR +
Sbjct  308   -LGYSEVGDELQIDNRKSPYMKSPGNLSTFHNLEGYLHGVAGTQGTTKADLFRLDVKRDI  366

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK MV  ++G W L
Sbjct  367   GLVNKSVDGLKDEYMVPGYWRVLKNKGMVQLDDGSWKL  404



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   307 bits (786),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 220/396 (56%), Gaps = 23/396 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G +NW+GLLDPL+  LR  ++R G+  QAT D+F  D  S YAG+ RY   +F  
Sbjct  37    WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P  D Y V  +LYAT+   VP  F+       +W  ESNW+GYVAV +DA    LG
Sbjct  97    RAQAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVARLG  156

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   +EW N      V A  ++                  P V  G+ ++
Sbjct  157   RRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQ----------PAVHRGFLSV  206

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             Y S++  SRF   SAREQ+  +I  L   YKGEN SITLTGHSLGA+L+ L A D+  NG
Sbjct  207   YASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANG  266

Query  687   VT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY-PGALLG  532
             +         +PV AIVFGSP++G+  F K        ++L +RN  D++P   P A   
Sbjct  267   LNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTVLPNAF--  324

Query  531   YVKSGLEFVIDHRKSTSLKN-SMNPSDWHNLQAMLHVVAGWN--GEDGEFELKVKRCVAL  361
             Y   G+E ++D RKS  LK     P+ WHNL+  LH VAG    G+   F L+V R VAL
Sbjct  325   YKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVAL  384

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VNK  + L ++  +P +WW+E NK M  D +G WVL
Sbjct  385   VNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVL  420



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   305 bits (782),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 163/392 (42%), Positives = 234/392 (60%), Gaps = 19/392 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NWEGLL PL++ LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  5     WEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSMENLFT  64

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L   + Y+V  + YATA + +P+AF++ S SRE+W +ESN++GY+AV +D    +LG
Sbjct  65    KVGL-DPNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVATDEGKVSLG  123

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   +EW+N     PV A  +                   P V  G++ +
Sbjct  124   RRDIVINWRGTLQKMEWVNDLQFLPVPAPKVFGDGG--------LLPLFKPLVHHGFYNV  175

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS    S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  NG
Sbjct  176   YTSASSRSQFNLTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNG  235

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA  F SP++G+  F     +  +L+IL I N +D++P+YP   +GY 
Sbjct  236   INKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKLKSLRILKIHNLLDIVPKYPP--IGYF  293

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  +S  +K   +P+ WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  294   DVGKELMIDTARSPYVKPPGDPASWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNK  353

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
                 LK+E  IPG WW+EKNK MV  E+G W+
Sbjct  354   QWNVLKDEYCIPGFWWVEKNKGMVQQEDGSWL  385



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   305 bits (782),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 170/409 (42%), Positives = 239/409 (58%), Gaps = 22/409 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W QL G  NWEGLLDPL++ LR  I++ G+    TYD+F  +  SKYAG+ RY
Sbjct  3     SMAEK--WEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F +  L     Y+V  Y YAT+ + +P AFL+ S SRE+W++ESN++GY+AV +D
Sbjct  61    SMENLFTRAGLDPLK-YKVTKYFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 ALGRR+I + +RGT   LEW+N      +    +                   P V
Sbjct  120   EGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGG--------LLPLFQPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YTS+DP S F   SAR+Q+  +++ L  +YK E +SIT+ GHSLGASLA L A
Sbjct  172   HHGFYNIYTSEDPRSMFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG        + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP
Sbjct  232   VDIAFNGFNKTSSGKEFPVTAFVFASPKVGDLNFQKAFSKLKNLHILRIHNLLDIVPKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVK  376
                +G++  G E +ID  KS  LK N  +P   HNL+  LH + G  G      F+L+V 
Sbjct  292   P--IGFIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGVLAGFKLEVN  349

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             R +ALVN+  + LK+E  IP +WW EK+K MV  E+G W+L    D DL
Sbjct  350   RDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDREDYDL  398



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   306 bits (785),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 170/398 (43%), Positives = 233/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  44    WKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYARKDFFA  103

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+++ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  104   KVCLEKAHPYTKYKVTKFLYATSEVHVPESFLLFPISREGWTKESNWMGYVAVTDDQGTA  163

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I VV+RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  164   LLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQV------------QIHQGW  211

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT  +AREQ+  ++  L  +YK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  212   YSIYMSQDDRSPFTKANAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAADIV  271

Query  696   ENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL     NL++L  RN  D+IP YP  
Sbjct  272   ANGYNRPKSRPDKACPVTAFVFASPRVGDSDFKKLFYGLENLRVLRTRNLPDVIPIYPP-  330

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FELKVKRCV  367
              +GY + G E  ID RKS  +K+  N + +H L+A LH VAG  G      F L VKR +
Sbjct  331   -IGYSEVGDELPIDTRKSQYMKSPGNLASYHCLEAYLHGVAGTQGTAKADIFRLDVKRDI  389

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK MV  ++G W L
Sbjct  390   GLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKL  427



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   305 bits (781),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 240/409 (59%), Gaps = 22/409 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W  L G  NWEGLL+PL++ LR  I++ G+    TYD+F  +  SKYAG+ RY
Sbjct  3     SMAEK--WEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F +  L   + Y+V  Y YAT+ + +P AFL+ S SRE+W +ESN++GY+AV +D
Sbjct  61    SMENLFTRAGLDPLN-YKVTKYFYATSSIPLPSAFLVKSLSREAWSKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 ALGRR+I + +RGT   LEW+N      +    +                   P V
Sbjct  120   EGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGG--------LLPLFKPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YTS+DP S+F   SAR+Q+  +++ L  +YK E +SIT+ GHSLGASLA L A
Sbjct  172   HHGFYNIYTSEDPRSKFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG+       + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP
Sbjct  232   VDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQKTFSKLKNLHILRIHNLLDIVPKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVK  376
                +GY+  G E +ID  KS  LK N  +P   HNL+  LH + G  G      F+L+V 
Sbjct  292   P--VGYIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGILAGFKLEVN  349

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             R +ALVN+  + LK+E  IP +WW EK+K MV  E+G W+L    D DL
Sbjct  350   RDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDREDYDL  398



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 235/393 (60%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G  NWEGLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8     WEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L     Y+V  + YAT+ + +P+AF++ S SRE+W +ESN++GY+AV +D    ALG
Sbjct  68    KVGLDPLK-YRVTKFFYATSSIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+N      V    +                     V  G++ +
Sbjct  127   RRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKP--------LVHHGFYNI  178

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YT++D  S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  NG
Sbjct  179   YTTEDLRSQFNQASARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNG  238

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP   +GY+
Sbjct  239   INKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPKYPP--VGYI  296

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K       WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  297   DVGEELIIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNK  356

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
               + +K+E  IPG WW++K+K MV  ++G W+L
Sbjct  357   QWDIIKDEYCIPGLWWVDKHKGMVQQQDGSWLL  389



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/398 (43%), Positives = 234/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  40    WRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFS  99

Query  1227  KVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+Q+ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  100   KVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPMSREGWTKESNWMGYVAVTDDQGTA  159

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW++ F    V+A  +   +                ++  GW
Sbjct  160   ILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHV------------QIHQGW  207

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S F   +AR+Q+  +I  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  208   YSIYMSQDERSHFNKANARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATDIV  267

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL     +L++L IRN  D++P YP  
Sbjct  268   ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFMKLFYGLQDLRVLRIRNLPDVVPIYPP-  326

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              LGY + G E  ID RKS  +K+  N + +H L+A LH VAG  G  +   F L VKR +
Sbjct  327   -LGYAEVGDELPIDTRKSQYMKSPGNFATFHCLEAYLHGVAGTQGTAKSDLFRLDVKRDI  385

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  IPG W + KNK MV  ++G W L
Sbjct  386   GLVNKSVDGLKDECMIPGHWRVLKNKGMVQQDDGSWKL  423



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   305 bits (780),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 166/398 (42%), Positives = 236/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN +++S++AG+  Y +  FF 
Sbjct  22    WRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGASIYSRKDFFA  81

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+++ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  82    KVGLEKAHPYTKYKVTKFLYATSEIHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  141

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  142   LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQV------------QIHQGW  189

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT  +AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  190   YSIYMSQDERSPFTKANARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATDIV  249

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL++   ++++L  RN  D+IP YP  
Sbjct  250   ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLLSILEDMRVLRTRNLPDVIPIYPP-  308

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              +GY + G E  ID RKS  +K+  N + +H L+A LH VAG  G  +   F L VKR +
Sbjct  309   -IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRAI  367

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK MV  ++G W L
Sbjct  368   GLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKL  405



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 236/394 (60%), Gaps = 15/394 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GLLDPL++ LR+ I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  17    WRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFLS  76

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y +  ++YA   + +P+ F++ S S+ +W ++SNW+G+VAV +D   + LG
Sbjct  77    RVDVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLG  136

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   +EW++      V A  ++R  ++ D           P V  GW ++
Sbjct  137   RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADD-----------PCVHGGWLSV  185

Query  867   YTSKDPNSRFTTLSAR-EQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             YTS DP S++   SAR +Q+  +I+ L+  Y+ E  SIT+TGHSLGA+LA ++A D+  N
Sbjct  186   YTSADPESQYNKQSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISATDIVSN  245

Query  690   GVT-DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGL  514
             G     PV+  VFGSP++GN  F K      +L++L IRN  D++P +P   LGY  +G 
Sbjct  246   GYNKSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPK--LGYSDAGT  303

Query  513   EFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLK  334
             E +ID  +S  LK   NP  WH+++  +H VAG  G +G F+L++ R ++LVNK  + LK
Sbjct  304   ELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALK  363

Query  333   EELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
              E  IP SWW+ +NK MV   +G W L    D+D
Sbjct  364   NEYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  397



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   303 bits (777),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 240/399 (60%), Gaps = 23/399 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+GLL PL++ LR  ++  G+  Q+TYD+FN    SKY GS  Y K  FF 
Sbjct  29    WKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIYSKKDFFS  88

Query  1227  KVMLPSADD----YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS  1060
             KV L   ++    Y+V  YLYAT+ + VP+AF+L S SRE+W +ESN+IGYVAV  D   
Sbjct  89    KVGLVKGNNDPYKYRVTKYLYATSGIDVPDAFILKSSSREAWSKESNFIGYVAVAEDTAV  148

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
              +LGRR+I + +RG+   LEW+N      VSA  ++      D+D  +       KV  G
Sbjct  149   ASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKAKA------KVHQG  202

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             W+++YTS DP S F   SAR+Q+  +I+ L  +YK E +SIT+TGHS+GA+LA L A DL
Sbjct  203   WYSIYTSDDPRSPFNKTSARDQVLLEIQSLMEQYKNEEISITITGHSMGAALATLNAVDL  262

Query  699   CENGVTDIP---------VTAIVFGSPQIGNKLFDKLMTE-KTNLKILHIRNKIDMIPEY  550
               N + +IP         VTAI+F SP++G+  F  ++++   +LK+L + N +D++  Y
Sbjct  263   VANNI-NIPKSSPKNPCLVTAILFASPRVGDFNFKNIISKYDHSLKLLRVCNALDVVLHY  321

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRC  370
             P   +GY   G E  ID  +S  LK   N   WHN +A LH +AG  G + EF+L V R 
Sbjct  322   PP--IGYCHVGKELSIDTIRSPYLKFPGNFWTWHNSEAYLHGIAGGQGSEEEFKLVVDRD  379

Query  369   VALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             ++L+NK  + LK+E  IP  WW  +NK MV   +G W+L
Sbjct  380   LSLLNKHWDNLKDEYLIPAFWWTLRNKGMVQQSDGSWLL  418



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 236/393 (60%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G +NWEGLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8     WEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              V L     Y+V  + YAT+ + +P+AF++ S SRE+W +ESN++GYVAV +D    +LG
Sbjct  68    GVGLDPLK-YRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYVAVATDEGKVSLG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT  +LEW+N F    V A  +                   P V  G++ +
Sbjct  127   RRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGG--------LLPLFQPLVHHGFYNI  178

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS+   S+F     R+Q+  +++ L  +YK E++SIT+TGHSLGASLA L A D+  NG
Sbjct  179   YTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNG  238

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP   +GY+
Sbjct  239   INKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNVLDIVPKYPP--IGYI  296

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K   +   WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  297   DVGKELMIDTTKSPYVKPPGDIVSWHLLEPYLHGVAGTQGISILAGFKLEVNRNISLVNK  356

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
                 LK+E  IPG WW+EK+K MV  ++G W+ 
Sbjct  357   MGNILKDEHCIPGLWWVEKHKGMVQQQDGTWLF  389



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   317 bits (813),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/393 (40%), Positives = 240/393 (61%), Gaps = 14/393 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  611   WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRREDFLS  670

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V + + + Y++  ++YA   +++P+ F++ S S+ +W ++SNW+G+VAV +D   + LG
Sbjct  671   RVDVSNPNLYEITKFIYAMCTVSLPDGFMIKSLSKAAWSKQSNWMGFVAVATDEGKEVLG  730

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR++ V +RGT   LEW++      V A  ++R  ++ D           P V  GW ++
Sbjct  731   RRDVVVAWRGTIRILEWMDDLDISLVPASEIVRPGSADD-----------PCVHGGWLSV  779

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS DP SR+   SAR Q+  +I+ L+  YK E  SIT+TGHSLGA+LA ++A D+  NG
Sbjct  780   YTSTDPGSRYNKQSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISATDIVSNG  839

Query  687   VTD-IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLE  511
                  PV+A VFGSP++GN  F K      +L++L + N  D++P++P   LGY ++G E
Sbjct  840   YNQSCPVSAFVFGSPRVGNSDFQKAFDSADDLRLLRVENSPDVVPKWPK--LGYSEAGTE  897

Query  510   FVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKE  331
              +ID  +S  +K   NP  WH+++  +H +AG  G +G FEL+V R +ALVNK  + LK 
Sbjct  898   LMIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSNGGFELEVDRDIALVNKHEDALKN  957

Query  330   ELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             E  IP SWW+ +NK MV  ++G W L    D+D
Sbjct  958   EYSIPSSWWVMQNKGMVKGKDGRWHLADHEDDD  990



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 182/413 (44%), Positives = 230/413 (56%), Gaps = 29/413 (7%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
              T   W +L G  NW+GLLDP +L LR  ++R G+  QATYD+FNH+  S +AG  R+G+
Sbjct  7     GTAHRWRELHGQNNWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFGR  66

Query  1242  NSFFHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
               FF +V LP  A  Y+V  +LYAT+ + VPE F+L S S     RESNWIGYVAV +D 
Sbjct  67    RRFFERVQLPDHAAAYRVTKFLYATSSVAVPEPFILRSVSLGRRCRESNWIGYVAVATDD  126

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
                ALGRR+I V +RGTT  LEWIN           LL    S               V 
Sbjct  127   GKTALGRRDIVVAWRGTTQALEWINDMEFVMAPPRSLLGDEAS------------EATVH  174

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW ++YTS DP S     SAR+Q+ +++  L S Y GE LSIT+TGHSLGA+L  L AF
Sbjct  175   RGWLSMYTSSDPESSHNKDSARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAF  234

Query  705   DLCENG-----------VTDIPVTAIVFGSPQIGNKLFDKLM--TEKTNLKILHIRNKID  565
             D+  NG            T  PVTA  F SP++G   F +         L++L +RN  D
Sbjct  235   DIAANGYNRSPRAAAATATGCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARD  294

Query  564   MIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGW-NGEDGEFE  388
             ++P YP ALL Y   G E  ID  +S  L+N  N   WHNL++ LH VAG   GE G FE
Sbjct  295   IVPRYPTALL-YHDVGAELAIDTGESPYLRNPGNELLWHNLESYLHGVAGARGGEAGRFE  353

Query  387   LKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL-GSPNDED  232
             L V+R VAL NK    L++E  +P  WWI  N+ MV   +G W L     DED
Sbjct  354   LAVERDVALTNKFYGALRDEHPVPAGWWIPSNRGMVRGADGRWTLMDCEEDED  406



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 233/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  39    WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+Q+ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  99    KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  159   LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQV------------QIHQGW  206

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT ++AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  207   YSIYMSQDERSPFTKVNARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIV  266

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   +L++L  RN  D+IP YP  
Sbjct  267   ANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYPP-  325

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              +GY + G E  ID RKS  +K+  N + +H L+A LH VAG  G  +   F L VKR V
Sbjct  326   -IGYSEVGDEIPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDVKRDV  384

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + L  E  +PG W + KNK MV  ++G W L
Sbjct  385   GLVNKSVDGLNVECMVPGKWRVLKNKGMVQQDDGSWKL  422



>ref|XP_009415339.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 175/408 (43%), Positives = 237/408 (58%), Gaps = 47/408 (12%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             A  P+W +LLGSE+W GLLDPL+ SLR  +L+CGD CQ T DSF  D +S Y G CRY  
Sbjct  7     ADTPSWPELLGSEHWSGLLDPLDQSLRVFLLQCGDMCQVTADSFISDDHSNYRGMCRYRP  66

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
             ++    V  P A +Y V+ YLYA             S +  ++  ESNW+GY+AV+ DA 
Sbjct  67    STLLDDVFFPYAANYDVKEYLYAM------------SINWSNFTEESNWMGYIAVSKDAY  114

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             +K  GRREIYVV+RGT    E+I       V  +P  +                  KV+ 
Sbjct  115   TKRTGRREIYVVWRGTMRPSEFIEGLVISLVPFDPDNQDVQD-------------VKVVN  161

Query  882   GWHTLYTSKDPNSRF--TTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             GW+ +YT KD  S+F     SAREQL +K+ EL   YK E+LSI   GHSLG +LAIL++
Sbjct  162   GWNDIYTLKDSGSQFPCNATSAREQLLSKLSELVKLYKNESLSIVCVGHSLGGALAILSS  221

Query  708   FDLCENGVTDI-------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             FD+   G++ I       PV A+VF +P++GNK F++   +  NL+ L +RN  D++P +
Sbjct  222   FDIVNKGLSKIEGKEEHFPVCAVVFENPKVGNKAFNERFEKLPNLRALRVRNTWDIVPYW  281

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKN-----------SMNPSDWHNLQAMLHVVAGWNGE  403
             P     YV +G    ID + S  LK             +  S+ H+LQ +LH VAGW  +
Sbjct  282   P-LPTDYVVTGSVLDIDSKLSPYLKVLDIDFKTSTILKILASN-HDLQVVLHTVAGWTWK  339

Query  402   DGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEW  259
             D EF LKV+R +ALVNK   +LK+EL IP +WW+EKNK MV D++GEW
Sbjct  340   DVEFHLKVERSLALVNKQGGYLKDELQIPEAWWVEKNKGMVPDKDGEW  387



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   302 bits (773),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 230/395 (58%), Gaps = 21/395 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  +W+GLLDPL+L LR  I+  G+  QATYD FN +  S + G+C YG +    
Sbjct  44    WRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACFYGHDDLLA  103

Query  1227  KVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSR--ESWDRESNWIGYVAVTSDAVSK  1057
              V +P  A++YQV  ++YAT+ L +PE+FLL       + W RESNW+GYVAV +D  + 
Sbjct  104   GVGVPHHANNYQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAVATDEGAA  163

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             ALGRR+I V +RGT  +LEW+N     PV A P+L S+ S +             V  G+
Sbjct  164   ALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAV---------VHRGF  214

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              ++YTS + +S FT  SA+EQ+  ++  L   YK E +SIT+ GHSLGASLA L A DL 
Sbjct  215   LSVYTSSNKSSEFTKTSAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLV  274

Query  696   ENGVT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              +G           PVTAIVF SP +G++ F        +LK LH++N  D++P YP   
Sbjct  275   SSGANKPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYPP--  332

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGYV   +E  I   +S  ++        HNL+  LH VAG  G  G F+L+V+R VALV
Sbjct  333   LGYVDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSAGGFKLEVERDVALV  392

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NK  + L  E  +P  WW+ K+K MV  ++G W L
Sbjct  393   NKGVDALTNEHPVPAEWWVPKHKFMVKGKDGRWTL  427



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   300 bits (768),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 163/401 (41%), Positives = 232/401 (58%), Gaps = 19/401 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NWEGLL PL++ LR  I+  G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  5     WEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSMENLFT  64

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L   + Y+V  + YATA + +P+ F++ S SRE+W +ESN++GY+AV +D    +LG
Sbjct  65    KVGL-DPNKYRVTKFFYATASIPLPDGFIVKSLSREAWSKESNFMGYIAVATDEGKVSLG  123

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   LEW+N      V A  +                   P V  G++  
Sbjct  124   RRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVFGDGG--------LLPLFQPLVHHGFYNA  175

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS    S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  NG
Sbjct  176   YTSSSSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNG  235

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA  F SP++G+  F     +   L++L I N +D++P+YP   +GY 
Sbjct  236   INKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKGLRVLKIHNLLDIVPKYPP--IGYF  293

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K    P  WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  294   DVGQELMIDTTKSPYVKPPGEPVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNK  353

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
               + LK+E  IPG WW+EKNK MV  E+G W++   ++ D 
Sbjct  354   QWDVLKDEYCIPGLWWVEKNKGMVQQEDGSWLMLDRDEYDF  394



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/408 (41%), Positives = 234/408 (57%), Gaps = 26/408 (6%)
 Frame = -1

Query  1431  QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCR  1252
              S AT   W +L G+ +W GLLDPL++ LR  I+  G+  QATYD FN +  S +AG+C 
Sbjct  25    SSSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACL  84

Query  1251  YGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEA---FLLHSRSRESWDRESNWIGYVA  1081
             YG+      V + +A  Y V  ++YAT+ L VP +    L    +RE+W RESNWIGYVA
Sbjct  85    YGRADLLPGVGVAAAGRYAVTRFVYATSALPVPGSDFPLLPLPETREAWTRESNWIGYVA  144

Query  1080  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK  901
             V +D  +  LGRR++ V +RGT  DLEW N F+  PVSA P+L S+ + +          
Sbjct  145   VATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAV------  198

Query  900   VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
                V  G+ ++YTS + +SRF   SAR+Q+  ++  L   YKGE  SIT+ GHSLGA+LA
Sbjct  199   ---VHQGFLSVYTSSNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALA  255

Query  720   ILAAFDLCENGVTD---------IPVTAIVFGSPQIGNKLFDKLMTEK-TNLKILHIRNK  571
              L A D+  NG+ +          PVTAI+F  P +G++ F         +L+ LH+RN 
Sbjct  256   TLNAVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNA  315

Query  570   IDMIPEYPGALLGYVKSGLEFV-IDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGE-DG  397
              D++P  P   L YV   +  + ID  +S  L++       HNL+  LH VAG  G   G
Sbjct  316   GDVVPVVP--PLAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSAAG  373

Query  396   EFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              F L+V R VALVNK  + L++E  +P +WW+ +N+ MV   +G WVL
Sbjct  374   GFRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSDGHWVL  421



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/405 (40%), Positives = 231/405 (57%), Gaps = 25/405 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G   W+GLLDPL+  LR  I+  G+  + TYD+FN D  SKYAG   + K   F 
Sbjct  9     WKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKTELFA  68

Query  1227  KVMLPSADDY--QVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +      + Y  +V  + YAT+ + +P +F++ S SRE+W +ESNW+GY+AV +D   + 
Sbjct  69    RTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAVATDEGKEK  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW N F      A  L   + +G            P++  GW 
Sbjct  129   LGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHK----------PQIASGWL  178

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              LYT+ DP S F   SAREQ+  ++  L  +YK E +SITLTGHSLGA+++ L A D+  
Sbjct  179   ALYTTDDPRSPFNKTSAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCATDIAY  238

Query  693   NGVTDIP--------VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG   +         VTA  F SP++G+K F  L+    NL IL I N  D++P YP  L
Sbjct  239   NGHKKMKSLQHKPFYVTAFAFASPRVGDKNFKMLVDSIENLNILRITNVPDVVPRYP--L  296

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LGY  +G    I+  KS  LK S+N  ++HN+   LH VAG  G  G F+L++++ ++ V
Sbjct  297   LGYDDAGEVLTINTLKSKYLKQSLNLRNYHNIDIYLHGVAGTQGSLGGFKLEIEKDISSV  356

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL---GSPNDED  232
             NK  + L +E  IPGSWW  +NK MV  ++G W L    +P+D++
Sbjct  357   NKRLDALDDEYLIPGSWWCVENKGMVQMDDGSWKLYTHRTPDDDE  401



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 166/405 (41%), Positives = 236/405 (58%), Gaps = 21/405 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G  NWEGLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY
Sbjct  3     SMAEK--WEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                +FF KV L     Y V  + Y T+ + +P+AF+  S SRE+W +ESN++GY+AV +D
Sbjct  61    SMENFFTKVGL-DPSKYHVTKFFYGTSSIPLPDAFMTRSLSREAWSKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 ALGRR+I + +RGT   LEW+N      V A  +                   P V
Sbjct  120   EGKVALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGG--------LLPLFHPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G+H +YT+++P S+F     R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A
Sbjct  172   HHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG+       + PVTA VF SP++G+  F K  ++  +L IL I N +D++P+YP
Sbjct  232   VDIAFNGINKSSNGKEFPVTAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWN--GEDGEFELKVKR  373
                +GY   G E +ID  KS  +K       WH L+  LH +AG    G    F+L+V R
Sbjct  292   P--VGYFDVGQELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKLEVNR  349

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPND  238
              ++LVNK    LK+E  IP  WW EK+K MV  ++G W+L   +D
Sbjct  350   DISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDD  394



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 163/398 (41%), Positives = 235/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W G+L PL+  LR  ++  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  37    WRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  96

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+Q+ VPE+FLL   SRE W +ESNW+GYVAVT +  + 
Sbjct  97    KVGLEKAHPYTKYKVTRFLYATSQIHVPESFLLFPLSREGWTKESNWMGYVAVTDNQGTA  156

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  157   VLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQV------------QIHQGW  204

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S F   +AR+Q+  +I  L  KYK E +SI++ GHSLGA+LA L A D+ 
Sbjct  205   YSIYMSEDERSPFNKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATDIV  264

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  + KL +   +L++L ++N  D++P YP  
Sbjct  265   ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGFEDLRVLRVKNLPDIVPIYPP-  323

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              LGY + G E  ID RKS  +K+  N + +H L++ LH VAG  G  ++  F L VKR +
Sbjct  324   -LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKNDIFRLDVKRDI  382

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + L +E  +PG+W + KNK MV  ++G WVL
Sbjct  383   GLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVL  420



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 237/393 (60%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G +NWE LL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8     WEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              V       Y+V  + YAT+ + +P+AF++ S SRE+W +ESN++GY+AV +D    +LG
Sbjct  68    GVGHDPLK-YRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYIAVATDEGKVSLG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT  +LEW+N F    V A  +                   P V  G++ +
Sbjct  127   RRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGG--------LLPLFQPLVHHGFYNI  178

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS+   S+F     R+Q+  +++ L  +YK E++SIT+TGHSLGASLA L A D+  NG
Sbjct  179   YTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATLNAVDITFNG  238

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP   +GY+
Sbjct  239   INKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNLLDIVPKYPP--IGYI  296

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K   + + WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  297   DVGKELMIDTTKSPYVKPPGDIASWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNK  356

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
               + LK+E  IPG WW+EK+K MV  ++G W+L
Sbjct  357   MGDTLKDEHCIPGHWWVEKHKGMVQQQDGTWLL  389



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/400 (41%), Positives = 237/400 (59%), Gaps = 22/400 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG-KNSFF  1231
             W +L G  NW+GLL+PL++ LR  I++ G+ CQA YD+F  ++ SKYAG+ RY  +  FF
Sbjct  5     WEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSMEKPFF  64

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              +  L   + Y+V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +D    +L
Sbjct  65    TRFGL-DPNKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGKVSL  123

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR+I + +RGT   LE+IN      V A  +                   P V  G++ 
Sbjct  124   GRRDIVINWRGTQQKLEFINDLQFLLVPAPKVFGDGG-----------LLQPLVHNGFYN  172

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS    S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  N
Sbjct  173   VYTSASSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFN  232

Query  690   GVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
             G+       + PVTA  F SP++G+  F     +  +L+IL I N +D+ P+YP   +GY
Sbjct  233   GINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKSLRILKIHNLLDIFPKYPP--IGY  290

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNKS  349
                G E +ID  KS  ++    P  WH L+  LH VAG  G  G F+L+V R ++LVNK 
Sbjct  291   FDVGQELMIDTTKSPYVRPPGEPFSWHLLEPYLHGVAGTQGLAG-FKLEVNRDISLVNKQ  349

Query  348   CEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              + LK+E  IPG WW+EKNK MV  E+G W+L   ++ D 
Sbjct  350   WDVLKDEYCIPGFWWVEKNKGMVQQEDGSWLLLDHDEYDF  389



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 168/413 (41%), Positives = 237/413 (57%), Gaps = 23/413 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G   WEGLL+PL++ LR  I++ G+  + TYD+F  D  SKYAG+ RY
Sbjct  3     SMAEK--WEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRY  60

Query  1248  GKNSFFHKVML-PSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
                + F  V L PS   Y+V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +
Sbjct  61    SMENLFSNVGLDPSK--YRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVAT  118

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             D    +LGRR+I + +RGT   LEW+N      +    +                   P 
Sbjct  119   DEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGG--------LLPLFKPL  170

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  G++ +YTS+   S F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L 
Sbjct  171   VHHGFYNVYTSESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLN  230

Query  711   AFDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             AFD+  N +       + PVTA VF SP++G+  F     +  +L ++ I N +D++P+Y
Sbjct  231   AFDIAYNKINKTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPKY  290

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVK  376
             P   LGY   G E +ID  KS  L    +   WHNL+  LH VAG  G      F+L+V 
Sbjct  291   PP--LGYFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYLHGVAGTQGIGLLAGFKLEVD  348

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             R +ALVNKS   LK E  +P +WW  KNK MV  E+G+WVL    + D+ V E
Sbjct  349   RDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQEDGKWVLNDREEYDIVVAE  401



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 165/408 (40%), Positives = 226/408 (55%), Gaps = 48/408 (12%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             + +  W  L G+ NW+GLLDPL+  LR  I+  G+  QATYDSFN +  S+YAGSC Y K
Sbjct  3     SIDKRWEVLSGNNNWDGLLDPLDYDLRQYIIHYGEMAQATYDSFNAEKASRYAGSCLYAK  62

Query  1242  NSFFHKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                F KV L + +   Y+V  YL                       +ESNW+GYVAV +D
Sbjct  63    KDLFAKVGLQNGNPFKYRVTKYL-----------------------KESNWMGYVAVATD  99

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 ALGRR+I + +RGT   LEW+N      VSA  +   +               PKV
Sbjct  100   EGKVALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFGENDD-------------PKV  146

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               GW+++YT+ D  S F   SAR+Q+  ++  L  ++K E +SIT+TGHSLGA++A L A
Sbjct  147   HQGWYSIYTTDDSRSPFNKTSARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNA  206

Query  708   FDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPE  553
              D+  NG            PVTA V+ SP++G + F K+ +++ NL++L I+N +D++P 
Sbjct  207   VDIVANGFNKSLENPGKACPVTAFVYASPRVGGQGFKKVFSQQQNLRVLRIQNSLDVVPN  266

Query  552   YPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKR  373
             YP  LLGY   G E  ID  KS  LKN  N S WH+L+  +H VAG  G    F+L V R
Sbjct  267   YP--LLGYADVGEELRIDTTKSKYLKNPGNLSSWHSLECYMHGVAGKQGLQEGFKLVVNR  324

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              VAL+NK  + LK+E  +P SWW  +NK MV   +G W L    D+D 
Sbjct  325   DVALLNKYMDVLKDEHCVPVSWWCIQNKGMVQQADGSWELEDHEDDDF  372



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   298 bits (764),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 172/402 (43%), Positives = 239/402 (59%), Gaps = 19/402 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+ LLDPL+L LR  ++  G+   ATYD+FN +  SKYAG  RYG  + F 
Sbjct  9     WRELSGQNNWKNLLDPLDLDLRRYLIHYGERASATYDTFNSEVKSKYAGDSRYGLKNLFS  68

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
              V L  A+  +Y    Y YAT+ + +P  FLL S SRE+W++ESNWIGYVAV +D    A
Sbjct  69    NVGLSIANPFEYTATKYFYATSSVKLPGCFLLRSLSREAWNKESNWIGYVAVATDKGKAA  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK------VPK  892
             LGRR+I + +RGT   LEW + F+     A  +L  +    + D   D         +PK
Sbjct  129   LGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADTAADAAADDVDDIIPK  188

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  G+ ++YTS DP S F   SAREQ+ T+++ L  +YK E +SIT+ GHSLGA+LA L 
Sbjct  189   VHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISITVAGHSLGAALASLN  248

Query  711   AFDLCENGVT---------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMI  559
             A D+  NG             PVTA V+ SP++GN  F  +     +L++L   N +D++
Sbjct  249   AVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSIPSLRLLRTANLLDVV  308

Query  558   PEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKV  379
             P+ PGA  GY  +G E +I+ + S  LKN  N S WH+++  LH +AG  G  G F+L+V
Sbjct  309   PKVPGA--GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYLHGLAGTQGTKGGFKLEV  366

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             KR VALVNK   F+++E  +P  WW+ KN+ MV  E+G W L
Sbjct  367   KRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDGSWQL  408



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/405 (41%), Positives = 231/405 (57%), Gaps = 27/405 (7%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S      W  L G  +W+GLL PL+  LR  ++  G+  QA YD+FN ++ SK+AGS  Y
Sbjct  31    SRGIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIY  90

Query  1248  GKNSFFHKVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAV  1078
              +  FF KV L  A     Y+V  +L+AT+Q+ VPE+FLL   SRE   +ESNWIGYVAV
Sbjct  91    SRKDFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYVAV  150

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV  898
             T D  + ALGRR+I V +RG+   LEW+N F    V+A+ +                   
Sbjct  151   TDDQGTAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQV-----------  199

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
              ++  GW+++Y SKD  S F   +AR+Q+  +I  L  KYK E +SI++ GH LGA++A 
Sbjct  200   -QIHQGWYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHILGAAIAT  258

Query  717   LAAFDLCENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDM  562
             L A D+  NG            PVTA VF SP++G+  F KL +   +L++L +RN  D+
Sbjct  259   LNAADIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDV  318

Query  561   IPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FE  388
             +P YP   LGY + G E  ID RKS  LK+  + + +H L+  LH +AG  G      F 
Sbjct  319   VPIYPP--LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFR  376

Query  387   LKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             L VKR + LVNKS + LK+E  +PG W I KNK MV   +G W L
Sbjct  377   LDVKRDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDGSWKL  421



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/427 (39%), Positives = 234/427 (55%), Gaps = 26/427 (6%)
 Frame = -1

Query  1494  LHANILIFSAAIFVLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDF  1315
             +H  +L+  A +    S     +    P W +L G +NW+GLLDPL+  LR +++R G+ 
Sbjct  1     MHRFLLLVGALVATALSADTAIAKGQRP-WAELSGRDNWDGLLDPLDADLRRVVIRYGEL  59

Query  1314  CQATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPS--ADDYQVEAYLYATAQLTVPEAFL  1141
              QAT D+F  D  S +AG+ RY   +F  +    +   D Y+V  +LYAT+   VP+  +
Sbjct  60    AQATSDAFISDPASPHAGASRYAPGAFLRRAQAGADVPDLYRVTRFLYATSGARVPDGII  119

Query  1140  LHSRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAE  961
             +      +W  ESNW+GYVAV +DA +  LGRR++ V +RGT   +EW N      V A 
Sbjct  120   MRPAPPGAWSLESNWMGYVAVATDAGAARLGRRDVVVAWRGTKRAVEWANDLDITLVPAA  179

Query  960   PLLRSSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSK  781
              ++                  P V  G+ ++Y S +  SRF   SAREQ+  +I+ L   
Sbjct  180   GVVGPGPGWSQ----------PAVHRGFLSVYASSNSTSRFNKQSAREQVLAEIKRLLDA  229

Query  780   YKGENLSITLTGHSLGASLAILAAFDLCENGVT-------DIPVTAIVFGSPQIGNKLFD  622
             YKGEN SIT+TGHSLGA+L+ L A D+  NGV         +PV AIVFGSP++G++   
Sbjct  230   YKGENCSITITGHSLGAALSTLTAIDIVSNGVNVRGSTNDTVPVAAIVFGSPRVGDEQLK  289

Query  621   KLMTEKTNLKILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTSLKN-SMNPSDWH  448
             K        ++L +RN  D++P   P A   Y   G+E ++D RKS  LK     P+ WH
Sbjct  290   KAFDSTPGARLLRVRNAPDIVPTILPAAF--YKDVGVELLVDTRKSPHLKQPGPGPAAWH  347

Query  447   NLQAMLHVVAGWNGE-DGE-FELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLD  274
             NL+  LH VAG  G  DG  F L V R +ALVNK  + L +E  +P  WW+E NK MV D
Sbjct  348   NLECYLHGVAGTQGAGDGAGFGLVVDRDLALVNKEVDALDDEYPVPAGWWVEGNKGMVKD  407

Query  273   ENGEWVL  253
              +G WVL
Sbjct  408   GSGRWVL  414



>ref|XP_009389474.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=377

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 237/403 (59%), Gaps = 40/403 (10%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S    P+W  LLG  +W GLLDPL+ +LR L+L  GD CQ T DSF  DS+S+Y G CRY
Sbjct  5     SGTESPSWADLLGLNHWSGLLDPLDDTLRDLLLMWGDMCQVTADSFIRDSDSRYRGLCRY  64

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
              KNS   K   P+A DY+V  YLYA + +     F L         +ESNW+GYVAV+S+
Sbjct  65    SKNSLLDKTFFPNAADYEVVEYLYALSTVL----FFL---------KESNWMGYVAVSSN  111

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
             A ++A+GRR+IYVV+RGT+  +E    F    +   P    +                KV
Sbjct  112   AHAEAVGRRDIYVVWRGTSRIME---AFEDITIPLWPFDDDNED-------------VKV  155

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
             M GW  +Y S DPN  F   SAR+QL   ++E   KYK ENL+I   GHSLG +LAIL+A
Sbjct  156   MLGWRDIYNSSDPNFEFNKTSARDQLLETVKEQVGKYKDENLTIVCVGHSLGGALAILSA  215

Query  708   FDLCENGVTDI-------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             +D+ ++G++ I       PV A+VF SP++GN+ F     ++ NL++L ++NK D +PE 
Sbjct  216   YDIVKHGLSKIGETEEYFPVCAMVFESPRVGNQAFRDSWEQQPNLRLLRVKNKGDGVPEL  275

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFE-LKVKR  373
             P    GYV  G    +   +S  LK+     D HNLQ +LH VAGW G  G F+  +VKR
Sbjct  276   PRLEWGYVDVGTVLEVASEQSRFLKSE---GDKHNLQVILHTVAGWEGASGGFDPTRVKR  332

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSP  244
              +ALVNK  + L +E  IP SWW+EKNK MVLD++G WV   P
Sbjct  333   SLALVNKQGDDLVDECKIPASWWVEKNKGMVLDKDGNWVEAPP  375



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 234/406 (58%), Gaps = 21/406 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NWEGLL+PL++ LR  I++ G+  + TYD+F  D  SKYAG+ RY   + F 
Sbjct  5     WEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSMENLFS  64

Query  1227  KVML-PSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
              V L PS   Y+V  Y YAT+ + +P+AF+  S SRE+W +ESN++GYVAV +D    +L
Sbjct  65    NVGLDPSK--YRVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYVAVATDEGKVSL  122

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR+I + +RGT   LEW+N     P+    +                   P V  G++ 
Sbjct  123   GRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVFGDGG--------LLPLFKPLVHHGFYN  174

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             +YTS+   S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  N
Sbjct  175   VYTSESARSKFNKTSARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAYN  234

Query  690   GVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGY  529
              +       + PVTA VF SP++G+  F     +   L ++ I N +D++P+YP   +GY
Sbjct  235   KINKSSHGKEFPVTAFVFASPKVGDLNFLNAFNKLKYLHVMRIHNILDIVPKYPP--IGY  292

Query  528   VKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVN  355
             +  G E +ID  KS  L    +   WHNL+  +H VAG  G      F+L+V R +ALVN
Sbjct  293   LDVGQEIIIDTTKSPYLNLPGDILTWHNLECYMHGVAGTQGIGLLTGFKLEVDRDIALVN  352

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPVPE  217
             KS   LK E  +P +WW  KNK M   E+G+WVL    + D+ V E
Sbjct  353   KSSGALKSEYLVPANWWTVKNKGMFQQEDGKWVLNDREEYDIVVAE  398



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/401 (41%), Positives = 232/401 (58%), Gaps = 28/401 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+GLLDPL++ LR  I+  G   QATYD FN +  S  AG+ RY K  FF 
Sbjct  8     WRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRYSKREFFG  67

Query  1227  KVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             KV L + +   Y V  +LYAT++ +  E FLL S S+++W  +SNWIGYVAV +D   +A
Sbjct  68    KVGLENGNPFKYLVTKFLYATSKASDSEKFLLRSFSKDAWSLQSNWIGYVAVATDEGKEA  127

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW+  F      A  +   + S              ++  G++
Sbjct  128   LGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIFGDAASA-------------ELHHGFY  174

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             +LYTSK+P S+FT  SAR Q+  ++  L  +YK E +SI++TGHSLGA+LA L A D+  
Sbjct  175   SLYTSKNPGSKFTNTSARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDIAA  234

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              G+           PVTA  + SP++G+  F+       +L+ L IRN+ D++P     L
Sbjct  235   QGLNKPKGQPQKACPVTAFAYASPRVGDSSFEDAFNGYKDLRALRIRNETDIVP--VSLL  292

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             LG+   G E +ID RKS  LK  ++    HNL+A LH VAG  G+ G F L+V R +AL+
Sbjct  293   LGFSDVGEELLIDTRKSKFLKEGVSA---HNLEAYLHGVAGTQGKKGGFNLEVNRDIALL  349

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             NK  + LK+E  +P  W +++NK MV   +G W L   N++
Sbjct  350   NKGMDALKDEYLVPVEWRVQENKGMVQQLDGTWKLIEKNED  390



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 226/396 (57%), Gaps = 22/396 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+ +W GLLDPL++ LR  ++  G+  QATYD FN +  S + G+C +G +    
Sbjct  16    WRELQGAGSWAGLLDPLDIDLRANLIAYGELTQATYDGFNQEKRSPHCGACVFGYSDLLA  75

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAF---LLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
                  +A  Y V  ++YAT+ L VPEAF    L     ESW RESNW+GYVAV +DA   
Sbjct  76    SSGAAAAGSYSVTKFIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYVAVATDAGVA  135

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             ALGRR+I V +RGT  +LEW+N F   PVSA P+L S+ + +             V  G+
Sbjct  136   ALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAAL---------VHRGF  186

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
              ++Y S +P+S++   SAR+Q+  ++  L + YK E  SIT+TGHSLGASLA L A DL 
Sbjct  187   LSVYRSSNPDSKYNQSSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLNAVDLA  246

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG+           PVTA V+ SP++G+  F        +L+ LH++N  D++P YP  
Sbjct  247   ANGLNAPADSSQPPCPVTAFVYASPRVGDANFKNAFASFPDLRALHVKNAGDVVPLYP--  304

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
              LGYV   +   ID  +S  L+        HNL+  LH VAG  G  G F+L+V R VAL
Sbjct  305   PLGYVDVAVPLPIDTGRSPYLRQPGTIPTRHNLECYLHGVAGEQGSAGGFKLEVDRDVAL  364

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              NK    LK++  +P  WW+ KNK MV   +G W L
Sbjct  365   ANKEEGALKDQYPVPADWWVAKNKFMVKGADGHWAL  400



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 232/398 (58%), Gaps = 24/398 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+++W GLLDPL++ LR  ++  G+  QATYD FN +  S +AG+C +G ++   
Sbjct  10    WRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGYSNLLA  69

Query  1227  KVMLPSADDYQVEAYLYATAQLT-VPEAFLLHSRSR---ESWDRESNWIGYVAVTSDAVS  1060
                  +A  Y V  ++YAT+ L  VPEAFLL        ESW RESNW+GYVAV +D   
Sbjct  70    GSGAAAAGSYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVATDDGV  129

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
              ALGRR+I V +RGT   LEW+N F   PVSA P+L  + + +             V  G
Sbjct  130   AALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL---------VHRG  180

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             + ++YTS +P+S++   SAR+Q+  ++  L + YK E  SIT+ GHSLGASLA L A DL
Sbjct  181   FLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDL  240

Query  699   CENGVT---------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
               NGV            PVTA+VF SP++G+  F + +    +L+ LH++N  D++P YP
Sbjct  241   AANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYP  300

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
                LGYV   ++  I   +S  L+     +  HNL+  LH VAG  G  G F L+V R V
Sbjct  301   --PLGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRLEVDRDV  358

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             ALVNK  + LK++  +P  WW+ KNK MV   +G + L
Sbjct  359   ALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYAL  396



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 174/412 (42%), Positives = 228/412 (55%), Gaps = 28/412 (7%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
              T   W +L G  +W+GLLDP +L LR  ++R G+  QATYD+FNH+  S +AG  R+  
Sbjct  10    GTARRWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFAA  69

Query  1242  NSFFHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
               FF +  LP  +  Y+V  ++YAT+ + VPE  +L S SR    RESNWIGYVAV +D 
Sbjct  70    RRFFERAQLPGHSAAYRVARFVYATSCVAVPEPLILRSASRARRCRESNWIGYVAVATDE  129

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
                ALGRR+I V +RGT   LEWI       V  + LLR   S               V 
Sbjct  130   GKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAM------------VH  177

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              GW ++YTS+D  S     SAR+Q+ +++ +L S Y+ E LSIT+TGHSLGA+LA L AF
Sbjct  178   RGWLSMYTSRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAF  237

Query  705   DLCENGVT----------DIPVTAIVFGSPQIGNKLFDKLM--TEKTNLKILHIRNKIDM  562
             D+ ENG              PVTA VF SP++G   F +         L++L +RN  D+
Sbjct  238   DIVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDV  297

Query  561   IPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAG-WNGEDGEFEL  385
             +P YP A   Y   G E  ID  +S  L+   N   WHNL+  LH VAG   GE G F+L
Sbjct  298   VPRYPPAPP-YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARGGEAGRFKL  356

Query  384   KVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL-GSPNDED  232
              V+R VAL NKS   L++E  +P  WWI  N+ MV   +G W L     DED
Sbjct  357   AVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREEDED  408



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 231/398 (58%), Gaps = 24/398 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+++W GLLDPL++ LR  ++  G+  QATYD FN +  S +AG+C +G +    
Sbjct  10    WRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGYSDLLA  69

Query  1227  KVMLPSADDYQVEAYLYATAQLT-VPEAFLLHSRSR---ESWDRESNWIGYVAVTSDAVS  1060
                  +A  Y V  ++YAT+ L  VPEAFLL        ESW RESNW+GYVAV +D   
Sbjct  70    GSGAAAAGSYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVATDDGV  129

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
              ALGRR+I V +RGT   LEW+N F   PVSA P+L  + + +             V  G
Sbjct  130   AALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL---------VHRG  180

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             + ++YTS +P+S++   SAR+Q+  ++  L + YK E  SIT+ GHSLGASLA L A DL
Sbjct  181   FLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLNAVDL  240

Query  699   CENGVT---------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
               NGV            PVTA+VF SP++G+  F + +    +L+ LH++N  D++P YP
Sbjct  241   AANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIVPTYP  300

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
                LGYV   ++  I   +S  L+     +  HNL+  LH VAG  G  G F L+V R V
Sbjct  301   --PLGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSAGGFRLEVDRDV  358

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             ALVNK  + LK++  +P  WW+ KNK MV   +G + L
Sbjct  359   ALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYAL  396



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   296 bits (757),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 162/398 (41%), Positives = 231/398 (58%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ S++AG+  Y +  FF 
Sbjct  23    WRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRKDFFA  82

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  ++YAT+ + VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  83    KVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTA  142

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+  F    V+A  +                    ++  GW
Sbjct  143   LLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQV------------QIHQGW  190

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT  +AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L+A D+ 
Sbjct  191   YSIYMSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIV  250

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   ++++L  RN  D+IP YP  
Sbjct  251   ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYPP-  309

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FELKVKRCV  367
              +GY + G EF ID RKS  +K+  N + +H L+  LH VAG  G +    F L V+R +
Sbjct  310   -IGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAI  368

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK M   ++G W L
Sbjct  369   GLVNKSVDGLKDECMVPGKWRVLKNKGMAQQDDGSWEL  406



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   295 bits (755),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 166/401 (41%), Positives = 236/401 (59%), Gaps = 23/401 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G + WEGLLDPL+L LR  ++  G+  QATYD+F  +  SKYAG  RY   + F 
Sbjct  10    WKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDSRYSMKNLFS  69

Query  1227  KV--MLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +V  +L +   YQ   YLYAT+++ VPE+F+L   SR++W+RESNWIGY+AV +D   +A
Sbjct  70    EVGLVLNNPFVYQPVKYLYATSKIDVPESFILKPLSRDAWNRESNWIGYIAVATDQGKQA  129

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT   LEWI  F     SA  ++                   +V  G+ 
Sbjct  130   LGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIVGVEKDA-------------QVHQGFL  176

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS +P S+F   S REQ+   ++EL  KY+ E++S+T+TGHSLGA+LA L+A D+  
Sbjct  177   SIYTSDNPQSQFNKTSVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDIVA  236

Query  693   NGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
             NG+           PVTA VF  P+ G+  F ++    ++L+IL + N  D+IP+ P   
Sbjct  237   NGLNRSDDQASKACPVTAFVFACPRTGDLAFREVSDSFSDLRILRVTNTPDIIPKVPPLA  296

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G    +D RKST LK +     WHNL+A +H +AG  G   +F L+V R +ALV
Sbjct  297   IGYRDVGQNLELDSRKSTYLKPTGAFITWHNLEAYMHCIAGTQGGKPDFHLEVNRDIALV  356

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             NK    LK+   +P +WW EK+K MV  E+G W L    D+
Sbjct  357   NKKLNSLKDIYLVPSAWWQEKHKGMVQQEDGSWKLDDHEDD  397



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   295 bits (755),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 166/397 (42%), Positives = 221/397 (56%), Gaps = 24/397 (6%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             T   W +L G   W G+LDPL+L LR  +LR G+  QATYD+FN +  S +AG  R+ + 
Sbjct  10    TARRWRELHGDGGWAGMLDPLDLDLRRTVLRYGEMAQATYDAFNRERASPHAGLSRFARA  69

Query  1239  SFFHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
              FF +V LP+ A  Y+V  +LYAT+ + VP+AF+L S SR    RESNWIGYVAV +D  
Sbjct  70    HFFDRVRLPAHAAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAVATDEG  129

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
               ALGRR++ V +RGT   LEW +      V    LL    +               V  
Sbjct  130   KAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDGDA--------------MVHR  175

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             GW ++YTS DP S     SAR Q   ++  L   Y+GE LSIT+TGHSLGA+LA L AFD
Sbjct  176   GWLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFD  235

Query  702   LCEN-------GVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +  N       G    PVT+  F SP++G   F K       L++L +RN  D++P+YP 
Sbjct  236   IAANGYNVAATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKYP-  294

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
              ++ Y   G E  ID  +S  L++      WHNL+  LH VAG  G  G FEL V R VA
Sbjct  295   -VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVA  353

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             LVNK+ + L++   +P  WW+  N+ MV   +G W L
Sbjct  354   LVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   295 bits (754),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 236/393 (60%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G  NWEGLL PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   S F 
Sbjct  8     WEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMESLFT  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L     Y+V  + YATA + +P+AF++ S SRE+W +ESN++GY+AV +D    ALG
Sbjct  68    KVGLDPLK-YRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+N      V    +                   P V  G++ +
Sbjct  127   RRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGG--------LLSLLQPLVHHGFYNI  178

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YT++DP S+F  +SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  NG
Sbjct  179   YTTEDPRSQFNQVSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAVDIAFNG  238

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F K  ++  NL IL I N +D++P+YP   +GY+
Sbjct  239   INKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPKYPP--IGYI  296

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K       WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  297   DVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKLEVNRDISLVNK  356

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
               + LK+E  IPG WW +K+K MV  ++G W+L
Sbjct  357   QWDILKDEYCIPGLWWADKHKGMVQQQDGSWLL  389



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 238/403 (59%), Gaps = 26/403 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G   WEGLL+PL++ LR  I++ G+    TYD+F  +  SKYAG+ RY
Sbjct  3     SMADK--WEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRY  60

Query  1248  GKNSFFHKVML-PSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTS  1072
                + F K  L PS   Y+V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +
Sbjct  61    SMENLFSKAGLDPSK--YRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVAT  118

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             D    +LGRR+I + +RGT   LEW+N      + A  +                   P 
Sbjct  119   DEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKG--------GLLPLTQPL  170

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  G++ +YTS+   S+F   SAR+Q+  +++ L  +YK + +SIT+ GHSLGASLA L 
Sbjct  171   VHHGFYNIYTSESERSKFNKTSARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATLN  230

Query  711   AFDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             A D+  NG+       + PVTA VF SP++G+  F     +  NL I+ I N +D++P+Y
Sbjct  231   AVDIAFNGINKTSEGKEFPVTAFVFASPKVGDVNFVNTFNKLKNLHIMRIDNLLDIVPKY  290

Query  549   PGALLGYVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNG---EDGEFELK  382
             P   +GY   G E +ID  KS  LK N  +P   HNL+  LH + G  G    DG F+L+
Sbjct  291   PP--IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDG-FKLE  347

Query  381   VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             V R +ALVN+  + LK+E  +PG+WW+EK+  MV  ENG+W+L
Sbjct  348   VNRDLALVNRIWDILKDEHLVPGAWWVEKHNGMVQQENGKWIL  390



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 171/402 (43%), Positives = 227/402 (56%), Gaps = 21/402 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L GS +WEGLLDPL+++LR  ++  G+   ATY++F  +S S  AG CRY +   F 
Sbjct  11    WRELHGSNHWEGLLDPLDVNLRRCLITYGEMIMATYEAFIGESRSPNAGMCRYRRADLFR  70

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V +     Y+   YLYATA   V    LL    R+   RE NW+GYVAV +D  + ALG
Sbjct  71    RVDVSRPGWYEATRYLYATASAEVRGKVLLRPLCRQGRARECNWMGYVAVATDQGAAALG  130

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+        SA  +L    +G +D         P V  G+ +L
Sbjct  131   RRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGAGGSD---------PSVHRGYLSL  181

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS D  S  +  SAR Q+ T+I  L  KYK E  SIT+ GHSLGA++A L A D+  N 
Sbjct  182   YTSADEGSNLSKQSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLNAADIVANA  241

Query  687   VTDI--------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
                         PVTAIVFGSP+ G++ F  +     +L++L IRN+ D IP YP   +G
Sbjct  242   YNKTPGYDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPDLRMLRIRNRPDRIPHYP--PVG  299

Query  531   YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
             Y   G+E +ID R+S  LK   N S  H+L+  LH VAGW G+ G FEL V R VALVNK
Sbjct  300   YADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDHGGFELVVDRDVALVNK  359

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGS--PNDED  232
               + L +E  +P  W +  NK+MV   +G WVL    P+ ED
Sbjct  360   FDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDYED  401



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/402 (42%), Positives = 225/402 (56%), Gaps = 17/402 (4%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L GS +WEGLLDPL++ LR  ++  G+   ATY++F  +S S  AG CRY +   F 
Sbjct  11    WKELQGSNHWEGLLDPLDVGLRRCLVTYGEMIMATYEAFIGESRSPNAGMCRYRRADLFQ  70

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V +     Y+   YLYATA   V    LL    RE   RE NW+GYVAV +D  + ALG
Sbjct  71    RVDVSHPGWYEATRYLYATASAEVRGKVLLRPLCRERCARECNWMGYVAVATDEGAAALG  130

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+        SA  +L     G            P V  G+ +L
Sbjct  131   RRDIVVAWRGTQRALEWVADLKLALASAAGIL-----GPEGGGGGSGGSDPSVHRGYLSL  185

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS    S  +  SAR Q+ T+I  L  KYKGE  SIT+ GHSLGA++A L A D+  N 
Sbjct  186   YTSDYEGSNLSKQSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATMATLNAVDIAANA  245

Query  687   VTDI--------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
                I        PVTAIVFGSP+ G++ F  +     +L++L +RN+ D IP YP   +G
Sbjct  246   YNKIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPDLRMLRVRNRPDRIPHYP--PVG  303

Query  531   YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVNK  352
             Y   G+E +ID R+S  LK+  + S  H+L+  LH +AGW G+ G FEL V R VALVNK
Sbjct  304   YADVGVELLIDTRRSPFLKHHGSESQSHDLEVHLHGIAGWQGDRGGFELVVDRDVALVNK  363

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL--GSPNDED  232
               + L +E  +P  W +  NKSMV   +G WVL    P+ ED
Sbjct  364   FDDCLADEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDPDYED  405



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/397 (42%), Positives = 221/397 (56%), Gaps = 24/397 (6%)
 Frame = -1

Query  1419  TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKN  1240
             T   W +L G   W G LDPL+L LR  +LR G+  QATYD+FN++  S +AG  R+ + 
Sbjct  10    TARRWRELHGDGGWAGTLDPLDLDLRRTVLRYGEMAQATYDAFNNERASPHAGLSRFARA  69

Query  1239  SFFHKVMLPS-ADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
              FF +V LP+ A  Y+V  +LYAT+ + VP+AF+L S SR    RESNWIGYVAV +D  
Sbjct  70    RFFDRVRLPAHAAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAVATDEG  129

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
               ALGRR++ V +RGT   LEW +      V    LL    +               V  
Sbjct  130   KAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDGDA--------------MVHR  175

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             GW ++YTS DP S     SAR Q   ++  L   Y+GE LSIT+TGHSLGA+LA L AFD
Sbjct  176   GWLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFD  235

Query  702   LCEN-------GVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +  N       G    PVT+  F SP++G   F K       L++L +RN  D++P+YP 
Sbjct  236   IAANGYNVTATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKYP-  294

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
              ++ Y   G E  ID  +S  L++      WHNL+  LH VAG  G  G FEL V R VA
Sbjct  295   -VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGARGGFELAVARDVA  353

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             LVNK+ + L++   +P  WW+  N+ MV   +G W L
Sbjct  354   LVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSL  390



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/401 (41%), Positives = 233/401 (58%), Gaps = 19/401 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+GLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   +FF 
Sbjct  9     WEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSMENFFT  68

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L     Y V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +D    +LG
Sbjct  69    KVGL-DPKKYCVTKYFYATSSMPLPDAFITKSFSREAWSKESNFMGYIAVATDEGKASLG  127

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   LEW+N      V A  +                   P V  G+H +
Sbjct  128   RRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGG--------LLPLFHPLVHHGFHNI  179

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YT+++P S+F     R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  N 
Sbjct  180   YTTENPRSQFNKTCVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVDIAFNK  239

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F    ++  +L IL I N +D++P+YP   +GY 
Sbjct  240   INKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNLLDIVPKYPP--IGYF  297

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K    P  WH L+  LH +AG  G      F+L+V R ++LVNK
Sbjct  298   DVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMFAGFKLEVNRDISLVNK  357

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
                 LK+E  IP  WW EK+K MV  E+G W+L   ++ D 
Sbjct  358   QWNILKDEHCIPPLWWSEKHKGMVQQEDGCWLLQDRDEYDF  398



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 229/393 (58%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+GLL+PL+L LR  I+  G+  QATYD+F  +  SKYAG+ RY   +FF 
Sbjct  9     WEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASRYSMENFFT  68

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L     Y V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +D    +LG
Sbjct  69    KVGL-DPKKYCVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYIAVATDEGKASLG  127

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I + +RGT   LEW+N      V A  +                   P V  G+H +
Sbjct  128   RRDIVINWRGTLQVLEWVNDLQFLLVPAPQVFGDGG--------LLPLFHPLVHHGFHNI  179

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YT+++P S+F     R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  N 
Sbjct  180   YTTENPRSQFNKTCVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNK  239

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F    ++  +L IL I N +D++P+YP   +GY 
Sbjct  240   INKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNVLDIVPKYPP--IGYF  297

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K    P  WH L+  LH +AG  G      F+L+V R ++LVNK
Sbjct  298   DVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMLAGFKLEVNRDISLVNK  357

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
                 LK+E  IP  WW EK+K MV  E+G W+L
Sbjct  358   QWNVLKDEHCIPPLWWSEKHKGMVQQEDGTWLL  390



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 229/393 (58%), Gaps = 19/393 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  NW+GL+ PL + LR  I++ G+  QATYD+F  +  SKYAG+ RY   +FF 
Sbjct  8     WEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRYSNENFFT  67

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             KV L   + Y V  + YATA + +P+AF+  S SRE+W +ESN++GYVAV +D    +LG
Sbjct  68    KVGL-DPNKYGVTKFFYATASIPLPDAFITRSFSREAWSKESNFMGYVAVATDEGKVSLG  126

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+N      V A  +  +                P V  G++ +
Sbjct  127   RRDIVVAWRGTKQALEWVNDLQFLLVPAPNVFGNGG--------LLPLFQPLVHHGFYNI  178

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             YTS+   S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D+  NG
Sbjct  179   YTSESARSQFNQTSVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNG  238

Query  687   VT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLGYV  526
             +       + PVTA VF SP++G+  F    ++  +L IL I N +D++P+YP   +GY 
Sbjct  239   INKTSEGKEFPVTAFVFASPKVGDINFLNKFSKLKHLHILRIHNLLDIVPKYPP--IGYF  296

Query  525   KSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCVALVNK  352
               G E +ID  KS  +K       WH L+  LH VAG  G      F+L+V R ++LVNK
Sbjct  297   DVGQEIMIDTTKSPYVKPPGEIVSWHLLEPYLHGVAGTQGLGLLAGFKLEVNRDISLVNK  356

Query  351   SCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
               + LK E  +P  WW EK+K MV  ENG W+L
Sbjct  357   EWDILKNEYCVPAFWWTEKHKGMVQQENGSWLL  389



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 158/398 (40%), Positives = 231/398 (58%), Gaps = 19/398 (5%)
 Frame = -1

Query  1422  ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGK  1243
             +T   W +L G  NW+GLL+PL++ LR  I+  G+   ATYD+   +  SKYAG+ RY  
Sbjct  3     STAEKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRYSM  62

Query  1242  NSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAV  1063
              +FF KV L   + Y+V  + YATA + +P+AF++ S SRE+W +ESN++GY+AV++D  
Sbjct  63    ENFFTKVGL-DPNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVSTDEG  121

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
               +LGRR+I + +RGT   +EW+N      + A  +                   P V  
Sbjct  122   KASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIFGDGG--------LLHLFKPLVHH  173

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             G++ +YTS    S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A D
Sbjct  174   GFYNVYTSASSRSQFNQTSVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATLNAVD  233

Query  702   LCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             +  NG+       + PVTA  F SP++G+  F     +  +L +L I N +D++P+YP  
Sbjct  234   ITFNGINKTSEGKEFPVTAFAFASPKVGDLQFKAAFDKLKHLHVLRIHNLMDIVPKYPP-  292

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKRCV  367
              +GY   G E +ID  KS  +K    P  WH L+  LH VAG  G      F+L+V R +
Sbjct  293   -IGYFDVGKELMIDTTKSPYVKPPGEPLSWHLLEPYLHGVAGTQGLGIFAGFKLEVNRDI  351

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             +LVNK    LK+E  IPG WW+EK K MV  E+G W++
Sbjct  352   SLVNKQWNILKDEYCIPGRWWVEKCKGMVQQEDGSWLM  389



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   293 bits (751),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 161/397 (41%), Positives = 226/397 (57%), Gaps = 23/397 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  +W+ LLDPL+  LR  ++  G+  QATYD FN +  S  AGSC +G +    
Sbjct  47    WRELHGETSWKNLLDPLDPHLRATLIAYGELAQATYDGFNSERRSPNAGSCLHGHDDLLT  106

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSR--ESWDRESNWIGYVAVTSDAVSKA  1054
                + S   Y+V  ++YAT+ + +PE+FL        ++W R+SNWIGYVAV +D  ++A
Sbjct  107   ASSVSSPGHYKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVATDEGAEA  166

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT  +LEW+N     PVSA P+L S+            +++  V  G+ 
Sbjct  167   LGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAG---------KNRLAVVHRGFL  217

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             ++YTS + +S+FT  SAR+Q+  ++  L   +K E  SIT+TGHSLGASLA L A DL  
Sbjct  218   SVYTSSNKSSKFTKTSARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLNAVDLVS  277

Query  693   NGVT----------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
             +G              PVTAIVF SP +G++ F        +LK LH++N  D++P YP 
Sbjct  278   SGTNKPSSSDGDKKPFPVTAIVFASPHVGDRFFRSAFGSFPDLKALHVQNVGDIVPLYP-  336

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
               LGYV    E  I   +S  L     P   HNL+  LH VAG  G  G F+L+V R VA
Sbjct  337   -PLGYVDVATELTIRTIRSPYLSVPGTPVTLHNLECYLHGVAGEQGSRGGFKLEVARDVA  395

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             LVNK  + L +E  +P  WW  K++ MV  ++G W L
Sbjct  396   LVNKGVDALTDEHPVPAGWWTPKHRCMVRGDDGRWTL  432



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   293 bits (751),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 234/398 (59%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y +  FF 
Sbjct  39    WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  +LYAT+Q+ VPE+FLL   SRE W +ESNW+GYVAVT D  + 
Sbjct  99    KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+N F    V+A+ +                    ++  GW
Sbjct  159   LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQV------------QIHQGW  206

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT  +AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L A D+ 
Sbjct  207   YSIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAADIV  266

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   +L++L  RN  D+IP Y   
Sbjct  267   ANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDIIPIY--P  324

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKRCV  367
              +GY + G E  ID RKS  +K+  N + +H L+A LH VAG  G  +  EF L VKR +
Sbjct  325   PIGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDVKRDI  384

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK MV  ++G W L
Sbjct  385   GLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNL  422



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/407 (39%), Positives = 237/407 (58%), Gaps = 38/407 (9%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  + G ++W GLLDP++  LR  ++R G+F QA YDSF++D  S+Y GSC+Y +  FF+
Sbjct  90    WRVIHGRDDWAGLLDPIDPLLRTELIRYGEFVQACYDSFDYDKFSRYCGSCKYSRRQFFY  149

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              + + SA  Y V  YLYAT+ + VP+ F        +W   +NWIGYV+V++D  +  LG
Sbjct  150   SLGMESAG-YDVTRYLYATSNVKVPKFFAKSVMGSRTWSERANWIGYVSVSNDETTARLG  208

Query  1047  RREIYVVFRGTTTDLEWINVFSAK--PVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             RR+I + +RGT T LEWI+ F AK  PV +  +    T               KV  G+ 
Sbjct  209   RRDILIAWRGTVTRLEWIHDFMAKMQPVRSAGIPCPDTRV-------------KVETGFV  255

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKY--KGENLSITLTGHSLGASLAILAAFDL  700
              LY  KD   RF   SAREQ+ T++ +L ++Y   GE +SIT+ GHSLG++LA L A+D+
Sbjct  256   DLYIEKDSTCRFCKYSAREQVLTEVRKLVAQYTEAGEEVSITVAGHSLGSALATLNAYDI  315

Query  699   CENGV------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              E  +        +P+    +G P++GN+ F K   +K  LK+L + N  D +P  PG L
Sbjct  316   AEMELIKGADGKQVPMAVFSYGGPRVGNEHF-KERCDKLGLKVLRVVNVHDKVPTVPGVL  374

Query  537   L-------------GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDG  397
             +             GYV  G+E ++DH+ S  LK+S++PS++HNL+A LH++ G+ G+  
Sbjct  375   INEHMPEFMLRAMDGYVHVGVELLLDHKHSPFLKDSLDPSNYHNLEAHLHLLDGFQGKGR  434

Query  396   EFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
             +F     R  ALVNKSC+FL E L +P +W  ++NK M+  + G W 
Sbjct  435   KFAPTTGRDPALVNKSCDFLHEHLMVPPNWRQDENKGMMRSQEGRWA  481



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 234/408 (57%), Gaps = 21/408 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G  NW GLL+PL + LR  I+  G+  QATYD+F  +  SKYAG+ RY
Sbjct  3     SMAEK--WEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                +FF KV L   + Y+V  + YAT+ + +P+ F++ S SRE+W +ESN++GY+AV +D
Sbjct  61    SMENFFTKVGL-DPNKYRVTKFFYATSSIPLPDGFIVKSFSREAWSKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 +LGRR+I V +RGT   +EW+N      + A  +  +                P V
Sbjct  120   EGKASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGG--------LLPLFKPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YTS    S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA + A
Sbjct  172   HHGFYNVYTSASSRSQFNKTSVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATMNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  N +       + PVTA  F SP++G+  F     +  +L IL I N +D++P+YP
Sbjct  232   VDIAFNKINKASNGKEFPVTAFAFASPKVGDIQFKATFDKLKHLHILRIHNLLDIVPKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVKR  373
                +GY   G E +ID  KS  +K       WH L+  LH VAG  G      F+L+V R
Sbjct  292   P--IGYFDVGKELMIDTTKSPYVKPPGENVSWHLLEPYLHGVAGTQGLGLFAGFKLEVNR  349

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              ++LVNK    LK+E  IPG WW+EKNK MV  E+G W++   ++ D 
Sbjct  350   DISLVNKQWNILKDEYCIPGMWWVEKNKGMVQQEDGSWLMLDRDEYDF  397



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 225/390 (58%), Gaps = 22/390 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G  +W+GL+DPL+L LR  I+  G+  +ATYD FN +  S +AG+C YG +    
Sbjct  17    WRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACIYGYSDLLA  76

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRS--RESWDRESNWIGYVAVTSDAVSKA  1054
                + +A  Y+V  ++YAT+   +P+AFL+   +  ++ W RESN++GYVAV +D  + A
Sbjct  77    SSGVAAAGHYEVTRFIYATSGQPLPDAFLVRPLAALKDVWSRESNFMGYVAVATDEGAAA  136

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT   LEW+N  +  PV A P+L    +          + +  V  G+ 
Sbjct  137   LGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAA---------ANPLAMVHMGFL  187

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             +LYTS    S+F   SAR+Q+  ++  L   YK E LSIT+TGHSLGA+++IL A D+  
Sbjct  188   SLYTSSHAGSKFNKTSARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILNAVDIVS  247

Query  693   NGV---------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             NGV            PVTA VF  P +G++ F        +L+ LH++N  D++P YP  
Sbjct  248   NGVNVPAGGGGSAACPVTAFVFACPHVGDRFFRAAFHSFRDLRALHVKNAGDVVPMYP--  305

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
              L YV   +   I+  +S  LK        HNL+  LH VAG  G  G F+L+VKR VAL
Sbjct  306   PLAYVDVAVTLNINTGRSPYLKWPGTVLTLHNLECYLHGVAGEQGSAGGFKLEVKRDVAL  365

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDE  271
             VNK  + LK+E  +P SWW  +NK MV D+
Sbjct  366   VNKGADALKDEYPVPASWWALENKGMVKDD  395



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 165/423 (39%), Positives = 227/423 (54%), Gaps = 51/423 (12%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G ++W+GLLDPL++ LR  ++  G+  QATYD FN ++ S +AG+C YG      
Sbjct  9     WRELHGKDSWKGLLDPLDMDLRASVIAYGELAQATYDGFNTEARSPHAGACLYGHADLLA  68

Query  1227  KVMLPSADD------YQVEAYLYATAQLTVPEAFLLHSR----SRESWDRESNWIGYVAV  1078
                            Y+V  ++YAT+ L VP+AFLL  +     +E W RESNW+GYVAV
Sbjct  69    ASDSAGGGAGGISDRYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNWMGYVAV  128

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV  898
              +D  + ALGRR++ V +RGT   LEW+N     PV A P+L S+ +             
Sbjct  129   ATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAH-----------  177

Query  897   PKVMF--GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASL  724
             P+ M   G+ +LYTS + +S++  LSAR+Q+  ++  L   YK E  SI++TGHSLGASL
Sbjct  178   PRAMVHGGFLSLYTSSNASSKYNKLSARDQVLEEVRRLMELYKDEETSISVTGHSLGASL  237

Query  723   AILAAFDLCENGV--------------------------TDIPVTAIVFGSPQIGNKLFD  622
             A L A D+  NGV                             PVTAIVF SP++G   F 
Sbjct  238   ATLNAVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRAGCPVTAIVFASPRVGGPFFK  297

Query  621   KLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNL  442
                    +L+ LH+RNK D++P YP   LGYV   +   I   +S  L+    P   HNL
Sbjct  298   AAFASFADLRALHVRNKGDVVPLYP--PLGYVDVAVPLPIHTARSPWLRRPGTPQTLHNL  355

Query  441   QAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGE  262
             +  LH VAG  G  G F L+V R VALVNK  + L++E  +P  W +  NK MV   +G 
Sbjct  356   ECYLHGVAGEQGAAGGFRLEVGRDVALVNKGADALRDEYPVPARWRVALNKGMVRGADGR  415

Query  261   WVL  253
             W L
Sbjct  416   WAL  418



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/400 (39%), Positives = 223/400 (56%), Gaps = 20/400 (5%)
 Frame = -1

Query  1425  MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYG  1246
             +A    W ++ GS  W GLLDPL++ +R  ++R G+  QAT D+F  D  S YAG+CRY 
Sbjct  18    VAIAQRWREISGSNQWSGLLDPLDIDVRREVIRYGELAQATSDAFITDPASPYAGACRYS  77

Query  1245  KNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDA  1066
               SFF+KV       Y+V  ++YAT+   +P+ F+       +W  +SNW+GYVAV +D 
Sbjct  78    PASFFNKVQASDPGAYRVTRFIYATSSARLPDGFMARPLPAGAWSTDSNWMGYVAVATDR  137

Query  1065  VSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVM  886
              + ALGRR+I V +R T    EW +      V A  ++                  P V 
Sbjct  138   GAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQ----------PYVH  187

Query  885   FGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAF  706
              G+ ++YTSK+  SRF   SARE + T++  L   YK E+ SI++TGHSLG +L  L A 
Sbjct  188   RGFLSVYTSKNSTSRFNRRSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNAI  247

Query  705   DLCENGV-------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             DL  NG        + +PVTAI FG+P++G++ F K       L +L +RN  D++P   
Sbjct  248   DLVANGFNVRGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVPTIL  307

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNG--EDGEFELKVKR  373
               ++ Y   G+E ++D RKS  LK    P+ WHNL+  LH VAG +G  +   F ++V R
Sbjct  308   PPVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDSAGFGMEVDR  366

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              +AL+NK  + L++E  +P  WW E NK MV +  G WVL
Sbjct  367   DLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVL  406



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 233/402 (58%), Gaps = 23/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+ LLDPL+L LR  I+  GD  +  Y +FN D  SKY G   Y K   F 
Sbjct  9     WKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEELFA  68

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +     A+   Y+V  ++Y T+ + +PE F++ S SRE+W++ESNW+GY+AV +D   + 
Sbjct  69    RTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRL  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW N F     SAE +   +T  D           P+V  GW 
Sbjct  129   LGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDP----------PRVANGWL  178

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             +LYTS DP SRF   SAREQ+Q ++  L   YK E ++ITLTGHSLGA L+IL+A D   
Sbjct  179   SLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLH  238

Query  693   NGVTDIP---------VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             N +  I          VT   FGSP+IG++ F +L+    +L IL + N  D+IP YP  
Sbjct  239   NELPKITPSLQHRLTCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIPRYP--  296

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             +  +   G E  I+  KS  LK S+N   +HNL+A LH VAG     GEF+L++KR +AL
Sbjct  297   VFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDIAL  356

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             VNK  + L+++  +PG WW+ +NK MV  ++G W L    D+
Sbjct  357   VNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKLNGDRDK  398



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/409 (40%), Positives = 234/409 (57%), Gaps = 25/409 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G  NWEGLL+PL+L LR  I++ G+  QA  D+F  +  SKYAG+ RY
Sbjct  3     SMADK--WEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQAINDTFITEKASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEA-FLLHSRSRESWDRESNWIGYVAVTS  1072
                + F KV L     Y+V  Y YATA + +P+  F + S SRE+W +ESN++GY+AV +
Sbjct  61    SMENLFTKVGL-DPTKYRVTKYFYATASIPLPDGVFFVKSLSREAWSKESNFMGYIAVAT  119

Query  1071  DAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPK  892
             D    +LGRR+I + +RG+   LEW+N      V A  +                   P 
Sbjct  120   DEGKVSLGRRDIVINWRGSMQTLEWVNDLQFVLVPAPEVFGDGG-----------LLQPL  168

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
             V  G++ +YT+    S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L 
Sbjct  169   VHQGFYNVYTASSSRSQFNVTSARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLN  228

Query  711   AFDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             A D+  N +       + PVTA  F  P++G+  F     +   L+IL I N +D+ P+Y
Sbjct  229   AVDIAFNKINKASNGKEFPVTAFPFACPKVGDLQFKAAFDKIIGLRILRIDNLLDIAPKY  288

Query  549   PGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGED--GEFELKVK  376
             P   +GY   G E +ID  KS  +K    P +WH+L++ LH +AG  G      F L+V 
Sbjct  289   PP--IGYFDVGQELMIDTTKSPYVKPPGQPVNWHSLESYLHGIAGTQGTGLLAGFNLEVN  346

Query  375   RCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             R ++L+NK  + LK+E  IP +WW+EKNK MV  E+G W+L   +D D 
Sbjct  347   RDISLINKQLDGLKDEYCIPVNWWVEKNKGMVQQEDGSWLLLDRDDYDF  395



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 232/405 (57%), Gaps = 26/405 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W QL G + W+GLL+PL+  LR  ++  GD  QATYD+F     S++AG  R+   + F 
Sbjct  10    WRQLSGQQKWQGLLEPLDNDLRQYLIHYGDLAQATYDNFIMQKYSQFAGDNRFSMKNLFS  69

Query  1227  KVMLPSADD---YQVEAYLYATAQLTVPEAFLLH--SRSRESWDRESNWIGYVAVTSDAV  1063
             +V L   ++   Y+   YLYAT+++ VP++F++   S SR   + ESNWIGY+AV +D  
Sbjct  70    RVGLGMRNNQFVYKPVKYLYATSKVDVPQSFIMSPASTSRAVPNGESNWIGYIAVATDQA  129

Query  1062  SKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
              + LGRR+I V +RGT   LEWI  F     SA  +L                   +V  
Sbjct  130   KEKLGRRDIAVAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDA-------------QVHQ  176

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             G+H++YTS +P S+ +  SAR+Q+   + EL +KY+ E +S+T+ GHSLGA+LA L+A D
Sbjct  177   GFHSVYTSDNPQSQTSKTSARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAAD  236

Query  702   LCENGV--TD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             +  NG   TD       PVTA  F  P+ GN+ F ++     +L+IL I N  DM+P+ P
Sbjct  237   IVANGFNRTDKQANKSCPVTAFAFACPRTGNRGFKQVCDSLEDLRILRITNTPDMVPKVP  296

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
               + GY + G    ID RKS  LK +     WHNL+  LH +AG  G+   F L+ +R +
Sbjct  297   PLIAGYSEVGENLEIDSRKSMYLKPTGGFISWHNLETYLHTIAGTQGKRSAFRLECQRDI  356

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDED  232
             +LVNK+ + LKE+  +PG+WW   N  M+  E+G W L   + +D
Sbjct  357   SLVNKNLDALKEKYMVPGNWWCGLNNGMIQQEDGLWKLFDRDKDD  401



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   305 bits (781),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 220/396 (56%), Gaps = 23/396 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G +NW+GLLDPL+  LR  ++R G+  QAT D+F  D  S YAG+ RY   +F  
Sbjct  674   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  733

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +   P  D Y V  +LYAT+   VP  F+       +W  ESNW+GYVAV +DA    LG
Sbjct  734   RAQAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVARLG  793

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   +EW N      V A  ++                  P V  G+ ++
Sbjct  794   RRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQ----------PAVHRGFLSV  843

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCENG  688
             Y S++  SRF   SAREQ+  +I  L   YKGEN SITLTGHSLGA+L+ L A D+  NG
Sbjct  844   YASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTAIDIVANG  903

Query  687   VT-------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY-PGALLG  532
             +         +PV AIVFGSP++G+  F K        ++L +RN  D++P   P A   
Sbjct  904   LNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTVLPNAF--  961

Query  531   YVKSGLEFVIDHRKSTSLKN-SMNPSDWHNLQAMLHVVAGWN--GEDGEFELKVKRCVAL  361
             Y   G+E ++D RKS  LK     P+ WHNL+  LH VAG    G+   F L+V R VAL
Sbjct  962   YKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSLEVDRDVAL  1021

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             VNK  + L ++  +P +WW+E NK M  D +G WVL
Sbjct  1022  VNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVL  1057



>ref|XP_010938535.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=524

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/411 (39%), Positives = 238/411 (58%), Gaps = 43/411 (10%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F++D  S+Y GSCRY +  FF 
Sbjct  102   WREIHGRDHWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCRYSRRKFFA  161

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              + + +A  Y V  YLYAT+ + +P  F   +R  +SW +++NWIGY+AV+ DA +  LG
Sbjct  162   SLGMDTAG-YDVTHYLYATSNINLPN-FFTKTRGPKSWSQKANWIGYIAVSDDATTALLG  219

Query  1047  RREIYVVFRGTTTDLEWINVFSA--KPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             RR+I + +RGT T LEW+       +PV++E +                    KV  G+ 
Sbjct  220   RRDIVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEV-------------KVESGFV  266

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYK--GENLSITLTGHSLGASLAILAAFDL  700
              LYT KDP  RF   SAR+Q+ T++  L  ++   GE +SIT+TGHSLG++LA+++AFD+
Sbjct  267   DLYTDKDPTCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMVSAFDI  326

Query  699   CENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              E GV        + VT + F  P++GN  F K   E+  LK L + N  D +P+ PG L
Sbjct  327   AETGVDVGVDGEKVAVTVLSFSGPRVGNGRF-KERFEELGLKALRVVNVHDTVPKVPGVL  385

Query  537   L-----------------GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWN  409
                                Y   G+E  +DH++S   K++ +PS +HNL+A LH++ G++
Sbjct  386   FNEHVPEFVRRLVEGLPWSYSHVGVELALDHKRSPFFKDTGDPSCFHNLEAHLHLLDGYH  445

Query  408   GEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
             G    F L  KR  ALVNK+C+FLK+ L +P  W  ++NK MV   +G WV
Sbjct  446   GSGHRFYLASKRDPALVNKACDFLKDHLMVPPFWRQDENKGMVRAHDGRWV  496



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/423 (40%), Positives = 240/423 (57%), Gaps = 24/423 (6%)
 Frame = -1

Query  1482  ILIFSAAIFVLKSFIHFQSMATEPT----WHQLLGSENWEGLLDPLNLSLRHLILRCGDF  1315
             +L+ S  + +L   +   + ++ PT    W +L G+ +W GLLDPL++ LR  ++  G+ 
Sbjct  3     MLVASLFMCLLVPSLTAAAPSSSPTTAVRWRELHGNNSWNGLLDPLDIDLRKSVIAYGEL  62

Query  1314  CQATYDSFNHDSNSKYAGSCRYGKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFL--  1141
              QA  D FNH+  S +AG+C YG++     V + +A  Y V  + YAT+ + VPE+ L  
Sbjct  63    AQAAQDGFNHERRSPHAGACLYGRSDLLAGVGVAAAGSYAVTKFFYATSAVPVPESVLLL  122

Query  1140  -LHSRSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSA  964
              L      +W RESNWIGYVAV +D     LGRR+I V +RGT TDLEW N FS  PVSA
Sbjct  123   PLPELGDAAWCRESNWIGYVAVATDEGVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSA  182

Query  963   EPLLRSSTSGdnddkeedddKVPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRS  784
              P+L SS +          + +  V  G+ ++YTS + NS++   SAR+Q+  ++  L  
Sbjct  183   APVLGSSAAA---------NPLAMVHQGFLSVYTSSNANSKYNKASARDQVFEEVRRLMQ  233

Query  783   KYKGENLSITLTGHSLGASLAILAAFDLCENGVT------DIPVTAIVFGSPQIGNKLFD  622
              YK E  SIT+TGHSLGA+LA+L A D+  NG+         PVTA+VF  P +G++ F 
Sbjct  234   LYKDEETSITITGHSLGAALAVLNAVDIAANGLNAASSQPPCPVTAVVFACPHVGDRSFK  293

Query  621   KLMTEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNL  442
                    +L+ LH++N  D++P  P  +   V   L   ID  +S  LK        HNL
Sbjct  294   AAFDSFEHLRALHVKNAGDVVPIVPPVVYVDVGVLL--AIDTGRSPYLKKPGTVQTLHNL  351

Query  441   QAMLHVVAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGE  262
             +  LH VAG  G  G F+L+V R VALVNK  + L++E  +P +WW+ KNK MV   +G 
Sbjct  352   ECYLHGVAGEQGRAGGFKLEVDRDVALVNKGVDALEDEYPVPANWWVPKNKWMVRGADGH  411

Query  261   WVL  253
             W L
Sbjct  412   WKL  414



>ref|XP_010031778.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Eucalyptus 
grandis]
Length=524

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/417 (38%), Positives = 236/417 (57%), Gaps = 54/417 (13%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G  +WEGLLDP+N  +R  I+R G+F QA YDSF+ D NSKY G+C+Y  + FF 
Sbjct  100   WREIQGCNHWEGLLDPMNSHVRQEIIRYGEFAQACYDSFDFDPNSKYCGTCKYQGSQFFE  159

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KAL  1051
             K+ + +   YQ+  YLYAT+ + +P  F  HSR  + W   +NW+GY+AVT+D    + L
Sbjct  160   KLGM-NHFGYQISRYLYATSNINLPN-FFQHSRLSKVWSTYANWMGYIAVTTDEEEIRRL  217

Query  1050  GRREIYVVFRGTTTDLEWI----NVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             GRR+I + +RGT T LEWI    ++        +P +                   K+  
Sbjct  218   GRRDIVIAWRGTVTYLEWIYDLKDILHPAHFKDDPTI-------------------KIEA  258

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             G++ LYT K+ +  F + SAREQ+  +++ L   Y+ E +SIT+TGHSLGA+LAI++A+D
Sbjct  259   GFYDLYTKKEKSCHFCSFSAREQILAEVKRLLDYYRDEEISITITGHSLGAALAIISAYD  318

Query  702   LCENGVT---------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             + E GV           +P+T   F  P++GN  F K   ++  +K+L + N  DM+P  
Sbjct  319   IAEMGVNVVNDGGEMKKVPITVYSFAGPRVGNLKF-KERCDELGVKVLRLTNVHDMVPTV  377

Query  549   PGALLG------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHV  424
             PG +                    Y   G E  +D   S  LK++ +PS  HNL+A+LH+
Sbjct  378   PGIIANEKMQFQKYLEETLSFPWSYAHVGTELALDQTHSPFLKSTNDPSCAHNLEALLHL  437

Query  423   VAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             V G++GE   F+L  +R +ALVNKSC+FLK E  +P  W  ++NK MV   +G WV+
Sbjct  438   VDGYHGEGRRFKLVTRRDIALVNKSCDFLKGEYGVPPCWRQDENKGMVRSSDGRWVV  494



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/407 (40%), Positives = 229/407 (56%), Gaps = 18/407 (4%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             S AT   W +L G+ +W GLLDPL++ LR  I+  G+  QATYD FN +  S +AG+C Y
Sbjct  37    SSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLY  96

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEA---FLLHSRSRESWDRESNWIGYVAV  1078
             G+      V + +A  Y V  ++YAT+ L VP +    L    +RE+W RESNWIGYVAV
Sbjct  97    GRADLLPGVGVAAAGRYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAV  156

Query  1077  TSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKV  898
              +D  +  LGRR++ V +RGT  DLEW N F+  PVSA P+L  S +  N         +
Sbjct  157   ATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVL-GSAAAANPLAVVHQGFL  215

Query  897   PKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAI  718
                     TL TS + +SRF   SAR+Q+  ++  L   YKGE  SIT+ GHSLGA+LA 
Sbjct  216   SVYQLSSLTLTTSCNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALAT  275

Query  717   LAAFDLCENGVTD---------IPVTAIVFGSPQIGNKLFDKLMTEK-TNLKILHIRNKI  568
             L A D+  NG+ +          PVTAI+F  P +G++ F         +L+ LH+RN  
Sbjct  276   LNAVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGSFRDLRALHVRNAG  335

Query  567   DMIPEYPGALLGYVKSGLEFV-IDHRKSTSLKNSMNPSDWHNLQAMLHVVAG-WNGEDGE  394
             D++P  P   L YV   +  + ID  +S  L++       HNL+  LH VAG  +   G 
Sbjct  336   DVVPLVPP--LAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGKQSSAAGG  393

Query  393   FELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             F L+V R VALVNK  + L++E  +P +WW+ +N+ MV    G W+L
Sbjct  394   FRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSEGHWML  440



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 160/406 (39%), Positives = 233/406 (57%), Gaps = 20/406 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W QL G  NWEGLL+PL+L LR  +++ G+  QATYD+F  +  SK AG+ RY
Sbjct  3     SMAEK--WEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F +V L     Y+V  + YAT+ + +P+   + S S E+W +ESN++GYVAV +D
Sbjct  61    SMENLFTRVGLDPLK-YRVTKFFYATSSIPLPDGLFVRSLSLEAWSKESNFMGYVAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I + +RGT   LEW+N F    V A  +                   P V
Sbjct  120   EGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDRG--------LLHLLQPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YT+ +P S+F   SAR+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A
Sbjct  172   HHGFYNIYTTNNPRSQFNHTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG+       + PVTA  F SP++G+  F     +  +++ L I N  D++P+ P
Sbjct  232   VDIAFNGINKTSEGREFPVTAFAFASPKVGDLKFKAAFDKLKSVRTLRIHNLWDVVPKVP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
                +GY+  G E +ID  KS  +K       WH L+  LH +AG  G  G F+L+V R +
Sbjct  292   P--IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLRG-FKLEVDRDI  348

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             +LVNK  + LK+E  IPG W +EKNK MV  ++G W+L    + D 
Sbjct  349   SLVNKQWDILKDEYGIPGRWLVEKNKGMVQQKDGSWLLMDREEYDF  394



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 231/406 (57%), Gaps = 20/406 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W QL G  NWEGLL+PL+  LR  +++ G+  QATYD+F  +  SK AG+ RY
Sbjct  3     SMAEK--WEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F +V L     Y+V  + YAT+ + +P+ F + S S E+W ++SN++GYVAV +D
Sbjct  61    SLENLFTRVGLDPLK-YRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I + +RGT   LEW+N F    V A  +                     V
Sbjct  120   EGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQP--------LV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YT+ +P S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A
Sbjct  172   HHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NGV       +  VTA  F SP++G+  F     +  +L+ L I N  D++P+ P
Sbjct  232   VDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKVP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCV  367
                +GY+  G E +ID  KS  +K       WH L+  LH +AG  G  G F+L+V R +
Sbjct  292   P--IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIG-FKLEVNRDI  348

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             +LVNK  + LK+E  IPG WW+EKNK MV  ++G W+L    + D 
Sbjct  349   SLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREEYDF  394



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   288 bits (737),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 227/398 (57%), Gaps = 27/398 (7%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  L G  +W+G L PL+  LR  I+  G+  QA YD+FN ++ S++AG+  Y +  FF 
Sbjct  23    WRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGASIYSRKDFFA  82

Query  1227  KVMLPSA---DDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSK  1057
             KV L  A     Y+V  ++YAT+ + VPE+FLL   SRE W +ESNW GYVAVT D  + 
Sbjct  83    KVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWXGYVAVTDDQGTA  142

Query  1056  ALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
              LGRR+I V +RG+   LEW+  F    V+A  +                    ++  GW
Sbjct  143   LLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQV------------QIHQGW  190

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLC  697
             +++Y S+D  S FT  +AR+Q+  ++  L  KYK E +SIT+ GHSLGA+LA L+A D+ 
Sbjct  191   YSIYXSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIV  250

Query  696   ENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              NG            PVTA VF SP++G+  F KL +   ++++L  RN  D+IP YP  
Sbjct  251   ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP--  308

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGE--FELKVKRCV  367
              +GY + G EF ID RKS   K+  N + +H L+  LH VAG  G +    F L V+R +
Sbjct  309   PIGYSEVGDEFPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAI  368

Query  366   ALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
              LVNKS + LK+E  +PG W + KNK     ++G W L
Sbjct  369   GLVNKSVDGLKDECXVPGKWRVLKNKGXAQQDDGSWEL  406



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   288 bits (737),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 166/402 (41%), Positives = 232/402 (58%), Gaps = 23/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+ LLDPL+L LR  I+  GD  +  Y +FN D  SKY G   Y K   F 
Sbjct  18    WKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEELFA  77

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +     A+   Y+V  ++Y T+ + +PE F++ S SRE+W++ESNW+GY+AV +D   + 
Sbjct  78    RTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRL  137

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW N F     SAE +   +T  D           P+V  GW 
Sbjct  138   LGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDP----------PRVANGWL  187

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             +LYTS DP SRF   SAREQ+Q ++  L   YK E ++ITLTGHSLGA L+IL+A D   
Sbjct  188   SLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLH  247

Query  693   NGVTDIP---------VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             N +  I          VT    GSP+IG++ F +L+    +L IL + N  D+IP YP  
Sbjct  248   NELPKIRPSLQHRLTCVTVFALGSPRIGDRSFKRLVESLQHLHILRVTNVPDLIPRYP--  305

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             +  +   G E  I+  KS  LK S+N   +HNL+A LH VAG     GEF+L++KR +AL
Sbjct  306   VFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDIAL  365

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             VNK  + L+++  +PG WW+ +NK MV  ++G W L    D+
Sbjct  366   VNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKLNGDRDK  407



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/410 (39%), Positives = 238/410 (58%), Gaps = 24/410 (6%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W +L G   WEGLL+PL++ LR  I++ G+    TYD+F  +  SKYAG+ RY
Sbjct  3     SMAEK--WEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F K  L     Y+V  Y YAT+ + +P+AF+  S SRE+W +ESN++GY+AV +D
Sbjct  61    SMENLFSKAGL-DPTKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                 +LGRR+I + +RGT   LEW+N      +    +                   P V
Sbjct  120   EGKASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGG--------LLPLFKPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YTS+   S++   SAR+Q+  +++ L  +YK + +SIT+ GHSLGASLA L A
Sbjct  172   HHGFYNVYTSESARSKYNQASARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NG+       + PVTA VF SP++G+  F   + +  +L I+ I N +D++ +YP
Sbjct  232   VDIAYNGINKTSSGKEFPVTAFVFASPKVGDLNFVNAVNKLEHLHIMRIHNLLDIVSKYP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLK-NSMNPSDWHNLQAMLHVVAGWNG---EDGEFELKV  379
                +GY   G E +ID  KS  LK N  +P   HNL+  LH + G  G    DG F+L+V
Sbjct  292   P--IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDG-FKLEV  348

Query  378   KRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              R ++LVN+  + LK+E  +PG+WW+EK+  MV  E+G+W+L    D +L
Sbjct  349   NRDLSLVNRIWDILKDEYLVPGAWWVEKHNGMVQQEDGKWILMDREDYEL  398



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/407 (40%), Positives = 233/407 (57%), Gaps = 29/407 (7%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             TW +L G   W+GLL+PL++ LR  +L  G F QATYD FN +  SKYAG+CRY K  FF
Sbjct  7     TWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSKKDFF  66

Query  1230  HKVMLPSAD--DYQVEAYLYATAQLTVPEAFLLHS-RSRESWDRESNWIGYVAVTSDAVS  1060
              KV L   +   Y V  YLYAT++     AFLL S  S+++W  E+NW+GYVAV +D   
Sbjct  67    SKVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAK  126

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
             +ALGRR+I V +RGT    EW+  F+   +   PL+    S              ++  G
Sbjct  127   EALGRRDIVVAWRGTIQGAEWVQNFNID-LDPAPLIFGPKSDV------------QLHNG  173

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             +++LYTS + +      SAR+Q+  +I  L   YK E +SIT+TGHSLG +LA +++ D+
Sbjct  174   FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  233

Query  699   CENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
               N             PVT   FGSP++GN  F+K+ ++  +L+ L IRN  D++P    
Sbjct  234   VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVPS--S  291

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
               L Y K G E  ID  KS  LK+ ++    HN++  LH +AG  G  G F L+V R +A
Sbjct  292   LRLAYSKVGEELEIDTEKSKYLKSGVSE---HNMEVYLHGIAGTQGSKGGFNLEVNRDIA  348

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDLPV  223
             L+NKS + LK+E  IP +W + +NK MV   +G W L   +++D+ +
Sbjct  349   LLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDDHNDDVLI  395



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/394 (42%), Positives = 220/394 (56%), Gaps = 20/394 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L GS++WEGLLDPL+  LR  ++  G+   ATY++F  +  S  AG CRY +     
Sbjct  28    WRELQGSDHWEGLLDPLDAGLRRCLIAYGEMITATYEAFIGERRSPNAGMCRYRRADLLR  87

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V +     Y    Y+YATA   V    LL    R    RE NW+GYVAV +D  + ALG
Sbjct  88    RVDVSHPGWYAATRYIYATASAEVRGEALLSPLCRHGRARECNWMGYVAVATDEGAAALG  147

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+        SA  +L    +  +D         P V  G+ +L
Sbjct  148   RRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGADGSD---------PSVHRGYLSL  198

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN-  691
             YTS D  S+ +  SAR Q+ T+I  L  KYK E  SIT+ GHSLGA+LA L A D+  N 
Sbjct  199   YTSADEGSKLSKKSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLNAADIVANA  258

Query  690   -----GVTD---IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALL  535
                  G  D    PVTA+VFGSP+ G++ F  +      L++L +RNK D IP YP   +
Sbjct  259   CNKSSGFDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLRGLRMLRVRNKPDRIPHYP--PV  316

Query  534   GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALVN  355
             GY   G+E +ID R+S  LK   N S  H+L+  LH VAGW G+ G FEL V+R VALVN
Sbjct  317   GYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDGGGFELVVERDVALVN  376

Query  354   KSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             K  + L +E  +P  W +  NK+MV   +G WVL
Sbjct  377   KFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVL  410



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 232/408 (57%), Gaps = 21/408 (5%)
 Frame = -1

Query  1428  SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRY  1249
             SMA +  W QL G  NWEGLL+PL+  LR  +++ G+  QATYD+F  +  SK AG+ RY
Sbjct  3     SMAEK--WEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  1248  GKNSFFHKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSD  1069
                + F +V L     Y+V  + YAT+ + +P+ F + S S E+W ++SN++GYVAV +D
Sbjct  61    SLENLFTRVGLDPLK-YRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAVATD  119

Query  1068  AVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKV  889
                  LGRR+I + +RGT   LEW+N F    V A  +                   P V
Sbjct  120   EGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGL--------LPLLQPLV  171

Query  888   MFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAA  709
               G++ +YT+ +P S+F   S R+Q+  +++ L  +YK E +SIT+TGHSLGASLA L A
Sbjct  172   HHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATLNA  231

Query  708   FDLCENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
              D+  NGV       +  VTA  F SP++G+  F     +  +L+ L I N  D++P+ P
Sbjct  232   VDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPKVP  291

Query  546   GALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDG--EFELKVKR  373
                +GY+  G E +ID  KS  +K       WH L+  LH +AG  G  G   F+L+V R
Sbjct  292   P--IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIGLIGFKLEVNR  349

Query  372   CVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
              ++LVNK  + LK+E  IPG WW+EKNK MV  ++G W+L    + D 
Sbjct  350   DISLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREEYDF  397



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/405 (40%), Positives = 235/405 (58%), Gaps = 29/405 (7%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             TW +L G   W+GLL+PL++ LR  +L  G F QATYD+FN +  SKYAG+CRY K  FF
Sbjct  16    TWRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGNCRYSKKDFF  75

Query  1230  HKVMLPSADDYQ--VEAYLYATAQLTVPEAFLLHS-RSRESWDRESNWIGYVAVTSDAVS  1060
              KV L   + Y+  V  YLYAT++ +   AFLL S  S+++W  ESNWIGYVAV +D   
Sbjct  76    SKVYLEEGNPYKYSVTKYLYATSKASDSAAFLLTSIFSKDAWSLESNWIGYVAVATDEAK  135

Query  1059  KALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFG  880
             +ALGRR+I VV+RGT    EW+  F+   +   PL+    S              ++  G
Sbjct  136   EALGRRDIVVVWRGTIQGSEWVQNFNID-LDPAPLIFGPKSNV------------QIHNG  182

Query  879   WHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDL  700
             +++LYTS++        SAR+Q+  +I  L   YK E +SIT+TGHSLG +LA +++ D+
Sbjct  183   FYSLYTSENSGLPSADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDI  242

Query  699   CENGVT--------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPG  544
               N             PVT   FG+P++GN  F K+ ++  +L  L +RN+ D++P+   
Sbjct  243   VANKFNMPKEQPQKACPVTTFAFGAPRVGNSYFQKIFSDHKDLSALFVRNENDIVPK--S  300

Query  543   ALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVA  364
                 Y K G E  ID  +S  LK+ ++    HN++  LH +AG  G  G F L+V R +A
Sbjct  301   LTFFYYKVGEELEIDTEESKYLKSGVSA---HNMEVYLHGIAGTQGSKGGFNLEVNRDIA  357

Query  363   LVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDEDL  229
             L+NKS + LK+E  IP +W + +NK MV   +G W L   +++D+
Sbjct  358   LLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDDHNDDV  402



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 160/413 (39%), Positives = 231/413 (56%), Gaps = 27/413 (7%)
 Frame = -1

Query  1431  QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCR  1252
             +S +    W  L G  +W GLL+PL+L LR  I+  G+  QA YD+FN  + S+YAGS  
Sbjct  37    KSASIAQRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSCTESQYAGSSI  96

Query  1251  YGKNSFFHKVMLPSAD---DYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVA  1081
             Y +  FF KV + + +    YQV  +LYAT++  +P AF++   S + W ++SNWIGYVA
Sbjct  97    YSRQDFFSKVGIVNGNPYCKYQVTKFLYATSEARMPGAFMVFPASGQGWTKQSNWIGYVA  156

Query  1080  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddK  901
             V ++  +  LGRR+I V +RGT    EWI+ F    V    +    +             
Sbjct  157   VATNDGTAVLGRRDIVVAWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPI----------  206

Query  900   VPKVMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLA  721
               KV  GW ++YTS D  S+F  + AR+QL  +I  L   YK E++SIT+ GHSLGA+LA
Sbjct  207   --KVHRGWLSIYTSYDTRSKFNKICARDQLLQEISRLVELYKDEDISITVCGHSLGAALA  264

Query  720   ILAAFDLCENGVTD--------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKID  565
              L+A D+  NG            PVTA  F  P++G   F  L +   NL+ L  +N  D
Sbjct  265   TLSATDIVFNGYNKPKGRPDKACPVTAFPFACPRVGASDFKNLFSGLDNLRALRTKNLPD  324

Query  564   MIPEYPGALLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFEL  385
             ++  YP  ++GY   G E  ID RKS  LK+  N + +H+++  +H VAG +G  GEF L
Sbjct  325   VVCAYP--MVGYSDVGDELAIDTRKSPYLKSPGNVTTFHSMEHYMHGVAGTHGTKGEFRL  382

Query  384   KVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL--GSPNDED  232
             ++ R ++LVNK+ + LK+E  +P  W + KNK MV   +G W L    P+D D
Sbjct  383   EINRDISLVNKNTDSLKDEHMVPDHWRVLKNKGMVQQGDGSWKLMDHEPDDGD  435



>ref|XP_008802654.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 240/411 (58%), Gaps = 43/411 (10%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F++   S+Y GSCRY +  FF 
Sbjct  101   WREIHGRDDWTGLLDPMDPLLRSELIRYGEFAQACYDAFDYQPFSRYCGSCRYNRRQFFA  160

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              + + +AD Y+V  YLYAT+ + +P  F   +R  ++W +++NWIGY+AV+ DA +  LG
Sbjct  161   SLGMDAAD-YEVAHYLYATSNINLPN-FFTTTRGGKTWSQKANWIGYIAVSDDAATARLG  218

Query  1047  RREIYVVFRGTTTDLEWINVFSA--KPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             RR++ + +RGT T LEW+       +PV++E +                    KV  G+ 
Sbjct  219   RRDVVIAWRGTVTRLEWVADLMDFLRPVASEGIPCPDPEV-------------KVESGFI  265

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYK--GENLSITLTGHSLGASLAILAAFDL  700
              LYT KDP+ RF   SAR+Q+ T++  L  ++   GE +SIT+TGHSLG++LA+L+A+D+
Sbjct  266   DLYTDKDPSCRFCKYSARQQVLTEVRRLVEQHTKMGETVSITVTGHSLGSALAMLSAYDI  325

Query  699   CENGVT------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
              E G+        + VT   F  P++GN  F K   E   LK L + N  D +P+ PG L
Sbjct  326   AETGLDVGVDGEKVAVTVFSFSGPRVGNGKF-KERFEGLGLKALRVVNVHDTVPKVPGIL  384

Query  537   LG-----------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWN  409
             +                  Y   G+E  +DH+ S  LK++ + S +HNL+A+LH++ G++
Sbjct  385   VNEHVPELLRKLAEGLPWSYSHVGVELALDHKSSPFLKDTGDRSCFHNLEALLHLIDGYH  444

Query  408   GEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
             G   +F L  KR  ALVNK+C+FLK+ L +P  W  E+NK MV   +G WV
Sbjct  445   GSGQKFYLASKRDPALVNKACDFLKDHLMVPPFWRQEENKGMVRAHDGRWV  495



>gb|KDP21364.1| hypothetical protein JCGZ_21835 [Jatropha curcas]
Length=512

 Score =   288 bits (738),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 164/415 (40%), Positives = 234/415 (56%), Gaps = 54/415 (13%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G  NW GLLDP++  LR  ++R G+  QATYD F  D  S+Y G+CRY    FF 
Sbjct  92    WQEIHGKNNWSGLLDPMDPILRSELIRYGEMTQATYDGFFFDQYSQYCGTCRYMHLEFFQ  151

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             K+ L     Y V  YL+AT+ L  P+ F   S     W   +NWIGYVAV++D  +  LG
Sbjct  152   KLGLDHLG-YYVSRYLFATSTLKFPK-FFRKSVFPTKWSSNANWIGYVAVSNDETTARLG  209

Query  1047  RREIYVVFRGTTTDLEWINVFSA--KPVS------AEPLLRSSTSGdnddkeedddKVPK  892
             RR+I + +RGT T LEW+    +  KP+S       EP +++ +                
Sbjct  210   RRDIVICWRGTVTGLEWLEDLMSFQKPISDYKIQSPEPNVKAES----------------  253

Query  891   VMFGWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILA  712
                G+  LYT KDP+ R+   SAREQ+  +I++L  KY GE LSIT+TGHSLG +LA+L+
Sbjct  254   ---GFLDLYTDKDPSCRYCKFSAREQILAEIKKLTEKYPGEELSITITGHSLGGALAVLS  310

Query  711   AFDLCENGVTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             AFD+ E  +        + V A  F  P++GN  F + M EK  +K+L + N  D++P+ 
Sbjct  311   AFDIAETALQKMEDSKRVKVCAFTFAGPRVGNVRFRERM-EKLGVKVLRVFNVHDVVPKS  369

Query  549   PGALLG-----------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVV  421
             PG LL                  Y   G+E  +DH  S  LK   +  + HNL+A LH++
Sbjct  370   PGLLLNEKLPDAALKVVEGLPWCYTHVGVELALDHTNSPYLKEHASLPNAHNLEAQLHLL  429

Query  420   AGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
              G++G+  +FEL ++R +ALVNKS +FLK+EL +P SW  ++NK MV  +NG WV
Sbjct  430   DGYHGKGTKFELAIERDIALVNKSSDFLKDELLVPPSWKQDENKGMVF-QNGRWV  483



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   285 bits (729),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 166/402 (41%), Positives = 231/402 (57%), Gaps = 23/402 (6%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L G+  W+ LLDPL+L LR  I+  GD  +  Y +FN D  SKY G   Y K   F 
Sbjct  9     WKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKEELFA  68

Query  1227  KVMLPSADD--YQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKA  1054
             +     A+   Y+V  ++Y T+ + +PE F++ S SRE+W++ESNW+GY+AV +D   + 
Sbjct  69    RTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKRL  128

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I V +RGT    EW N F     SAE +   +T  D           P+V  GW 
Sbjct  129   LGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDP----------PRVANGWL  178

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
             +LYTS DP SRF   SAREQ+Q ++  L   YK E ++ITLTGHSLGA L+IL+A D   
Sbjct  179   SLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSAADFLH  238

Query  693   NGVTDIP---------VTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
             N    I          VT   FGSP+IG++ F +L+    +L IL + N  D+IP YP  
Sbjct  239   NEFPKITPSLQQRLSCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIPRYP--  296

Query  540   LLGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVAL  361
             +  +   G E  I+  KS  LK S+N   +HNL+A LH VAG     GEF+L++KR +AL
Sbjct  297   VFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEIKRDIAL  356

Query  360   VNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             VNK  + L+++  +PG  W+ +NK MV  ++G W L    D+
Sbjct  357   VNKGLDALEDKYLVPGHGWVLENKGMVQSDDGTWKLNGDRDK  398



>ref|XP_006446147.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
 gb|ESR59387.1| hypothetical protein CICLE_v10014848mg [Citrus clementina]
Length=535

 Score =   289 bits (739),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 166/427 (39%), Positives = 241/427 (56%), Gaps = 51/427 (12%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  + G  +W+GLLDP+N  LR  I+R G+F QA YDSF+ D +SKY G+C+Y   SFF 
Sbjct  92    WKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYSAASFFK  151

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KAL  1051
             K+ +  +  YQ+  YLYAT+ + +P+ F   SR    W   +NW+GY+AVT+D    K L
Sbjct  152   KLDMADSG-YQISRYLYATSNINLPK-FFQKSRLSSVWSTYANWMGYIAVTTDEEEIKRL  209

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR+I V +RGT T +EWI          + +L ++  G +           K+  G+H 
Sbjct  210   GRRDIVVAWRGTVTYIEWI-------YDLKDILHTANFGSDPSI--------KIELGFHD  254

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             LYT K+ +  + T SAREQ+  +I+ L   Y+GE +SIT TGHSLGA+LAI++A+D+ E 
Sbjct  255   LYTKKEQSCNYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAEL  314

Query  690   GVT------------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             G+              IP+T   F  P++GN  F K   ++  +K+L + N  D +P  P
Sbjct  315   GLNIVNDGESSSSTKKIPITVYSFAGPRVGNLKF-KERCDELGVKVLRVVNVHDKVPTVP  373

Query  546   GALLG------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVV  421
             G L                    Y   G+E  +DH  S  LKN+ +    HNL+A+LH++
Sbjct  374   GILANEKFQFQKHFEEATKFPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLL  433

Query  420   AGWNGEDGEFELK-VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGS-  247
              G+ G++ +F L+  KR +ALVNKSC+FLK E  +P  W  ++NK MV + +G WVL   
Sbjct  434   DGYCGKENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPER  493

Query  246   PNDEDLP  226
             P  E LP
Sbjct  494   PRLEALP  500



>ref|XP_006470637.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic-like [Citrus 
sinensis]
 gb|KDO61218.1| hypothetical protein CISIN_1g009412mg [Citrus sinensis]
Length=535

 Score =   288 bits (738),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 166/427 (39%), Positives = 241/427 (56%), Gaps = 51/427 (12%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W  + G  +W+GLLDP+N  LR  I+R G+F QA YDSF+ D +SKY G+C+Y   SFF 
Sbjct  92    WKAIQGCNDWQGLLDPMNCHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYSAASFFK  151

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KAL  1051
             K+ +  +  YQ+  YLYAT+ + +P+ F   SR    W   +NW+GY+AVT+D    K L
Sbjct  152   KLDMADSG-YQISRYLYATSNINLPK-FFQKSRLSSVWSTYANWMGYIAVTTDEEEIKRL  209

Query  1050  GRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHT  871
             GRR+I V +RGT T +EWI          + +L ++  G +           K+  G+H 
Sbjct  210   GRRDIVVAWRGTVTYIEWI-------YDLKDILHTANFGSDPSI--------KIELGFHD  254

Query  870   LYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN  691
             LYT K+ +  + T SAREQ+  +I+ L   Y+GE +SIT TGHSLGA+LAI++A+D+ E 
Sbjct  255   LYTKKEQSCNYCTFSAREQVLAEIKRLIEYYEGEEISITFTGHSLGAALAIVSAYDVAEL  314

Query  690   GVT------------DIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYP  547
             G+              IP+T   F  P++GN  F K   ++  +K+L + N  D +P  P
Sbjct  315   GLNIVNDGESSSSTKKIPITVYSFAGPRVGNLKF-KERCDELGVKVLRVVNVHDKVPTVP  373

Query  546   GALLG------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVV  421
             G L                    Y   G+E  +DH  S  LKN+ +    HNL+A+LH++
Sbjct  374   GILANEKFQFQKHFEEATKFPWSYAHVGVELALDHTNSPFLKNTKDFGCAHNLEALLHLL  433

Query  420   AGWNGEDGEFELK-VKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGS-  247
              G+ G++ +F L+  KR +ALVNKSC+FLK E  +P  W  ++NK MV + +G WVL   
Sbjct  434   DGYCGKENQFCLETTKRDIALVNKSCDFLKSEYEVPPHWRQDENKGMVRNTDGRWVLPER  493

Query  246   PNDEDLP  226
             P  E LP
Sbjct  494   PRLEALP  500



>ref|XP_010278159.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=525

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/409 (40%), Positives = 232/409 (57%), Gaps = 41/409 (10%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G ++W GLLDP++  LR  ++R GD  QA YD+F+ DS SKY GSCR+ +  FF 
Sbjct  106   WREIQGQDDWAGLLDPMDPLLRSELIRYGDMAQACYDAFDFDSFSKYCGSCRFTRRKFFD  165

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
              + L S   Y V  YLY+TA + +P  F   SR  + W R +NW+GYVAV++D  S  LG
Sbjct  166   CLGLTSLG-YDVSRYLYSTANINLPN-FFKKSRWPKVWSRNANWMGYVAVSNDDTSARLG  223

Query  1047  RREIYVVFRGTTTDLEWINVFSA--KPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             RR+I V +RGT T LEW+       +PVSA+ +     +              KV  G+ 
Sbjct  224   RRDIAVAWRGTVTRLEWVADLMDFLRPVSADKIPCPDPNA-------------KVESGFL  270

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              LYT KD   RF   SAREQ+ T+I+    +Y  E LSIT+TGHSLG++LAIL+A+D+ E
Sbjct  271   DLYTDKDDKCRFCKFSAREQVLTEIKRSIQQYPNEELSITVTGHSLGSALAILSAYDIEE  330

Query  693   NGVTD------IPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG  532
              G+        IPVT   F  P++GN  F K   E   +K+L + N  D +P+ PG +  
Sbjct  331   TGLNVTADGRIIPVTVFSFSGPRVGNVRF-KERVEGLGVKVLRVFNVHDSVPKVPGIVFN  389

Query  531   -----------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGE  403
                              Y   G+E  +DH+KS  L ++ +P  +HNL+A+LH++ G++G+
Sbjct  390   EHVPEMVQKMLEWLPWNYSHVGVELCLDHKKSPFLNDTSDPGCFHNLEALLHLIDGYHGK  449

Query  402   DGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
                F L  +R  ALVNK+ +FLK+   +P  W   +NK MV ++ G WV
Sbjct  450   GQRFVLSSRRDPALVNKASDFLKDHYLVPPYWRQHENKGMVRNQEGRWV  498



>ref|XP_004962195.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Setaria italica]
Length=583

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/411 (37%), Positives = 232/411 (56%), Gaps = 40/411 (10%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F++D +S+Y GSC+Y +  FF 
Sbjct  114   WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  1227  KVMLP-SADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKAL  1051
             ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV+ D  S  L
Sbjct  174   RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDEESARL  233

Query  1050  GRREIYVVFRGTTTDLEWINVFSA--KPVSAEPLLRSSTSGdnddkeedddKVPKVMFGW  877
             GRR+I + +RGT T LEW++      +PV+ E +                    KV+ G+
Sbjct  234   GRRDIAIAWRGTVTRLEWVSDLMDFLRPVADEGIPCPDPEV-------------KVLAGF  280

Query  876   HTLYTSKDPNSRFTTLSAREQLQTKIEELRSKY--KGENLSITLTGHSLGASLAILAAFD  703
               LYT KDP  RF   SAREQ+  ++  L ++Y  +GE++SIT+TGHSLG++LA+L+A+D
Sbjct  281   ADLYTDKDPTCRFCKYSAREQVLMEVRRLVARYAARGEDVSITVTGHSLGSALAMLSAYD  340

Query  702   LCENGVTDI--PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGALLG-  532
             + E+G      PV    F  P++GN  F +    +  ++ L + N  D +   PG LL  
Sbjct  341   IAESGANRAVAPVCVYSFAGPRVGNAAFKRRFESELGVRALRVVNVHDNVTRMPGILLNE  400

Query  531   -------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWN  409
                                Y   G+E  +DH++S  LK++M+P+ +H+L+A LH++ G++
Sbjct  401   GAPEAVRRVAERLLRVPWCYTHVGVELALDHKRSPFLKDTMDPACYHDLEAHLHLIDGYH  460

Query  408   GEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWV  256
             G    F L   R  ALVNK+C+FLK+   +P  W  ++NK MV   +G WV
Sbjct  461   GRGERFVLASGRDPALVNKACDFLKDHHGVPPCWRQDENKGMVRGRDGRWV  511



>ref|XP_011032046.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Populus euphratica]
Length=508

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/417 (38%), Positives = 233/417 (56%), Gaps = 53/417 (13%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W ++ G  +WEGLLDP+N  LR  I+R G+F QA+YDSF+ D +SKY GSC+Y    FF 
Sbjct  80    WKEIQGCNDWEGLLDPMNSHLRKEIIRYGEFAQASYDSFDFDPHSKYCGSCKYRGAQFFE  139

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KAL  1051
             K+ +     YQ+  YLYAT+ + +P  F   S+    W   +NW+GYVAVT++    K L
Sbjct  140   KLDMQGHVKYQISRYLYATSNINLPN-FFQKSKLSRVWSTHANWMGYVAVTTNEEEIKRL  198

Query  1050  GRREIYVVFRGTTTDLEWI----NVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMF  883
             GRR+I V +RGT T LEWI    ++      + +P +                   K+  
Sbjct  199   GRRDIVVAWRGTVTYLEWIYDLKDILCVANFTNDPSI-------------------KIEL  239

Query  882   GWHTLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFD  703
             G++ LYT K+ + ++ T SAREQ+  +I+ L   Y+GE +SIT+TGHSLGA+LA L+A+D
Sbjct  240   GFYDLYTKKENSCKYCTFSAREQVLAEIKRLLDYYRGEEISITITGHSLGAALATLSAYD  299

Query  702   LCENGV---------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
             + E  +         T IP+T   F  P++GN  F K   ++  +K+L + N  DM+P  
Sbjct  300   IAEMRLNYMDDGEYRTKIPITVYSFSGPRVGNLKF-KERCDELGVKVLRVINVHDMVPNV  358

Query  549   PGALLG------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHV  424
             PG +                    Y   G+E  +DH  S  LK + +    HNL+A LH+
Sbjct  359   PGMIANEKLQFQRYIEDNMSFPWSYAHVGVELALDHTHSPFLKPTKDLGCAHNLEAHLHL  418

Query  423   VAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             V G++G+   F L  KR +ALVNKSC+FL+ E  +P  W  ++NK MV + +G W+L
Sbjct  419   VDGYHGKGQRFCLATKRDIALVNKSCDFLRREYGVPPYWRQDENKGMVRNADGRWIL  475



>ref|XP_008227339.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Prunus mume]
Length=517

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/417 (40%), Positives = 235/417 (56%), Gaps = 50/417 (12%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDP-LNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
             W ++ G  NWEGLLDP LN  LR  I+R G+F QA YDSF+ D +SKY G+C+Y    FF
Sbjct  88    WKEIQGLNNWEGLLDPTLNSHLRQEIIRYGEFAQACYDSFDFDPHSKYCGTCKYQGARFF  147

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KA  1054
               + + +   YQ+  YLYAT+ + +P  F   S+    W R +NW+G+VAV +D    K 
Sbjct  148   ENLDM-ADRGYQISRYLYATSNINLPN-FFQKSKLGSVWSRHANWMGFVAVATDPYQIKR  205

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT T LEWI  +  K +      R+  S              K+  G++
Sbjct  206   LGRRDIVIAWRGTVTYLEWI--YDLKDILHPAQFRNDPSI-------------KIESGFY  250

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCE  694
              LYT K+   RF + SAREQL  +++ LR  Y+GE +SIT+TGHSLGA+LAIL+A+D+ E
Sbjct  251   DLYTKKEDECRFCSFSAREQLLAEVKRLRELYQGEEISITITGHSLGAALAILSAYDIAE  310

Query  693   NGV------------TDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEY  550
              G+            T IP+T   F  P++GN  F K   +K  +K+L + N  D +P  
Sbjct  311   MGLNIVHEGHHELESTKIPITVYSFSGPRVGNLRF-KERCDKLGVKVLRVVNVHDKVPRV  369

Query  549   PGALLG------------------YVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHV  424
             PG +                    Y   G+E  +DH +S  LK + +    HNL+A LH+
Sbjct  370   PGIITNEKFRFQKYIEDTIAFPWSYAHVGVELELDHNQSPFLKPTNDFGCAHNLEAHLHL  429

Query  423   VAGWNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             V G++G+  +F L  KR +ALVNKSC+FL+ E  +P  W  ++NK MV  ++G WVL
Sbjct  430   VDGYHGKGQKFCLVTKRDIALVNKSCDFLRAEYGVPPHWRQDENKGMVRSKDGRWVL  486



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/395 (42%), Positives = 218/395 (55%), Gaps = 21/395 (5%)
 Frame = -1

Query  1407  WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFFH  1228
             W +L GS +W+GLLDPL++ LR  ++  G+   ATY++F  +  S  AG CRY +   F 
Sbjct  5     WRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRADLFR  64

Query  1227  KVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVSKALG  1048
             +V +     Y    Y+YATA   V    LL    RE    E NW+GYVAV +D  + ALG
Sbjct  65    RVDVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAVATDEGAAALG  124

Query  1047  RREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWHTL  868
             RR+I V +RGT   LEW+      P SA  +L    +   D         P V  G+ +L
Sbjct  125   RRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTD---------PSVHRGYLSL  175

Query  867   YTSKDPNSRFTTLSAREQLQTKIEELRSKYKGENLSITLTGHSLGASLAILAAFDLCEN-  691
             YTS+D  S     SAR Q+ T+I  L  KYK E  SIT+ GHSLGA+LA L A D+  N 
Sbjct  176   YTSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLNAADIAANS  235

Query  690   ---------GVTDIPVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGAL  538
                      G T  PVTA+VFGSP+ G++ F        +L++L +RN+ D IP YP   
Sbjct  236   YNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDRIPHYP--P  293

Query  537   LGYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAGWNGEDGEFELKVKRCVALV  358
             +GY   G+E +ID R S  L+   + S  H+L+  LH VAGW+G+   FEL V R VALV
Sbjct  294   VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDHRGFELVVDRDVALV  353

Query  357   NKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVL  253
             NK  + L +E  +P  W +  NKSMV   +G WVL
Sbjct  354   NKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  388



>ref|XP_010544180.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Tarenaya 
hassleriana]
Length=525

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/426 (38%), Positives = 238/426 (56%), Gaps = 45/426 (11%)
 Frame = -1

Query  1410  TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNHDSNSKYAGSCRYGKNSFF  1231
              W ++ G  +WEGLLDP+N  LR  I+R G+F QA YDSF+ D +SKY GSC+Y  + FF
Sbjct  101   VWREIQGCNSWEGLLDPMNSHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPSDFF  160

Query  1230  HKVMLPSADDYQVEAYLYATAQLTVPEAFLLHSRSRESWDRESNWIGYVAVTSDAVS-KA  1054
              ++ L +   Y +  YLYAT+ + +P+ F   S+    W + +NW+GYVAV +D    K 
Sbjct  161   ARLDLATHKAYTITRYLYATSNINLPK-FFQKSKLSSVWSKHANWMGYVAVVTDEEEVKR  219

Query  1053  LGRREIYVVFRGTTTDLEWINVFSAKPVSAEPLLRSSTSGdnddkeedddKVPKVMFGWH  874
             LGRR+I + +RGT T LEWI  +  K +   P      S              K+  G+H
Sbjct  220   LGRRDIVIAWRGTVTYLEWI--YDLKDILYPPNFSEDPSI-------------KIECGFH  264

Query  873   TLYTSKDPNSRFTTLSAREQLQTKIEELRSKYKGE--NLSITLTGHSLGASLAILAAFDL  700
              LYT K+ + +F++ SAREQ+  +++ L   Y  E  ++SIT+TGHSLGA+LA+++A+D+
Sbjct  265   DLYTKKEDSCKFSSFSAREQVLAEVKRLLDYYGREEHDISITITGHSLGAALALVSAYDI  324

Query  699   CENGVTDI-------PVTAIVFGSPQIGNKLFDKLMTEKTNLKILHIRNKIDMIPEYPGA  541
              E  +  I       P++   F  P++GN  F K   E+  +K+L + N  D +P  PG 
Sbjct  325   AELNINRIPENSYQVPISVFSFSGPRVGNLKF-KERCEELGIKVLRVVNVHDKVPTVPGI  383

Query  540   LL------------------GYVKSGLEFVIDHRKSTSLKNSMNPSDWHNLQAMLHVVAG  415
                                  Y   G+E  +DH KS  LK + +    H+L+A+LH+V G
Sbjct  384   FANEKSQFQKYIEETTSFPWSYAHVGVELALDHTKSPFLKPTKDLGCAHSLEALLHLVDG  443

Query  414   WNGEDGEFELKVKRCVALVNKSCEFLKEELFIPGSWWIEKNKSMVLDENGEWVLGSPNDE  235
             ++GE G F L+ KR VALVNKSC+FLK E  +P  W  ++NK MV +  G WVL      
Sbjct  444   FHGEGGRFHLETKRDVALVNKSCDFLKSEYGVPPCWRQDENKGMVRNGEGRWVLSERARP  503

Query  234   DLPVPE  217
             +  +PE
Sbjct  504   EAHLPE  509



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4298553847740