BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24792_g2_i2 len=1250 path=[1:0-70 72:71-123 125:124-144 146:145-284
286:285-339 341:340-495 497:496-498 500:499-540 4247:541-560
562:561-639 641:640-698 700:699-735 737:736-806 808:807-864
866:865-930 932:931-949 951:950-1249]

Length=1250
                                                                      Score     E

ref|XP_009595413.1|  PREDICTED: bifunctional monodehydroascorbate...    302   1e-96   
ref|XP_009782909.1|  PREDICTED: bifunctional monodehydroascorbate...    302   1e-96   
ref|XP_009621603.1|  PREDICTED: alpha carbonic anhydrase 7              291   3e-92   
ref|XP_011090098.1|  PREDICTED: alpha carbonic anhydrase 7              288   3e-91   
ref|XP_009776894.1|  PREDICTED: bifunctional monodehydroascorbate...    288   3e-91   
ref|XP_006340169.1|  PREDICTED: bifunctional monodehydroascorbate...    284   1e-89   
ref|XP_006340168.1|  PREDICTED: bifunctional monodehydroascorbate...    283   3e-89   
ref|XP_004251153.1|  PREDICTED: alpha carbonic anhydrase 7              283   4e-89   
emb|CDP11563.1|  unnamed protein product                                275   5e-86   
sp|Q84UV8.1|NEC3_NICLS  RecName: Full=Bifunctional monodehydroasc...    272   6e-85   Nicotiana langsdorffii x Nicotiana sanderae
emb|CDP07086.1|  unnamed protein product                                271   3e-84   
ref|XP_006424533.1|  hypothetical protein CICLE_v10029790mg             268   3e-83   
ref|XP_011090042.1|  PREDICTED: alpha carbonic anhydrase 7-like         267   6e-83   
gb|KDO73356.1|  hypothetical protein CISIN_1g039445mg                   266   2e-82   
ref|XP_004139554.1|  PREDICTED: bifunctional monodehydroascorbate...    266   2e-82   
ref|XP_004160913.1|  PREDICTED: bifunctional monodehydroascorbate...    265   2e-82   
ref|XP_006488639.1|  PREDICTED: bifunctional monodehydroascorbate...    265   3e-82   
ref|XP_006424534.1|  hypothetical protein CICLE_v10030314mg             263   3e-81   
ref|XP_008464591.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    262   4e-81   
gb|KDO73355.1|  hypothetical protein CISIN_1g046862mg                   261   1e-80   
ref|XP_006488640.1|  PREDICTED: bifunctional monodehydroascorbate...    261   1e-80   
ref|XP_003541987.1|  PREDICTED: bifunctional monodehydroascorbate...    260   4e-80   
ref|XP_006384924.1|  hypothetical protein POPTR_0004s22280g             259   6e-80   
ref|XP_007016796.1|  Alpha carbonic anhydrase 7                         259   1e-79   
gb|KDP44024.1|  hypothetical protein JCGZ_05491                         258   1e-79   
ref|XP_008359452.1|  PREDICTED: bifunctional monodehydroascorbate...    257   5e-79   
ref|XP_004242097.1|  PREDICTED: bifunctional monodehydroascorbate...    256   1e-78   
ref|XP_004293093.1|  PREDICTED: bifunctional monodehydroascorbate...    263   1e-78   
ref|XP_009367040.1|  PREDICTED: alpha carbonic anhydrase 7-like         256   1e-78   
ref|XP_004506042.1|  PREDICTED: bifunctional monodehydroascorbate...    256   1e-78   
ref|XP_011040911.1|  PREDICTED: alpha carbonic anhydrase 7-like         255   2e-78   
gb|KHG27075.1|  Bifunctional monodehydroascorbate reductase and c...    254   4e-78   
ref|XP_011044411.1|  PREDICTED: alpha carbonic anhydrase 7-like         254   4e-78   
ref|XP_010043780.1|  PREDICTED: alpha carbonic anhydrase 7-like         254   7e-78   
ref|XP_009391366.1|  PREDICTED: alpha carbonic anhydrase 7-like         253   1e-77   
ref|XP_006365755.1|  PREDICTED: bifunctional monodehydroascorbate...    253   2e-77   
ref|XP_008810946.1|  PREDICTED: alpha carbonic anhydrase 7-like         253   2e-77   
gb|KDP44023.1|  hypothetical protein JCGZ_05490                         252   3e-77   
ref|XP_009399717.1|  PREDICTED: alpha carbonic anhydrase 7-like         252   3e-77   
ref|XP_002529418.1|  carbonic anhydrase, putative                       251   6e-77   Ricinus communis
gb|KEH16352.1|  eukaryotic-type carbonic anhydrase                      251   1e-76   
ref|XP_010458032.1|  PREDICTED: alpha carbonic anhydrase 7              250   2e-76   
ref|XP_010488326.1|  PREDICTED: alpha carbonic anhydrase 7              250   3e-76   
ref|XP_002282495.2|  PREDICTED: alpha carbonic anhydrase 7              249   4e-76   Vitis vinifera
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                         249   4e-76   
ref|XP_003539200.1|  PREDICTED: bifunctional monodehydroascorbate...    249   6e-76   
ref|XP_010046439.1|  PREDICTED: alpha carbonic anhydrase 7-like         248   1e-75   
ref|XP_004506040.1|  PREDICTED: bifunctional monodehydroascorbate...    249   1e-75   
ref|XP_006473002.1|  PREDICTED: bifunctional monodehydroascorbate...    248   2e-75   
ref|XP_010109499.1|  hypothetical protein L484_007519                   247   5e-75   
gb|KDO81077.1|  hypothetical protein CISIN_1g038655mg                   246   5e-75   
ref|XP_008802055.1|  PREDICTED: alpha carbonic anhydrase 7-like         246   5e-75   
ref|XP_006303231.1|  hypothetical protein CARUB_v10012300mg             246   5e-75   
ref|XP_010475599.1|  PREDICTED: alpha carbonic anhydrase 7-like         246   6e-75   
gb|KHN38743.1|  Bifunctional monodehydroascorbate reductase and c...    246   7e-75   
ref|XP_008462774.1|  PREDICTED: bifunctional monodehydroascorbate...    246   9e-75   
ref|XP_006409842.1|  hypothetical protein EUTSA_v10017075mg             246   9e-75   
ref|XP_002529419.1|  carbonic anhydrase, putative                       246   1e-74   Ricinus communis
ref|XP_002892434.1|  carbonic anhydrase family protein                  245   1e-74   
gb|KGN64825.1|  hypothetical protein Csa_1G120410                       244   1e-74   
ref|XP_009356885.1|  PREDICTED: alpha carbonic anhydrase 7-like         245   2e-74   
ref|XP_006433902.1|  hypothetical protein CICLE_v10003227mg             244   3e-74   
ref|XP_008462808.1|  PREDICTED: bifunctional monodehydroascorbate...    244   4e-74   
ref|XP_006417733.1|  hypothetical protein EUTSA_v10008451mg             244   5e-74   
ref|XP_008462825.1|  PREDICTED: bifunctional monodehydroascorbate...    244   6e-74   
gb|KGN64826.1|  hypothetical protein Csa_1G120420                       244   6e-74   
ref|XP_004139553.1|  PREDICTED: bifunctional monodehydroascorbate...    244   6e-74   
ref|XP_007150177.1|  hypothetical protein PHAVU_005G133000g             243   7e-74   
ref|XP_008385339.1|  PREDICTED: bifunctional monodehydroascorbate...    243   8e-74   
ref|XP_010414580.1|  PREDICTED: alpha carbonic anhydrase 2-like         243   9e-74   
ref|XP_009795833.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    242   9e-74   
ref|XP_010916592.1|  PREDICTED: alpha carbonic anhydrase 7-like         243   2e-73   
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like         241   4e-73   
ref|XP_009400916.1|  PREDICTED: alpha carbonic anhydrase 7-like         242   5e-73   
ref|XP_008226047.1|  PREDICTED: bifunctional monodehydroascorbate...    241   5e-73   
ref|XP_009132759.1|  PREDICTED: alpha carbonic anhydrase 2-like         241   6e-73   
ref|XP_009113037.1|  PREDICTED: alpha carbonic anhydrase 2-like         241   8e-73   
ref|XP_009148224.1|  PREDICTED: alpha carbonic anhydrase 7-like         241   9e-73   
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like         241   9e-73   
emb|CDX95095.1|  BnaC05g05760D                                          240   1e-72   
ref|XP_006594167.1|  PREDICTED: bifunctional monodehydroascorbate...    241   1e-72   
gb|KFK43125.1|  hypothetical protein AALP_AA1G083600                    240   1e-72   
ref|XP_007206520.1|  hypothetical protein PRUPE_ppa019410mg             240   2e-72   
ref|NP_172287.1|  alpha carbonic anhydrase 7                            240   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45963.1|  BnaA09g13030D                                          240   2e-72   
emb|CDY45480.1|  BnaC09g12980D                                          239   3e-72   
ref|XP_009103655.1|  PREDICTED: alpha carbonic anhydrase 2              239   3e-72   
ref|XP_010450977.1|  PREDICTED: alpha carbonic anhydrase 8              241   4e-72   
ref|XP_010470128.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    239   4e-72   
ref|XP_004241280.1|  PREDICTED: bifunctional monodehydroascorbate...    239   5e-72   
ref|XP_008462835.1|  PREDICTED: bifunctional monodehydroascorbate...    238   6e-72   
ref|XP_004139442.1|  PREDICTED: bifunctional monodehydroascorbate...    239   7e-72   
gb|KHN39018.1|  Bifunctional monodehydroascorbate reductase and c...    239   7e-72   
ref|XP_007144378.1|  hypothetical protein PHAVU_007G151300g             239   7e-72   
ref|XP_006845947.1|  hypothetical protein AMTR_s00157p00092470          238   7e-72   
ref|XP_002314288.2|  hypothetical protein POPTR_0009s01540g             238   8e-72   Populus trichocarpa [western balsam poplar]
ref|XP_009148066.1|  PREDICTED: alpha carbonic anhydrase 7-like         238   8e-72   
ref|XP_004242096.1|  PREDICTED: bifunctional monodehydroascorbate...    238   9e-72   
emb|CDY04545.1|  BnaA07g13710D                                          238   1e-71   
gb|KHN48240.1|  Bifunctional monodehydroascorbate reductase and c...    238   2e-71   
gb|KFK32339.1|  hypothetical protein AALP_AA6G228800                    237   2e-71   
ref|XP_008227262.1|  PREDICTED: bifunctional monodehydroascorbate...    237   2e-71   
ref|XP_004160914.1|  PREDICTED: bifunctional monodehydroascorbate...    237   3e-71   
ref|XP_010443286.1|  PREDICTED: alpha carbonic anhydrase 8-like         239   3e-71   
ref|XP_003535188.1|  PREDICTED: bifunctional monodehydroascorbate...    236   5e-71   
ref|XP_004166480.1|  PREDICTED: bifunctional monodehydroascorbate...    235   6e-71   
emb|CDY23976.1|  BnaC03g17150D                                          236   8e-71   
ref|XP_010916593.1|  PREDICTED: alpha carbonic anhydrase 7-like         235   1e-70   
ref|XP_003538184.1|  PREDICTED: bifunctional monodehydroascorbate...    236   1e-70   
ref|XP_004139552.1|  PREDICTED: bifunctional monodehydroascorbate...    234   1e-70   
ref|XP_008462817.1|  PREDICTED: bifunctional monodehydroascorbate...    235   2e-70   
ref|XP_010510673.1|  PREDICTED: alpha carbonic anhydrase 2-like         234   2e-70   
ref|XP_009380700.1|  PREDICTED: alpha carbonic anhydrase 7-like         234   3e-70   
gb|KFK43123.1|  hypothetical protein AALP_AA1G083400                    234   5e-70   
sp|Q9FM99.2|ATCA8_ARATH  RecName: Full=Alpha carbonic anhydrase 8...    234   6e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93595.1|  BnaA06g04530D                                          233   7e-70   
emb|CDX95097.1|  BnaC05g05740D                                          233   1e-69   
gb|AFK36418.1|  unknown                                                 233   1e-69   
ref|XP_010696305.1|  PREDICTED: alpha carbonic anhydrase 7-like         232   2e-69   
ref|XP_004515925.1|  PREDICTED: bifunctional monodehydroascorbate...    232   2e-69   
emb|CDX93593.1|  BnaA06g04550D                                          240   2e-69   
gb|KEH42156.1|  eukaryotic-type carbonic anhydrase                      231   1e-68   
ref|XP_006304810.1|  hypothetical protein CARUB_v10012428mg             230   1e-68   
ref|XP_008778933.1|  PREDICTED: alpha carbonic anhydrase 7-like         230   1e-68   
ref|XP_010050537.1|  PREDICTED: alpha carbonic anhydrase 7-like         230   1e-68   
gb|KEH42158.1|  eukaryotic-type carbonic anhydrase                      230   2e-68   
gb|AAD29832.1|  putative carbonic anhydrase                             229   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148063.1|  PREDICTED: alpha carbonic anhydrase 5              229   2e-68   
ref|XP_008810960.1|  PREDICTED: alpha carbonic anhydrase 7-like         229   3e-68   
gb|AFK33933.1|  unknown                                                 229   3e-68   
ref|XP_002445622.1|  hypothetical protein SORBIDRAFT_07g022860          229   3e-68   Sorghum bicolor [broomcorn]
ref|XP_010098808.1|  hypothetical protein L484_022573                   228   6e-68   
ref|XP_010050504.1|  PREDICTED: alpha carbonic anhydrase 7-like         228   6e-68   
dbj|BAD09854.1|  putative dioscorin class A precursor                   228   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011094588.1|  PREDICTED: alpha carbonic anhydrase 7-like         228   1e-67   
ref|XP_008362138.1|  PREDICTED: bifunctional monodehydroascorbate...    228   1e-67   
ref|XP_010458030.1|  PREDICTED: alpha carbonic anhydrase 5              227   2e-67   
ref|XP_003537009.2|  PREDICTED: bifunctional monodehydroascorbate...    227   4e-67   
ref|XP_010510674.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    226   4e-67   
gb|KHN39017.1|  Bifunctional monodehydroascorbate reductase and c...    227   5e-67   
ref|XP_004973661.1|  PREDICTED: bifunctional monodehydroascorbate...    226   6e-67   
ref|XP_010470127.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    226   7e-67   
ref|XP_010475597.1|  PREDICTED: alpha carbonic anhydrase 5-like         226   7e-67   
ref|XP_002892432.1|  carbonate dehydratase/ zinc ion binding protein    225   8e-67   
ref|XP_011077301.1|  PREDICTED: alpha carbonic anhydrase 7-like         225   1e-66   
ref|XP_006401345.1|  hypothetical protein EUTSA_v10014359mg             225   1e-66   
ref|XP_010109502.1|  hypothetical protein L484_007522                   225   1e-66   
ref|XP_010262876.1|  PREDICTED: alpha carbonic anhydrase 7-like         225   2e-66   
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like         224   2e-66   
ref|XP_010696309.1|  PREDICTED: alpha carbonic anhydrase 7-like         225   2e-66   
ref|XP_006659489.1|  PREDICTED: bifunctional monodehydroascorbate...    224   2e-66   
ref|XP_010241820.1|  PREDICTED: alpha carbonic anhydrase 7-like         223   6e-66   
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g             223   7e-66   
ref|XP_008227264.1|  PREDICTED: bifunctional monodehydroascorbate...    223   9e-66   
tpg|DAA48425.1|  TPA: carbonic anhydrase                                223   1e-65   
emb|CDX84811.1|  BnaA03g14190D                                          221   1e-65   
ref|NP_001149032.1|  carbonic anhydrase precursor                       223   1e-65   Zea mays [maize]
ref|XP_010510675.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    221   1e-65   
ref|XP_010488317.1|  PREDICTED: alpha carbonic anhydrase 5              222   1e-65   
gb|ABK22387.1|  unknown                                                 222   2e-65   Picea sitchensis
ref|XP_008227274.1|  PREDICTED: bifunctional monodehydroascorbate...    222   2e-65   
ref|XP_007213463.1|  hypothetical protein PRUPE_ppa024299mg             222   2e-65   
gb|KGN59000.1|  hypothetical protein Csa_3G742880                       222   2e-65   
ref|XP_004249474.1|  PREDICTED: alpha carbonic anhydrase 7-like         221   2e-65   
ref|XP_008442725.1|  PREDICTED: bifunctional monodehydroascorbate...    221   3e-65   
gb|AAF79837.1|AC026875_17  T6D22.16                                     221   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241384.1|  PREDICTED: bifunctional monodehydroascorbate...    221   4e-65   
ref|XP_002268233.1|  PREDICTED: alpha carbonic anhydrase 7              221   5e-65   Vitis vinifera
gb|KDP26093.1|  hypothetical protein JCGZ_21126                         221   5e-65   
ref|XP_007132283.1|  hypothetical protein PHAVU_011G081900g             221   6e-65   
ref|NP_172285.2|  alpha carbonic anhydrase 5                            220   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147028.1|  carbonic anhydrase precursor                       220   9e-65   Zea mays [maize]
gb|EMT00558.1|  Bifunctional monodehydroascorbate reductase and c...    220   1e-64   
ref|XP_002445625.1|  hypothetical protein SORBIDRAFT_07g022890          220   1e-64   Sorghum bicolor [broomcorn]
ref|XP_004143278.1|  PREDICTED: bifunctional monodehydroascorbate...    220   1e-64   
ref|XP_010267256.1|  PREDICTED: alpha carbonic anhydrase 7-like         220   1e-64   
ref|XP_006339092.1|  PREDICTED: bifunctional monodehydroascorbate...    219   2e-64   
gb|EYU41598.1|  hypothetical protein MIMGU_mgv1a011586mg                219   2e-64   
gb|ADW27480.1|  carbonic anhydrase                                      219   2e-64   
ref|XP_004973662.1|  PREDICTED: bifunctional monodehydroascorbate...    219   3e-64   
ref|XP_002519458.1|  carbonic anhydrase, putative                       218   4e-64   Ricinus communis
ref|XP_010696308.1|  PREDICTED: alpha carbonic anhydrase 7-like         218   6e-64   
emb|CDX94018.1|  BnaC07g36520D                                          217   1e-63   
ref|XP_007203913.1|  hypothetical protein PRUPE_ppa016859mg             219   1e-63   
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like         218   2e-63   
gb|KCW89335.1|  hypothetical protein EUGRSUZ_A01626                     216   2e-63   
ref|XP_008462491.1|  PREDICTED: bifunctional monodehydroascorbate...    217   2e-63   
ref|XP_004168624.1|  PREDICTED: bifunctional monodehydroascorbate...    216   2e-63   
ref|XP_010036662.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    216   3e-63   
ref|XP_003574630.1|  PREDICTED: alpha carbonic anhydrase 7-like         216   3e-63   
ref|XP_008664513.1|  PREDICTED: bifunctional monodehydroascorbate...    217   3e-63   
ref|XP_002529417.1|  carbonic anhydrase, putative                       214   6e-63   Ricinus communis
ref|XP_009775004.1|  PREDICTED: alpha carbonic anhydrase 7-like         215   6e-63   
ref|XP_008464600.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    215   7e-63   
ref|XP_002445628.1|  hypothetical protein SORBIDRAFT_07g022910          215   7e-63   Sorghum bicolor [broomcorn]
gb|EYU38572.1|  hypothetical protein MIMGU_mgv1a011717mg                215   9e-63   
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...    215   1e-62   
ref|XP_004973745.1|  PREDICTED: bifunctional monodehydroascorbate...    215   1e-62   
ref|XP_010279581.1|  PREDICTED: alpha carbonic anhydrase 4-like         214   2e-62   
ref|XP_006417731.1|  hypothetical protein EUTSA_v10009315mg             213   2e-62   
ref|XP_007144381.1|  hypothetical protein PHAVU_007G151500g             214   3e-62   
ref|XP_010322405.1|  PREDICTED: bifunctional monodehydroascorbate...    213   3e-62   
ref|XP_007144380.1|  hypothetical protein PHAVU_007G151500g             213   4e-62   
ref|XP_010050530.1|  PREDICTED: alpha carbonic anhydrase 7-like         213   4e-62   
gb|KHG29611.1|  Bifunctional monodehydroascorbate reductase and c...    213   4e-62   
ref|XP_009592985.1|  PREDICTED: alpha carbonic anhydrase 7-like         213   6e-62   
emb|CAM59682.1|  a-type carbonic anhydrase                              212   7e-62   Lotus japonicus
ref|XP_010696307.1|  PREDICTED: alpha carbonic anhydrase 7-like         213   7e-62   
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                    212   8e-62   
emb|CDY27409.1|  BnaC03g64490D                                          212   9e-62   
ref|XP_002445624.1|  hypothetical protein SORBIDRAFT_07g022880          212   9e-62   Sorghum bicolor [broomcorn]
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like         212   1e-61   
ref|XP_007027463.1|  Alpha carbonic anhydrase 7 isoform 1               212   1e-61   
emb|CDP15287.1|  unnamed protein product                                213   1e-61   
ref|XP_004137981.1|  PREDICTED: bifunctional monodehydroascorbate...    214   1e-61   
gb|KHG14539.1|  Bifunctional monodehydroascorbate reductase and c...    212   2e-61   
ref|XP_011033188.1|  PREDICTED: alpha carbonic anhydrase 4-like         213   2e-61   
ref|XP_004300792.1|  PREDICTED: bifunctional monodehydroascorbate...    211   2e-61   
ref|XP_011044414.1|  PREDICTED: LOW QUALITY PROTEIN: alpha carbon...    211   2e-61   
ref|XP_008360674.1|  PREDICTED: bifunctional monodehydroascorbate...    211   3e-61   
emb|CDX76404.1|  BnaA08g09960D                                          211   3e-61   
ref|XP_002278815.1|  PREDICTED: alpha carbonic anhydrase 4-like         210   7e-61   Vitis vinifera
ref|XP_004303634.1|  PREDICTED: bifunctional monodehydroascorbate...    210   9e-61   
ref|XP_010269790.1|  PREDICTED: alpha carbonic anhydrase 4-like         209   9e-61   
emb|CBI33385.3|  unnamed protein product                                209   1e-60   
ref|XP_009363226.1|  PREDICTED: alpha carbonic anhydrase 4-like         209   1e-60   
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like         209   1e-60   
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg             209   1e-60   
dbj|BAK03530.1|  predicted protein                                      209   2e-60   
ref|XP_010050514.1|  PREDICTED: alpha carbonic anhydrase 7-like         209   2e-60   
ref|XP_010904591.1|  PREDICTED: alpha carbonic anhydrase 7-like         209   2e-60   
ref|XP_007028632.1|  Carbonic anhydrase, putative                       209   2e-60   
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4              208   2e-60   
gb|EEC83720.1|  hypothetical protein OsI_29556                          208   2e-60   Oryza sativa Indica Group [Indian rice]
dbj|BAK01826.1|  predicted protein                                      208   3e-60   
gb|EMT11024.1|  Bifunctional monodehydroascorbate reductase and c...    208   3e-60   
ref|XP_006845943.1|  hypothetical protein AMTR_s00157p00085110          207   4e-60   
ref|XP_004304476.1|  PREDICTED: bifunctional monodehydroascorbate...    208   4e-60   
ref|XP_009358738.1|  PREDICTED: alpha carbonic anhydrase 4-like         210   4e-60   
ref|XP_002323272.2|  hypothetical protein POPTR_0016s04300g             208   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like         207   5e-60   
ref|XP_008364026.1|  PREDICTED: bifunctional monodehydroascorbate...    206   7e-60   
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg             207   8e-60   
emb|CDY65169.1|  BnaC05g49130D                                          206   8e-60   
emb|CDP14170.1|  unnamed protein product                                207   9e-60   
ref|XP_010098809.1|  hypothetical protein L484_022574                   206   1e-59   
ref|XP_006489872.1|  PREDICTED: bifunctional monodehydroascorbate...    207   1e-59   
dbj|BAK02152.1|  predicted protein                                      207   1e-59   
ref|XP_010050524.1|  PREDICTED: alpha carbonic anhydrase 7-like         207   1e-59   
ref|XP_008383977.1|  PREDICTED: bifunctional monodehydroascorbate...    209   1e-59   
dbj|BAD09858.1|  putative dioscorin class A precursor                   206   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010090219.1|  hypothetical protein L484_016558                   205   2e-59   
ref|XP_009767316.1|  PREDICTED: alpha carbonic anhydrase 7-like         206   2e-59   
gb|KEH24050.1|  eukaryotic-type carbonic anhydrase                      206   3e-59   
ref|XP_008227263.1|  PREDICTED: bifunctional monodehydroascorbate...    205   3e-59   
gb|KHG05281.1|  Bifunctional monodehydroascorbate reductase and c...    206   3e-59   
dbj|BAC99799.1|  putative dioscorin                                     206   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07037.1|  hypothetical protein OsI_29284                          206   3e-59   Oryza sativa Indica Group [Indian rice]
gb|AFK49331.1|  unknown                                                 204   4e-59   
ref|XP_002880942.1|  hypothetical protein ARALYDRAFT_320571             204   4e-59   
ref|XP_006294831.1|  hypothetical protein CARUB_v10023883mg             205   4e-59   
ref|XP_008443579.1|  PREDICTED: bifunctional monodehydroascorbate...    205   4e-59   
ref|XP_011075357.1|  PREDICTED: alpha carbonic anhydrase 4-like         205   5e-59   
ref|XP_009776976.1|  PREDICTED: alpha carbonic anhydrase 7-like         202   5e-59   
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                     205   5e-59   
ref|XP_003520661.2|  PREDICTED: bifunctional monodehydroascorbate...    205   6e-59   
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg             204   8e-59   
ref|XP_010036663.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    204   9e-59   
ref|XP_004306263.1|  PREDICTED: bifunctional monodehydroascorbate...    206   1e-58   
gb|KGN58999.1|  hypothetical protein Csa_3G742870                       204   1e-58   
ref|XP_006421163.1|  hypothetical protein CICLE_v10005610mg             204   1e-58   
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative               204   1e-58   
ref|XP_010036660.1|  PREDICTED: alpha carbonic anhydrase 4-like         204   1e-58   
ref|XP_004168623.1|  PREDICTED: bifunctional monodehydroascorbate...    204   1e-58   
ref|XP_008241448.1|  PREDICTED: bifunctional monodehydroascorbate...    204   2e-58   
ref|XP_011048125.1|  PREDICTED: alpha carbonic anhydrase 4-like         204   3e-58   
gb|AFW61791.1|  hypothetical protein ZEAMMB73_990747                    202   3e-58   
ref|XP_008241447.1|  PREDICTED: bifunctional monodehydroascorbate...    203   3e-58   
ref|NP_193831.1|  alpha carbonic anhydrase 4                            202   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011015725.1|  PREDICTED: alpha carbonic anhydrase 4-like         204   3e-58   
ref|XP_002869915.1|  carbonic anhydrase family protein                  202   4e-58   
ref|XP_004973744.1|  PREDICTED: bifunctional monodehydroascorbate...    202   4e-58   
gb|EEE68846.1|  hypothetical protein OsJ_27636                          202   5e-58   
ref|XP_011048097.1|  PREDICTED: alpha carbonic anhydrase 4-like         202   6e-58   
gb|KDO48229.1|  hypothetical protein CISIN_1g025618mg                   201   7e-58   
ref|XP_011015541.1|  PREDICTED: alpha carbonic anhydrase 4-like         201   9e-58   
ref|XP_006296034.1|  hypothetical protein CARUB_v10025180mg             201   9e-58   
ref|XP_007202419.1|  hypothetical protein PRUPE_ppa009714mg             202   9e-58   
ref|XP_004172039.1|  PREDICTED: bifunctional monodehydroascorbate...    201   1e-57   
ref|XP_007211988.1|  hypothetical protein PRUPE_ppa010973mg             200   1e-57   
ref|XP_008387558.1|  PREDICTED: bifunctional monodehydroascorbate...    202   1e-57   
ref|XP_009622096.1|  PREDICTED: alpha carbonic anhydrase 7-like         201   3e-57   
ref|NP_001061831.1|  Os08g0423500                                       201   3e-57   
ref|XP_010555357.1|  PREDICTED: alpha carbonic anhydrase 4              200   3e-57   
ref|XP_004494904.1|  PREDICTED: bifunctional monodehydroascorbate...    200   3e-57   
ref|XP_008244285.1|  PREDICTED: bifunctional monodehydroascorbate...    200   4e-57   
ref|XP_002278828.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    200   4e-57   
ref|XP_006845945.1|  hypothetical protein AMTR_s00157p00088030          199   4e-57   
ref|XP_002308927.2|  hypothetical protein POPTR_0006s04600g             200   5e-57   
emb|CAO98738.1|  dioscorin 5 precursor                                  199   9e-57   
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                     199   1e-56   
ref|XP_007028639.1|  Carbonic anhydrase, putative                       199   1e-56   
ref|XP_010646590.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    199   1e-56   
dbj|BAJ99342.1|  predicted protein                                      199   2e-56   
gb|ACT36291.1|  dioscorin precursor                                     198   2e-56   
gb|ACT36289.1|  dioscorin precursor                                     198   2e-56   
emb|CAO98737.1|  dioscorin 4 precursor                                  198   2e-56   
gb|ACT36292.1|  dioscorin precursor                                     198   3e-56   
gb|ABO36620.1|  eukaryotic-type carbonic anhydrase family protein       197   3e-56   
gb|ACT36293.1|  dioscorin precursor                                     197   3e-56   
emb|CAO98739.1|  dioscorin 6 precursor                                  197   4e-56   
ref|XP_003520509.1|  PREDICTED: bifunctional monodehydroascorbate...    197   4e-56   
emb|CAA53781.1|  storage protein                                        197   5e-56   
ref|XP_002532664.1|  carbonic anhydrase, putative                       197   5e-56   
gb|ACN85275.1|  unknown                                                 198   5e-56   
gb|ACT36290.1|  dioscorin precursor                                     197   5e-56   
ref|XP_009770757.1|  PREDICTED: alpha carbonic anhydrase 4-like         197   6e-56   
ref|XP_006577712.1|  PREDICTED: bifunctional monodehydroascorbate...    197   6e-56   
gb|KHN18685.1|  Bifunctional monodehydroascorbate reductase and c...    197   6e-56   
dbj|BAD18021.1|  tuber storage protein                                  196   8e-56   
ref|XP_007162157.1|  hypothetical protein PHAVU_001G129100g             196   8e-56   
pir||S57767  dioscorin class B - Dioscorea cayenensis (fragment)        196   9e-56
gb|AAF63334.1|AF245019_1  dioscorin A                                   196   1e-55   
ref|XP_009377055.1|  PREDICTED: alpha carbonic anhydrase 4-like         198   1e-55   
gb|EMT14740.1|  Bifunctional monodehydroascorbate reductase and c...    197   1e-55   
ref|XP_009407045.1|  PREDICTED: alpha carbonic anhydrase 7-like         196   1e-55   
gb|AEN14505.1|  dioscorin A3                                            195   1e-55   
ref|XP_004142716.1|  PREDICTED: bifunctional monodehydroascorbate...    197   2e-55   
gb|ACN85304.1|  unknown                                                 196   2e-55   
ref|XP_007027757.1|  Alpha carbonic anhydrase 1, putative               195   2e-55   
emb|CDX79018.1|  BnaA01g10850D                                          195   3e-55   
gb|EEE68706.1|  hypothetical protein OsJ_27361                          195   3e-55   
ref|XP_002528758.1|  carbonic anhydrase, putative                       195   3e-55   
gb|ACN85335.1|  unknown                                                 195   4e-55   
gb|AAF60191.1|AF242551_1  dioscorin A                                   195   4e-55   
emb|CAO98736.1|  dioscorin 3 precursor                                  194   4e-55   
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...    195   5e-55   
ref|XP_009599195.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    194   5e-55   
ref|XP_006351243.1|  PREDICTED: bifunctional monodehydroascorbate...    194   6e-55   
ref|XP_008784764.1|  PREDICTED: alpha carbonic anhydrase 7-like         194   7e-55   
gb|ACT36288.1|  dioscorin precursor                                     194   1e-54   
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like         193   1e-54   
gb|KHN11228.1|  Bifunctional monodehydroascorbate reductase and c...    193   1e-54   
ref|XP_007204039.1|  hypothetical protein PRUPE_ppa021069mg             193   1e-54   
gb|EYU18694.1|  hypothetical protein MIMGU_mgv11b010420mg               192   1e-54   
dbj|BAD18020.1|  tuber storage protein                                  193   2e-54   
emb|CAN60024.1|  hypothetical protein VITISV_006907                     191   4e-54   
ref|XP_006604587.1|  PREDICTED: bifunctional monodehydroascorbate...    192   5e-54   
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...    192   6e-54   
sp|F4IHR4.2|ATCA2_ARATH  RecName: Full=Alpha carbonic anhydrase 2...    191   8e-54   
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...    191   1e-53   
dbj|BAK00887.1|  predicted protein                                      191   1e-53   
ref|XP_007202870.1|  hypothetical protein PRUPE_ppa015691mg             191   1e-53   
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...    191   1e-53   
ref|XP_002532665.1|  carbonic anhydrase, putative                       190   1e-53   
ref|XP_009377054.1|  PREDICTED: alpha carbonic anhydrase 7-like         191   1e-53   
ref|XP_002323427.2|  hypothetical protein POPTR_0016s08050g             191   2e-53   
ref|NP_001175588.1|  Os08g0424100                                       191   2e-53   
ref|XP_006284932.1|  hypothetical protein CARUB_v10006231mg             189   3e-53   
emb|CAO98734.1|  dioscorin 1 precursor                                  189   4e-53   
ref|XP_011075611.1|  PREDICTED: alpha carbonic anhydrase 7-like         189   4e-53   
gb|ACN85320.1|  unknown                                                 190   4e-53   
gb|EAZ07038.1|  hypothetical protein OsI_29285                          189   5e-53   
emb|CAO98735.1|  dioscorin 2 precursor                                  189   5e-53   
ref|XP_006660200.1|  PREDICTED: bifunctional monodehydroascorbate...    190   8e-53   
ref|XP_011004112.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    189   8e-53   
ref|XP_006301790.1|  hypothetical protein CARUB_v10022254mg             189   8e-53   
ref|NP_001047030.1|  Os02g0533300                                       188   1e-52   
ref|XP_011075358.1|  PREDICTED: alpha carbonic anhydrase 7-like         188   1e-52   
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg                187   1e-52   
ref|XP_006660137.1|  PREDICTED: bifunctional monodehydroascorbate...    188   1e-52   
ref|XP_010527573.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    188   2e-52   
ref|XP_002308928.2|  hypothetical protein POPTR_0006s04610g             188   2e-52   
ref|XP_010101554.1|  hypothetical protein L484_015378                   187   3e-52   
ref|XP_009413153.1|  PREDICTED: alpha carbonic anhydrase 7-like         187   3e-52   
gb|EPS62533.1|  hypothetical protein M569_12260                         186   3e-52   
ref|XP_006430188.1|  hypothetical protein CICLE_v10013720mg             186   4e-52   
ref|XP_009599194.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    186   5e-52   
ref|XP_010050605.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    187   5e-52   
ref|XP_003560592.1|  PREDICTED: alpha carbonic anhydrase 7-like         187   6e-52   
gb|AAF44711.1|AF243526_1  dioscorin B                                   186   6e-52   
ref|NP_180388.2|  alpha carbonic anhydrase 2                            184   8e-52   
ref|XP_006339307.1|  PREDICTED: bifunctional monodehydroascorbate...    184   1e-51   
emb|CDP14169.1|  unnamed protein product                                185   1e-51   
ref|XP_010050600.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    186   1e-51   
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...    184   1e-51   
gb|ACN85281.1|  unknown                                                 186   2e-51   
ref|XP_009387987.1|  PREDICTED: alpha carbonic anhydrase 7-like         185   2e-51   
ref|XP_010520706.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    185   2e-51   
ref|XP_006481762.1|  PREDICTED: bifunctional monodehydroascorbate...    185   3e-51   
ref|XP_008241381.1|  PREDICTED: bifunctional monodehydroascorbate...    185   4e-51   
ref|XP_006286833.1|  hypothetical protein CARUB_v10003788mg             184   5e-51   
ref|XP_010036672.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   5e-51   
ref|XP_003579701.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   5e-51   
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg                184   6e-51   
emb|CDP15426.1|  unnamed protein product                                184   6e-51   
ref|XP_010239880.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   7e-51   
ref|XP_008241380.1|  PREDICTED: bifunctional monodehydroascorbate...    184   7e-51   
emb|CDY56563.1|  BnaCnng30610D                                          183   9e-51   
ref|XP_008442726.1|  PREDICTED: bifunctional monodehydroascorbate...    183   1e-50   
ref|XP_009115968.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    183   1e-50   
ref|XP_006398874.1|  hypothetical protein EUTSA_v10014397mg             182   2e-50   
ref|XP_004149223.1|  PREDICTED: bifunctional monodehydroascorbate...    182   2e-50   
emb|CDX78118.1|  BnaA09g33130D                                          183   2e-50   
ref|XP_004161225.1|  PREDICTED: bifunctional monodehydroascorbate...    182   3e-50   
ref|XP_004954966.1|  PREDICTED: bifunctional monodehydroascorbate...    182   3e-50   
ref|XP_008383978.1|  PREDICTED: bifunctional monodehydroascorbate...    182   3e-50   
ref|XP_007162791.1|  hypothetical protein PHAVU_001G180900g             182   3e-50   
gb|EMS55408.1|  Bifunctional monodehydroascorbate reductase and c...    181   3e-50   
ref|XP_003625103.1|  Bifunctional monodehydroascorbate reductase ...    181   4e-50   
ref|XP_004965905.1|  PREDICTED: bifunctional monodehydroascorbate...    182   4e-50   
ref|XP_006354411.1|  PREDICTED: bifunctional monodehydroascorbate...    182   5e-50   
emb|CDX73611.1|  BnaC08g23920D                                          181   6e-50   
ref|XP_009358737.1|  PREDICTED: alpha carbonic anhydrase 7-like         181   7e-50   
ref|XP_009125546.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    181   7e-50   
ref|XP_006286119.1|  hypothetical protein CARUB_v10007668mg             180   8e-50   
ref|XP_002877879.1|  carbonic anhydrase family protein                  181   9e-50   
emb|CDX76409.1|  BnaA08g09910D                                          180   1e-49   
gb|EMS54273.1|  Bifunctional monodehydroascorbate reductase and c...    181   1e-49   
ref|XP_011004239.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   2e-49   
gb|AFK47340.1|  unknown                                                 180   2e-49   
ref|XP_007027464.1|  Alpha carbonic anhydrase 7 isoform 2               179   2e-49   
ref|NP_566971.2|  alpha carbonic anhydrase 1                            180   3e-49   
gb|EEC83601.1|  hypothetical protein OsI_29288                          179   3e-49   
ref|XP_008677173.1|  PREDICTED: carbonic anhydrase isoform X1           181   3e-49   
gb|EMS63276.1|  Bifunctional monodehydroascorbate reductase and c...    180   3e-49   
ref|XP_002309427.2|  hypothetical protein POPTR_0006s22940g             178   4e-49   
gb|EYU38639.1|  hypothetical protein MIMGU_mgv1a011347mg                179   4e-49   
ref|XP_009389630.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   5e-49   
gb|KEH42020.1|  eukaryotic-type carbonic anhydrase                      178   6e-49   
ref|XP_010449136.1|  PREDICTED: alpha carbonic anhydrase 4-like         178   7e-49   
ref|XP_008784028.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   7e-49   
ref|XP_010423620.1|  PREDICTED: alpha carbonic anhydrase 3              178   8e-49   
gb|KHN02302.1|  Bifunctional monodehydroascorbate reductase and c...    181   8e-49   
dbj|BAH20029.1|  AT3G52720                                              178   1e-48   
ref|XP_009796023.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    177   2e-48   
ref|XP_010050579.1|  PREDICTED: alpha carbonic anhydrase 7-like         178   2e-48   
gb|EMT14743.1|  Bifunctional monodehydroascorbate reductase and c...    176   3e-48   
ref|XP_010931134.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    177   3e-48   
ref|XP_006403779.1|  hypothetical protein EUTSA_v10010611mg             177   4e-48   
ref|XP_010439534.1|  PREDICTED: alpha carbonic anhydrase 4-like         176   5e-48   
gb|EMS68433.1|  hypothetical protein TRIUR3_33908                       176   5e-48   
ref|XP_009125547.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    176   5e-48   
ref|XP_002873139.1|  carbonic anhydrase family protein                  176   5e-48   
ref|XP_010090214.1|  hypothetical protein L484_016553                   176   6e-48   
ref|XP_009374764.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    176   7e-48   
ref|XP_006843475.1|  hypothetical protein AMTR_s00053p00197030          175   7e-48   
ref|XP_008231952.1|  PREDICTED: bifunctional monodehydroascorbate...    175   8e-48   
ref|XP_011077861.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    176   1e-47   
ref|XP_009606839.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    175   1e-47   
ref|XP_010530484.1|  PREDICTED: alpha carbonic anhydrase 7-like         173   1e-47   
ref|XP_009122630.1|  PREDICTED: alpha carbonic anhydrase 3              175   1e-47   
ref|XP_010426891.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    176   1e-47   
ref|XP_010912303.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    175   1e-47   
ref|XP_004959504.1|  PREDICTED: bifunctional monodehydroascorbate...    175   2e-47   
ref|XP_006281537.1|  hypothetical protein CARUB_v10027638mg             176   2e-47   
gb|KFK24865.1|  hypothetical protein AALP_AA8G035000                    174   2e-47   
emb|CBI30302.3|  unnamed protein product                                174   2e-47   
ref|XP_010490921.1|  PREDICTED: alpha carbonic anhydrase 3-like         174   2e-47   
ref|XP_007144395.1|  hypothetical protein PHAVU_007G152600g             174   2e-47   
gb|KEH42021.1|  eukaryotic-type carbonic anhydrase                      173   2e-47   
ref|XP_008442729.1|  PREDICTED: bifunctional monodehydroascorbate...    176   2e-47   
ref|XP_002282507.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    174   3e-47   
gb|KEH42022.1|  eukaryotic-type carbonic anhydrase                      174   3e-47   
gb|ABK28680.1|  unknown                                                 174   3e-47   
gb|EMT14744.1|  Bifunctional monodehydroascorbate reductase and c...    176   3e-47   
ref|XP_010912301.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    174   3e-47   
ref|XP_010504017.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    174   3e-47   
ref|NP_196038.1|  alpha carbonic anhydrase 3                            174   3e-47   
ref|XP_008442846.1|  PREDICTED: bifunctional monodehydroascorbate...    173   5e-47   
ref|XP_010515745.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    174   6e-47   
ref|XP_002864450.1|  hypothetical protein ARALYDRAFT_331944             174   6e-47   
emb|CAN80583.1|  hypothetical protein VITISV_022681                     173   1e-46   
ref|XP_010325903.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    172   1e-46   
ref|XP_008243568.1|  PREDICTED: bifunctional monodehydroascorbate...    172   1e-46   
dbj|BAG87020.1|  unnamed protein product                                172   2e-46   
ref|XP_011094325.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    172   2e-46   
ref|XP_006403777.1|  hypothetical protein EUTSA_v10010611mg             172   2e-46   
gb|KHN46012.1|  Bifunctional monodehydroascorbate reductase and c...    172   2e-46   
ref|XP_006653371.1|  PREDICTED: bifunctional monodehydroascorbate...    172   2e-46   
emb|CDY41393.1|  BnaCnng10290D                                          172   2e-46   
ref|XP_004494036.1|  PREDICTED: bifunctional monodehydroascorbate...    172   2e-46   
ref|XP_006659407.1|  PREDICTED: bifunctional monodehydroascorbate...    172   2e-46   
ref|XP_006291539.1|  hypothetical protein CARUB_v10017694mg             172   2e-46   
ref|XP_009390032.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    171   3e-46   
ref|XP_007150181.1|  hypothetical protein PHAVU_005G133400g             171   3e-46   
ref|XP_010434246.1|  PREDICTED: alpha carbonic anhydrase 4-like         171   3e-46   
ref|NP_001242755.1|  uncharacterized protein LOC100797401 precursor     171   5e-46   
ref|XP_010245039.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    171   5e-46   
emb|CDY61773.1|  BnaAnng17740D                                          181   5e-46   
gb|KDP37303.1|  hypothetical protein JCGZ_06757                         170   5e-46   
ref|XP_010236801.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    171   7e-46   
gb|AFW87496.1|  hypothetical protein ZEAMMB73_893265                    171   8e-46   
ref|XP_006341109.1|  PREDICTED: bifunctional monodehydroascorbate...    170   9e-46   
emb|CDF47511.1|  bifunctional monodehydroascorbate reductase and ...    166   1e-45   
ref|WP_013538320.1|  carbonic anhydrase                                 169   2e-45   
ref|XP_002869914.1|  carbonic anhydrase family protein                  167   3e-45   
gb|EPS73716.1|  hypothetical protein M569_01041                         167   3e-45   
ref|XP_007203398.1|  hypothetical protein PRUPE_ppa021144mg             168   3e-45   
ref|XP_010271743.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    168   3e-45   



>ref|XP_009595413.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana tomentosiformis]
Length=269

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 190/256 (74%), Gaps = 2/256 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            LF I+FL LS   + +S EVDDE  FSYDE ++ GP++WG++ PEW  C+ GK+Q+PIDL
Sbjct  7    LFIISFLFLSSAFLARSAEVDDESEFSYDEKNENGPANWGKIYPEWNTCNTGKLQSPIDL  66

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             +K V V SNLG ++ +Y    ATL N G+ MML W  G  +L ING +Y  +Q HWH P
Sbjct  67   LNKRVEVVSNLGKLRKHYKPSNATLLNRGHDMMLRWEGGAGHLKINGTKYQLKQCHWHTP  126

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH +NG R++LEAHLVH S+DG+ AV+ +MY+IG  P+  LS+IE DLK LA T G+++
Sbjct  127  SEHTINGKRFNLEAHLVHESDDGKTAVIGIMYKIGR-PDFFLSMIEKDLKALANTKGIER  185

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             IG +DPNL++  G++YYRY+GSLT PPCTE VVWT+ R ++++TK+Q+ LIR A+HDES
Sbjct  186  AIGTIDPNLIKMDGKKYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREAVHDES  245

Query  788  KTNARPLQTINDRFVK  835
            +TNARP Q +N R +K
Sbjct  246  ETNARPAQPVNRRPIK  261



>ref|XP_009782909.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana sylvestris]
Length=270

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 187/261 (72%), Gaps = 2/261 (1%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            M   K+  I+FL LS   + +S EVDDE  FSYDE S+ GP+ WG++ PEW  C+ GK+Q
Sbjct  3    MAATKILFISFLFLSSAFLARSAEVDDESEFSYDEKSENGPAKWGKIHPEWSTCNTGKLQ  62

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            +PIDL +K V V SNLG +  +Y    ATL N G+ MML W  G  YL ING +Y  +Q 
Sbjct  63   SPIDLLNKRVEVVSNLGKLCTHYKPSNATLLNRGHDMMLRWEGGGGYLKINGTKYQLKQC  122

Query  413  HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            HWH PSEH +NG R++LEAHLVH S+DG+ AV+ +MY+IG  P+  LS+IE DLK LA T
Sbjct  123  HWHTPSEHTINGKRFNLEAHLVHESDDGKTAVIGIMYKIGR-PDSFLSMIEKDLKALAST  181

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
             GV++ IG +DP L++  G+ YYRY+GSLT PPCTE VVWT+ R ++++TK+Q+ LIR A
Sbjct  182  KGVERAIGTIDPKLIKMDGKTYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREA  241

Query  773  IHDESKTNARPLQTINDRFVK  835
            +HDES+TNARP Q +N R +K
Sbjct  242  VHDESETNARPAQPVNRRPIK  262



>ref|XP_009621603.1| PREDICTED: alpha carbonic anhydrase 7 [Nicotiana tomentosiformis]
Length=273

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 190/266 (71%), Gaps = 6/266 (2%)
 Frame = +2

Query  56   MDML----KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            M+ML    K+  ++FL L+   + +S EVDDE  F+YDE S++GP+HWGE+  EW  C++
Sbjct  1    MEMLTRTNKILFLSFLFLASALLTRSHEVDDESEFTYDEESEKGPAHWGEIHTEWSMCNS  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            GK+Q+PIDL ++ V V S+LG ++  Y    +TL N G+ MML W  G  ++ ING RY 
Sbjct  61   GKLQSPIDLLNERVEVVSHLGRLRRSYKPSNSTLLNRGHDMMLRWEGGAGHIEINGTRYQ  120

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
              Q HWH PSEH +NG R+DLE HLVH SNDG+ AV+ +MY+IG   +  LS IEDDLK 
Sbjct  121  LNQAHWHSPSEHTINGKRFDLEVHLVHESNDGKTAVVGIMYKIGRA-DSFLSKIEDDLKA  179

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            LA T GV++ IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VT++Q+ L
Sbjct  180  LAHTKGVERNIGIIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKL  239

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            IR A+HDES+TN+RP+Q  N R +++
Sbjct  240  IREAVHDESETNSRPVQAANKRPIRL  265



>ref|XP_011090098.1| PREDICTED: alpha carbonic anhydrase 7 [Sesamum indicum]
Length=271

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 190/256 (74%), Gaps = 2/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
             SI   LL V  + ++QEVDDE  FSY+ENS+ GP+HWGE+RPEW +CS+G+MQ+PIDL 
Sbjct  10   LSIFIPLLLVACLTRAQEVDDEREFSYEENSEIGPAHWGEIRPEWKECSSGEMQSPIDLL  69

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V V S+LG ++  Y     TL N G+ MML WP G  ++ ING  Y  +Q HWH PS
Sbjct  70   NERVEVVSHLGKLKRSYKPSNTTLINRGHDMMLRWPGGAGHININGTLYQLKQCHWHSPS  129

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH ++G R+D+E HLVH S+D RIAV+ +MY+IG  P+  LS+++ +LK +AE   V+K 
Sbjct  130  EHTISGRRFDMEVHLVHQSDDNRIAVIGIMYKIGR-PDSFLSMMKRNLKAVAEMRDVEKT  188

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            IG +DP L++   R+YYRY+GSLTTPPCT+ V+WT++R +R+VT++QV LIR+ +HD+S+
Sbjct  189  IGIIDPKLIKLGSRKYYRYIGSLTTPPCTQNVIWTIVRKVRTVTREQVELIRDVVHDDSE  248

Query  791  TNARPLQTINDRFVKV  838
             NARP+Q +++R V++
Sbjct  249  ANARPIQPVHERLVEL  264



>ref|XP_009776894.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3, partial [Nicotiana sylvestris]
Length=260

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 181/252 (72%), Gaps = 2/252 (1%)
 Frame = +2

Query  68   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            K+   +FL L+   + +S EVDDE  F+YDE S++GPSHWGE+  EW  C++GK+Q+PID
Sbjct  9    KILFFSFLFLTSALLARSHEVDDESEFTYDEESEKGPSHWGEIHSEWSMCNSGKLQSPID  68

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L ++ V + S+LG +   Y    +TL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  69   LLNERVEIVSHLGRLHRSYKPSNSTLLNRGHDMMLRWEGGAGHIKINGTQYQLNQAHWHS  128

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG R+DLE HLVH SNDG+ AV+ +MY+IG   +  LS+IEDDLK LA T GV+
Sbjct  129  PSEHTINGRRFDLEVHLVHESNDGKTAVVGIMYKIGRA-DSFLSMIEDDLKALAHTKGVE  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VT++Q+ LIR A+HDE
Sbjct  188  RNIGVIDPKQVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDE  247

Query  785  SKTNARPLQTIN  820
            S+TN+RP+Q  N
Sbjct  248  SETNSRPVQAAN  259



>ref|XP_006340169.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 182/258 (71%), Gaps = 3/258 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +  ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C++GK+Q+PIDL
Sbjct  11   ILFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDL  70

Query  251  ESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
             ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  71   LNERVEVVSHLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG R+DLE HLVH S DG+ AV+ +MY+IG   +P LS+IE DLK LA T  V+
Sbjct  131  PSEHTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DPFLSMIESDLKALAHTKNVE  189

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HDE
Sbjct  190  RNIGVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDE  249

Query  785  SKTNARPLQTINDRFVKV  838
            S+TN+RP+Q  N R +++
Sbjct  250  SETNSRPVQATNKRTIRL  267



>ref|XP_006340168.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 182/258 (71%), Gaps = 3/258 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +  ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C++GK+Q+PIDL
Sbjct  11   ILFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDL  70

Query  251  ESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
             ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH 
Sbjct  71   LNERVEVVSHLGRLHRSYKTSSYATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHS  130

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG R+DLE HLVH S DG+ AV+ +MY+IG   +P L++IE DLK LA T  V+
Sbjct  131  PSEHTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DPFLTMIESDLKALAHTKNVE  189

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HDE
Sbjct  190  RNIGVIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDE  249

Query  785  SKTNARPLQTINDRFVKV  838
            S+TN+RP+Q  N R +++
Sbjct  250  SETNSRPVQATNKRTIRL  267



>ref|XP_004251153.1| PREDICTED: alpha carbonic anhydrase 7 [Solanum lycopersicum]
Length=276

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 182/259 (70%), Gaps = 3/259 (1%)
 Frame = +2

Query  68   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            K+F ++FL L+   +    EVDDE  FSYD  S+ GP+HWGE+ PEW  C+ GK+Q+PID
Sbjct  11   KIFFLSFLFLTNAFIATCHEVDDESEFSYDRESENGPTHWGEIHPEWKLCNTGKLQSPID  70

Query  248  LESKPV-VYSNLGPI-QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            L ++ V V S+LG + ++Y     ATL N G+ MML W  G  ++ ING +Y   Q HWH
Sbjct  71   LLNERVEVVSHLGRLHRSYKTTSYATLLNRGHDMMLRWEGGAGHIVINGTKYQLNQAHWH  130

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R+DLE HLVH S DG+ AV+ +MY+IG   +  LS+IE DLK LA T  V
Sbjct  131  SPSEHTINGRRFDLEVHLVHESEDGKTAVVGIMYKIGRA-DSFLSMIESDLKALAHTKNV  189

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ IG +DP  ++   R+YYRY+GSLT PPCT+ VVWT++R +R+VTK+Q+ LIR A+HD
Sbjct  190  ERKIGIIDPKKVKLGSRKYYRYIGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHD  249

Query  782  ESKTNARPLQTINDRFVKV  838
            ES+TN+RP+Q  N R +++
Sbjct  250  ESETNSRPVQATNKRTIRL  268



>emb|CDP11563.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 186/266 (70%), Gaps = 3/266 (1%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLLLS-VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +E++    LF   F+L++   ++ ++QE DD+ GFSYDENS RGP+HWGEL+ EW  CS 
Sbjct  1    MENLARKFLFCCCFILVTFACNLARAQEEDDQHGFSYDENSPRGPAHWGELKEEWCTCSH  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            G+MQ+PIDL    V V  +LG +  +Y    ATL N G+ +ML W     Y+ I+G  Y 
Sbjct  61   GRMQSPIDLPDAEVQVDPSLGKLHRHYRPSNATLINRGHDIMLRWVDDAGYIRIDGTLYQ  120

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
             +Q HWH P+EH +NG RYDLEAHLVH S DG+IAV+ ++Y+IG  P+P LS++E  L+ 
Sbjct  121  LQQCHWHSPTEHAINGERYDLEAHLVHQSPDGKIAVIGILYKIGR-PDPFLSMLEHYLEA  179

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            LA+T   ++ +G++DPN +    + YYRY GSLTTPPCTE V+WT++  + +V++ QV L
Sbjct  180  LADTLEEEEVVGFVDPNQITFGSKGYYRYSGSLTTPPCTEDVLWTIVDKVGTVSRHQVKL  239

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            IRNA+HD SK NARPLQ INDR +++
Sbjct  240  IRNAVHDGSKMNARPLQPINDRPIRL  265



>sp|Q84UV8.1|NEC3_NICLS RecName: Full=Bifunctional monodehydroascorbate reductase and 
carbonic anhydrase nectarin-3; AltName: Full=Nectarin-III; 
Contains: RecName: Full=Nectarin-2; Flags: Precursor [Nicotiana 
langsdorffii x Nicotiana sanderae]
 gb|AAO85482.1| nectarin III [Nicotiana langsdorffii x Nicotiana sanderae]
Length=274

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 186/258 (72%), Gaps = 3/258 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            + K+  I+FL LS   + +S EVDDE  FSYDE S+ GP++WG +RP+W +CS GK+Q+P
Sbjct  6    ITKMLFISFLFLSSVFLARSGEVDDESEFSYDEKSENGPANWGNIRPDWKECS-GKLQSP  64

Query  242  IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            ID+ + +  V SNL  +Q  Y    ATL N G+ +ML    G  YL IN  +Y  +Q+HW
Sbjct  65   IDIFDLRAEVVSNLRILQKDYKPSNATLLNRGHDIMLRLDDGG-YLKINETQYQLKQLHW  123

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R++LEAHLVH SN+G+  V+ ++Y+IG  P+P LS+IE+DLK  A   G
Sbjct  124  HTPSEHTINGERFNLEAHLVHESNNGKFVVIGIVYEIGLWPDPFLSMIENDLKVPANKKG  183

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
            +++GIG +DPN ++  G++Y+RY+GSLTTPPCTEGVVW + R +++VT++Q+ L++ A+H
Sbjct  184  IERGIGIIDPNQIKLDGKKYFRYIGSLTTPPCTEGVVWIIDRKVKTVTRRQIKLLQEAVH  243

Query  779  DESKTNARPLQTINDRFV  832
            D  +TNARP Q  N+R++
Sbjct  244  DGFETNARPTQPENERYI  261



>emb|CDP07086.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 187/266 (70%), Gaps = 3/266 (1%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLLLS-VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +E++    LF   F+  +   ++ +++EV+DE  FSYDE S RGP+HWGE+R EW  C+ 
Sbjct  1    MENLTRKALFCCFFVCTTFACNLARAEEVEDEKEFSYDERSHRGPAHWGEIRQEWSMCNH  60

Query  224  GKMQTPIDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            G MQ+PIDL +++  V S+LG +   Y    ATL N G+ MML W     ++ ING  Y 
Sbjct  61   GSMQSPIDLLDARVQVVSSLGRLHREYKPSNATLVNRGHDMMLRWVDDAGHIHINGTLYH  120

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
             RQ HWH PSEH +NG RYDLEAHLVH + +GRIAV+ ++Y+IG + +  LS++E+ LK 
Sbjct  121  LRQCHWHSPSEHSINGKRYDLEAHLVHEALNGRIAVIGIIYEIGRS-DSFLSMMENKLKA  179

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            LA+T  ++K +G +DP  ++   R+YYRY+GSLT PPCT+ VVWT+++ +R+VT+ QV +
Sbjct  180  LADTRDLEKVVGVIDPKQIKLGSRKYYRYIGSLTIPPCTQNVVWTIVKKVRTVTRDQVKM  239

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            IR A+HDES+ NARPLQ +++R +++
Sbjct  240  IREAVHDESEANARPLQPLHNRPIRM  265



>ref|XP_006424533.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
 gb|ESR37773.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
Length=275

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   F +  LLLS   V  SQEVDDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LFSCFFLVLLLLSCPAV--SQEVDDEKEFNYEEEGQRGPSKWGELHKEWSDCKKGTMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R+ LEAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +  
Sbjct  127  HSPSEHTINGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASIADHLRQIAGSDE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +  +G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+H
Sbjct  186  RETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVH  245

Query  779  DESKTNARPLQTINDRFVKV  838
            D+S TNARP Q IN R +K+
Sbjct  246  DDSGTNARPQQPINLRTIKL  265



>ref|XP_011090042.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=274

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 180/250 (72%), Gaps = 2/250 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            +  +L S     ++QEVDDE  FSY+E+S+ GPS+WG++RPEW QC++G++Q+PIDL ++
Sbjct  14   LVLVLPSFACFTRAQEVDDERQFSYEEDSEIGPSNWGKIRPEWSQCNSGRLQSPIDLLNQ  73

Query  260  PVV-YSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V   S+LG ++  Y    ATL N G+ MML W     ++ ING  Y  RQ HWH PSEH
Sbjct  74   RVEEVSHLGRLKRNYNPSNATLINRGHDMMLRWRNDAGHIQINGTLYHLRQCHWHSPSEH  133

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             +NG R+D+E HLVH S+D R AV+ +MY+IG  P+  LS+++ D + + ET  V++ +G
Sbjct  134  TINGKRFDMETHLVHESDDKRTAVIGIMYKIGR-PDAFLSMLKRDFEAIVETRDVERTVG  192

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             ++P L++   R+YYRYMGSLT PPCT+ ++WT+++ +R+VT++QV LIR A+HDES+ N
Sbjct  193  VVNPKLVELGSRKYYRYMGSLTVPPCTQDIIWTMVKKVRTVTREQVELIREAVHDESEMN  252

Query  797  ARPLQTINDR  826
            ARP+Q +N+R
Sbjct  253  ARPIQPMNER  262



>gb|KDO73356.1| hypothetical protein CISIN_1g039445mg [Citrus sinensis]
Length=275

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   F +  LLLS   V  SQEVDDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LFSCFFLVLLLLSCPAV--SQEVDDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH ++G R+ LEAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +  
Sbjct  127  HSPSEHTIDGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASISDHLRQIAGSNE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +  +G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+H
Sbjct  186  RETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVH  245

Query  779  DESKTNARPLQTINDRFVKV  838
            D+S TNARP Q IN R +K+
Sbjct  246  DDSGTNARPQQPINLRTIKL  265



>ref|XP_004139554.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 181/259 (70%), Gaps = 6/259 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            L  FS+    L  T    SQEV++E GF Y+ + ++GP+HWGELR EW +C  G MQ+PI
Sbjct  8    LIFFSLLLFSLKAT----SQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HWH
Sbjct  64   DLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHWH  123

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH ++G  +DLEAHLVH S++G I+V+ ++YQIGE P+  LS IE+DL+  + T   
Sbjct  124  SPSEHTIDGKTFDLEAHLVHESSNGMISVIGILYQIGE-PDYFLSTIEEDLEVASNTHEE  182

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ IG +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+HD
Sbjct  183  ERVIGIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRVAVHD  242

Query  782  ESKTNARPLQTINDRFVKV  838
            +S +NARPLQ   DR +++
Sbjct  243  DSDSNARPLQPFYDRTMQL  261



>ref|XP_004160913.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=269

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 181/259 (70%), Gaps = 6/259 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            L  FS+    L  T    SQEV++E GF Y+ + ++GP+HWGELR EW +C  G MQ+PI
Sbjct  8    LIFFSLPLFSLKAT----SQEVENERGFDYERDGEKGPTHWGELRAEWHKCKGGLMQSPI  63

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HWH
Sbjct  64   DLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHWH  123

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH ++G  +DLEAHLVH S++G I+V+ ++YQIGE P+  LS IE+DL+  + T   
Sbjct  124  SPSEHTIDGKTFDLEAHLVHESSNGMISVIGILYQIGE-PDYFLSTIEEDLEVASNTHEE  182

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ IG +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+HD
Sbjct  183  ERVIGIIDPNILKMGSKQYYRYIGSLTVPPCTENVMWTIIHQVRTVTEEQVKLLRVAVHD  242

Query  782  ESKTNARPLQTINDRFVKV  838
            +S +NARPLQ   DR +++
Sbjct  243  DSDSNARPLQPFYDRTMQL  261



>ref|XP_006488639.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 178/260 (68%), Gaps = 4/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +L  F +  LLLS   +  SQE DDE  F+Y+E   RGPS WGEL  EW  C  G MQ+P
Sbjct  9    LLSCFFLVLLLLSCPAL--SQEADDEKEFNYEEEGQRGPSKWGELHKEWSACKKGTMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSYATLKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH ++G R+ LEAH+VH S DG+IAV+ +MY+IG  P+ +L+ I D L+++A +  
Sbjct  127  HSPSEHTIDGERFALEAHMVHESQDGKIAVVGIMYKIGR-PDSLLASISDHLRQIAGSNE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +  +G +DP  ++   R+YYRY+GSLTTPPCTE V+WT++R +R+VT++QV L+R A+H
Sbjct  186  RETVVGVIDPRGIKLGSRKYYRYIGSLTTPPCTENVIWTIVRKVRTVTREQVKLLRVAVH  245

Query  779  DESKTNARPLQTINDRFVKV  838
            D+S TNARP Q IN R VK+
Sbjct  246  DDSGTNARPQQPINLRTVKL  265



>ref|XP_006424534.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
 gb|ESR37774.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
Length=275

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 175/259 (68%), Gaps = 4/259 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WGEL  +W  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGELHSKWSACKNGRMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L INGI Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGIEYVLQQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R+ LEAH+VHVS DG+IAV+ +MY+IG  P+  L  I D L ++A +  
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGKIAVVGIMYKIGR-PDSFLESISDHLTQVAGSNE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +   G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+H
Sbjct  186  RETVAGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVH  245

Query  779  DESKTNARPLQTINDRFVK  835
            DES TNARP Q IN R VK
Sbjct  246  DESDTNARPQQPINLRIVK  264



>ref|XP_008464591.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=268

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 183/260 (70%), Gaps = 4/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +  L   + LL S+    +SQEV+DE GF Y+ + ++GP HWGELR EW +C  G MQ+P
Sbjct  5    LCSLIFSSLLLFSLK--ARSQEVEDERGFDYERDGEKGPVHWGELRAEWHKCKGGLMQSP  62

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL  + V V S+LG +Q  Y    ATL+N G+ MM+ W  G  Y+ +NG +Y  +Q HW
Sbjct  63   IDLLHERVEVISHLGDLQINYKSSNATLKNRGHDMMMKWVDGGGYMEMNGTQYKLKQCHW  122

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH ++G  +DLEAHLVH S++G ++V+ ++YQIGE P+  LS I++DL+  + T  
Sbjct  123  HSPSEHTIDGKNFDLEAHLVHESSNGMVSVIGILYQIGE-PDYFLSTIKEDLEVASNTHE  181

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             ++ +G +DPN+L+   ++YYRY+GSLT PPCTE V+WT+I  +R+VT++QV L+R A+H
Sbjct  182  EERVVGIIDPNILKMGSKQYYRYIGSLTVPPCTEDVMWTIIHQVRTVTEEQVKLLRVAVH  241

Query  779  DESKTNARPLQTINDRFVKV  838
            D+S +NARPLQ I +R +++
Sbjct  242  DDSNSNARPLQPIYNRTMQL  261



>gb|KDO73355.1| hypothetical protein CISIN_1g046862mg [Citrus sinensis]
Length=275

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 174/259 (67%), Gaps = 4/259 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WG+L  EW  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R+ LEAH+VHVS DG+IAV+ +MY+IG  P+  L  I D L ++A +  
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGKIAVVGIMYKIGR-PDSFLESISDHLTQVAGSNE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +   G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+H
Sbjct  186  RETVAGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVH  245

Query  779  DESKTNARPLQTINDRFVK  835
            DES TNARP Q IN R VK
Sbjct  246  DESDTNARPQQPINLRIVK  264



>ref|XP_006488640.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 175/259 (68%), Gaps = 4/259 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   F +  LLLS T +  SQEVDDE  F+Y+E  + GPS WG+L  EW  C  G+MQ+P
Sbjct  9    LFCCFFVVLLLLSGTAI--SQEVDDEIEFNYEEGGENGPSKWGQLHSEWSACKNGRMQSP  66

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   L ING  Y+ +Q HW
Sbjct  67   IDLLNERVQVVSHLGRLKRSYKPSNATLKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHW  126

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R+ LEAH+VHVS DG+IAV+ ++Y+IG  P+  L  I D L ++A +  
Sbjct  127  HSPSEHTINGQRFALEAHMVHVSQDGKIAVVGIVYKIGR-PDSFLESISDHLTQVAGSNE  185

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +  +G +DP  ++   R+YYRY+GSLT PPCTE V+WT++R +R+VT++QV  +R A+H
Sbjct  186  RETVVGVIDPRGIKIGSRKYYRYIGSLTIPPCTENVLWTIVRKVRTVTREQVRSLRVAVH  245

Query  779  DESKTNARPLQTINDRFVK  835
            DES TNARP Q IN R VK
Sbjct  246  DESDTNARPQQPINLRIVK  264



>ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
 gb|KHN21504.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=274

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 181/257 (70%), Gaps = 5/257 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            LF+ AFL LS+   + SQEV+DE  FSYDE S+ GPS+WG++ PEW  C+ G MQ+PIDL
Sbjct  11   LFT-AFLFLSLP--VMSQEVEDESEFSYDEKSENGPSNWGDIHPEWSLCNNGSMQSPIDL  67

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             ++ V + S+LG +Q  Y    AT++N G+ + L W  G  YL IN   Y+ +Q HWH P
Sbjct  68   LNERVQIVSHLGRLQMNYQPSNATIKNRGHDIKLEWVAGAGYLQINETEYVLKQCHWHSP  127

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH ++G R DLE H+VH +  G+ AV+ ++Y+IG +P+  LS + D LK +++T   ++
Sbjct  128  SEHTIDGKRLDLELHMVHETPSGQSAVIGMLYKIG-SPDSFLSSLTDHLKAISDTTEAER  186

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++   ++YYRY+GSLT PPCTE V WT+IR I+SV+K+QV L+R A+HDES
Sbjct  187  VVGVVDPRQIKIFYKQYYRYIGSLTIPPCTENVSWTIIRKIQSVSKEQVRLLRVAVHDES  246

Query  788  KTNARPLQTINDRFVKV  838
             TNARPLQ IN+R VK+
Sbjct  247  DTNARPLQLINNRLVKL  263



>ref|XP_006384924.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
 gb|ERP62721.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
Length=274

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 177/259 (68%), Gaps = 4/259 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            LF I F L+ V+H+  I SQE++DE  F Y+  S+RGP+HWG + PEW  CS G MQ+PI
Sbjct  9    LFLITFFLVLVSHILPITSQELEDETEFDYNPYSERGPAHWGRIHPEWVACSNGSMQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL ++ V + S LG +   Y    ATL N G+ +ML W  G   + ING  Y+ +Q HWH
Sbjct  69   DLLNERVDIVSYLGRLNRSYKPGNATLRNRGHDIMLKWESGAGTIEINGTEYVLKQCHWH  128

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH ++G R+ LEAH+VH S DG++AV+ ++Y+IG  P+  LS + + L+ +A T   
Sbjct  129  SPSEHTIDGKRFALEAHMVHESLDGKVAVVGILYKIGR-PDSFLSSLTEQLESVAGTNER  187

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
               +G +DP  ++   R+YYRY+GSLTTPPCTE V+WT+++ +R+ T++QV L+R A+HD
Sbjct  188  DTVVGVVDPRNIEIGSRKYYRYLGSLTTPPCTENVLWTIVKKVRTATREQVRLLRVAVHD  247

Query  782  ESKTNARPLQTINDRFVKV  838
            +S TNARPLQ +N R VK+
Sbjct  248  DSDTNARPLQPLNGRSVKL  266



>ref|XP_007016796.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34415.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 172/257 (67%), Gaps = 3/257 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +FSI  L+L  +    SQEV+DE  F Y+ENS RGP+ WGE+ PEW  CS G MQ+PID+
Sbjct  12   IFSI-VLVLQYSCPATSQEVEDESEFDYNENSPRGPARWGEIHPEWSACSNGSMQSPIDM  70

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             ++ V + S+LG ++  Y    ATL+N G+ MML W      + ING  Y  +Q HWH P
Sbjct  71   SNERVNIVSHLGRLKRSYKPSNATLKNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSP  130

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH +NG RYDLE HLVH S DG++AV+ +MY+IG  P+  LS + D L  + +    + 
Sbjct  131  SEHTINGRRYDLEVHLVHESADGKVAVIGIMYKIGR-PDSFLSSLLDHLASITDITEGES  189

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
              G +DP  ++   R+YYRY+GSLT PPC E VVW+++R +R+VT++QV L+R A+HD S
Sbjct  190  VAGVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDAS  249

Query  788  KTNARPLQTINDRFVKV  838
             TNARPLQ IN R V++
Sbjct  250  DTNARPLQPINKRSVQL  266



>gb|KDP44024.1| hypothetical protein JCGZ_05491 [Jatropha curcas]
Length=274

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 176/261 (67%), Gaps = 4/261 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            ++L    F +  + H +   SQEV+DE  FSY++NS+ GP  WGEL PEW  CS G MQ+
Sbjct  6    IQLLCFTFFISLLFHALPSSSQEVEDEREFSYEKNSETGPERWGELHPEWSTCSNGTMQS  65

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL ++ V V S+LG ++  Y    ATL+N G+ MML W  G   + ING  Y+ RQ H
Sbjct  66   PIDLLNERVEVVSHLGKLKRSYKPSNATLKNRGHDMMLEWENGAGTIEINGTEYVLRQCH  125

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH ++G R+ LE H+VH S DG++AV+ +MY IG  P+  LS + + L++++ T 
Sbjct  126  WHSPSEHTIDGGRFALELHMVHESQDGKVAVVGIMYIIGR-PDSFLSSLTEKLREVSGTE  184

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +  +G ++P  ++   R+YYRY+GSLT PPCTE VVWT+ R +R+VTK+QV L+R A+
Sbjct  185  EEETVVGIVNPKDIKIGSRKYYRYIGSLTVPPCTENVVWTISRKVRTVTKEQVELLRVAV  244

Query  776  HDESKTNARPLQTINDRFVKV  838
            HDE+ TNARPLQ  N R V++
Sbjct  245  HDEADTNARPLQPTNGRSVQL  265



>ref|XP_008359452.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 173/256 (68%), Gaps = 3/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  250
            F I  +LL+      S EV+DE  F+Y E+S++GP+ WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLIVLVLLNSCQA-SSDEVEDEREFNYXEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLL  71

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            + +  V SN G +Q  Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVEVVSNFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+DLEAHLVH S+ G+IAV  ++Y+IG  P+P LS + D L +++ T   ++ 
Sbjct  132  EHTINGKRFDLEAHLVHESSTGKIAVTGILYKIG-APDPFLSSMMDSLAEVSGTSEEEEA  190

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++ R  +YYRY+GSLT PPCT+ V WT+++ +R+V+++QV  +R A+HD+SK
Sbjct  191  VGTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIVQEVRTVSEEQVEFLRVAVHDDSK  250

Query  791  TNARPLQTINDRFVKV  838
            TNARP+Q  N R V+V
Sbjct  251  TNARPVQPRNGRVVQV  266



>ref|XP_004242097.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=270

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 175/262 (67%), Gaps = 5/262 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            + K+  ++F  LS   + +S EVDDE  FSYDEN++ GP++W  + P W +C  GKMQ+P
Sbjct  6    ITKMLFVSFAFLSSAFLARSGEVDDESEFSYDENAENGPANWSNIHPNWIKCKTGKMQSP  65

Query  242  IDLESKPVV-YSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            ID  +  +   SNLG +Q  Y    ATL N G+ +ML W  G  +L ING +Y  +QVHW
Sbjct  66   IDFANNKIENVSNLGILQKLYKPSNATLLNRGHDIMLRWDDGG-FLKINGTQYRLKQVHW  124

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGR-IAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            H PSEH +NG R+D+E HLVH +NDG+ IAV+ ++Y+IG  P+  L++IE DL+ L    
Sbjct  125  HTPSEHTINGKRFDMEGHLVHETNDGKNIAVIGILYEIGLFPDLFLTMIEKDLEALRLAD  184

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +K IG   PNL++   +RYYRYMGSLT PPCTE V+WT+    ++VT++Q+ L+R+ +
Sbjct  185  --QKAIGINHPNLIKIDEKRYYRYMGSLTVPPCTENVIWTIDGKTKTVTRRQIQLLRDVV  242

Query  776  HDESKTNARPLQTINDRFVKVD  841
            HD  + NARP+Q +N R +K +
Sbjct  243  HDGFEYNARPIQQLNGRTIKFN  264



>ref|XP_004293093.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=472

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 180/267 (67%), Gaps = 9/267 (3%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKS-------QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            MLKL S+  L  S+  V+ S        EV+DE  FSYDENS++GP+ WG +R EW  C+
Sbjct  198  MLKLSSLLILFCSIVLVLHSYQVTSHENEVEDESEFSYDENSEKGPARWGNIRREWSMCN  257

Query  221  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
             G +Q+PI+L    V V S+LG +Q  Y    ATL+N G+ +ML W     Y+ ING  Y
Sbjct  258  NGLLQSPINLSDDRVNVISDLGALQGSYKACNATLKNRGHDIMLKWQADAGYIPINGTHY  317

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
              RQ HWH PSEH +NG ++DLEAH+VH   +G IAV+ ++Y+IG+ P+P L+ + D ++
Sbjct  318  SVRQCHWHSPSEHKINGKQFDLEAHMVHDGPNGSIAVIGILYKIGK-PDPFLTQMMDYIE  376

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             L+E+ G +K IG +DP  ++    +YYRY+GSLT PPCT+ V+W ++  +R+V+K+QV 
Sbjct  377  DLSESSGEEKVIGMVDPKQIKTVSTKYYRYIGSLTIPPCTQNVLWNLVGEVRTVSKEQVE  436

Query  758  LIRNAIHDESKTNARPLQTINDRFVKV  838
             +R A+HDES+TNARPLQ IN R V++
Sbjct  437  FLREAVHDESETNARPLQPINTRSVRL  463



>ref|XP_009367040.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 172/256 (67%), Gaps = 3/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  250
            F I  +LL+      S EV+DE  F+Y E+S++GP+ WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLIVLVLLNSCQA-SSDEVEDEREFNYKEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLL  71

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            + +  V SN G +Q  Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVEVVSNFGILQGSYRPCNATLKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+DLEAHLVH S+ G+IAV  ++Y+IG  P+P LS + D L +++ T   ++ 
Sbjct  132  EHTINGKRFDLEAHLVHESSTGKIAVTGILYKIG-APDPFLSSMMDSLAEVSGTSEEEEV  190

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++ R  +YYRY+GSLT PPCT+ V WT+ + +R+V+K+QV  +R A+HD+SK
Sbjct  191  VGTVDPKKIKTRSTKYYRYIGSLTIPPCTQNVTWTIDQEVRTVSKEQVKFLRVAVHDDSK  250

Query  791  TNARPLQTINDRFVKV  838
            TNARP+Q  N R V+V
Sbjct  251  TNARPVQQRNGRVVQV  266



>ref|XP_004506042.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=269

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 171/254 (67%), Gaps = 3/254 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            IA +LLS    + SQEV+ E  F+YDE S +GP HWG+++PEW  C  G MQ+PIDL ++
Sbjct  15   IALVLLSSCPTM-SQEVEHESEFNYDEKSMKGPQHWGDIKPEWSMCKNGTMQSPIDLLNQ  73

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V + SNLG +Q  Y    ATL+N G+ +ML       YL ING +Y+ +Q HWH PSEH
Sbjct  74   RVQIVSNLGTLQINYKPSNATLKNRGHDIMLELIANSSYLQINGTQYVLKQFHWHSPSEH  133

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             ++G R+DLE H+VH +  G+ AV+ ++Y+ G  PNP  SL+  DL+ ++E    ++ +G
Sbjct  134  TIDGKRFDLELHMVHQTPSGQTAVIGILYKTGR-PNPFFSLLRSDLEAISEKTEEERALG  192

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             +DP  +      YYRY+GSLTTP C+E + WT+I+ +RSV+K+Q+ L R A HDES +N
Sbjct  193  VIDPRWINFGKTHYYRYIGSLTTPSCSENITWTIIQEVRSVSKEQIKLFRVAAHDESNSN  252

Query  797  ARPLQTINDRFVKV  838
            ARPLQ +NDR V++
Sbjct  253  ARPLQPLNDRLVQL  266



>ref|XP_011040911.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 174/259 (67%), Gaps = 4/259 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            LF I FLL+ V+H+  I SQEV+DE  F Y+ + ++GP+ WG + PEW  CS G MQ+PI
Sbjct  9    LFLITFLLVLVSHILPIASQEVEDEEEFDYNPDGEKGPAQWGRIHPEWGACSNGSMQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL ++ V + S+LG +   Y    ATL N G+ MML W  G   + ING  Y+  Q HWH
Sbjct  69   DLLNERVDIVSHLGRLNRSYKPGNATLRNRGHDMMLKWESGAGTIEINGTEYVLNQCHWH  128

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R  LE H+VH S DG++AV+ ++Y+IG  P+  LS + + L+ +A T   
Sbjct  129  SPSEHTINGKRLALEVHMVHESLDGKVAVVGILYKIGR-PDSFLSSLTEQLQSVAGTNER  187

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
               +G +DP  ++   R+YYRY+GSLT PPCTE V+WT+++ +R+ T++QV L+R A+HD
Sbjct  188  DTVVGIVDPRNIKIGSRKYYRYLGSLTIPPCTENVLWTIVKKVRTATREQVRLLRVAVHD  247

Query  782  ESKTNARPLQTINDRFVKV  838
            +S TNARPLQ +N R VK+
Sbjct  248  DSDTNARPLQPLNSRPVKL  266



>gb|KHG27075.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=274

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 174/258 (67%), Gaps = 3/258 (1%)
 Frame = +2

Query  71   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            L    F+LL++ +  ++SQE++DE  F Y  NS +GP+ WGE+  EW  CS G MQ+PID
Sbjct  9    LVCCFFILLALHSFSVRSQEIEDESEFDYGANSTKGPARWGEIHAEWGACSNGTMQSPID  68

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            + ++ V + S+LG ++  Y    ATL N G+ MML W      + I G  Y+  Q HWH 
Sbjct  69   MSNERVNIVSHLGRLKKSYKPSNATLRNRGHDMMLRWEDEAGAIEIKGREYVLHQCHWHS  128

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG RYDLE H+VH S DG++AV+ +MY+IG  P+  LS + D L+ + +    +
Sbjct  129  PSEHTINGRRYDLELHMVHESADGKVAVIGIMYKIGR-PDSFLSSLMDHLEAITDITDGE  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + +G +DP  ++   R+YYRY+GSLT PPCTE VVW+++R +R+VT++QV  +R A+HDE
Sbjct  188  RAVGVIDPRHIKFGSRKYYRYVGSLTIPPCTENVVWSIVRKVRTVTREQVRFLRVAVHDE  247

Query  785  SKTNARPLQTINDRFVKV  838
            S +NARPLQ+IN R +++
Sbjct  248  SDSNARPLQSINKRSIQL  265



>ref|XP_011044411.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 170/259 (66%), Gaps = 4/259 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            LF I F L+ V+ ++   SQEV+DE  F+YD N ++GP++WG + PEW  CS G MQ+PI
Sbjct  9    LFLITFFLVLVSRILPATSQEVEDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL S+ V V S+LG +   Y    ATL N G+ MML W      + ING  YL +Q HWH
Sbjct  69   DLLSERVDVVSHLGRLSRSYKPANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWH  128

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R  LE H+VH S DG++AV+ +MY IG  P+  LS +   L+ +A T   
Sbjct  129  SPSEHTINGKRLALEVHMVHESLDGKVAVVGIMYMIGR-PDSFLSSLTKQLQLVAGTYER  187

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
                G +DP  ++   R+YYRYMGSLT PPCTE V+WT++R +R+ T++QV ++R A+HD
Sbjct  188  DTVAGVVDPRNIKIGSRKYYRYMGSLTIPPCTENVLWTIVRKVRTATREQVRMLRVAVHD  247

Query  782  ESKTNARPLQTINDRFVKV  838
            ES TNAR +Q IN R VK+
Sbjct  248  ESDTNARQIQPINSRTVKL  266



>ref|XP_010043780.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85764.1| hypothetical protein EUGRSUZ_B02520 [Eucalyptus grandis]
Length=278

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 179/258 (69%), Gaps = 3/258 (1%)
 Frame = +2

Query  71   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            L    FL+L++   + KS+EV++E  F+YD  SDRGP+ WGE+R EW  C  G MQ+PID
Sbjct  9    LLCTIFLVLALHVGLTKSEEVENESQFNYDARSDRGPARWGEIRREWEMCRNGSMQSPID  68

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L S+ V V + LG ++  Y    ATL+N G+ +ML W      + +NG +YL +Q HWH 
Sbjct  69   LSSERVQVMARLGRLKRSYKASNATLKNRGHDIMLRWDGDAGSIYVNGTQYLLKQSHWHS  128

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH VNG R+DLE H+VH S +G++AV+ VMY++G  P+  LS +   ++ +A+T G +
Sbjct  129  PSEHAVNGRRFDLELHMVHDSPEGKVAVVGVMYKLGR-PDTFLSTMMKHIQGIADTHGAE  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + +G ++P  ++   R+YYRY+GSLT PPCT+ V+WT++R +R+VT++QV L+R A+ D+
Sbjct  188  RTVGIVNPKHIKIGSRKYYRYVGSLTVPPCTQNVLWTIVRKVRTVTREQVKLLREAVRDD  247

Query  785  SKTNARPLQTINDRFVKV  838
            S+ NARPLQ IN R V++
Sbjct  248  SEFNARPLQPINKRPVQL  265



>ref|XP_009391366.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 170/252 (67%), Gaps = 3/252 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            +AF LL  T +  SQEV+DE  FSY   S+ GP HWGE+  +W  C  G MQ+PIDL  K
Sbjct  13   VAFFLLQAT-LAASQEVEDEKEFSYVTGSELGPEHWGEIHKDWVACGDGHMQSPIDLSHK  71

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V +  NLG ++  Y   +A +EN G+ +ML W      + ING +Y  +Q+HWH PSEH
Sbjct  72   RVRILPNLGHLRRSYRPAMAIVENRGHDIMLKWEDEAGVIWINGTKYALKQLHWHSPSEH  131

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             +NG RY LE H+VH S D  IAV+ ++Y++G   +P L+ +E  +KK+A+    ++  G
Sbjct  132  TINGRRYSLELHMVHESADKNIAVVGILYKMGRH-DPFLAKLERYIKKIADKHDAEEVAG  190

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+I+ +R+V+++QVAL+R A+HD+S+ N
Sbjct  191  MVDPRHIRKGSRKYYRYMGSLTTPPCTEGVVWTIIKKVRTVSREQVALLREAVHDDSEMN  250

Query  797  ARPLQTINDRFV  832
            ARP Q IN R V
Sbjct  251  ARPTQQINGRIV  262



>ref|XP_006365755.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=270

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 176/262 (67%), Gaps = 5/262 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            + K+  I+F  LS   + +S EVDDE  FSY EN++ GP++W  + P W +C  GK+Q+P
Sbjct  6    ITKMLFISFAFLSSAFLARSGEVDDESEFSYIENAENGPANWSNIHPNWIKCKTGKLQSP  65

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            ID  +  V + SNLG +Q +Y    ATL N G+ +ML W  G  +L ING +Y  +QVHW
Sbjct  66   IDFPNNKVEIVSNLGILQKFYKPSNATLLNRGHDIMLRWDDGG-FLKINGTQYRLKQVHW  124

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGR-IAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            H PSEH ++G R+D+E HLVH +NDG+ IAV+ ++Y+IG  P+  L++IE DL+ L    
Sbjct  125  HTPSEHTIDGKRFDMEGHLVHETNDGKNIAVIGILYEIGLFPDLFLTMIEKDLEALRLAD  184

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
                GI Y  PNL++   +RYYRYMGSLT PPCTE V+WT+   +++VT++Q+ L+R+ +
Sbjct  185  QKAIGINY--PNLIKIDEKRYYRYMGSLTVPPCTENVIWTIDGKVKTVTRKQIQLLRDVV  242

Query  776  HDESKTNARPLQTINDRFVKVD  841
            HD  + NARP+Q +N R +K +
Sbjct  243  HDGFEYNARPIQPLNGRPIKFN  264



>ref|XP_008810946.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=284

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 168/243 (69%), Gaps = 2/243 (1%)
 Frame = +2

Query  110  VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  286
            V+ SQEV+DE  FSY+E S  GP HWGE+  EW  C+ G MQ+PIDL  + V ++  LG 
Sbjct  24   VVVSQEVEDEKEFSYEEGSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGR  83

Query  287  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            ++  Y    ATL+N G+ +ML W  G  ++ ING  Y   Q HWH PSEH +NG RYDLE
Sbjct  84   LKRSYKASNATLKNRGHDIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRYDLE  143

Query  467  AHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
             H+VH S+D + AV+ +MY+IG  P+  LS + + +K++A+    +  +G +DP  ++  
Sbjct  144  IHMVHQSSDQKNAVVGIMYKIGR-PDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKIG  202

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
             R+YYRYMGSLTTPPCT+GVVWT+ + +R+V+++QV L+R A+HD +K NARP+Q IN+R
Sbjct  203  SRKYYRYMGSLTTPPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAKNNARPIQPINER  262

Query  827  FVK  835
             ++
Sbjct  263  EIQ  265



>gb|KDP44023.1| hypothetical protein JCGZ_05490 [Jatropha curcas]
Length=275

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 175/260 (67%), Gaps = 6/260 (2%)
 Frame = +2

Query  71   LFSIAFLLLSV---THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            LF   F+ +S+   T  I SQE++DE  F Y E  ++GPS WGEL PEW  C+ G MQ+P
Sbjct  9    LFFTRFIFISLLLHTLPISSQEIEDEKDFDYYE-GEKGPSRWGELHPEWSACNNGSMQSP  67

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V V S+LG ++  Y    ATL+N G+ MM+ W  G     ING  Y+ +Q HW
Sbjct  68   IDLLNERVEVVSHLGKLKREYKSSNATLKNRGHDMMMEWENGAGITEINGTEYILKQCHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH VNG R+ LE H+VH S DG++AV+ VMY IG  P+  LS ++  L+ +A T  
Sbjct  128  HSPSEHSVNGVRFALELHMVHESLDGKVAVIGVMYIIGR-PDSFLSSVDKHLRSVAGTRK  186

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
            ++  +G ++P  ++ R R+YYRY GSLT PPCTE V+WT++  +R+V+++QV L+R A+H
Sbjct  187  LQTVVGMVNPKSIKLRSRKYYRYKGSLTVPPCTENVLWTIVTKVRTVSREQVRLLRVAVH  246

Query  779  DESKTNARPLQTINDRFVKV  838
            DES TNARP+Q +N R V++
Sbjct  247  DESDTNARPIQLMNGRSVQL  266



>ref|XP_009399717.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 171/254 (67%), Gaps = 4/254 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F   F L SV  ++ S+EV+DE  FSY++ S+ GP HWGE+  +W  C  G MQ+PIDL 
Sbjct  12   FLAIFTLQSV--LVASREVEDEKEFSYEKGSETGPEHWGEIHKDWAACGKGHMQSPIDLT  69

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
             K V +  +LG ++  Y    A L+N G+ +ML W      L ING  Y  +Q+HWH PS
Sbjct  70   HKRVQILPHLGRLRRSYHPAEAILKNRGHDIMLKWEEEAGGLWINGTEYALKQLHWHSPS  129

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH V+G RY LE H+VH S D + AV+ ++Y IG   +P L+ +E  ++K+A+    ++ 
Sbjct  130  EHTVDGRRYSLEMHMVHESTDNKTAVVGILYTIGRH-DPFLAKLERYIEKIADKHEAEEA  188

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+++ +R+VT++QVAL+R A+HD+S+
Sbjct  189  VGMVDPRHIKRGSRKYYRYMGSLTTPPCTEGVVWTIVKKVRTVTREQVALLREAVHDDSE  248

Query  791  TNARPLQTINDRFV  832
             NARP Q INDR +
Sbjct  249  MNARPTQKINDRMI  262



>ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 168/241 (70%), Gaps = 2/241 (1%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            SQEV++E  F Y++N +RGP+ WGEL  EW  CS G MQ+PID+ ++ V V S+LG +  
Sbjct  26   SQEVENEREFDYEKNGERGPARWGELHEEWRACSNGSMQSPIDMLNERVEVVSHLGRLNR  85

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
             Y    ATL+N G+ MML W  G   + ING  Y+ RQ HWH PSEH ++G R+ LE H+
Sbjct  86   SYEPSNATLKNRGHDMMLEWENGAGTIEINGTEYILRQCHWHSPSEHTLDGRRFALELHM  145

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH S DG++AV+ VMY IG   + +LSL  D L+ ++ T   ++ +G ++P  ++   R+
Sbjct  146  VHESPDGKVAVVGVMYTIGRPDSFLLSLT-DHLRSISGTEEEERVVGIINPKDIKIGSRK  204

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            YYRYMGSLT PPCTE V+WT+++ +R+VT++QV+L+R A+HDES TNARPLQ IN R V 
Sbjct  205  YYRYMGSLTVPPCTENVIWTIVKKVRTVTREQVSLLRVAVHDESDTNARPLQQINGRSVH  264

Query  836  V  838
            +
Sbjct  265  L  265



>gb|KEH16352.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=274

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 176/269 (65%), Gaps = 10/269 (4%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVI-------KSQEVDDEWGFSYDENSDRGPSHWGELRP-EWWQC  217
            M KL S+  +   +T ++        S+EV+DE  F+YDE S  GP +WG ++P EW+ C
Sbjct  1    MAKLTSLVLIFSLLTAIVLLSSCPAMSEEVEDETEFNYDEASPLGPPNWGHIKPNEWFLC  60

Query  218  SAGKMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
              G MQ+PIDL  + V  SNLGP+Q  Y    ATL+N G+ + +       YL I+G +Y
Sbjct  61   KNGTMQSPIDLRDEVVQISNLGPLQTNYNPSNATLKNRGHDVKVELMSNSSYLQIDGTQY  120

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
               Q HWH PSEH +NG R+DLE HLVH +     AV+ V+Y IG  P+P LSL+EDDL+
Sbjct  121  ELLQFHWHTPSEHTINGVRFDLELHLVHQTPLNETAVIGVLYTIG-MPDPFLSLLEDDLE  179

Query  578  KLA-ETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
             ++  T G ++ +G +DPN +     +YYRYMGSLTTPPC+E V WTVI+ ++SV+++Q+
Sbjct  180  AISNNTAGEERAVGVIDPNQINFNTTKYYRYMGSLTTPPCSENVTWTVIKEVKSVSQEQI  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKVD  841
             L++ A+HD+   NARPLQ +N+R V+++
Sbjct  240  ELLQAAVHDDYDYNARPLQPLNNRLVQLN  268



>ref|XP_010458032.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 174/259 (67%), Gaps = 3/259 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
             + LFSI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+
Sbjct  12   FVALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWEMCGKGEMQS  71

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q+H
Sbjct  72   PIDLMNERVNIGSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIKINGFQYELQQLH  131

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH VNG R+ LE H+VH    GR+AV+ V+Y+IG     I SL E++L+ +AE  
Sbjct  132  WHSPSEHTVNGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEME  190

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +K +G +DP  ++   R+YYRY GSLTTPPCT+ V WTV+R +R+VT++QV L+R A+
Sbjct  191  EAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKVRTVTRKQVKLLRVAV  250

Query  776  HDESKTNARPLQTINDRFV  832
            HD+S +NARP+Q  N R V
Sbjct  251  HDDSNSNARPVQPTNKRTV  269



>ref|XP_010488326.1| PREDICTED: alpha carbonic anhydrase 7 [Camelina sativa]
Length=276

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 174/259 (67%), Gaps = 3/259 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
             + LFSI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+
Sbjct  12   FVALFSIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWEMCGKGEMQS  71

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL ++ V + S+LG +   Y    ATL+N G+ +ML    G   + ING +Y  +Q+H
Sbjct  72   PIDLMNERVNIGSHLGRLNRDYQPSNATLKNRGHDIMLKLEDGAGSIKINGFQYELQQLH  131

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH VNG R+ LE H+VH    GR+AV++V+Y+IG     I SL E++L+ +AE  
Sbjct  132  WHSPSEHTVNGRRFALELHMVHEGKKGRMAVVSVLYKIGRADTFIRSL-ENELEGIAEME  190

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +K +G +DP  ++   R+YYRY GSLTTPPCT+ V WTV+R +R+VT++QV L+R A+
Sbjct  191  EAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVRKVRTVTRKQVKLLRVAV  250

Query  776  HDESKTNARPLQTINDRFV  832
            HD+S +NARP+Q  N R V
Sbjct  251  HDDSNSNARPVQPTNKRTV  269



>ref|XP_002282495.2| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI16339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/260 (46%), Positives = 171/260 (66%), Gaps = 4/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            M  +   +F ++ V H     SQEV+DE  F Y++ SD+GP  WGE+  EW  C  G MQ
Sbjct  5    MTHILLCSFFIVLVLHACPAISQEVEDEKEFDYEKGSDKGPDKWGEIHEEWSTCKHGNMQ  64

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            +PIDL  + V V S+LG +Q  Y    ATL+N G+ M LSW      + ING +Y  +Q 
Sbjct  65   SPIDLLHERVQVVSHLGRLQRSYKPSQATLKNRGHDMKLSWEGDAGSIQINGTKYELKQC  124

Query  413  HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            HWH PSEH VNG R+DLE H++H +  G+ +V+ +MY+IG   +  LS + D L+ L+++
Sbjct  125  HWHSPSEHTVNGKRFDLELHMLHETPSGKTSVVGIMYKIGRA-DSFLSTLTDHLEALSDS  183

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
               ++ +G +DP  ++   R+YYRYMGSLTTPPCTE V+WT++  +R+VT++QV L+R A
Sbjct  184  SDQERDVGVVDPRHIKIGSRKYYRYMGSLTTPPCTEDVIWTIVNKVRTVTREQVNLLRVA  243

Query  773  IHDESKTNARPLQTINDRFV  832
            +HD+S +NARP+Q IN R V
Sbjct  244  VHDDSGSNARPIQPINRRSV  263



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 169/257 (66%), Gaps = 3/257 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +FSI  L+L  +    S+EV+ E  F Y+ENS RGP+ WGE+ PEW  CS G MQ+PID+
Sbjct  12   IFSI-ILVLQYSCPATSREVEYESEFDYNENSARGPARWGEIHPEWRACSNGSMQSPIDM  70

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             ++ V + S+LG ++  Y    ATL N G+ MML W      + ING  Y  +Q HWH P
Sbjct  71   SNERVNIVSHLGRLKRSYKPCNATLRNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSP  130

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH +NG RYDLE HLVH S D ++AV+ +MY+IG  P+  LS + D L  + +    + 
Sbjct  131  SEHTINGRRYDLEVHLVHESADDKVAVIGIMYKIGR-PDSFLSSLLDHLASITDITEGES  189

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
              G +DP  ++   R+YYRY+GSLT PPC E VVW+++R +R+VT++QV L+R A+HD S
Sbjct  190  VAGVIDPRHIKIGSRKYYRYIGSLTVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDAS  249

Query  788  KTNARPLQTINDRFVKV  838
             TNARPLQ IN R V++
Sbjct  250  DTNARPLQPINKRSVQL  266



>ref|XP_003539200.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=276

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 174/256 (68%), Gaps = 4/256 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            A + LS   +I S EV+DE  F+YD  S+ GP +WG ++PEW  C  G MQ+PIDL ++ 
Sbjct  16   ALVFLSCP-LIMSHEVEDESEFNYDVKSEIGPFNWGHIKPEWSLCKIGSMQSPIDLLNER  74

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V + S+LG +Q  Y    ATL+N G+ + L W  G  +L ING  Y+ +Q HWH PSEH 
Sbjct  75   VQIVSHLGTLQMNYQPSNATLKNRGHDIKLGWLAGTSFLQINGTEYVLKQFHWHSPSEHT  134

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
            ++G R DLE H+VH +  G+ AV+ ++Y+ G  P+P LSL+ + LK ++ + G ++ +G 
Sbjct  135  IDGRRLDLELHMVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLKAISNSTGAEREVGV  194

Query  620  LDPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
            +DP L++       YYRY+GSLTTPPCTE + WT+++ ++SV+K+Q+ L+R+A+HD+   
Sbjct  195  MDPRLVKIGTSTTLYYRYIGSLTTPPCTENIAWTMLKKVKSVSKEQIRLLRDAVHDDFDA  254

Query  794  NARPLQTINDRFVKVD  841
            NARPLQ IN+R V+++
Sbjct  255  NARPLQPINNRLVQLN  270



>ref|XP_010046439.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85766.1| hypothetical protein EUGRSUZ_B02522 [Eucalyptus grandis]
Length=278

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 178/258 (69%), Gaps = 3/258 (1%)
 Frame = +2

Query  71   LFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            +    FL+L++   +  S+EV+DE  F+YD  S+RGP+ WGE+R EW  CS+G MQ+PID
Sbjct  9    VLCTIFLVLALHVGLTTSEEVEDESEFNYDAGSERGPARWGEIRREWGMCSSGSMQSPID  68

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L S+ V V ++LG ++  Y    ATL+N G+ + L W  G   + +NG  YL +Q HWH 
Sbjct  69   LSSERVQVVAHLGRLKRCYKASNATLKNRGHDITLRWEGGAGSIYVNGTWYLLKQCHWHS  128

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH VNG R+DLE H+VH S +G++AV+ +MY++G  P+  LS++   ++ +A+    +
Sbjct  129  PSEHAVNGRRFDLELHMVHESLNGKVAVVGIMYKLGR-PDTFLSMMMKHIEDIADIHEAE  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K +G ++P  ++   R+YYRY+GSLT PPCTE V+WT+++ +R+V ++QV L+R A+ D+
Sbjct  188  KAVGIVNPKRIKIGSRKYYRYVGSLTVPPCTENVLWTIVQKVRTVAREQVKLLRKAVRDD  247

Query  785  SKTNARPLQTINDRFVKV  838
            S+ NARPLQ IN R V++
Sbjct  248  SEFNARPLQPINIRSVQL  265



>ref|XP_004506040.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=298

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 183/263 (70%), Gaps = 5/263 (2%)
 Frame = +2

Query  62   MLKLFSI--AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            ++ +FS+  A +LLS    I SQE++++  FSYDE+S+ GP HWG+++PEW  C  G+ Q
Sbjct  11   LVSIFSLLTALVLLSSCPAI-SQELENQNEFSYDEDSEIGPQHWGDIKPEWSLCKYGERQ  69

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            +PIDL +K V + S LGP+Q       A L+N G+ + L +     YL I+GI+Y  +Q 
Sbjct  70   SPIDLINKLVEIVSYLGPLQIRSKPSNAILKNRGHDIKLEFTENSNYLLIDGIQYALKQF  129

Query  413  HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            HWH PSEH +NG R DLE H+VH +  G+IAV+ V+Y+IG+ P+ +LSL+  DL+ ++  
Sbjct  130  HWHSPSEHTINGRRLDLELHMVHQTPSGQIAVIGVLYRIGK-PDTLLSLLRKDLRAISGQ  188

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
             G ++ +G ++P L++     YYRY GSLTTP C++ + WT+IR ++SV+K+Q+ L+R A
Sbjct  189  TGEERVVGVINPKLVKLDRDEYYRYNGSLTTPACSQNITWTIIREVKSVSKKQIELLRVA  248

Query  773  IHDESKTNARPLQTINDRFVKVD  841
            +HDES +NARPLQ +NDR V+++
Sbjct  249  VHDESDSNARPLQPLNDRLVQLN  271



>ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 172/256 (67%), Gaps = 4/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F    LLLS + +  S+EVD+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V V S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH ++G R+ LEAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      
Sbjct  131  EHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDAT  189

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV L+R A+HDES 
Sbjct  190  VGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRLLRVAVHDESN  249

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ IN R VK+
Sbjct  250  TNARPLQPINMRSVKL  265



>ref|XP_010109499.1| hypothetical protein L484_007519 [Morus notabilis]
 gb|EXC22910.1| hypothetical protein L484_007519 [Morus notabilis]
Length=274

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 177/263 (67%), Gaps = 7/263 (3%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            + ++F  +F  + V H     S EV+DE  F+Y++ S++GP  WGE+RPEW  CS G +Q
Sbjct  5    VTQIFLCSFFTILVLHFCPALSDEVEDESEFNYEQGSEKGPDRWGEIRPEWSTCSNGTLQ  64

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQ  409
            +PIDL  K V V S+L   +  Y    ATL+N G+ +ML W  G+  Y+ ING +YL +Q
Sbjct  65   SPIDLLDKRVEVISHLEITKRNYKPSNATLKNRGHDIMLKWNSGEAGYIEINGTQYLIQQ  124

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             HWH PSEH +NG ++DLE H VH +  G+  V  ++YQ GE P+P LS +ED L+++++
Sbjct  125  CHWHSPSEHTINGNKFDLELHAVHQTPTGQTFVFGILYQFGE-PDPFLSSVEDYLEEISD  183

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
            T   ++ I  +DPN ++   +RYY Y+GSLTTPPCTE VVW V   IR+V+++QV+L+R 
Sbjct  184  TG--EEIIVVIDPNKIKIGSQRYYNYIGSLTTPPCTENVVWIVASEIRTVSREQVSLLRV  241

Query  770  AIHDESKTNARPLQTINDRFVKV  838
            A+HD+S TNARP+Q  N R VK+
Sbjct  242  AVHDDSDTNARPIQETNGRTVKL  264



>gb|KDO81077.1| hypothetical protein CISIN_1g038655mg [Citrus sinensis]
Length=275

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 172/256 (67%), Gaps = 4/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F    LLLS + +  S+EVD+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V V S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH ++G R+ LEAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      
Sbjct  131  EHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDAT  189

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV ++R A+HDES 
Sbjct  190  VGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESN  249

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ IN R VK+
Sbjct  250  TNARPLQPINMRSVKL  265



>ref|XP_008802055.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=275

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 169/251 (67%), Gaps = 3/251 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            +A L    T  + SQEV+DE  FSY+  S+ GP  WGEL  EW  C  GK+Q+PIDL  +
Sbjct  14   LAILFFFSTSPVASQEVEDEKEFSYEIGSETGPERWGELHEEWSACGKGKLQSPIDLSDE  73

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V V    GP+++ Y    A ++N G+ + + W      + ING +Y+ +Q+HWH PSEH
Sbjct  74   RVQVLHQSGPLRSSYHPADAVMKNRGHDIEIKWENQTGGVWINGTKYVLKQLHWHSPSEH  133

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK-GI  613
             +NG RY LE H+VH S D +IAV+ ++Y+IG  P+P L+ +ED +KK+ +    ++  +
Sbjct  134  TINGRRYSLELHMVHQSADEKIAVVGILYKIGR-PDPFLAKMEDYIKKMEDMEESEEEKL  192

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
            G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+IR +R+V KQQV L+R A+HD ++ 
Sbjct  193  GLVDPGDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVAKQQVNLLREAVHDHAEK  252

Query  794  NARPLQTINDR  826
            NARPLQ INDR
Sbjct  253  NARPLQLINDR  263



>ref|XP_006303231.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
 gb|EOA36129.1| hypothetical protein CARUB_v10012300mg [Capsella rubella]
Length=276

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 171/259 (66%), Gaps = 3/259 (1%)
 Frame = +2

Query  62   MLKLFSI-AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
             + LFSI  F +L  +      EV+DE  F+Y EN ++GP  WGEL+PEW  C  G+MQ+
Sbjct  12   FVALFSIFTFNVLISSAASSHGEVEDEHEFNYKENDEKGPERWGELKPEWEMCGKGEMQS  71

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL ++ V + S+LG +   Y    ATL+N G+ +M+ +  G   + ING  Y  +Q+H
Sbjct  72   PIDLMNERVNIVSHLGRLNRDYEPSNATLKNRGHDIMIKFEDGAGNIKINGFEYELQQLH  131

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH +NG R  LE H+VH   +GR+AV+ V+Y+IG     I SL E++L+ +AE  
Sbjct  132  WHSPSEHTINGRRLALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEME  190

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +K +G +DP  ++   R+YYRY GSLTTPPCT+ + WTV+R IR+VT++QV L+R A+
Sbjct  191  EAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNITWTVVRKIRTVTRKQVKLLRVAV  250

Query  776  HDESKTNARPLQTINDRFV  832
            HD+S +NARP+Q  N R V
Sbjct  251  HDDSNSNARPVQPTNKRTV  269



>ref|XP_010475599.1| PREDICTED: alpha carbonic anhydrase 7-like [Camelina sativa]
Length=277

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 172/256 (67%), Gaps = 3/256 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
              SI  + +S++    S  EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+PID
Sbjct  16   FISIFTINVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGELKPEWELCGKGEMQSPID  75

Query  248  LESKPVVY-SNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L ++ V+  S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q+HWH 
Sbjct  76   LMNERVIIGSHLGRLNRDYQPSNATLKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHS  135

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH VNG R+ LE H+VH    GR+AV+ V+Y+IG     I SL E++L+ +AE    +
Sbjct  136  PSEHTVNGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGIAEMEDAE  194

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K +G +DP  ++   R+YYRY GSLTTPPCT+ V WTV++ +R+VT++QV L+R A+HD+
Sbjct  195  KNVGVIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWTVVKKVRTVTRKQVKLLRVAVHDD  254

Query  785  SKTNARPLQTINDRFV  832
            S +NARP+Q IN R V
Sbjct  255  SNSNARPVQPINKRTV  270



>gb|KHN38743.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=276

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 173/256 (68%), Gaps = 4/256 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            A + LS   +I S EV+DE  F+YD  S+ GP +WG ++PEW  C  G MQ+PIDL ++ 
Sbjct  16   ALVFLSCP-LIMSHEVEDESEFNYDVKSEIGPFNWGHIKPEWSLCKIGSMQSPIDLLNER  74

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V + S+LG +Q  Y    ATL+N G+ + L W  G  +L ING  Y+ +Q HWH PSEH 
Sbjct  75   VQIVSHLGTLQMNYQPSNATLKNRGHDIKLGWLAGTSFLQINGTEYVLKQFHWHSPSEHT  134

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
            ++G R DLE H+VH +  G+ AV+ ++Y+ G  P+P LSL+ + LK ++ + G ++ +G 
Sbjct  135  IDGRRLDLELHMVHETPSGQTAVIGILYKAGRRPDPFLSLLTNHLKAISNSTGAEREVGV  194

Query  620  LDPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
            +DP L++       YYRY+GSLTTPPCTE + WT+++ ++ V+K+Q+ L+R+A+HD+   
Sbjct  195  MDPRLVKIGTSTTLYYRYIGSLTTPPCTENIAWTMLKEVKFVSKEQIRLLRDAVHDDFDA  254

Query  794  NARPLQTINDRFVKVD  841
            NARPLQ IN+R V+++
Sbjct  255  NARPLQPINNRLVQLN  270



>ref|XP_008462774.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 173/253 (68%), Gaps = 4/253 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            AF+LL ++    SQEVDDE GF+YDE+ ++GPS WGEL  EW +C++GKMQ+PIDL  K 
Sbjct  16   AFVLL-LSRPAVSQEVDDESGFNYDEDGNKGPSRWGELNVEWQECNSGKMQSPIDLLHKR  74

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V +       +  Y    ATL+N G+ +ML W     Y+ ING RY  +Q HWH PSEH 
Sbjct  75   VQIVPKFVDFKIAYKPTNATLKNRGHDIMLKWSDDAGYIEINGTRYFLKQCHWHSPSEHT  134

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
            +NG ++ LEAHLVH S++G IAV+ ++YQ G  P+  LS I++ L++++ET    + +  
Sbjct  135  INGEKFALEAHLVHQSHNGHIAVIGILYQFGH-PDYFLSTIKEHLEEISETNEYIE-VND  192

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            +DP+LL+     YY+Y GSLTTPPCT+ V+W + + +RSV   QV L+R A+HD+S TNA
Sbjct  193  IDPSLLRMDISSYYQYFGSLTTPPCTQNVLWIIAKKVRSVAPSQVELLRVAVHDDSNTNA  252

Query  800  RPLQTINDRFVKV  838
            RPLQ +N+R +++
Sbjct  253  RPLQPLNNRMIQL  265



>ref|XP_006409842.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
 gb|ESQ51295.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
Length=271

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 172/266 (65%), Gaps = 6/266 (2%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIK----SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            MD   +    FLLL++   I      +EV+DE  FSY+ N + GP  WG+L+PEW  C  
Sbjct  1    MDKSAIQCFFFLLLTIIVTISFSNAQREVEDESEFSYERNEENGPEKWGKLKPEWKMCGK  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            G+MQ+PIDL ++ V V  +LG +   Y    ATL+N G+ MML +  G   + ING  Y 
Sbjct  61   GEMQSPIDLMNERVRVVYHLGRLTRDYKPSNATLKNRGHDMMLRFEEGSGSIKINGTEYQ  120

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
              Q+HWH PSEH +NG R+ +E HLVH S +GR+AV+ V+Y+IG  P+  L L+E+ L  
Sbjct  121  LLQLHWHSPSEHTINGRRFAMELHLVHESINGRMAVVTVLYKIGR-PDSFLRLLENKLLA  179

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            + +    +K IG +DP  ++   R+YYRY+GSLTTPPCT+ V WTV++ +R+V+K QV L
Sbjct  180  ITDQNEKEKNIGLIDPKKIKFGSRKYYRYVGSLTTPPCTQNVTWTVVKKVRTVSKNQVRL  239

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            +R A+HD+S +NARP+Q  N R V +
Sbjct  240  LRVAVHDDSNSNARPVQPTNKRVVNL  265



>ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis]
Length=272

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 164/244 (67%), Gaps = 3/244 (1%)
 Frame = +2

Query  110  VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  286
            +  SQEV+DE  F Y  NS++GP+ WGEL  EW  CS G MQ+PIDL ++ V + S LG 
Sbjct  24   LTSSQEVEDEHEFDY-RNSEKGPNRWGELHHEWGACSNGSMQSPIDLFNERVEIVSYLGR  82

Query  287  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            +   Y    ATL+N G+ MML W  G   L ING  Y+ +Q HWH PSEH VNG  Y LE
Sbjct  83   LIRSYKPSNATLKNRGHDMMLQWETGAGTLRINGTEYILKQCHWHSPSEHTVNGKSYALE  142

Query  467  AHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
             H+VH S DG+IAV+ +MY IG  P+  LS + D L+ +A T   +   G ++P  ++  
Sbjct  143  LHMVHESLDGKIAVVGIMYTIGR-PDSFLSSLTDRLQLVAGTREYETAAGTVNPKDIKIG  201

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
             R+YYRYMGSLT PPCTE V+WT++R +R+VT++QV L+R A+HDES +NARP+Q IN R
Sbjct  202  SRKYYRYMGSLTVPPCTENVLWTIVRKVRTVTREQVRLLRVAVHDESNSNARPIQGINGR  261

Query  827  FVKV  838
             V++
Sbjct  262  SVQL  265



>ref|XP_002892434.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68693.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 174/263 (66%), Gaps = 2/263 (1%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  226
            I+ +  + LFS+  ++   +      EV+DE  F+Y +N ++GP  WG+L+PEW  C  G
Sbjct  7    IQCIFFVALFSMFAIVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKG  66

Query  227  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  403
            +MQ+PIDL ++ V V S+LG +   Y    ATL+N G+ +ML +  G   + ING RY  
Sbjct  67   EMQSPIDLMNERVNVVSHLGRLNRDYKPSNATLKNRGHDIMLKFEYGAGSIKINGFRYEL  126

Query  404  RQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            +Q+HWH PSEH +NG R+ LE H+VH    GR+AV+ V+Y+IG     I SL E++L+ +
Sbjct  127  QQLHWHSPSEHTINGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-ENELEGI  185

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
            AE    +K +G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+
Sbjct  186  AEMEEAEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLL  245

Query  764  RNAIHDESKTNARPLQTINDRFV  832
            R A+HD++ +NARP+Q  N R V
Sbjct  246  RVAVHDDANSNARPVQPTNKRMV  268



>gb|KGN64825.1| hypothetical protein Csa_1G120410 [Cucumis sativus]
Length=254

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 172/247 (70%), Gaps = 2/247 (1%)
 Frame = +2

Query  101  VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSN  277
            ++ V  SQEV+DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V + S 
Sbjct  2    ISRVAISQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASL  61

Query  278  LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY  457
               I+  Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+
Sbjct  62   FTNIEFNYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRF  121

Query  458  DLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
             LEAHLVH S +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +  +D ++L
Sbjct  122  ALEAHLVHQSQNGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDTCE-EKALDVIDLSML  180

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            + +   YYRY+GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S TNARPLQ I
Sbjct  181  KMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPI  240

Query  818  NDRFVKV  838
            NDR +++
Sbjct  241  NDRKIQL  247



>ref|XP_009356885.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 171/256 (67%), Gaps = 3/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F  A +LL+  H   S+EV+D+  F+Y+E+S++GP  WGE+R EW  CS G MQ+PIDL 
Sbjct  13   FLFALVLLNSRHAT-SEEVEDQREFNYEEDSEKGPLRWGEIRQEWSMCSKGSMQSPIDLS  71

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
               V + S+LG +++ Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVELVSHLGILKSNYRPCNATLKNRGHDMMLKWETDAGFILLNGTLYKLKQCHWHASS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+DLE HLVH S  G IAV  V+Y+IG  P+P LS I D L  +++T   ++ 
Sbjct  132  EHTINGKRFDLEVHLVHESATGNIAVTGVLYRIG-APDPFLSSIMDYLADVSDTTEEEEV  190

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++    +YYRY+GSLTTPPCT+ V+WT+ R + +V+++QV  +R A+HD+S 
Sbjct  191  VGMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKSLRVAVHDDSD  250

Query  791  TNARPLQTINDRFVKV  838
            TNARP+Q  N R V++
Sbjct  251  TNARPVQPRNRRIVQL  266



>ref|XP_006433902.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
 gb|ESR47142.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
Length=275

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 170/256 (66%), Gaps = 4/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  250
            F    LLLS + +  S+E D+E  F+Y++  + GP  WGE+  EW  C  G MQ+PIDL 
Sbjct  13   FFAVILLLSGSAM--SKEFDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL  70

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
              + VV S+LG ++  Y    ATL N G+ +ML W  G   + ING +Y+ +Q HWH PS
Sbjct  71   NERVVVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS  130

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH ++G R+ LEAH+VH S+DG++AV+ ++Y+IG  P+  L+ I D L+ ++ +      
Sbjct  131  EHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGR-PDSFLASISDHLRNISGSNERDAT  189

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++    +YYRY+GSLT PPCTE V WT++R +RSVT++QV ++R A+HDES 
Sbjct  190  VGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESN  249

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ +N R VK+
Sbjct  250  TNARPLQPLNMRSVKL  265



>ref|XP_008462808.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 172/256 (67%), Gaps = 5/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F  AFLL+S   +  SQEV+++  F Y+ N  RGP+HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  14   FFFAFLLVSWPAM--SQEVENQREFDYNTNGTRGPAHWGDLRPEWHNCNTGRMQSPIDLL  71

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V + S+    Q  Y    ATL+N G+ MML W     ++ +N  RY  RQ+HWH PS
Sbjct  72   NQRVRIVSHFTDFQIDYRSSNATLKNRGHDMMLQWSGAAGHMEVNRSRYFLRQIHWHSPS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+ LEAHLVH S  G IAV+ ++Y IG+ P+  LS +     +++ T    K 
Sbjct  132  EHTLNGKRFALEAHLVHQSQTGNIAVIGILYNIGQ-PDYFLSTMRQHFVEISATQR-DKL  189

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +  ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+V  +QV L+R A+HD+S 
Sbjct  190  LNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPEQVNLLRVAVHDDSN  249

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ +N+R V++
Sbjct  250  TNARPLQPLNNRNVQL  265



>ref|XP_006417733.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
 gb|ESQ36086.1| hypothetical protein EUTSA_v10008451mg [Eutrema salsugineum]
Length=274

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 181/268 (68%), Gaps = 11/268 (4%)
 Frame = +2

Query  65   LKLFSIA----FLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +K+ SI     F+ +S+T V       EV+DE  FSY++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCLFFFIFVSITSVSTQPGHGEVEDETEFSYEKNGEKGPENWGTLKPEWEMCGN  60

Query  224  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            GKMQ+PIDL +K V+   NLG ++++Y+   AT++N G+ +ML +  G   LGI  NG  
Sbjct  61   GKMQSPIDLTAKRVLIDHNLGSLRSHYLPYNATIKNRGHDIMLKFEGGNAGLGIVINGTA  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH + G R+ LE H+VH S DGRIAV+A +Y++G  P+  L  +E  L
Sbjct  121  YQLQQIHWHTPSEHTIGGRRFVLEEHVVHESKDGRIAVVAFLYKLGR-PDSFLLSLESQL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
            K++ +T   ++ I  +DP  +    R YYRY+GSLTTPPC+E V+W++ + +R+VT +Q+
Sbjct  180  KRITDTHESEEYIRMVDPIRVNFESRLYYRYLGSLTTPPCSENVIWSISKEMRTVTIKQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKV  838
             L+R A+HD+S TNARPLQ IN+R VK+
Sbjct  240  ELLRVAVHDQSNTNARPLQRINERLVKL  267



>ref|XP_008462825.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cucumis melo]
Length=271

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 175/253 (69%), Gaps = 5/253 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            AFLL+S   +  SQEV+DE  F Y+E  ++GP+HWG+L+PEW  C  G+MQ+PIDL  + 
Sbjct  16   AFLLVSRLAI--SQEVEDETEFDYNEEGEKGPTHWGDLKPEWHSCKTGEMQSPIDLLHER  73

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V + S    I   Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH 
Sbjct  74   VRIVSLFTDIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHT  133

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
            +NG R+ LEAHLVH S +G  AV+ V+Y+IG  P+  LS ++++L++++ T   +K +  
Sbjct  134  INGKRFALEAHLVHQSQNGNYAVIGVVYKIGR-PDSFLSKMKENLEEISNTHE-EKALDV  191

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            +D +LL+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +Q+ L+R A HD+S TNA
Sbjct  192  IDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQIKLLRVAAHDDSNTNA  251

Query  800  RPLQTINDRFVKV  838
            RPLQ INDR +++
Sbjct  252  RPLQPINDRKIQL  264



>gb|KGN64826.1| hypothetical protein Csa_1G120420 [Cucumis sativus]
Length=275

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 175/256 (68%), Gaps = 5/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F  AF+L+S   +  SQEV+++  F Y+ N  RGP HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  14   FFFAFILVSWPAM--SQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQSPIDLL  71

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V + S+    Q  Y    ATL+N G+ +ML W     ++ +N  RY  RQ+HWH PS
Sbjct  72   NQRVRIVSHFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQIHWHSPS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+ LEAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    K 
Sbjct  132  EHTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRQHLVEISGTQR-DKL  189

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +  ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+VT +QV L+R A+HD+S+
Sbjct  190  LNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLRVAVHDDSE  249

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ +N+R V++
Sbjct  250  TNARPLQPLNNRNVQL  265



>ref|XP_004139553.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004160915.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=274

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 175/256 (68%), Gaps = 5/256 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F  AF+L+S   +  SQEV+++  F Y+ N  RGP HWG+LRPEW  C+ G+MQ+PIDL 
Sbjct  13   FFFAFILVSWPAM--SQEVENQREFDYNTNGTRGPIHWGDLRPEWHNCNTGQMQSPIDLL  70

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            ++ V + S+    Q  Y    ATL+N G+ +ML W     ++ +N  RY  RQ+HWH PS
Sbjct  71   NQRVRIVSHFTDFQIDYGSSNATLKNRGHDIMLKWRSAAGHMEVNRTRYFLRQIHWHSPS  130

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+ LEAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T    K 
Sbjct  131  EHTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRQHLVEISGTQR-DKL  188

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +  ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+VT +QV L+R A+HD+S+
Sbjct  189  LNMVNPSLLKMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVTPEQVNLLRVAVHDDSE  248

Query  791  TNARPLQTINDRFVKV  838
            TNARPLQ +N+R V++
Sbjct  249  TNARPLQPLNNRNVQL  264



>ref|XP_007150177.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
 gb|ESW22171.1| hypothetical protein PHAVU_005G133000g [Phaseolus vulgaris]
Length=271

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 180/265 (68%), Gaps = 3/265 (1%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  226
            +E +  + L   + L LS++  + S+EVDDE  FSY+E S+ GPSHWG++ PEW  C+ G
Sbjct  1    MEKLATMVLICCSLLFLSLS--VMSREVDDESEFSYEEESENGPSHWGDIHPEWRLCNNG  58

Query  227  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  403
             MQ+PIDL ++ V + S LG +Q  Y    A++ N G+ +ML W  G  +L IN  +Y+ 
Sbjct  59   SMQSPIDLLNERVEIVSQLGRLQMNYQPSNASIRNRGHDIMLEWVAGAGHLQINETKYVL  118

Query  404  RQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
             Q HWH PSEH ++G R+DLE H+VH +  G+  V+ ++Y+IG TP+  LS +   +K +
Sbjct  119  NQCHWHSPSEHTIDGKRFDLELHIVHETPSGQTTVIGILYKIGRTPDSFLSSLTSHIKVI  178

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
            + +   ++ +G +DP  ++   ++YYRYMGSLT PPCTE V WT++R IRSV+K+QV L+
Sbjct  179  SNSTEAERMVGVVDPRQIKIFYKQYYRYMGSLTIPPCTENVSWTIVREIRSVSKEQVRLL  238

Query  764  RNAIHDESKTNARPLQTINDRFVKV  838
            R A+ DES+TNARPLQ IN+R +++
Sbjct  239  RAAVDDESETNARPLQLINNRLLQL  263



>ref|XP_008385339.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 173/256 (68%), Gaps = 3/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  250
            F IA +LL+  H   S+EV+D+  F+Y+E+S++GP  WGE+R +W  CS G MQ+PIDL 
Sbjct  13   FLIALVLLNSRHAT-SEEVEDQREFNYEEDSEKGPVRWGEIRQDWSMCSKGSMQSPIDLL  71

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            + +  + S+LG +++ Y    ATL+N G+ MML W     ++ +NG  Y  +Q HWH  S
Sbjct  72   DDRVELVSHLGILKSNYRPCNATLKNRGHDMMLKWEADPGFILLNGTLYKLKQCHWHASS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R+DLE HLVH S  G IAV  ++Y+IG  P+P LS I D L  +++T   ++ 
Sbjct  132  EHTINGKRFDLEVHLVHESATGNIAVTGILYRIG-APDPFLSSIMDYLADVSDTTEDEEV  190

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++    +YYRY+GSLTTPPCT+ V+WT+ R + +V+++QV  +R A+HD+S 
Sbjct  191  VGMVDPRQMKTSSTKYYRYIGSLTTPPCTQNVIWTIAREVSTVSEEQVKALRVAVHDDSD  250

Query  791  TNARPLQTINDRFVKV  838
            TNARP+Q  N R V++
Sbjct  251  TNARPVQPRNRRIVQL  266



>ref|XP_010414580.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 170/269 (63%), Gaps = 11/269 (4%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  211
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFIILTILGTIVSCSSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  212  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  385
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLTNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  386  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIE  565
            G  Y   Q+HWH PSEH VNG R+ LE H+VH S +G +AV+ V+Y+IG  PN  L L+E
Sbjct  121  GTEYKLLQLHWHSPSEHTVNGKRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLE  179

Query  566  DDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTK  745
              L  + +    ++ +  +DPN ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+K
Sbjct  180  QKLVAITDQHDAERNVVMIDPNKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSK  239

Query  746  QQVALIRNAIHDESKTNARPLQTINDRFV  832
             QV L+R A+HD+S +NARP+Q  N R +
Sbjct  240  SQVNLLRVAVHDDSNSNARPVQPTNKRVI  268



>ref|XP_009795833.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like, partial 
[Nicotiana sylvestris]
Length=226

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 158/220 (72%), Gaps = 3/220 (1%)
 Frame = +2

Query  68   KLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            K+  I+FL LS   + +S EVDDE  FSYDE S+ GP++WG +RP+W  CS GK+Q PID
Sbjct  8    KMLFISFLFLSSVFLARSGEVDDESEFSYDEKSENGPANWGNIRPDWKDCS-GKLQPPID  66

Query  248  L-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L E +  V S LG +Q  Y    ATL N G+ +ML W  G  YL ING +Y  +Q+HWH 
Sbjct  67   LFELRAEVVSKLGILQTDYKPSNATLLNRGHDIMLRWDDGG-YLKINGTQYQLKQLHWHT  125

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH VNG R++LE+HLVH SN+G+ AV+ ++Y+IG  P+P LS+IE+DLK  A+  G++
Sbjct  126  PSEHTVNGERFNLESHLVHESNNGKFAVIGIIYEIGLWPDPFLSMIENDLKVPADKKGIE  185

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIR  724
            +  G +DPN ++  G++Y+RY+GSLTTPPCTEGVVWT+ R
Sbjct  186  RATGTIDPNQIKLDGKQYFRYIGSLTTPPCTEGVVWTIDR  225



>ref|XP_010916592.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=275

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 169/259 (65%), Gaps = 3/259 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +L    +A L    T  + SQEV+DE  FSY+  S+ GP HWGEL  EW  C  GK+Q+P
Sbjct  8    LLSSIFLAILFFFSTSPVTSQEVEDEKDFSYESGSETGPEHWGELHTEWSACGKGKLQSP  67

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL  + V V   LG +++ Y    A ++N G+ + + W      + ING +Y  +Q+HW
Sbjct  68   IDLSDERVQVVHQLGQLRSSYRPADAVMKNRGHDIEIKWENHTGGIWINGTKYDLKQLHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE-TP  595
            H PSEH +N  RY LE H+VH + D + AV+ ++Y+IG  P+P L+ +E  +KK+ +   
Sbjct  128  HSPSEHTINRHRYSLELHMVHQTTDNKTAVVGILYKIGR-PDPFLAKMEKYIKKMEDMAE  186

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              ++ +G +DP  ++   R+YYRYMGSLTTPPCTEGVVWT+IR +R+V+K QV L+R A+
Sbjct  187  SEEEKLGMVDPRDVKKGSRKYYRYMGSLTTPPCTEGVVWTIIRKVRTVSKHQVNLLREAV  246

Query  776  HDESKTNARPLQTINDRFV  832
            HD ++ NARPLQ +N+R V
Sbjct  247  HDHAEMNARPLQLLNNRPV  265



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 174/267 (65%), Gaps = 9/267 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQ-------EVDDEWGFSYDENSDRGPSHWGELRPEWWQ  214
            M+   +  + FLL     VI          E +DE  F+Y+   +RGP +WG+L+PEW  
Sbjct  1    MEKSSIKCMFFLLFVCVTVISHSNAAPGDGETEDEHEFNYEMEGERGPKNWGKLKPEWKM  60

Query  215  CSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGI  391
            C  GKMQ+PIDL +K V + S+LG ++  Y    ATL+N G+ MML +  G   + + G 
Sbjct  61   CGRGKMQSPIDLLNKRVRIVSHLGRLKRDYRPSNATLKNRGHDMMLRFEDGAGRIHVKGR  120

Query  392  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDD  571
             Y  RQ+HWH PSEH +NG R+ LE H+VH S +GR AV+ ++Y+IG  P+  L  +E+ 
Sbjct  121  PYTLRQIHWHSPSEHTINGKRFALELHMVHESKNGRFAVVTILYKIGR-PDTFLQSLENG  179

Query  572  LKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ  751
            L+++++    +K IG +DP  ++   R+YYRY+GSLTTPPCT+ VVWTV++ +R+VT++Q
Sbjct  180  LEEVSDKHEAEKNIGIIDPKKIKFGSRKYYRYIGSLTTPPCTQNVVWTVLKKVRTVTREQ  239

Query  752  VALIRNAIHDESKTNARPLQTINDRFV  832
            V L+R ++HD+S +NARP+Q  N R V
Sbjct  240  VRLLRVSVHDDSNSNARPIQRRNKRRV  266



>ref|XP_009400916.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 167/247 (68%), Gaps = 2/247 (1%)
 Frame = +2

Query  98   SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYS  274
            S +H+  SQEV+DE  FSY+E S  GP  WGE+R EW  C+ G MQ+PIDL  + V V  
Sbjct  22   SRSHLATSQEVEDESEFSYEEGSPNGPQRWGEIREEWAICNNGDMQSPIDLLHERVKVLP  81

Query  275  NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTR  454
             LG ++  Y    ATL+N G+ +ML WP     + I+G  Y  +Q HWH PSEH +NG R
Sbjct  82   GLGRLRRSYRAANATLKNRGHDIMLEWPEEAGRIHIDGTDYELKQCHWHSPSEHSINGKR  141

Query  455  YDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL  634
            + LE H+VH S D R+AV+ +MY+IG  P+  L+ + + ++++A     ++ +G++DP  
Sbjct  142  FALELHMVHQSADERVAVVGIMYKIGR-PDSFLTELMEYIEEIAGNKEEERVVGFVDPRY  200

Query  635  LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQT  814
            ++   R+YYRYMGSLTTPPC +GVVWT+   IR+V+K QV+L+R A+HD+++ NARPLQ 
Sbjct  201  IKIGSRKYYRYMGSLTTPPCKQGVVWTISEKIRTVSKDQVSLLREAVHDDAENNARPLQP  260

Query  815  INDRFVK  835
            +N R ++
Sbjct  261  LNGREIQ  267



>ref|XP_008226047.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Prunus mume]
Length=275

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 172/260 (66%), Gaps = 5/260 (2%)
 Frame = +2

Query  71   LFSIAFLLLSV---THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +   +FL++ V   +    S EV+DE  F+Y+++S++GP+ WGE+R EW  C+ G MQ+P
Sbjct  8    ILVCSFLIVLVWLLSCQATSDEVEDEREFNYEDDSEKGPARWGEIRQEWSMCNKGSMQSP  67

Query  242  IDL-ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL + +  V S+LG +Q  Y    ATL+N G+ +ML W     ++ ING  Y  +Q HW
Sbjct  68   IDLLDDRVEVVSDLGRLQGSYRPCNATLKNRGHDIMLKWEADAGFIRINGTLYQLKQCHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH VN   +DLE HL+H S  G+IAV  ++Y+IGE P+P L+ I D L  ++ T  
Sbjct  128  HSPSEHTVNDKSFDLEVHLLHQSPTGKIAVTGILYKIGE-PDPFLTSIMDYLADISGTSE  186

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++    +YYRY+GSLT PPCT+ V+WT++  +RSV+ +QV L+R A+H
Sbjct  187  KQKVVGMVDPKQIKTGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVH  246

Query  779  DESKTNARPLQTINDRFVKV  838
            DES TNARP+Q  N R V++
Sbjct  247  DESDTNARPVQPRNGRVVQL  266



>ref|XP_009132759.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=268

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 172/263 (65%), Gaps = 3/263 (1%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  232
            M+   +  + F+LL++     +Q EV+DE  FSY+ N + GP  WG+L+PEW  C  G+M
Sbjct  1    MEKSSIQCLLFILLTIISCSNAQREVEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEM  60

Query  233  QTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  409
            Q+PIDL +K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN I Y   Q
Sbjct  61   QSPIDLMNKRVKIVSHLGRLTRDYKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQ  120

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
            +HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +
Sbjct  121  LHWHSPSEHTINGRRFALELHMVHESINGSMAVVTVLYKIGR-PDSFLSLLENKLCAITD  179

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +  IG +DP  ++   R+YYRY+GSLT PPCT+ V+WTVI+ +R+V++ QV L+R 
Sbjct  180  HNEAEINIGMIDPKDIKFGSRKYYRYIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRV  239

Query  770  AIHDESKTNARPLQTINDRFVKV  838
            A+HD S TNARP+Q  N R VK+
Sbjct  240  AVHDYSDTNARPVQPTNMRTVKL  262



>ref|XP_009113037.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=271

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 171/268 (64%), Gaps = 8/268 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  221  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEY  120

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
               Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L 
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLS  179

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             + + P  +K IG +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV 
Sbjct  180  AMTD-PNEEKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVK  238

Query  758  LIRNAIHDESKTNARPLQTINDRFVKVD  841
            L+R A+HD S TNARP+Q  N R VK +
Sbjct  239  LLRVAVHDHSNTNARPVQPTNMRVVKFN  266



>ref|XP_009148224.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 169/253 (67%), Gaps = 3/253 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  256
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PID+ +
Sbjct  14   IIFTLFSFSTAATSNGEVEDEREFNYKKNDDKGPDRWGEIKPEWEMCGKGELQSPIDMMN  73

Query  257  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  433
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSE
Sbjct  74   ERVKIVSHLGRLIRDYEASNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHSPSE  133

Query  434  HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  613
            H VNG R+ LE H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  794  NARPLQTINDRFV  832
            NARP+Q IN R V
Sbjct  253  NARPVQPINKRMV  265



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 172/263 (65%), Gaps = 5/263 (2%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHV---IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  226
            M+ +K   +A LL+  + +   + ++EV+DE  F+Y E S  GP HWGE+  EW  C  G
Sbjct  1    MEPIKPIFLAILLVIPSLLFSPVTTEEVEDEREFNYVEGSGVGPEHWGEIHEEWAACGNG  60

Query  227  KMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLF  403
            +MQ+PIDL  K V V  +LG ++  Y    A L N G+ +M+ W      + ING RY  
Sbjct  61   EMQSPIDLSEKKVEVLHHLGKLKRRYRPSRAVLVNRGHDIMIKWVERAGSIYINGTRYFL  120

Query  404  RQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            R  HWH PSEH +NG RY LE H+VH S+D ++AV+ ++Y+ G  P+  LS++E+ + K 
Sbjct  121  RHCHWHSPSEHTINGVRYALEGHMVHESSDKKVAVVGILYKFGR-PDRFLSMMENYVFKT  179

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
            A+  G ++ +G ++P  ++  G  YYRYMGSLTTPPCTEGVVWT+++ +++V+K+QV L+
Sbjct  180  ADKEGAEEELGIVNPKRIKLGGTEYYRYMGSLTTPPCTEGVVWTILKKVKTVSKEQVELL  239

Query  764  RNAIHDESKTNARPLQTINDRFV  832
            R A+HD+S+ NARP Q  N R V
Sbjct  240  RMAVHDDSEMNARPTQPTNYRSV  262



>emb|CDX95095.1| BnaC05g05760D [Brassica napus]
Length=272

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 168/253 (66%), Gaps = 3/253 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  256
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PIDL +
Sbjct  14   IIFTLFSFSTAATSHGEVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDLMN  73

Query  257  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  433
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING  Y  +Q+HWH PSE
Sbjct  74   ERVKIVSHLGRLIRDYEPSNATIKNRGHDIMLKFKDGAGSIKINGFHYELQQLHWHSPSE  133

Query  434  HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  613
            H VNG R+ LE H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  134  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  192

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  193  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  252

Query  794  NARPLQTINDRFV  832
            NARP+Q IN R V
Sbjct  253  NARPVQPINKRMV  265



>ref|XP_006594167.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=282

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 169/261 (65%), Gaps = 9/261 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +  +  +LL  T  I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL
Sbjct  19   MIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDL  78

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             S  V V   LG ++ YY    AT++N G+ + L W      + ING  +   Q HWH P
Sbjct  79   SSHRVRVVPKLGELKKYYTPQNATIKNRGHDIELKWEDAGS-ININGTEFFLHQCHWHSP  137

Query  428  SEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            SEH +NG RYDLE H+VH S +     + AV+ + Y+IG  P+P+L  +   +K +    
Sbjct  138  SEHTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGR-PDPVLKKLSKFIKTMVY--  194

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
            G +K IG  DP+ ++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+
Sbjct  195  GEEKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAV  254

Query  776  HDESKTNARPLQTINDRFVKV  838
            HD ++ NARP+Q IN R +++
Sbjct  255  HDHAEKNARPIQPINRRGIQL  275



>gb|KFK43125.1| hypothetical protein AALP_AA1G083600 [Arabis alpina]
Length=272

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 173/260 (67%), Gaps = 8/260 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ------EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            I FLL+  T V  S       EV+DE  F+Y +N ++GP  WG+L+PEW  C  G++Q+P
Sbjct  9    IFFLLIISTVVSLSNAATSHGEVEDEHEFNYKKNDEKGPERWGKLKPEWEMCGKGEIQSP  68

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING +Y  +Q+HW
Sbjct  69   IDLMNERVNIVSHLGRLNRNYKPSNATLKNRGHDIMLRFENGAGSIKINGSQYELQQLHW  128

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH VNG R+ LE H+VH + +GR+AV+ V+Y+IG   +  L  +E +L+ +A    
Sbjct  129  HSPSEHSVNGRRFALELHMVHEAKNGRMAVVTVLYKIGRA-DTFLGSLEKELEGIAVLEE  187

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K  G +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+H
Sbjct  188  AEKNAGIIDPKKIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKVRTVTRKQVRLLRVAVH  247

Query  779  DESKTNARPLQTINDRFVKV  838
            D+  TNARP+Q IN R VK+
Sbjct  248  DDQDTNARPVQPINKRMVKL  267



>ref|XP_007206520.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
 gb|EMJ07719.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
Length=275

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 170/256 (66%), Gaps = 3/256 (1%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-  250
            F I  +LL ++    S EV+DE  F+Y+++S++GP+ WG++R EW  C+ G MQ+PIDL 
Sbjct  13   FLIVLVLL-LSCQATSDEVEDEREFNYEDDSEKGPARWGKIRQEWSMCNKGSMQSPIDLL  71

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            + +  V S+LG +Q  Y    ATLEN G+ +ML W     ++ ING  Y  +Q HWH PS
Sbjct  72   DDRVEVVSDLGRLQGSYRPRNATLENRGHDIMLKWEADAGFIRINGTLYQLKQCHWHSPS  131

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH VN   +DLE HLVH S  G+ AV  ++Y+IGE P+P L+ I D L  ++ T   +K 
Sbjct  132  EHTVNDKSFDLEVHLVHQSPTGKNAVTGILYKIGE-PDPFLTSIMDYLADISGTCEKQKV  190

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESK  790
            +G +DP  ++A   +YYRY+GSLT PPCT+ V+WT++  +RSV+ +QV L+R A+HD S 
Sbjct  191  VGMVDPKQIKAGSIKYYRYIGSLTIPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVHDGSD  250

Query  791  TNARPLQTINDRFVKV  838
            TNARP+Q  N R V++
Sbjct  251  TNARPVQPRNRRVVQL  266



>ref|NP_172287.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
 sp|Q8L817.1|ATCA7_ARATH RecName: Full=Alpha carbonic anhydrase 7; Short=AtaCA7; Short=AtalphaCA7; 
AltName: Full=Alpha carbonate dehydratase 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM67440.1| putative storage protein [Arabidopsis thaliana]
 gb|AEE28240.1| alpha carbonic anhydrase 7 [Arabidopsis thaliana]
Length=275

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 169/258 (66%), Gaps = 2/258 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
             + LFSI  ++   +      EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+P
Sbjct  12   FVALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSP  71

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HW
Sbjct  72   IDLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHW  131

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R+ LE H+VH   + R+AV+ V+Y+IG     I SL E +L+ +AE   
Sbjct  132  HSPSEHTINGRRFALELHMVHEGRNRRMAVVTVLYKIGRADTFIRSL-EKELEGIAEMEE  190

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+H
Sbjct  191  AEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVH  250

Query  779  DESKTNARPLQTINDRFV  832
            D++ +NARP+Q  N R V
Sbjct  251  DDANSNARPVQPTNKRIV  268



>emb|CDY45963.1| BnaA09g13030D [Brassica napus]
Length=271

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 171/268 (64%), Gaps = 8/268 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  221  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIKINNVEY  120

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
               Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L 
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLS  179

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             + + P  +K IG +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV 
Sbjct  180  AMTD-PNEEKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVK  238

Query  758  LIRNAIHDESKTNARPLQTINDRFVKVD  841
            ++R A+HD S TNARP+Q  N R VK +
Sbjct  239  ILRVAVHDHSNTNARPVQPTNMRVVKFN  266



>emb|CDY45480.1| BnaC09g12980D [Brassica napus]
Length=271

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/268 (44%), Positives = 171/268 (64%), Gaps = 8/268 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS-----QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            MD   +    F+LL++   + S     +EV+DE  FSY  N + GP  WG+L+PEW  C 
Sbjct  1    MDKSSIQCFLFILLTIIVTMISCSNAQREVEDESEFSYMRNQENGPEKWGKLKPEWKMCG  60

Query  221  AGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
             G+MQ+PIDL  K V + S+LG +   Y    ATL N G+ MM+ +  G   + IN + Y
Sbjct  61   KGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNATLRNRGHDMMVRFEEGSSSIRINNVEY  120

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
               Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  P+  L+L+E+ L 
Sbjct  121  QLHQLHWHSPSEHTINGRRFALELHMVHESLNGSLAVVTVLYKIGR-PDSFLNLLENKLS  179

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             + + P  +K IG +DP  ++   R+YYRY+GSLT PPCT+ V+WTV++ +++V + QV 
Sbjct  180  AMTD-PNEEKNIGMIDPRGIKFGSRKYYRYIGSLTIPPCTQNVIWTVVKEVKTVARNQVK  238

Query  758  LIRNAIHDESKTNARPLQTINDRFVKVD  841
            ++R A+HD S TNARP+Q  N R VK +
Sbjct  239  ILRVAVHDHSNTNARPVQPTNMRVVKFN  266



>ref|XP_009103655.1| PREDICTED: alpha carbonic anhydrase 2 [Brassica rapa]
 emb|CDX71369.1| BnaC04g16040D [Brassica napus]
Length=272

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 173/266 (65%), Gaps = 5/266 (2%)
 Frame = +2

Query  53   DMDMLKLFSIAFLLLSVTHVIKS---QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            D   ++ F    L + VT +  S   +EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  2    DKSSIQCFLFILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGK  61

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            G+MQ+PIDL ++ V + S+LG +   Y    A+L+N G+ MML +      + INGI Y 
Sbjct  62   GEMQSPIDLMNERVRIVSHLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIEYQ  121

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
              Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG + +  L+L+E+ L  
Sbjct  122  LLQLHWHSPSEHTINGRRFALELHMVHESINGSMAVVTVLYKIGRS-DSFLTLLENKLSA  180

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            + +    +  IG +DP  ++   R+YYRY+GSLTTPPCT+ + WTV++ +R+V + QV L
Sbjct  181  MTDQNEAEFNIGMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRL  240

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            +R A+HD+S TNARP+Q  N R VK+
Sbjct  241  LRVAVHDDSNTNARPVQPTNKRVVKL  266



>ref|XP_010450977.1| PREDICTED: alpha carbonic anhydrase 8 [Camelina sativa]
Length=325

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 163/239 (68%), Gaps = 4/239 (2%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  301
            EV+DE  FSY++   +GP+ WG ++ EW  C  GKMQ+PIDL  K VV +  LG +++ Y
Sbjct  81   EVEDETEFSYEKKGKKGPAKWGTIKEEWKMCGTGKMQSPIDLRDKNVVVTTKLGSLRSQY  140

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +    T++N G+ +ML +  G + +GI  NG +Y  +Q+HWH PSEH +NG RY LE HL
Sbjct  141  LPSNTTIKNRGHDIMLKFKGGNKGIGITVNGTKYQLQQLHWHSPSEHTINGKRYALEKHL  200

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH S D R AV+A +Y++G + +P L  ++  LKK+ +T   ++ +G +DP  L  + + 
Sbjct  201  VHESKDKRYAVVAFLYKLGAS-DPFLLSLDKQLKKITDTHEAEEHVGIIDPKKLSFKSKL  259

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            YYRY+GSLT PPC+E V+W+V + IR+VT +QV L+R A+HD+S +NARPLQ IN R V
Sbjct  260  YYRYIGSLTAPPCSENVIWSVAKEIRTVTSKQVKLLRVAVHDDSNSNARPLQPINKRVV  318



>ref|XP_010470128.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X2 [Camelina 
sativa]
Length=276

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 170/269 (63%), Gaps = 11/269 (4%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  211
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFVILTILGTIVSCSSAAKNDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  212  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  385
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  386  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIE  565
            G  Y   Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  PN  L L+E
Sbjct  121  GTEYRLLQLHWHSPSEHTINGXRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLE  179

Query  566  DDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTK  745
              L  + +    ++ +  +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+K
Sbjct  180  HKLVAITDQHDAERNVVMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVSK  239

Query  746  QQVALIRNAIHDESKTNARPLQTINDRFV  832
             QV L+R A+HD+S +NARP+Q  N R +
Sbjct  240  SQVNLLRVAVHDDSNSNARPVQPANKRVI  268



>ref|XP_004241280.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Solanum lycopersicum]
Length=273

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 174/244 (71%), Gaps = 6/244 (2%)
 Frame = +2

Query  116  KSQEVDDEWG-FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            +S EVDD    FSYD+ ++ GP+ WGE+      C+ G +Q+PIDL++K V V SNLG +
Sbjct  24   RSLEVDDTSDEFSYDQYANNGPAKWGEISS---NCN-GNLQSPIDLDNKVVEVVSNLGIL  79

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            Q YY    ATL N G+ +ML W     YL IN  +Y   Q+HWH PSEH ++G RYD+EA
Sbjct  80   QKYYKPSNATLVNRGHDIMLRWDGDAGYLKINETQYQLLQIHWHTPSEHSIDGKRYDMEA  139

Query  470  HLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG  649
            HLVH+S+DG+IAV+A++Y+IG  P+ +L+++E DL  +A+  G +K +G +DPN+++   
Sbjct  140  HLVHMSSDGKIAVIAILYEIGLLPDDLLTILEGDLIAVADKKGAEKPMGIIDPNIIKLDV  199

Query  650  RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF  829
              YYRY+GSLTTPPCT+GVVWT+   + SVT +Q+ L+++A+ +  ++NARP+Q +N+R 
Sbjct  200  NIYYRYIGSLTTPPCTQGVVWTIDGKVNSVTARQIKLLQDAVVNGFESNARPVQPLNERS  259

Query  830  VKVD  841
            +K++
Sbjct  260  IKLN  263



>ref|XP_008462835.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cucumis melo]
Length=270

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 174/253 (69%), Gaps = 6/253 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            AFLL+S   +  SQEVD E  F Y+E  ++GP+HWG+L+PEW  C  G+MQ+PIDL  + 
Sbjct  16   AFLLVSRLAI--SQEVD-ETEFDYNEEGEKGPTHWGDLKPEWHSCKTGEMQSPIDLLHER  72

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V + S    I   Y    ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH 
Sbjct  73   VRIVSLFTDIDFDYKPTNATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHT  132

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
            +NG R+ LEAHLVH S +G  AV+ V+Y+IG  P+  LS ++++L++++ T   +K +  
Sbjct  133  INGKRFALEAHLVHQSQNGNYAVIGVVYKIGR-PDSFLSKMKENLEEISNTHE-EKALDV  190

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            +D +LL+ +   YYRY+GSLTTPPC++ V+WT++R +R+VT +Q+ L+R A HD+S TNA
Sbjct  191  IDLSLLEMQSSLYYRYIGSLTTPPCSQNVLWTIVRKVRTVTVEQIKLLRVAAHDDSNTNA  250

Query  800  RPLQTINDRFVKV  838
            RPLQ INDR +++
Sbjct  251  RPLQPINDRKIQL  263



>ref|XP_004139442.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 ref|XP_004170043.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64831.1| hypothetical protein Csa_1G120470 [Cucumis sativus]
Length=276

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 173/260 (67%), Gaps = 5/260 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
               +F    LLLS   V  SQEVD+E GF+Y+E+ ++GPSHWGEL+ EW +C  GKMQ+P
Sbjct  10   FCSIFYALVLLLSRPAV--SQEVDNESGFNYNEDGNKGPSHWGELKQEWHECKTGKMQSP  67

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL  + V +       +  Y    ATL N G+ +ML W     Y+ ING RY  +Q HW
Sbjct  68   IDLSHQRVQIVHKFVDSKIAYNPTNATLMNRGHDIMLKWSDDAGYIEINGTRYFLKQCHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG ++ LEAHLVH S++G IAV+ ++Y IG + +  LS I++ L++++ET  
Sbjct  128  HSPSEHTINGEKFALEAHLVHQSHNGNIAVIGILYDIGHS-DYFLSTIKEHLEEISETNE  186

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
              + +  +DP+L++ +   YY+Y GSLT PPCT+ V+W +++ +RSV   Q+ L+R A+H
Sbjct  187  YIE-LNDIDPSLVEMKSSIYYQYYGSLTVPPCTQNVLWIIVKKVRSVASYQLELLRVAVH  245

Query  779  DESKTNARPLQTINDRFVKV  838
            D+S TNARP+Q +N+R +++
Sbjct  246  DDSNTNARPVQPLNNRIIQL  265



>gb|KHN39018.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=278

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 165/247 (67%), Gaps = 7/247 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL S  V V   LG +
Sbjct  27   INAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGEL  86

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            + YY    AT++N G+ + L W      + ING  +   Q HWH PSEH +NG RYDLE 
Sbjct  87   KKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLEL  146

Query  470  HLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
            H+VH    ++  G+IAV+ + Y+IG  P+ +L+ +   +K + +    +K IG  DP+ +
Sbjct  147  HMVHESKRINGKGKIAVVGLFYKIGR-PDSVLNKLSKFIKTMVDEEE-EKNIGAFDPSKI  204

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+HD ++ NARP+Q +
Sbjct  205  KLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVNLLREAVHDHAEKNARPIQPL  264

Query  818  NDRFVKV  838
            N R +++
Sbjct  265  NRRGIQL  271



>ref|XP_007144378.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
 gb|ESW16372.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
Length=279

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 171/261 (66%), Gaps = 7/261 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            L  +A ++L  T  I +QEV+DE  F Y + S++GPS WGEL+ EW  C +GKMQ+PIDL
Sbjct  14   LIILAIIVLHSTPWISAQEVEDESEFDYLKGSEKGPSRWGELKKEWETCKSGKMQSPIDL  73

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             S  V V   LG ++ +Y    AT++N G+ + L W      + IN   +   Q HWH P
Sbjct  74   SSHRVKVVPKLGELKKHYKPQNATVKNRGHDIELKWGEDAGSININATDFFLHQCHWHSP  133

Query  428  SEHVVNGTRYDLEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            SEH +NG RYDLE H+VH S       +IAV+ ++++IG  P+PILS + + +K + E  
Sbjct  134  SEHTINGRRYDLELHMVHESKSKNGKTKIAVVGILFKIGR-PDPILSKLSEIIKSMGENE  192

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
             V+K IG  DP+ ++  G++YYRY+GSLT PPCTEGV+WT+ + I++V++ QV L+R A+
Sbjct  193  -VEKKIGVFDPSEIKLGGKKYYRYIGSLTVPPCTEGVIWTINKKIKTVSRAQVNLLREAV  251

Query  776  HDESKTNARPLQTINDRFVKV  838
            HD ++ N+RP Q +N R +++
Sbjct  252  HDHAELNSRPRQALNKRGIQL  272



>ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
 gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
Length=253

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 158/239 (66%), Gaps = 3/239 (1%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            V+DE  F Y E+S+RGP HWGEL PEW  CS G MQ+PIDL  + V V  NLG +Q  Y 
Sbjct  2    VEDEREFDYLEDSERGPKHWGELYPEWRACSNGDMQSPIDLLHERVEVLPNLGRLQRKYK  61

Query  305  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
               A L+N G+ +ML W   G   L IN   Y+ +Q HWH PSEH  NG+RY LE HLVH
Sbjct  62   PAKAILKNRGHDIMLKWGKSGAGTLEINQTEYVLKQCHWHSPSEHTFNGSRYHLEVHLVH  121

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
             S DG+ AV+ + Y+IG  P+  L  +  ++  +A++   +  +G +DP  ++   R+YY
Sbjct  122  QSKDGKNAVVGITYKIGR-PDTFLKELMGNISSIADSKNAEAQVGVVDPRHIKMGSRKYY  180

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            RYMGSLTTPPCT+GV W +++ +R+V+++Q+ L+R A+HDE++ NARP Q IN R V +
Sbjct  181  RYMGSLTTPPCTQGVAWNIVKKVRTVSREQLRLLRAAVHDEAEANARPTQPINKRVVDL  239



>ref|XP_002314288.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
 gb|EEE88243.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
Length=277

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 156/238 (66%), Gaps = 2/238 (1%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
             +DE  F+YD N ++GP++WG + PEW  CS G MQ+PIDL S+ V V S+LG +   Y 
Sbjct  33   AEDEADFNYDPNGEKGPANWGRIHPEWGACSNGSMQSPIDLLSERVDVVSHLGRLSRSYK  92

Query  305  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  484
               ATL N G+ MML W      + ING  YL +Q HWH PSEH +NG R  LE H+VH 
Sbjct  93   PANATLRNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWHSPSEHTINGKRLALEVHMVHE  152

Query  485  SNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYR  664
            S DG++AV+ +MY IG  P+  LS +   L+ +A T       G +DP  ++   R+YYR
Sbjct  153  SLDGKVAVVGIMYMIGR-PDSFLSSLTKQLQSVAGTYERDTVAGVVDPRNIKIGSRKYYR  211

Query  665  YMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            Y+GSLT PPCTE V+WT++R +R+ T++QV ++R A+HDES TNAR +Q IN R VK+
Sbjct  212  YIGSLTIPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDTNARQIQPINSRTVKL  269



>ref|XP_009148066.1| PREDICTED: alpha carbonic anhydrase 7-like [Brassica rapa]
Length=272

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 171/254 (67%), Gaps = 3/254 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            + F+ LS T      EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PI+L ++
Sbjct  16   LNFISLS-TAASSHGEVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIELMNE  74

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSEH
Sbjct  75   RVKIVSHLGRLIRDYEASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSPSEH  134

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             VNG R+ LE H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K + 
Sbjct  135  TVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHVR  193

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S TN
Sbjct  194  MIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLTN  253

Query  797  ARPLQTINDRFVKV  838
            ARP+Q IN R V++
Sbjct  254  ARPVQPINKRVVRL  267



>ref|XP_004242096.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=264

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 171/247 (69%), Gaps = 7/247 (3%)
 Frame = +2

Query  104  THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNL  280
            T  ++  +++DE  FSYD+N+  GPS WGE+      C+ G +Q+PID ++K V V SNL
Sbjct  21   TISLEVDQMNDE--FSYDQNAKNGPSKWGEISS---YCN-GNLQSPIDFDNKVVEVVSNL  74

Query  281  GPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYD  460
            G +Q YY    ATL N G+ +ML W     YL IN  +Y  +Q+HWH PSEH +NG RYD
Sbjct  75   GILQKYYKPSNATLVNRGHNIMLRWDGDSGYLKINETQYQLQQIHWHTPSEHSINGKRYD  134

Query  461  LEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ  640
            +EAHLVH+S+D + AV+ ++Y+IG  P+ +L+++E DLK +A+  G +KG+G +DPN+++
Sbjct  135  MEAHLVHMSSDRKTAVIGILYEIGSLPDDLLTILEGDLKAVADKRGAEKGMGIIDPNIIK  194

Query  641  ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN  820
                 YYRY+GSLTTPPCTEG+VWT+   + SVT +Q+ L+++A  +  + NARP+Q +N
Sbjct  195  LDDNIYYRYIGSLTTPPCTEGLVWTIDGKVNSVTARQIKLLQDAAVNGFEFNARPVQLLN  254

Query  821  DRFVKVD  841
             R +K +
Sbjct  255  GRSIKFN  261



>emb|CDY04545.1| BnaA07g13710D [Brassica napus]
Length=272

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 173/266 (65%), Gaps = 5/266 (2%)
 Frame = +2

Query  53   DMDMLKLFSIAFLLLSVTHVIKS---QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            D   ++ F    L + VT +  S   +EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  2    DKSSIQCFLFILLTIIVTFISCSNAQREVEDESEFSYEQNVENGPEKWGKLKPEWKMCGK  61

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            G+MQ+PIDL ++ V + S+LG +   Y    A+L+N G+ MML +      + INGI Y 
Sbjct  62   GEMQSPIDLMNERVRIVSHLGRLTRNYKPCNASLKNRGHDMMLRFEERPGSIKINGIIYQ  121

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
              Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG + +  L+L+E+ L  
Sbjct  122  LLQLHWHSPSEHTINGRRFALELHMVHESINGSMAVVTVLYKIGRS-DSFLTLLENKLSA  180

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            + +    +  IG +DP  ++   R+YYRY+GSLTTPPCT+ + WTV++ +R+V + QV L
Sbjct  181  MTDQNEAEFNIGMIDPKEIKIGSRKYYRYVGSLTTPPCTQNITWTVVKKVRTVARNQVRL  240

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            +R A+HD+S TNARP+Q  N R VK+
Sbjct  241  LRVAVHDDSNTNARPVQPTNKRVVKL  266



>gb|KHN48240.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=282

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 168/261 (64%), Gaps = 9/261 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +  +  +LL  T  I +QEV+DE  F Y + S++GPSHWG L+ EW  C +GKMQ+PIDL
Sbjct  19   MIILVTILLHSTTWISAQEVEDESEFDYIKGSEKGPSHWGGLKKEWETCKSGKMQSPIDL  78

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             S  V V   LG ++ YY    AT++N G+ + L W      + ING  +   Q HWH P
Sbjct  79   SSHRVRVVPKLGELKKYYTPQNATIKNRGHDIELKWEDAGS-ININGTEFFLHQCHWHSP  137

Query  428  SEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            SEH +NG RYDLE H+VH S +     + AV+ + Y+IG  P+P+L  +   +K +    
Sbjct  138  SEHTINGRRYDLELHMVHESKNIKGKTKFAVVGLFYKIGR-PDPVLKKLSKFIKTMVY--  194

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
            G +K IG  DP+ ++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L+R A+
Sbjct  195  GEEKNIGVFDPSKIKLGGKKYYRYMGSLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAV  254

Query  776  HDESKTNARPLQTINDRFVKV  838
            HD ++ NARP+Q IN R +++
Sbjct  255  HDHAEKNARPIQPINRRGIQL  275



>gb|KFK32339.1| hypothetical protein AALP_AA6G228800 [Arabis alpina]
Length=271

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 170/265 (64%), Gaps = 8/265 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQ----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            MD   +     +LL++     +Q    EV+DE  FSY++N + GP  WG+L+PEW  C  
Sbjct  1    MDKTSIQCFFLVLLTIVSCSSAQSNLREVEDERDFSYEQNKETGPEKWGKLKPEWKMCGK  60

Query  224  GKMQTPIDLESKPV--VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
            G++Q+PIDL +  V  VY +LG +   Y    ATL+N G+ MML +      + ING  Y
Sbjct  61   GELQSPIDLTNDRVKLVY-HLGRLTKDYKPSNATLKNRGHDMMLRFEEESGSIKINGTEY  119

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
               Q+HWH PSEH +NG R+ LE H+VH S +G +AVL ++Y+IG  P+  L L+E+ L 
Sbjct  120  QLLQLHWHSPSEHTINGRRFALELHMVHESINGTMAVLTILYKIGR-PDSFLRLMENKLG  178

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             + +    +K +G +DP  ++   R++YRY+GSLTTPPCT+ V WT+++ IR+VTK+Q+ 
Sbjct  179  AVTDQHEGEKNVGMIDPQKIEIGSRKFYRYIGSLTTPPCTQNVTWTIVKKIRTVTKEQIR  238

Query  758  LIRNAIHDESKTNARPLQTINDRFV  832
            L+R A+HD+S TNARP+Q  N R V
Sbjct  239  LLRVAVHDDSNTNARPVQPTNMRVV  263



>ref|XP_008227262.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Prunus mume]
Length=281

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 171/265 (65%), Gaps = 9/265 (3%)
 Frame = +2

Query  65   LKLFSIAFLLL--SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            + +FS+ FL+L    +  + +QEV+DE  F Y + S +GP  WGE++ EW  C  G MQ+
Sbjct  9    ISIFSVLFLVLFSQYSTPVTAQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQS  68

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL S+ V +  NLG +   Y    AT++N G+ + + W      L ING  YL +Q H
Sbjct  69   PIDLSSQRVKLIPNLGKLNTAYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCH  128

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            WH PSEH +NG RYD+E H+VH+S D     +IAV+A +Y+IG  P+  LS +  D+K +
Sbjct  129  WHSPSEHSINGRRYDMELHMVHLSPDPNVTNKIAVVAALYKIGR-PDSFLSKLTRDIKSM  187

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
             +    ++  G +DPN ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L 
Sbjct  188  TDQKE-ERSAGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLF  246

Query  764  RNAIHDESKTNARPLQTINDRFVKV  838
            R A+HD ++TNARP+Q +N R + V
Sbjct  247  RVAVHDYAETNARPVQPLNLREIHV  271



>ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64829.1| hypothetical protein Csa_1G120450 [Cucumis sativus]
Length=275

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 171/259 (66%), Gaps = 3/259 (1%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            L   S  F  L V     SQEV+++  F Y+ N  RGP+HWG LRPEW  C+ G+MQ+PI
Sbjct  9    LLFCSFFFAFLLVPWPAMSQEVENQREFDYNANGTRGPAHWGVLRPEWHTCNTGQMQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL ++ V + S+   ++  Y    ATL+N G+ +ML W     Y+ +N  +Y  RQ+HWH
Sbjct  69   DLLNQRVRIVSHFTDLKINYSSSNATLKNRGHDIMLQWSGRAGYMEVNKTQYFLRQIHWH  128

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R+ LEAHLVH S  G+IAV+ ++Y IG+ P+  LS +   L +++ T   
Sbjct  129  SPSEHTINGRRFALEAHLVHQSQTGKIAVIGILYNIGQ-PDYFLSTMRPHLIEISGTQR-  186

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
             + +  ++P+LL+ R   YYRY+GSLT PPC++ V+WT++R +R+V  +QV L+R A+HD
Sbjct  187  DRLLNVVNPSLLRMRSSLYYRYIGSLTVPPCSQNVLWTLVRKVRTVAPEQVNLLRVAVHD  246

Query  782  ESKTNARPLQTINDRFVKV  838
            +S TNARPLQ +N+R V++
Sbjct  247  DSNTNARPLQPLNNRNVQL  265



>ref|XP_010443286.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443287.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
 ref|XP_010443289.1| PREDICTED: alpha carbonic anhydrase 8-like [Camelina sativa]
Length=355

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 162/239 (68%), Gaps = 4/239 (2%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSN-LGPIQNYY  301
            EV+DE  FSY++   +GP+ WG ++ EW  C  GKMQ+PIDL  K VV +N LG +++ Y
Sbjct  99   EVEDETEFSYEKKGKKGPAKWGTIKEEWKMCGTGKMQSPIDLRDKNVVVTNKLGSLRSQY  158

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +    T++N G+G+ML +  G + +GI  NG +Y  +Q+HWH PSEH +NG RY LE HL
Sbjct  159  LPSNTTIKNRGHGIMLKFKGGNKGIGITVNGTKYQLQQLHWHSPSEHTINGKRYALEKHL  218

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH S D R AV+A +Y++G + +P L  ++  LKK+ +    ++ +G +DP  L    + 
Sbjct  219  VHESEDERYAVVAFLYKLGAS-DPFLLSLDKQLKKITDAHESEEHVGIIDPKKLSFESKL  277

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            YYRY+GSLT PPC++ V+W+V + IR+VT +QV L+R A+HD S +NARPLQ IN R V
Sbjct  278  YYRYIGSLTAPPCSDNVIWSVAKEIRTVTSKQVKLLRVAVHDASNSNARPLQPINKRVV  336



>ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=278

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 164/247 (66%), Gaps = 7/247 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y + S++GPSHWGEL+ EW  C +GKMQ+PIDL S  V V   LG +
Sbjct  27   INAQEVEDESEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGEL  86

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            + YY    AT++N G+ + L W      + ING  +   Q HWH PSEH +NG RYDLE 
Sbjct  87   KKYYKPQNATVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLEL  146

Query  470  HLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
            H+VH    ++  G+IAV+ + Y+IG  P+ +L+ +   +K + +    +K IG  DP+ +
Sbjct  147  HMVHESKRINGKGKIAVVGLFYKIGR-PDSVLNKLSKFIKTMVDEEE-EKNIGVFDPSKI  204

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +  G++YYRYMGSLT PPC EGV+WT+ + IR+V++ QV L+R A+HD ++ NARP+Q +
Sbjct  205  KLGGKKYYRYMGSLTVPPCIEGVIWTINKKIRTVSRAQVNLLREAVHDHAEKNARPIQPL  264

Query  818  NDRFVKV  838
            N R +++
Sbjct  265  NRRGIQL  271



>ref|XP_004166480.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like, partial [Cucumis sativus]
Length=242

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRD  310
            DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V + S    I+  Y   
Sbjct  1    DETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTNIEFNYKPT  60

Query  311  VATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSN  490
             ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+ LEAHLVH S 
Sbjct  61   NATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVHQSQ  120

Query  491  DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYM  670
            +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +  +D ++L+ +   YYRY+
Sbjct  121  NGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDTCE-EKALDVIDLSMLKMQSSLYYRYI  179

Query  671  GSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S TNARPLQ INDR +++
Sbjct  180  GSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPINDRKIQL  235



>emb|CDY23976.1| BnaC03g17150D [Brassica napus]
Length=272

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 159/240 (66%), Gaps = 2/240 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +EV+DE  FSY+ N + GP  WG+L+PEW  C  G+MQ+PIDL  K V + S+LG +   
Sbjct  28   REVEDESEFSYERNQENGPEKWGKLKPEWKMCGKGEMQSPIDLLHKRVRIVSHLGRLTRD  87

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    ATL N G+ MM+ +  G   + IN I Y   Q+HWH PSEH +NG R+ LE H+V
Sbjct  88   YKPANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMV  147

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +    +  IG +DP  ++   R+Y
Sbjct  148  HESANGSLAVVTVLYKIGR-PDSFLSLLENKLCAITDHNEAEVNIGMIDPKDIKFGSRKY  206

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRY+GSLT PPCT+ V+WTVI+ +R+V + QV L+R A+HD S TNARP+Q  N R VK+
Sbjct  207  YRYIGSLTIPPCTQNVIWTVIKKVRTVARHQVKLLRVAVHDYSDTNARPVQPTNKRPVKL  266



>ref|XP_010916593.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=270

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 165/259 (64%), Gaps = 3/259 (1%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +L    +A L    T  + S   +DE  FSY   S RGP HWGEL+  W  C  GK+Q+P
Sbjct  8    LLSSIFLAILFFFNTSPVTSCSQEDEREFSYVRGSKRGPEHWGELKNSWSACGTGKLQSP  67

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL  + V V   LG +++ Y    A ++N G+ + + W      + ING +Y+ +Q+HW
Sbjct  68   IDLSDERVRVLPQLGELRSSYHPANAVMKNRGHDIEIEWKNQTGGIWINGTKYVLQQLHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG RY LE H+VH + D + AV+ ++Y+IG  P+P L+ +ED LKK+ +   
Sbjct  128  HLPSEHTINGRRYSLELHMVHQTADNKTAVVGILYKIGR-PDPFLAKMEDYLKKVEDLAE  186

Query  599  VKK-GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
            +++  +G +DP  ++     YYRYMGSLT PPCTEGVVW +IR +R+VT+QQV L+R A+
Sbjct  187  LEEEKLGMVDPRDVRKGSSEYYRYMGSLTAPPCTEGVVWIIIRKVRTVTQQQVNLLREAV  246

Query  776  HDESKTNARPLQTINDRFV  832
            HD+   NARPLQ IN+R V
Sbjct  247  HDDVGMNARPLQPINNRSV  265



>ref|XP_003538184.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Glycine max]
 gb|KHN38744.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=279

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 167/246 (68%), Gaps = 6/246 (2%)
 Frame = +2

Query  110  VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  286
            VI S  V+DE  F+YD  S RGP +WG ++PEW  C  G MQ+PI+L +K V +  +LG 
Sbjct  24   VIMSHLVEDESEFNYDVKSKRGPYNWGNIKPEWSICKNGSMQSPINLLNKRVQIAPHLGK  83

Query  287  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            +   Y    ATL N G+ +ML W  G  YL IN  +Y+ +Q HWH PSEH ++G R+DLE
Sbjct  84   LHINYQPSNATLRNRGHNIMLEWLAGTSYLQINETQYVLKQFHWHSPSEHTIDGRRFDLE  143

Query  467  AHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ-A  643
             H+VH ++ G IAV+ ++Y+ G  P+P+LSL+ + +K +++  G +  +G LDP L+   
Sbjct  144  LHMVHEASSGEIAVIGMLYKAGR-PDPLLSLLGNHIKAISDCTGAEIELGVLDPWLVSIC  202

Query  644  RGR-RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN  820
            R R +YYRY GSLTTPPCTE V WTV+  +R V+++Q+ L+R A+HD+S  NARPLQ IN
Sbjct  203  RSRTQYYRYSGSLTTPPCTENVAWTVLTEVRYVSREQIRLLRVAVHDDS--NARPLQPIN  260

Query  821  DRFVKV  838
            +R VK+
Sbjct  261  NRLVKL  266



>ref|XP_004139552.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=250

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRD  310
            DE  F Y+E  ++GP+HWG+L+PEW  C  G MQ+PIDL  + V + S    I+  Y   
Sbjct  9    DETEFDYNEEGEKGPTHWGDLKPEWHSCKTGHMQSPIDLLHERVRIASLFTNIEFNYKPT  68

Query  311  VATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSN  490
             ATL+N G+ +ML    G  Y+ +N  RY  +Q+HWH PSEH +NG R+ LEAHLVH S 
Sbjct  69   NATLKNRGHDIMLKLGHGAGYMVMNRTRYFLQQIHWHSPSEHTINGRRFALEAHLVHQSQ  128

Query  491  DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYM  670
            +G  AV+ V+Y IG  P+ +LS ++++L+++++T   +K +  +D ++L+ +   YYRY+
Sbjct  129  NGNYAVIGVVYNIGRRPDYLLSKMKENLEEISDTCE-EKALDVIDLSMLKMQSSLYYRYI  187

Query  671  GSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            GSLTTPPC++ V+WT++R +R+VT +QV L+R A HD+S TNARPLQ INDR +++
Sbjct  188  GSLTTPPCSQNVLWTIVRKVRTVTTEQVKLLRVASHDDSNTNARPLQPINDRKIQL  243



>ref|XP_008462817.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 169/264 (64%), Gaps = 4/264 (2%)
 Frame = +2

Query  50   EDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  229
            +  D+L   S  F  L V     SQEV+++  F Y+ N  RGP+HWG++RPEW  C  G+
Sbjct  5    QSFDLL-FCSSFFAFLLVLWPAMSQEVENQREFDYNTNGTRGPAHWGDIRPEWHTCRTGQ  63

Query  230  MQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  406
            MQ+PIDL ++ V + S+   ++  Y    ATL+N G+ +ML W     Y+ +N  RY  R
Sbjct  64   MQSPIDLLNQRVRIVSHFTDLKINYSSSNATLKNRGHDIMLQWSGSAGYMEVNRSRYFLR  123

Query  407  QVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLA  586
            Q+HWH PSEH +NG R+ LEAHLVH S  G IAV+ ++Y IG+ P+  LS +      ++
Sbjct  124  QIHWHSPSEHTINGRRFALEAHLVHQSQTGNIAVIGILYNIGQ-PDYFLSTMRQHFIDIS  182

Query  587  ETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR  766
             T    K +  ++P+ L+ R   YYRY+GSLT PPC++ V+WT++R +R+V   QV L+R
Sbjct  183  TTQR-DKLLNVVNPSRLRMRSSLYYRYIGSLTVPPCSQNVLWTIVRKVRTVAPDQVNLLR  241

Query  767  NAIHDESKTNARPLQTINDRFVKV  838
             A+HD+S TNARPLQ +N+R V++
Sbjct  242  VAVHDDSNTNARPLQPLNNRNVQL  265



>ref|XP_010510673.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 168/269 (62%), Gaps = 11/269 (4%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKS--------QEVDDEWGFSYDENSDRGPSHWGELRPEWW  211
            MD   +    F++L++   I S        +EV+DE  FSY+ N + GP +WG+L+PEW 
Sbjct  1    MDKSSIRCFFFVILTILGTIVSCSSAAENDREVEDESEFSYEHNKENGPKNWGKLKPEWN  60

Query  212  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGIN  385
             C  G+MQ+PIDL +K V + S+LG +   Y    ATL+N G+ MML +   G     IN
Sbjct  61   MCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNATLKNRGHDMMLKFGEEGAGSFKIN  120

Query  386  GIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIE  565
            G  Y   Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  PN  L L+E
Sbjct  121  GTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLLE  179

Query  566  DDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTK  745
              L  + +    ++ +  +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ +  V+K
Sbjct  180  HKLVAITDQHDAERNVIMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKVXXVSK  239

Query  746  QQVALIRNAIHDESKTNARPLQTINDRFV  832
             QV L+R A+HD+S +NARP+Q  N R +
Sbjct  240  SQVNLLRVAVHDDSDSNARPVQPTNKRVI  268



>ref|XP_009380700.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/255 (44%), Positives = 164/255 (64%), Gaps = 2/255 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
             F +    L  +  + SQEV+DE  FSY   S  GP HWGE+  EW  C  G+ Q+PIDL
Sbjct  9    FFGVLIAALLQSFPVASQEVEDEKEFSYQRGSQIGPEHWGEIHHEWAACGKGRTQSPIDL  68

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
              + V V+  LG ++  Y    A L+N G+ +ML W      + ING  Y  +Q+HWH P
Sbjct  69   SDERVQVFPCLGRLRRSYRPADAILKNRGHDIMLKWEDEAGGIWINGTEYGLKQMHWHSP  128

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH +NG RY +E H+VH S D +IAV+ ++Y+IG   +P L+ +E  ++++++    ++
Sbjct  129  SEHTINGRRYPMEMHMVHESADNKIAVVGILYKIGHR-DPFLAELERYIERISDKHEAEE  187

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++   R+YYRY GSLTTPPCTEGV WT+I+ +R+V+++Q+AL+R A+HD S
Sbjct  188  VVGMVDPRHVRKGSRKYYRYTGSLTTPPCTEGVAWTIIKKVRTVSREQLALLREAVHDGS  247

Query  788  KTNARPLQTINDRFV  832
            + NARP Q +N R V
Sbjct  248  EMNARPTQKMNKRIV  262



>gb|KFK43123.1| hypothetical protein AALP_AA1G083400 [Arabis alpina]
Length=275

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 176/269 (65%), Gaps = 9/269 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            M +  +  + FL++ ++  I S      EV+DE  F+YDE  D+GPS WG L+PEW  C 
Sbjct  1    MKISSVGCVLFLIIFISVTIVSSSPGHGEVEDESEFNYDEQGDKGPSKWGTLKPEWAMCG  60

Query  221  AGKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQ--RYLGINGI  391
             GKMQ+PIDL    V++  +LG +++ Y+   ATL+N G+ +M+ +  G   + + ING 
Sbjct  61   KGKMQSPIDLCDISVLFDHDLGYLRSSYLPSNATLKNRGHDIMMKFEGGNAGKGITINGT  120

Query  392  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDD  571
             Y  +Q+HWH PSEH +NG R+ LE H+VH S DGRI V+A  Y++G  P+P L  +E  
Sbjct  121  DYQLQQIHWHSPSEHTINGKRFFLEKHMVHESKDGRITVVAFFYKLGR-PDPFLFSLERQ  179

Query  572  LKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQ  751
            LK++ +T   ++ +  + P  ++   + YYRY+GSLTTPPCTE V+WT+ + ++++T +Q
Sbjct  180  LKRITDTHESEEYVRVIHPRRVEFESKHYYRYIGSLTTPPCTENVIWTISKELKTMTLKQ  239

Query  752  VALIRNAIHDESKTNARPLQTINDRFVKV  838
            + L+R ++HD+S TNARPLQ  N+R V +
Sbjct  240  LNLLRVSVHDQSNTNARPLQRKNERPVTL  268



>sp|Q9FM99.2|ATCA8_ARATH RecName: Full=Alpha carbonic anhydrase 8; Short=AtaCA8; Short=AtalphaCA8; 
AltName: Full=Alpha carbonate dehydratase 8; Flags: 
Precursor [Arabidopsis thaliana]
Length=277

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 164/257 (64%), Gaps = 7/257 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +  + +S+T V  +     ++DE  FSY+   ++GP+ WG L  EW  C  GKMQ+PIDL
Sbjct  10   LVLIFISITIVSSAPALIRIEDETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDL  69

Query  251  ESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG--INGIRYLFRQVHWH  421
              K VV SN  G +++ Y+    T++N G+ +ML +  G + +G  I G RY  +Q+HWH
Sbjct  70   RDKNVVVSNKFGLLRSQYLPSNTTIKNRGHDIMLKFKGGNKGIGVTIRGTRYQLQQLHWH  129

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R+ LE HLVH S D R AV+A +Y +G + +P L  +E  LKK+ +T   
Sbjct  130  SPSEHTINGKRFALEEHLVHESKDKRYAVVAFLYNLGAS-DPFLFSLEKQLKKITDTHAS  188

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ +G +DP  L    + YYRY GSLT PPC+E V+W+V + IR+V+ +QV L+R A+HD
Sbjct  189  EEHVGIIDPKKLSFESKHYYRYSGSLTAPPCSENVIWSVSKEIRTVSSKQVKLLRVAVHD  248

Query  782  ESKTNARPLQTINDRFV  832
             S +NARPLQ +N R V
Sbjct  249  ASDSNARPLQAVNKRKV  265



>emb|CDX93595.1| BnaA06g04530D [Brassica napus]
Length=274

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 170/258 (66%), Gaps = 7/258 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            I  +++S+T    S    EV+DE  F+Y++  ++GP  WG L+PEW  C  G MQ+PIDL
Sbjct  10   IFLIVISITTASGSPDHGEVEDETEFNYEKGGEKGPEKWGTLKPEWKMCGNGTMQSPIDL  69

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWH  421
              K V +  NLGP++++Y+   AT++N G+ +ML +  G   +GI  NG  Y  +Q+HWH
Sbjct  70   TDKRVFIDHNLGPLRSHYLPSNATIKNRGHDIMLEFEGGNAGMGIIINGTVYQLQQLHWH  129

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R+ LE H++H S DGR+AV+A +Y +G  P+  L  +E  LK++ +  G 
Sbjct  130  SPSEHTINGKRFVLEQHMLHQSKDGRLAVVAFLYSLGR-PDSFLLSLERQLKRITDAHGS  188

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            +  +  +DP  +  + R YYRY+GSLTTPPC+E V W++ R +R+VT +Q+ L+R ++HD
Sbjct  189  EDFVSLIDPRAVNFKTRLYYRYLGSLTTPPCSENVTWSISREMRTVTLKQLDLLRVSVHD  248

Query  782  ESKTNARPLQTINDRFVK  835
            +S TNARPLQ  N R VK
Sbjct  249  QSNTNARPLQRQNGRPVK  266



>emb|CDX95097.1| BnaC05g05740D [Brassica napus]
Length=274

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 171/267 (64%), Gaps = 8/267 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLL-LSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            M    +  I FL+ +S+T V  S    EV+DE  FSY++  ++GP  WG L+PEW  C  
Sbjct  1    MKRPSIVCIVFLIVISITTVSSSPDHGEVEDETEFSYEKGGEKGPEKWGTLKPEWKMCGN  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            G MQ+PIDL  K V +  NLGP++ +Y+   AT++N G+ +ML +  G   +GI  NG  
Sbjct  61   GTMQSPIDLTDKRVFIDHNLGPLRGHYLPSNATIKNRGHDIMLEFEGGNAGIGITINGTV  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DGR AV+A +Y +G  P+  L  +E  L
Sbjct  121  YQLQQLHWHSPSEHTINGKRFVLEEHMVHQSKDGRFAVVAFLYSLGR-PDSFLLSLERQL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
            K++ +    +  +  +DP  +  + + YYRY+GSLTTPPC+E V W++ R +R+VT +Q+
Sbjct  180  KRITDAHESEDFVSLIDPRAVNFKTKFYYRYLGSLTTPPCSENVTWSISREMRTVTLEQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVK  835
             L+R ++HD+S TNARPLQ  N R VK
Sbjct  240  NLLRVSVHDQSNTNARPLQRQNGRPVK  266



>gb|AFK36418.1| unknown [Lotus japonicus]
Length=280

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 164/245 (67%), Gaps = 6/245 (2%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            +QEV+DE  F+Y + +++GPS+WG ++ EW  C  GKMQ+PIDL S  V V  NLG ++ 
Sbjct  30   AQEVEDESEFNYIQGNEKGPSNWGTMKKEWKTCKTGKMQSPIDLSSHRVRVVPNLGELKK  89

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RY+LE H+
Sbjct  90   FYKPQNATVKNRGHDIEVKWEADAGSIIINGTEFFLHQSHWHTPSEHTINGRRYELELHM  149

Query  476  VH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA  643
            VH    ++   +IAV+ VMY IG+ P+P+L+ +   +K +      +K IG +DP+ ++ 
Sbjct  150  VHESRKINGKSKIAVVGVMYNIGQ-PDPVLNKLSKYIKSMGSDHEAEKSIGVMDPSEIKL  208

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
             G++YYRY+GSLT PPCTEGV+WT+ + IRSV+K Q+  +R A+H+ ++ NARP Q++N 
Sbjct  209  GGKKYYRYVGSLTIPPCTEGVIWTINKKIRSVSKAQINFLREAVHNHAQRNARPAQSLNR  268

Query  824  RFVKV  838
            R +++
Sbjct  269  RGIQL  273



>ref|XP_010696305.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 163/246 (66%), Gaps = 3/246 (1%)
 Frame = +2

Query  104  THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNL  280
            T  +  QEVDDE  F Y   S+ GP  WGE+RPEW  CS G+MQ+PIDL +++  V    
Sbjct  23   TASVLCQEVDDEREFDYIRGSEMGPERWGEIRPEWATCSTGEMQSPIDLLDARVKVTPRS  82

Query  281  GPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYD  460
              I   Y    A L N G+ + L W      + ING  Y+ RQ HWH PSEH +NG RYD
Sbjct  83   AEINRLYRPTRAMLRNRGHDIELEWEDDSSRIQINGTEYILRQSHWHSPSEHTINGKRYD  142

Query  461  LEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQ  640
            +E H+VH S D + AV+ ++Y+IG+ PN  LS + ++++ ++ET  ++  +G ++P+ ++
Sbjct  143  MELHMVHQSRDNQTAVIGLLYKIGK-PNHFLSKLMNNIRLISETT-LELDVGIINPSRIK  200

Query  641  ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIN  820
              GR+YYRY+GSLTTPPCTEGV+WT+   I +V+++QV+L+R A+HD ++ NARPLQ  N
Sbjct  201  MGGRKYYRYLGSLTTPPCTEGVIWTLNTQIGTVSEEQVSLLREAVHDHAEENARPLQRTN  260

Query  821  DRFVKV  838
             R +++
Sbjct  261  GRNMRL  266



>ref|XP_004515925.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=279

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 171/266 (64%), Gaps = 7/266 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            M +  L  +  +L+  T +  +QEV+DE  F Y + S +GPS WGEL+ EW  C  GK+Q
Sbjct  9    MFLPNLLILVTILIHSTTLTIAQEVEDESEFDYIKESKKGPSRWGELKKEWASCKNGKLQ  68

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            +PIDL S  V + +NLG ++ YY    AT++N G+ + + W      + ING  +   Q 
Sbjct  69   SPIDLSSHRVRIVTNLGKLKKYYKPQNATIKNRGHDIEVKWEGDAGSININGTEFFLHQC  128

Query  413  HWHFPSEHVVNGTRYDLEAHLVH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
            HWH PSEH +NG RYD+E H+VH    ++   +IAV+ ++Y+IG  P+P+L+ +   +K 
Sbjct  129  HWHSPSEHTINGRRYDMELHMVHESPKINGKSKIAVIGLLYKIGR-PDPVLTKLSKYIKS  187

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            + +    ++ IG +DP+ ++   ++YYRY GSLT PPCTEGV+WT+ + IR V++ Q+ L
Sbjct  188  MIDNEA-ERSIGVIDPSDIKFGSKKYYRYRGSLTVPPCTEGVIWTINKKIRRVSRDQMEL  246

Query  761  IRNAIHDESKTNARPLQTINDRFVKV  838
            +R A+HD ++ NARP+Q +N R +++
Sbjct  247  LREAVHDHAEKNARPVQFLNRREIQL  272



>emb|CDX93593.1| BnaA06g04550D [Brassica napus]
Length=547

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 171/254 (67%), Gaps = 3/254 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            + F+ LS T      EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PIDL ++
Sbjct  16   LNFISLS-TAASSHGEVEDEHEFNYKKNDDKGPERWGEIKPEWEMCGKGEIQSPIDLMNE  74

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSEH
Sbjct  75   RVKIVSHLGRLIRDYEASNATIKNRGHDIMLKFEAGAGSIKINGFQYELQQLHWHSPSEH  134

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             VNG R+ LE H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K + 
Sbjct  135  TVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHVR  193

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S TN
Sbjct  194  MIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLTN  253

Query  797  ARPLQTINDRFVKV  838
            ARP+Q IN R V++
Sbjct  254  ARPVQPINKRVVRL  267


 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 169/253 (67%), Gaps = 3/253 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  256
            I F L S +    S  EV+DE  F+Y +N D+GP  WGE++PEW  C  G++Q+PID+ +
Sbjct  289  IIFSLFSFSTAATSNGEVEDEREFNYKKNDDKGPERWGEIKPEWEMCGKGELQSPIDMMN  348

Query  257  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  433
            + V + S+LG +   Y    AT++N G+ +ML +  G   + ING +Y  +Q+HWH PSE
Sbjct  349  ERVKIVSHLGRLIRDYEPSNATIKNRGHDIMLKFEDGAGSIKINGFQYELQQLHWHSPSE  408

Query  434  HVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  613
            H VNG R+ LE H+VH   +GR+AV+ V+Y+IG     I SL E +L+ + +    +K +
Sbjct  409  HTVNGRRFALELHMVHEGKNGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHV  467

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
              +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD+S T
Sbjct  468  RMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDDSLT  527

Query  794  NARPLQTINDRFV  832
            NARP+Q IN R V
Sbjct  528  NARPVQPINKRMV  540



>gb|KEH42156.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=286

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 170/270 (63%), Gaps = 6/270 (2%)
 Frame = +2

Query  38   KL*IEDMDMLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQC  217
            KL  E+   L+   +  ++L  T  I++QEV+DE  F Y E S++GP HWGEL+ EW  C
Sbjct  2    KLERENTYTLRTSLMILIILLYTTSIRAQEVEDEREFDYIEGSEKGPHHWGELKEEWAAC  61

Query  218  SAGKMQTPIDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGI  391
              G MQ+PIDL  E   ++ +    I+  Y    AT+ N G+ + + W      + ING 
Sbjct  62   KHGDMQSPIDLSNERVKIIPNYRQVIKTKYKSSNATIINRGHDIAVFWRGDAGSISINGT  121

Query  392  RYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND---GRIAVLAVMYQIGETPNPILSLI  562
            ++   Q HWH PSEH +NG +YDLE H+VH+S +    +IAV+   ++IG  PN  LS +
Sbjct  122  KFFLHQCHWHSPSEHSINGRKYDLEMHMVHISPNPKGNKIAVVGAFFKIGR-PNSFLSQL  180

Query  563  EDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT  742
            E+D+K + +    ++ IG  DP+ +Q +G+ YYRY+GSLTTPPCTEGV+W + + IR+V+
Sbjct  181  EEDIKHMVDEEEEERVIGDKDPSQIQTKGKIYYRYVGSLTTPPCTEGVMWNLDKKIRTVS  240

Query  743  KQQVALIRNAIHDESKTNARPLQTINDRFV  832
            K QV L+R A+HD ++ NARP Q  N+R +
Sbjct  241  KAQVDLLRQAVHDHAEMNARPRQPHNNRDI  270



>ref|XP_006304810.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
 gb|EOA37708.1| hypothetical protein CARUB_v10012428mg [Capsella rubella]
Length=274

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 170/260 (65%), Gaps = 5/260 (2%)
 Frame = +2

Query  68   KLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            ++F + F+ +++      Q EV+DE  F+Y++  D+GP +WG+L+PEW  C  G MQ+PI
Sbjct  8    RVFLLIFISITLVSSSPDQGEVEDEMQFNYEKKGDKGPENWGKLKPEWGMCGKGNMQSPI  67

Query  245  DLESKPVVYSN-LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVH  415
            DL  K V+  + LG +++ Y+   AT++N G+ +ML +  G   LGI  NG  Y  +Q+H
Sbjct  68   DLTDKRVLVDHKLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGLGITINGTEYKLQQIH  127

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH +NG R+ LE H+VH S DGR AV+A +Y++G  P+  L  +E  L ++ +  
Sbjct  128  WHSPSEHTINGKRFVLEEHMVHQSKDGRNAVVAFLYKLGR-PDYFLLSLESHLMRITDAH  186

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              ++ +G + P       R YYRY+GSLTTPPC+E V+WT+ + IR+VT +Q+ ++R  +
Sbjct  187  ESEESVGMIHPRTFDFESRHYYRYLGSLTTPPCSENVLWTISKEIRTVTLKQLIMLRVTV  246

Query  776  HDESKTNARPLQTINDRFVK  835
            HD+S TNARPLQ  N+R VK
Sbjct  247  HDQSNTNARPLQRNNNRPVK  266



>ref|XP_008778933.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=273

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 170/254 (67%), Gaps = 2/254 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            +A  LL       ++EV DE  FSY+ +S+ GP +WG++  +W  C+ G+MQ+P+DL  K
Sbjct  13   VAVFLLRCIPRTTAEEVGDEREFSYESDSEHGPENWGKIHEDWAICNKGQMQSPLDLLDK  72

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V V+ +LGP++  Y   +A ++N G+ +M+ W      + IN   Y  +Q+HWH PSEH
Sbjct  73   RVQVHHHLGPLRRTYRAALAVVKNRGHDIMVKWEEDPGAIWINETMYTLKQLHWHAPSEH  132

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             +NG RY +E H+VH S D ++AV+ ++Y+IG  P+  L  +E+++ K+ +  G ++ +G
Sbjct  133  TLNGRRYAVEMHMVHESADQKVAVVGILYKIGR-PDSFLEEVEEEIMKIGDLTGEEEVLG  191

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             ++P   +   R+YYRY+GSLT PPCTEGVVWT+I+ +R+V+++QV  +R A+HD+ + N
Sbjct  192  MVNPRHAKWGSRKYYRYLGSLTVPPCTEGVVWTIIKKVRTVSRKQVDRLREAVHDDFEMN  251

Query  797  ARPLQTINDRFVKV  838
            ARP+Q IN+R V +
Sbjct  252  ARPIQEINERTVSL  265



>ref|XP_010050537.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89340.1| hypothetical protein EUGRSUZ_A01633 [Eucalyptus grandis]
Length=283

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 165/258 (64%), Gaps = 11/258 (4%)
 Frame = +2

Query  86   FLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  256
            F LL++  V  S    EV+DE  F Y   S +GP HWGELR EW  C  G+MQ+PIDL S
Sbjct  16   FFLLALRSVAASSMPGEVEDEREFDYIPKSKKGPRHWGELRKEWEACKKGEMQSPIDLSS  75

Query  257  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPS  430
            + V V   LG I+  Y    A L+N G+ + L W LG    + ING R+  +Q HWH PS
Sbjct  76   RRVKVIPKLGEIKRSYKPSKAILKNRGHDISLQWDLGSAGSIKINGTRHFLQQFHWHSPS  135

Query  431  EHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            EH +NG RY+LE H+VHV+ D     +IAV+ ++Y+ G+ PN  LS +  +++ + +  G
Sbjct  136  EHTINGRRYELELHMVHVTTDPDVKNKIAVVGLLYKTGQ-PNAFLSKLMGNVRSMVDKKG  194

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++  G+ Y RYMGSLT PPCTEGV+WT+ + I +V+K Q+ L+R A+H
Sbjct  195  ERK-MGAIDPREIKMGGKSYLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVH  253

Query  779  DESKTNARPLQTINDRFV  832
            D ++ N+RP+Q +N R +
Sbjct  254  DYAEKNSRPVQPLNRREI  271



>gb|KEH42158.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=279

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/245 (44%), Positives = 163/245 (67%), Gaps = 7/245 (3%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            +QEV+DE  F Y ++S  GPSHWG+++ EW  C  GKMQ+PID+ S  V V   LG ++ 
Sbjct  30   AQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKR  89

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RYDLE H+
Sbjct  90   HYKPHNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHM  149

Query  476  VH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA  643
            VH    V+   ++AV+ +MY+IG  P+ +LS +   +K + +   V++ IG  DP+ ++ 
Sbjct  150  VHESAKVNGKSKLAVIGLMYKIGR-PDRLLSKLSKYIKTMMDNE-VERSIGVFDPSEIKL  207

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
             G++YYRY+GSLT PPCTEGV+WT+ + IRSV++ Q+ L+R A+HD ++ NARP+Q +N 
Sbjct  208  GGKKYYRYIGSLTVPPCTEGVIWTINKKIRSVSRAQLELLREAVHDHAEKNARPVQLLNR  267

Query  824  RFVKV  838
            R +++
Sbjct  268  REIQL  272



>gb|AAD29832.1| putative carbonic anhydrase [Arabidopsis thaliana]
Length=248

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 161/239 (67%), Gaps = 3/239 (1%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            V+DE  FSY+ N + GP+ WG+LRPEW  C  G+MQ+PIDL +K V + ++L  +  +Y 
Sbjct  5    VEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYK  64

Query  305  RDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
               ATL+N G+ MML +   G   + +NG  Y   Q+HWH PSEH +NG R+ LE H+VH
Sbjct  65   PCNATLKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMVH  124

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
             + +G +AV+ V+Y+IG  P+  L L+E+ L  + +    +K +  +DP  ++   R++Y
Sbjct  125  ENINGSLAVVTVLYKIGR-PDSFLGLLENKLSAITDQNEAEKYVDVIDPRDIKIGSRKFY  183

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            RY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD S TNARP+Q  N R VK+
Sbjct  184  RYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSDTNARPVQPTNKRVVKL  242



>ref|XP_009148063.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
 ref|XP_009148064.1| PREDICTED: alpha carbonic anhydrase 5 [Brassica rapa]
Length=274

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 169/258 (66%), Gaps = 7/258 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            I  +++S+T    S    EV+DE  F+Y++  ++GP  WG L+PEW  C  G MQ+PIDL
Sbjct  10   IFLIVISITTASGSPDHGEVEDETEFNYEKGGEKGPEKWGTLKPEWKMCGNGTMQSPIDL  69

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWH  421
              K V +  NLGP++++Y+   AT++N G+ +ML +  G   +GI  NG  Y  +Q+HWH
Sbjct  70   TDKRVFIDHNLGPLRSHYLPSNATIKNRGHDIMLEFEGGNAGMGITINGTVYQLQQLHWH  129

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG R+ LE H++H S DGR+AV+A +Y +G  P+  L  +E  LK++ +    
Sbjct  130  SPSEHTINGKRFVLEQHMLHQSKDGRLAVVAFLYSLGR-PDSFLLSLEKQLKRITDAHES  188

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            +  +  +DP  +  + + YYRY+GSLTTPPC+E V W++ R +R+VT +Q+ L+R ++HD
Sbjct  189  EDFVSLIDPRAVNFKTKFYYRYLGSLTTPPCSENVTWSISREMRTVTLKQLNLLRVSVHD  248

Query  782  ESKTNARPLQTINDRFVK  835
            +S TNARPLQ  N R VK
Sbjct  249  QSNTNARPLQRQNGRPVK  266



>ref|XP_008810960.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=263

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 154/225 (68%), Gaps = 2/225 (1%)
 Frame = +2

Query  164  SDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYG  340
            S  GP HWGE+  EW  C+ G MQ+PIDL  + V ++  LG ++  Y    ATL+N G+ 
Sbjct  25   SPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGRLKRSYKASNATLKNRGHD  84

Query  341  MMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVM  520
            +ML W  G  ++ ING  Y   Q HWH PSEH +NG R+DLE H+VH S+D + AV+ +M
Sbjct  85   IMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRFDLEIHMVHQSSDQKNAVVGIM  144

Query  521  YQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTE  700
            Y+IG  P+  LS + + +K++A+    +  +G +DP  ++   R+YYRYMGSLTTPPCT+
Sbjct  145  YKIGR-PDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKIGSRKYYRYMGSLTTPPCTQ  203

Query  701  GVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            GVVWT+ + +R+V+++QV L+R A+HD ++ NARP+Q IN+R ++
Sbjct  204  GVVWTITKKVRTVSREQVRLLREAVHDNAENNARPIQPINEREIQ  248



>gb|AFK33933.1| unknown [Medicago truncatula]
Length=279

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 163/245 (67%), Gaps = 7/245 (3%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            +QEV+DE  F Y ++S  GPSHWG+++ EW  C  GKMQ+PID+ S  V V   LG ++ 
Sbjct  30   AQEVEDEHEFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKR  89

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +Y    AT++N G+ + + W      + ING  +   Q HWH PSEH +NG RYDLE H+
Sbjct  90   HYKPRNATIKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHM  149

Query  476  VH----VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA  643
            VH    V+   ++AV+ +MY+IG  P+ +LS +   +K + +   V++ IG  DP+ ++ 
Sbjct  150  VHESAKVNGKSKLAVIGLMYKIGR-PDRLLSKLSKYIKTMMDNE-VERSIGVFDPSEIKL  207

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
             G++YYRY+GSLT PPCTEGV+WT+ + +RSV++ Q+ L+R A+HD ++ NARP+Q +N 
Sbjct  208  GGKKYYRYIGSLTVPPCTEGVIWTINKKVRSVSRAQLELLREAVHDHAEKNARPVQLLNR  267

Query  824  RFVKV  838
            R +++
Sbjct  268  REIQL  272



>ref|XP_002445622.1| hypothetical protein SORBIDRAFT_07g022860 [Sorghum bicolor]
 gb|EES15117.1| hypothetical protein SORBIDRAFT_07g022860 [Sorghum bicolor]
Length=280

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 155/239 (65%), Gaps = 1/239 (0%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK-PVVYSNLGPIQNYY  301
            E + E GFSY   +  GP +WG+++P+W  CS G+MQ+PIDL  +   +  +LG ++ +Y
Sbjct  32   ETEHEEGFSYIPGAPNGPENWGKIKPQWANCSVGRMQSPIDLSHELAKLVQSLGYLKTFY  91

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
                AT+ N G+ +M+S+      L ING  Y  RQ+HWH PSEH ++G RYD+E HLVH
Sbjct  92   RPAEATIVNSGHDVMVSFKGDAGSLVINGTTYHLRQLHWHTPSEHTIDGRRYDMELHLVH  151

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
             +   + AV+ V+Y+IG   +P L ++E  ++ +  T    K IG +DPN  +  G  YY
Sbjct  152  QTLANKTAVIGVLYEIGPIRDPFLQMLEPFIRSIENTKDQPKDIGVVDPNGARGSGSAYY  211

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            RYMGSLTTPPCTEGVVWTV+R I  V K QV L+R+A+ D +  NARPLQ +N+R + +
Sbjct  212  RYMGSLTTPPCTEGVVWTVVRKISPVAKDQVKLLRDALQDGNTMNARPLQEVNNRDISI  270



>ref|XP_010098808.1| hypothetical protein L484_022573 [Morus notabilis]
 gb|EXB75896.1| hypothetical protein L484_022573 [Morus notabilis]
Length=280

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 168/264 (64%), Gaps = 14/264 (5%)
 Frame = +2

Query  71   LFSIA-FLLLSV------THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  229
            +FS + FL+L +      +  +K+QEV+DE  F Y   S++GP  WGEL+ EW  C  G 
Sbjct  8    IFSFSCFLVLVIILFSHSSKSVKAQEVEDESEFDYSRRSEKGPDRWGELKKEWSACKNGG  67

Query  230  MQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  406
            MQ+PIDL ++ V +   LG +   Y    AT++N G+ + + W      + ING  Y  +
Sbjct  68   MQSPIDLSNQRVKIIPKLGKLTRSYTPSNATVKNRGHDISIQWHGKAGSIKINGTEYFLQ  127

Query  407  QVHWHFPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDL  574
            Q HWH PSEH +NG R+ +E H+VH S D      IAV+ V+Y++G  P+  LS +  D+
Sbjct  128  QAHWHSPSEHTINGRRFHMELHMVHQSTDKTVKNNIAVIGVLYKLGR-PDSFLSKLMKDI  186

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
              +++    +K +G +DP+ ++  G+RYYRYMGSLT PPCTEGV+WT+ + IR+V+KQQV
Sbjct  187  TAISDKKE-EKHMGIIDPSEIKLGGKRYYRYMGSLTVPPCTEGVIWTISKKIRTVSKQQV  245

Query  755  ALIRNAIHDESKTNARPLQTINDR  826
             L+R A+HD ++ NARP+Q IN R
Sbjct  246  ELLRVAVHDYAEENARPVQPINRR  269



>ref|XP_010050504.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
Length=283

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 165/265 (62%), Gaps = 10/265 (4%)
 Frame = +2

Query  62   MLKLFSIAFLLL--SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            +L  FS+ FLL   S   +  + EV+DE  F Y   S++GP HWGELR EW  C  G+ Q
Sbjct  9    LLSAFSLFFLLAPSSAATLSTAGEVEDEREFDYIAGSEKGPKHWGELRKEWEACKKGETQ  68

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQ-RYLGINGIRYLFRQ  409
            +PIDL S+ V V   LG IQ  Y    ATL+N G+ + L W +G    + ING  Y  +Q
Sbjct  69   SPIDLSSRRVKVIPKLGGIQRSYKPSNATLKNRGHDISLQWDVGNVGSVKINGTEYFLQQ  128

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLK  577
             HWH PSEH +NG RY++E H+VHVS D      IAV+ ++Y+ G  P+  LS +  +L 
Sbjct  129  CHWHSPSEHTINGRRYEMELHMVHVSTDPNVENNIAVVGLLYKTGR-PDAFLSKLMGNLW  187

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             + +  G ++ +G  DP  ++  G+ Y RYMGSLT PPCTEGV+WT+ + I +V+K Q+ 
Sbjct  188  SMVDQEG-ERTMGVFDPRKIKMGGKSYLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIK  246

Query  758  LIRNAIHDESKTNARPLQTINDRFV  832
            L+R A+HD ++ NARP+Q +N R +
Sbjct  247  LLREAVHDHAEKNARPVQPLNRREI  271



>dbj|BAD09854.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
 gb|EAZ07303.1| hypothetical protein OsI_29552 [Oryza sativa Indica Group]
 gb|EAZ43045.1| hypothetical protein OsJ_27633 [Oryza sativa Japonica Group]
Length=275

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 161/240 (67%), Gaps = 2/240 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +E D E  F+Y    ++GP HWG+L+PEW QC AG+MQ+PIDL  + V +  +LG + + 
Sbjct  28   EETDHEEEFTYISGDEKGPEHWGKLKPEWAQCGAGEMQSPIDLSHERVKLVRDLGYLDDS  87

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G RYD+E H+V
Sbjct  88   YRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMV  147

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H S + + AV+ ++Y++G  P+  L  +E  LK +A+    ++ +G +DP   + R   Y
Sbjct  148  HESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLKMIADKEDREEKVGMIDPRGARGRASVY  206

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRYMGSLTTPPCT+GVVWT+++ +R+V++ Q+ L+R A+HDE + NARPLQ +N+R + +
Sbjct  207  YRYMGSLTTPPCTQGVVWTIVKRVRTVSRYQLDLLREAVHDEMENNARPLQAVNNRDISI  266



>ref|XP_011094588.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=279

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 161/263 (61%), Gaps = 5/263 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +L    +AF +L  T  I +QEVDDE  F+YD+NS +GP +WG+++ EW  C+ G MQ+P
Sbjct  9    ILAPIFVAFFVLFGTKPINAQEVDDESEFNYDQNSAKGPINWGKIKEEWGGCNTGIMQSP  68

Query  242  IDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            ID+    +V     P    Y    A L+N G+ + + W      L ING  Y  R  HWH
Sbjct  69   IDISGDRMVRIISHPQTPNYKPAHALLKNRGHDIQIQWLDDAGSLSINGTEYCLRYAHWH  128

Query  422  FPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             PSEH  NG RY LE HLVH + D     +IAV+ V Y+ G+ P+P LS +  ++  +A 
Sbjct  129  SPSEHTYNGKRYALELHLVHKATDPVVENKIAVIGVFYKTGQ-PDPFLSKLTTNITSMAR  187

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                ++ +G +DP  +Q   RRYYRYMGSLT PPCTEGV+WT+ + +++V+ +QV L+R 
Sbjct  188  KKDDQRSLGPVDPKEVQICSRRYYRYMGSLTVPPCTEGVIWTINKKVKTVSMEQVKLLRK  247

Query  770  AIHDESKTNARPLQTINDRFVKV  838
             +HD ++ NARPLQ +N R + +
Sbjct  248  VVHDYAEHNARPLQPLNSRRISL  270



>ref|XP_008362138.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=279

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 165/260 (63%), Gaps = 8/260 (3%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
            F + F L S T  I +QEV+DE  F Y + S +GP  WG  + EW  C  G MQ+PIDL 
Sbjct  13   FCLVFFLCSATS-ITAQEVEDEREFDYLQGSGKGPKQWGAXKKEWSACKNGGMQSPIDLS  71

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            S  V +  NLG +   Y    AT++N G+ + + W      + ING +YL +Q HWH PS
Sbjct  72   SHRVTLVPNLGKLNISYNPCNATVKNRGHDISIYWEGNAGSIHINGTQYLLKQSHWHSPS  131

Query  431  EHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            EH VNG RYD+E H+VH+S+D     +IAV+ V+Y+IG  P+  LS +   +K + +   
Sbjct  132  EHSVNGRRYDMELHMVHLSSDPNVTNKIAVVGVLYKIGR-PDSFLSKLTGHVKSMMDQTE  190

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             ++ IG +DP  ++ R + YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+H
Sbjct  191  -ERNIGTIDPREIKIRKKNYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVH  249

Query  779  DESKTNARPLQTINDRFVKV  838
            D ++ NARP+Q +N R ++V
Sbjct  250  DYAEMNARPVQPLNLREIQV  269



>ref|XP_010458030.1| PREDICTED: alpha carbonic anhydrase 5 [Camelina sativa]
Length=274

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 170/268 (63%), Gaps = 11/268 (4%)
 Frame = +2

Query  65   LKLFSIA--FLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +K+ SI   FLL+ ++  I S      EV+DE  F+Y++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVFLLIFISITIVSSSPDQGEVEDEAQFNYEKNGEKGPENWGRLKPEWTMCGK  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            G MQ+PIDL  K V V  NLG +++ Y+   AT++N G+ +ML +  G    GI  NG  
Sbjct  61   GNMQSPIDLTDKRVLVDHNLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGSGITINGTE  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DGR AV+A  Y++G  P+  L  +E  L
Sbjct  121  YKLQQIHWHSPSEHTINGKRFILEEHMVHQSKDGRNAVVAFFYKLGR-PDFFLLSLERYL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
             ++ +T   ++ +G + P       + YYRY+GSLTTPPC+E V WT+ + +R+VT +Q+
Sbjct  180  MRITDTHEAEESVGMIHPRTFDFESKHYYRYLGSLTTPPCSENVTWTISKEMRTVTLKQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKV  838
             ++R  +HD+S TNARPLQ  N R V +
Sbjct  240  IMLRVTVHDQSNTNARPLQRQNQRPVTL  267



>ref|XP_003537009.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=296

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 160/256 (63%), Gaps = 4/256 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +L LF I  LL S +   + +E++DE  F Y   S++GP HWGE++ EW  C  G +Q+P
Sbjct  28   LLVLFMI--LLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSP  85

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL    V +         YY    AT+ N G+ + + W      + +NG  Y  +Q HW
Sbjct  86   IDLSCARVKIIPRCRQPDIYYTATNATIINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHW  145

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG RYDLE H+VHVS D +I V+  +Y+ G  P+  LS +E D+K L +   
Sbjct  146  HSPSEHSMNGRRYDLEMHMVHVSPDNKIFVVGALYKFGHRPDRFLSQLEKDIKHLVDNE-  204

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
            V++ IG  +P+ LQ RG  YYRY+GSLTTPPCTEGV+W + R IR+V+++QV L+R A+H
Sbjct  205  VEREIGETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDRKIRTVSEEQVRLLREAVH  264

Query  779  DESKTNARPLQTINDR  826
            D ++ NARP+Q   +R
Sbjct  265  DHAERNARPMQRRYNR  280



>ref|XP_010510674.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=278

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 167/273 (61%), Gaps = 13/273 (5%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLS--------VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWW  211
            MD + +    FL+L+        ++     +EV+DE  FSY+ N + GP  WG+L+PEW 
Sbjct  1    MDKVSIQCFIFLVLTSFVATVWCLSATADYREVEDEREFSYERNKENGPEKWGKLKPEWK  60

Query  212  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPL---GQRYLG  379
             C  G++Q+PIDL +K V + ++   +   Y    ATL N G+ MML +     G     
Sbjct  61   LCGKGELQSPIDLMNKRVRLVTDFEKLTKDYKPCNATLINRGHDMMLRFEEEEEGPGSFK  120

Query  380  INGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSL  559
            ING  Y   Q+HWH PSEH +NG R+ LE HLVH + +G +AV+ V+Y+IG  P+  L  
Sbjct  121  INGTEYKLLQLHWHSPSEHTINGRRFALELHLVHENINGSLAVVTVLYKIGR-PDSFLES  179

Query  560  IEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSV  739
            +E  L  + +    +K +  +DP  +Q   R++YRY+GSLTTPPCT+ V+WTV++ +R+V
Sbjct  180  LEKKLSVITDQNEAEKNVEMIDPRNIQIGSRKFYRYLGSLTTPPCTQNVIWTVVKKVRTV  239

Query  740  TKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TK QV L+R A+HD   TNARP+Q IN R VK+
Sbjct  240  TKSQVKLLRVAVHDNYDTNARPVQPINKRVVKL  272



>gb|KHN39017.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=296

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 159/254 (63%), Gaps = 3/254 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            LF +  +LL+ T    + +E++DE  F Y   S++GP HWGE++ EW  C  G +Q+PID
Sbjct  28   LFVLFIILLASTSTRAQVEELEDEREFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSPID  87

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L    V +         YY    AT+ N G+ + + W      + +NG  Y  +Q HWH 
Sbjct  88   LSCARVKIIPRCRQPDIYYTATNATIINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHWHS  147

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG RYDLE H+VHVS D +I V+  +Y+ G  P+  LS +E D+K L +   V+
Sbjct  148  PSEHSMNGRRYDLEMHMVHVSPDNKIFVVGALYKFGHRPDRFLSQLEKDIKHLVDNE-VE  206

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            + IG  +P+ LQ RG  YYRY+GSLTTPPCTEGV+W + R IR+V+++QV L+R A+HD 
Sbjct  207  RAIGETNPSGLQTRGNAYYRYVGSLTTPPCTEGVIWNIDRKIRTVSEEQVRLLREAVHDH  266

Query  785  SKTNARPLQTINDR  826
            ++ NARP+Q   +R
Sbjct  267  AERNARPMQRRYNR  280



>ref|XP_004973661.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=285

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 159/240 (66%), Gaps = 2/240 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            QE +DE  FSYD   + GP+HWG ++ EW  CSAG MQ+PIDL  + V +   LG + + 
Sbjct  38   QETEDEHEFSYDPRDEHGPAHWGRIKAEWANCSAGGMQSPIDLAHERVTLVRALGYLDHS  97

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G +YD+E HLV
Sbjct  98   YRPAQASIVNRGHDIMVRFKGDAGSVVINGTAYYLRQLHWHAPTEHTVDGRQYDMELHLV  157

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H S +G+ AV+ V+Y++G   +  L  +E  + ++A+    ++ +G +DP   + R   Y
Sbjct  158  HQSAEGKAAVIGVLYEVG-AHDAFLHALEPAIHRIADRRDREEPVGVVDPRGARGRASVY  216

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRYMGSLTTPPCTEGV+WT+++ +R+V+K Q+ L+R A+HD+ + NARPLQ +NDR + +
Sbjct  217  YRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDDMEKNARPLQEVNDRDISI  276



>ref|XP_010470127.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 166/270 (61%), Gaps = 12/270 (4%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLS--------VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWW  211
            MD + +    FL+L+        ++     +EV+DE  FSY+   + GP  WG+L+PEW 
Sbjct  1    MDKVSIQCFIFLVLTSFVATVWCLSATTDYREVEDEREFSYERKKENGPEKWGKLKPEWK  60

Query  212  QCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPL--GQRYLGI  382
             C  G++Q+PIDL +K V + ++   +   Y    ATL N G+ MML +    G   L I
Sbjct  61   LCGKGELQSPIDLMNKRVRLVTDFQKLTKDYKPCNATLINRGHDMMLRFEEEEGSGSLKI  120

Query  383  NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLI  562
            NG  Y   Q+HWH PSEH +NG R+ LE H+VH S +G +AV+ V+Y+IG  PN  L L+
Sbjct  121  NGTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKNGSMAVVTVLYKIGR-PNSFLKLL  179

Query  563  EDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVT  742
            E  L  + +    ++ +  +DP+ ++   R YYRY+GSLTTPPCT+ + WT+++ IR+V+
Sbjct  180  EHKLVAITDQHDAERNVVMIDPSKIKTESRNYYRYIGSLTTPPCTQNITWTILKKIRTVS  239

Query  743  KQQVALIRNAIHDESKTNARPLQTINDRFV  832
            K QV L+R A+HD+S +NARP+Q  N R +
Sbjct  240  KSQVNLLRVAVHDDSNSNARPVQPANKRVI  269



>ref|XP_010475597.1| PREDICTED: alpha carbonic anhydrase 5-like [Camelina sativa]
Length=281

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 158/241 (66%), Gaps = 4/241 (2%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            EV+DE  F+Y++N ++GP +WG L+PEW  C  G MQ+PIDL  K V V  NLG +++ Y
Sbjct  28   EVEDEEQFNYEKNGEKGPENWGRLKPEWAMCGKGNMQSPIDLTDKRVLVDHNLGYLRSQY  87

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +   AT++N G+ +ML +  G    GI  NG  Y  +Q+HWH PSEH +NG R+ LE H+
Sbjct  88   LPSNATIKNRGHDIMLKFEGGNAGSGITINGTEYKLQQIHWHSPSEHTINGKRFILEEHM  147

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH S DGRIAV+A  Y++G  P+  L  +E  L ++ +T   ++ +G + P       R 
Sbjct  148  VHQSKDGRIAVVAFFYKLGR-PDFFLLSLERYLMRITDTHEAEEFVGMIHPRTFDFESRH  206

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            YYRY+GSLTTPPC+E V WT+ + +R+V+ +Q+ L+R  +HD+S TNARPLQ  N R V 
Sbjct  207  YYRYLGSLTTPPCSENVTWTISKEMRTVSLKQLILLRVTVHDQSNTNARPLQRKNQRPVT  266

Query  836  V  838
            +
Sbjct  267  L  267



>ref|XP_002892432.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68691.1| carbonate dehydratase/ zinc ion binding protein [Arabidopsis 
lyrata subsp. lyrata]
Length=277

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 169/268 (63%), Gaps = 8/268 (3%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSVTHVIKSQ----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            M +  +  + FL+     ++ S     EV+DE  F+Y++  ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVVFLIFISITIVSSSPDNGEVEDETQFNYEKKGEKGPDNWGRLKPEWAMCGK  60

Query  224  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            G MQ+PIDL  K V+   NLG +++ Y+    T++N G+ +M+ +  G   LGI  NG  
Sbjct  61   GNMQSPIDLTDKRVLIDHNLGYLRSQYLPSNITIKNRGHDIMMKFEGGNAGLGITINGTE  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DGR AV+A  Y++G+ P+  L  +E  L
Sbjct  121  YKLQQIHWHSPSEHTLNGKRFVLEEHMVHQSKDGRNAVVAFFYKLGK-PDYFLLTLERYL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
            +K+ +T   ++ +G + P       R YYRY GSLTTPPC+E V+WT+ + +R+VT +Q+
Sbjct  180  RKITDTHESEEYVGMIHPRTFDFESRHYYRYTGSLTTPPCSENVIWTISKEMRTVTLKQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKV  838
             ++R  +HD+S TNARPLQ  N+R V +
Sbjct  240  IMLRVTVHDQSNTNARPLQRENERPVAL  267



>ref|XP_011077301.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=278

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 161/255 (63%), Gaps = 6/255 (2%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            I   +L+    I +QEVDDE  F Y  NSD GP  WG+++ EW  C+ G +Q+PID+ ++
Sbjct  17   IVLFILAGPKSIDAQEVDDEREFEYAANSDMGPGKWGQIKKEWAACNNGSLQSPIDMSNE  76

Query  260  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
             V   +    + Y   + AT+ N G+ + + W      + ING  Y  R  HWH PSEH 
Sbjct  77   RVRIISRSEKRTYRAAN-ATVRNRGHDIQMQWFGDAGSIFINGTEYPLRNAHWHSPSEHT  135

Query  440  VNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            +NG RYDLE HLVH++ D     +IAV+ V Y+IG+ PN  LS +  +++ + +    +K
Sbjct  136  INGRRYDLELHLVHLNTDPNVKNKIAVIGVFYKIGK-PNQFLSKLMTNIRSMIDKKDEEK  194

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++ R +RYYRYMGSLT PPCTEGV+WT+ + +++V++ QV L+R A+HD +
Sbjct  195  ILGMIDPEDIKIRSKRYYRYMGSLTVPPCTEGVIWTINKKVKTVSRDQVKLLREAVHDYA  254

Query  788  KTNARPLQTINDRFV  832
            + NARPLQ  ++R V
Sbjct  255  EENARPLQPKHNRDV  269



>ref|XP_006401345.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
 gb|ESQ42798.1| hypothetical protein EUTSA_v10014359mg [Eutrema salsugineum]
Length=275

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 163/259 (63%), Gaps = 11/259 (4%)
 Frame = +2

Query  86   FLLLSVTHVI-------KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            FLL+ VT  I          EV+DE  FSY+    +GP+  G L+ +W  C  GKMQ+PI
Sbjct  10   FLLIIVTISIVLSAPPPPGGEVEDETEFSYETLGKKGPAKRGTLKEDWKMCGTGKMQSPI  69

Query  245  DLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIRYLFRQVH  415
            D+  K VV +  LG ++++Y+    T++N G+ +ML +  G +  GI     +Y  +Q+H
Sbjct  70   DIRDKNVVVTYKLGSLRSHYLPSNTTMKNRGHDIMLKFKGGNQGFGIIIGNTKYKLQQLH  129

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            WH PSEH +NG R+ LEAHLVH S +G+ AV+A +Y +G  P+  L  ++  LK++ +T 
Sbjct  130  WHSPSEHTINGKRFALEAHLVHESKNGKYAVVAFLYNVG-APDAFLLSLDRHLKRITDTH  188

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +  +G +DP  +    ++YYRY GSLT PPC+E V+W++ R IR+VT QQV L+R A+
Sbjct  189  EGEANVGSIDPKKISFESKQYYRYSGSLTAPPCSENVLWSISRQIRTVTSQQVKLLRVAV  248

Query  776  HDESKTNARPLQTINDRFV  832
            HD S TNARPLQ IN R V
Sbjct  249  HDASNTNARPLQPINKRVV  267



>ref|XP_010109502.1| hypothetical protein L484_007522 [Morus notabilis]
 gb|EXC22913.1| hypothetical protein L484_007522 [Morus notabilis]
Length=289

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 167/263 (63%), Gaps = 9/263 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVI--KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            LF I F+ L V H     SQEV+DE  F Y+  S RGP+ WG++RP+W  C+ G MQ+PI
Sbjct  10   LFCIFFIFL-VLHFCPATSQEVEDERAFDYEAWSTRGPARWGQIRPDWRMCNNGTMQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHW  418
            DL  + V V S L  ++ +Y    ATL N G+ MM+ W  G+  Y+ +NG +YL +Q+HW
Sbjct  69   DLMDQRVQVISTLQRLRRFYKPVNATLLNRGHDMMMKWTSGEAGYIDMNGTQYLLQQLHW  128

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE---  589
            H PSEH +NG R+DLE H+VH S  G++ V+ + Y+I  + +  LS +E  L+ +A    
Sbjct  129  HSPSEHTINGRRFDLELHMVHQSRTGQLVVIGINYRISSS-DFFLSSMETHLQDIANMSY  187

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +K +G +D   L  R RRYYRY+GSLT PPCT+ VVW V++  R V ++QV L+R 
Sbjct  188  NSQPQKLVGIVDLRQLNIRSRRYYRYIGSLTVPPCTQSVVWIVLQQTRPVAREQVRLLRM  247

Query  770  AIHDESKTNARPLQTINDRFVKV  838
            A+ D S TNARPLQ  + R V++
Sbjct  248  AVRDGSATNARPLQRKHGRSVQL  270



>ref|XP_010262876.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=294

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 162/244 (66%), Gaps = 5/244 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            +++    FLL+ + H     SQEV+DE  F Y E S +GP  WGE+ PEW  C  G+MQ+
Sbjct  30   IQILPSVFLLVFILHSGPTTSQEVEDEQEFDYVEGSGKGPEQWGEIHPEWALCKNGEMQS  89

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL +K V + S+LG ++  Y    AT++N G+ +ML W  G  ++ ING +Y+ +Q H
Sbjct  90   PIDLLNKRVQIVSHLGRLKRNYRPSNATIKNRGHDIMLKWVDGAGWIEINGTQYVLQQCH  149

Query  416  WHFPSEHVVNGTRYDLEAHLVHVS-NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            WH PSEH +NG R+DLE H+VH S +D + +V+ +MY+IG  P+  LS I   +  +AET
Sbjct  150  WHSPSEHTINGKRFDLEVHMVHQSISDNKTSVVGIMYKIGR-PDTFLSKIMGYINSIAET  208

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
               +  +G +DP  ++   R+YYRYMGSLT PPCT+ VVWT++R +R+V+++QV L+R A
Sbjct  209  KEKETVVGVVDPKNIKLGSRKYYRYMGSLTVPPCTQDVVWTIVRKVRTVSREQVRLLREA  268

Query  773  IHDE  784
            + D+
Sbjct  269  VDDK  272



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 169/258 (66%), Gaps = 11/258 (4%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +F++    LSVT    +QEV+DE  F Y E S++GP+HWG+++ EW  C  G++Q+PID+
Sbjct  15   IFALVVSPLSVT----AQEVEDEREFDYTEGSEKGPAHWGDIKEEWADCKTGRLQSPIDM  70

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLG---INGIRYLFRQVHW  418
              + V +      ++  Y    ATL+N G+ +M+ W  G+   G   +N  RY  RQ HW
Sbjct  71   SDRRVKMVQKKDNMKRNYRPFNATLKNRGHDIMVQWE-GRDKAGSIQLNCTRYFLRQCHW  129

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG RYD+E H++H + + +IAV+  +Y+IG+ P+  LS + +D+  + +   
Sbjct  130  HSPSEHTINGRRYDMELHMIHTTPEQKIAVVGYLYKIGK-PDAFLSKLLNDIVSMTDQKS  188

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             ++ IG +DP  ++  G++YYRYMGSLTTPPC +GV+WT+ + IR+++K QV  +R A+H
Sbjct  189  -ERNIGIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVH  247

Query  779  DESKTNARPLQTINDRFV  832
            D ++ NARPLQ +N R +
Sbjct  248  DYAEKNARPLQPLNQREI  265



>ref|XP_010696309.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/243 (44%), Positives = 154/243 (63%), Gaps = 4/243 (2%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK-PVVYSNLGPI  289
            I +QEV+DE  F+Y +  +RGP +WG ++PEW  C+ G+ Q+PI+L +  P    N   I
Sbjct  26   IVAQEVEDESEFNYIQGDERGPENWGNIKPEWATCNTGRKQSPINLFAPFPETVPNFVRI  85

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
               Y     T++N G+ + L W  G   + ING+ Y+ RQ HWH PSEH +NG RY LEA
Sbjct  86   TRLYQPGQTTIKNRGHDIKLEWTEGSSSIQINGVDYILRQCHWHSPSEHAINGRRYALEA  145

Query  470  HLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG  649
            H VH S D ++AV+  +Y  G  P+P LS IED ++ ++       G+  + P+ ++  G
Sbjct  146  HFVHQSLDNKVAVIGFLYHYG-NPDPFLSSIEDKIRSISNNASTDAGV--ISPSQVRMEG  202

Query  650  RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF  829
             +YYRY GSLTTPPC EGV+WTV   + +V+ +QV L+RNA+ D S+ NARPLQ +N R+
Sbjct  203  SQYYRYSGSLTTPPCDEGVIWTVENMLGTVSIEQVQLLRNAVDDGSRENARPLQPVNRRW  262

Query  830  VKV  838
            V +
Sbjct  263  VHL  265



>ref|XP_006659489.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=276

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 160/240 (67%), Gaps = 2/240 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +E + E  F+Y    ++GP HWG+++PEW QC AG+MQ+PIDL  + V +  +LG + + 
Sbjct  29   EETEREDEFTYTSGEEKGPEHWGKIKPEWAQCGAGEMQSPIDLSHERVTLVRDLGYLDHS  88

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH P+EH V+G RYD+E H+V
Sbjct  89   YRAAEASIVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMV  148

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H S + + AV+ ++Y++G  P+  L  +E  L+ +A+    ++ +G +DP   + R   Y
Sbjct  149  HESAEKKAAVIGLLYEVGR-PDRFLQKMEPYLRMIADKEDKEEKVGVIDPRGARGRASVY  207

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRYMGSLTTPPCTEGV+WT+++ +R+V+K Q+ L+R A+HD  + NARPLQ +N+R V +
Sbjct  208  YRYMGSLTTPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDNMENNARPLQAVNNRDVSI  267



>ref|XP_010241820.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 164/263 (62%), Gaps = 9/263 (3%)
 Frame = +2

Query  65   LKLFSIAFLLLSV--THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            +  F +  LLL +  T      EV+DE  F Y E S +GP HWGEL  EW  C  G MQ+
Sbjct  8    MSTFGLVCLLLLIFNTEAATFHEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQS  67

Query  239  PIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            PIDL ++ V +   LG ++  Y    A L+N G+ + L W  G   + ING  Y+  Q H
Sbjct  68   PIDLLNERVQLVPGLGRLKRSYKPSNAILKNRGHDIALEWGEGAGSININGXDYVLEQCH  127

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            WH PSEH +NG R+DLE H+VHVS D     +IAV+ ++Y+IG  P+  LS ++  +  +
Sbjct  128  WHSPSEHTLNGKRFDLELHMVHVSPDNTTANQIAVIGILYKIGR-PDDFLSELKKGIWSI  186

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
            A++   + G+G +DP  ++   R+YYRYMGSLT PPCT+GV+WT+   +R+V+K QV  +
Sbjct  187  ADSKN-EVGVGVVDPRHIKIGSRKYYRYMGSLTVPPCTQGVIWTINTKVRTVSKGQVKAL  245

Query  764  RNAIHDESKTNARPLQTINDRFV  832
            R+A+HD ++ NARPLQ +N R +
Sbjct  246  RDAVHDYAEQNARPLQPLNKREI  268



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 167/257 (65%), Gaps = 9/257 (4%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +F + F  LSVT    +QEV+DE  F Y E S++GP+HWG+++ EW  C  G +Q+PID+
Sbjct  15   IFVLVFSPLSVT----AQEVEDEREFDYTEGSEKGPAHWGDIKTEWADCKTGSLQSPIDM  70

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRY--LGINGIRYLFRQVHWH  421
              + V +      I+  Y    ATL+N G+ +M+ W    +   + ING RY  +Q HWH
Sbjct  71   SDRRVKMVQKTENIKRNYRPFNATLKNRGHDIMVQWEGFDKAGSIQINGARYFLQQCHWH  130

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG  YD+E H++H + + +IAV+  +Y+ G+ P+  LS + +D+  + +   +
Sbjct  131  SPSEHTINGRSYDMELHMLHTTPEQKIAVIGYLYKTGK-PDAFLSKLLNDIVSMTDQK-M  188

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ IG +DP  ++  G++YYRYMGSLTTPPC +GV+WT+ + IR+++K QV  +R A+HD
Sbjct  189  ERNIGIVDPREIKFGGKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVHD  248

Query  782  ESKTNARPLQTINDRFV  832
             ++ NARPLQ +N R +
Sbjct  249  YAEKNARPLQPLNQREI  265



>ref|XP_008227264.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 158/263 (60%), Gaps = 7/263 (3%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            +  F     L S    + +QEV+DE  F Y   S +GP  WGE++ EW  C  G +Q+PI
Sbjct  11   ISYFLFFVFLFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPI  70

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL S  V +  +LG ++  Y  D ATL+N G+ + + W      + ING  Y  +Q HWH
Sbjct  71   DLSSHRVKLIPHLGNLKTSYKPDNATLKNRGHDISVQWETNAGSIEINGTEYFLKQCHWH  130

Query  422  FPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             PSEH +N   YD+E H++H+S D     +IAV+AV+Y+IG   N  LS +   +K + +
Sbjct  131  SPSEHSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRA-NSFLSTLTRHVKSMID  189

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +  IG  DP  ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R 
Sbjct  190  E-NHEISIGMTDPRKIKIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFRE  248

Query  770  AIHDESKTNARPLQTINDRFVKV  838
            A+HD ++ NARP+Q +N R + V
Sbjct  249  AVHDYAEVNARPVQPLNLREIHV  271



>tpg|DAA48425.1| TPA: carbonic anhydrase [Zea mays]
Length=291

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            F+Y      GP +WG ++PEW  CSAG+MQ+PIDL  + V +   LG + + Y    A++
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVSLVPALGFLNHSYRPAQASI  99

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +      L ING  Y  RQ+HWH PSEH V+G RY +E H+VH S  G+ 
Sbjct  100  VNRGHDIMVRFNGDAGSLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESAAGKA  159

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ ++Y+IG  P+P L  +E  ++++A+    ++ IG +DP L +     YYRYMGSLT
Sbjct  160  AVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRYMGSLT  219

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPC+EGVVWT+I+ +RSV+K+Q+ L+R A+HD ++ NARP+Q +NDR + +
Sbjct  220  TPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISL  271



>emb|CDX84811.1| BnaA03g14190D [Brassica napus]
Length=242

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 156/238 (66%), Gaps = 5/238 (2%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            V+DE  FSY+ N + GP  WG+L+PEW  C  G+MQ+PIDL +K V + S+LG +   Y 
Sbjct  3    VEDESEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMNKRVKIVSHLGRLTRDYK  62

Query  305  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  484
               ATL N G+ MM+ +  G   + IN I Y   Q+HWH PSEH +NG R+ LE H+VH 
Sbjct  63   PANATLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVHE  122

Query  485  SNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYR  664
            S +G +AV+ V+Y+IG  P+  LSL+E+ L  + +    +  IG +DP  ++   R+YYR
Sbjct  123  SINGSMAVVTVLYKIGR-PDSFLSLLENKLCAITDHNEAEINIGMIDPKDIKFGSRKYYR  181

Query  665  YMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            Y+GSLT PPCT+ V+WTVI+ +R+V++ QV L+R A  D   TNARP+Q  N R VK+
Sbjct  182  YIGSLTIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAYSD---TNARPVQPTNMRTVKL  236



>ref|NP_001149032.1| carbonic anhydrase precursor [Zea mays]
 gb|ACG33896.1| carbonic anhydrase precursor [Zea mays]
Length=291

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 155/232 (67%), Gaps = 1/232 (0%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            F+Y      GP +WG ++PEW  CSAG+MQ+PIDL  + V +   LG + + Y    A++
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVTLVPALGFLNHSYRPAQASI  99

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +      L ING  Y  RQ+HWH PSEH V+G RY +E H+VH S  G+ 
Sbjct  100  VNRGHDIMVRFNGDAGRLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESAAGKA  159

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ ++Y+IG  P+P L  +E  ++++A+    ++ IG +DP L +     YYRYMGSLT
Sbjct  160  AVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRYMGSLT  219

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPC+EGVVWT+I+ +RSV+K+Q+ L+R A+HD ++ NARP+Q +NDR + +
Sbjct  220  TPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISL  271



>ref|XP_010510675.1| PREDICTED: alpha carbonic anhydrase 7-like isoform X2 [Camelina 
sativa]
Length=248

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 154/241 (64%), Gaps = 5/241 (2%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            ++DE  FSY+ N + GP  WG+L+PEW  C  G++Q+PIDL +K V + ++   +   Y 
Sbjct  3    IEDEREFSYERNKENGPEKWGKLKPEWKLCGKGELQSPIDLMNKRVRLVTDFEKLTKDYK  62

Query  305  RDVATLENHGYGMMLSWPL---GQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
               ATL N G+ MML +     G     ING  Y   Q+HWH PSEH +NG R+ LE HL
Sbjct  63   PCNATLINRGHDMMLRFEEEEEGPGSFKINGTEYKLLQLHWHSPSEHTINGRRFALELHL  122

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH + +G +AV+ V+Y+IG  P+  L  +E  L  + +    +K +  +DP  +Q   R+
Sbjct  123  VHENINGSLAVVTVLYKIGR-PDSFLESLEKKLSVITDQNEAEKNVEMIDPRNIQIGSRK  181

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            +YRY+GSLTTPPCT+ V+WTV++ +R+VTK QV L+R A+HD   TNARP+Q IN R VK
Sbjct  182  FYRYLGSLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDTNARPVQPINKRVVK  241

Query  836  V  838
            +
Sbjct  242  L  242



>ref|XP_010488317.1| PREDICTED: alpha carbonic anhydrase 5 [Camelina sativa]
Length=274

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 169/268 (63%), Gaps = 11/268 (4%)
 Frame = +2

Query  65   LKLFSIA--FLLLSVTHVIKSQ-----EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +K+ SI   FLL+ ++  I S      EV+DE  F+Y++N ++GP +WG L+PEW  C  
Sbjct  1    MKISSIGCVFLLIFISITIVSSSTDQGEVEDEAQFNYEKNGEKGPENWGRLKPEWAICGK  60

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            G MQ+PIDL  K V V  NLG +++ Y+   AT++N G+ +ML +  G    GI  NG  
Sbjct  61   GNMQSPIDLTDKRVLVDHNLGYLRSQYLPSNATIKNRGHDIMLKFEGGNAGSGITINGTE  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DGR AV++  Y++G  P+  L  +   L
Sbjct  121  YKLQQIHWHSPSEHTINGKRFILEEHMVHQSKDGRNAVVSFFYKLGR-PDFFLLSLGRYL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
             ++ +T   ++ +G + P       R YYRY+GSLTTPPC+E V WT+ + +R+V+ +Q+
Sbjct  180  MRITDTHEAEESVGMIHPRTFDFESRHYYRYLGSLTTPPCSENVTWTISKEMRTVSLKQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKV  838
             ++R  +HD+S TNARPLQ  N R V +
Sbjct  240  IMLRVTVHDQSNTNARPLQRKNQRPVTL  267



>gb|ABK22387.1| unknown [Picea sitchensis]
Length=271

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 158/252 (63%), Gaps = 3/252 (1%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            IAF L+     +++QE+DDE  F Y E   +GP HWGEL+ EW  C  G  Q+PID+  +
Sbjct  10   IAFALILFIAGVRTQEIDDEREFEYKEGP-KGPEHWGELKEEWKACGRGTQQSPIDVVKR  68

Query  260  PVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
              + S NLG +   Y    ATL N G+ +M++W  G   + I G R+  +Q HWH P+EH
Sbjct  69   NAIISPNLGTLHRIYHPANATLVNRGHDIMVNWSEGAGSVEIKGKRFTLKQCHWHTPAEH  128

Query  437  VVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIG  616
             ++G ++ LE HLVH + DG IAV+ ++++ G  P+  L+ + D +  +A      K +G
Sbjct  129  TIDGKQHPLEIHLVHQAVDGEIAVIGIIFEFGR-PDTFLAELRDAIMAIAHMEPPVKPLG  187

Query  617  YLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
             +DP  ++   R+YYRYMGSLTTPPCTEGV+W VI  +R+V++ QV  ++ A+HD  + N
Sbjct  188  MVDPYDIKFDSRKYYRYMGSLTTPPCTEGVIWNVIDEVRTVSEDQVRALQEAVHDGYEKN  247

Query  797  ARPLQTINDRFV  832
            ARP+Q +N R V
Sbjct  248  ARPIQPLNGRIV  259



>ref|XP_008227274.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 159/247 (64%), Gaps = 7/247 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            +++QEV+DE  F Y + S +GP  WGE++ EW  C  G MQ+PIDL S+ V +  NLG +
Sbjct  28   VEAQEVEDEREFDYLQRSGKGPKQWGEMKKEWAACKNGVMQSPIDLSSQRVKLIPNLGKL  87

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
               Y    AT++N G+ + + W      + ING  YL +Q HWH PSEH +NG R  +E 
Sbjct  88   NTTYKPCNATVKNRGHDISMEWMGNAGSIQINGTEYLLKQCHWHSPSEHSINGRRNAMEL  147

Query  470  HLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
            H+VH+S D     +IAV+ V+Y+IG   N  LS +  D+K + +    K+ +G +DP  +
Sbjct  148  HMVHLSLDPNVTNKIAVVGVLYKIGRA-NSFLSKLTRDVKSMTDQKE-KRNMGMIDPRKI  205

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R A+HD ++ NARP+Q +
Sbjct  206  KIGGKNYYRYMGSLTVPPCTEGVIWTIDKKIRTVSRDQVKLFRFAVHDYAEMNARPVQPL  265

Query  818  NDRFVKV  838
            N R ++V
Sbjct  266  NLREIQV  272



>ref|XP_007213463.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
 gb|EMJ14662.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
Length=282

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 158/263 (60%), Gaps = 7/263 (3%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            +  F     L S    + +QEV+DE  F Y   S +GP  WGE++ EW  C  G +Q+PI
Sbjct  11   ISYFLFFVFLFSYFTSLAAQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPI  70

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL S  V +  +LG ++  Y  D ATL+N G+ + + W      + ING  Y  +Q HWH
Sbjct  71   DLSSHRVKLIPHLGNLKTGYKPDNATLKNRGHDISIQWETNAGSIEINGTEYFLKQCHWH  130

Query  422  FPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             PSEH +N   YD+E H++H+S D     +IAV+AV+Y+IG   N  LS +   +K + +
Sbjct  131  SPSEHSINNRSYDMELHMIHISPDLNVTNKIAVIAVLYKIGRA-NSFLSTLTRHVKSMID  189

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +  IG  DP  ++  G+ YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV L R 
Sbjct  190  E-NHEISIGMTDPRKIRIGGKNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFRE  248

Query  770  AIHDESKTNARPLQTINDRFVKV  838
            A+HD ++ NARP+Q +N R + V
Sbjct  249  AVHDYAEVNARPVQPLNLREIHV  271



>gb|KGN59000.1| hypothetical protein Csa_3G742880 [Cucumis sativus]
Length=275

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 159/243 (65%), Gaps = 8/243 (3%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            +QEV+DE  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N
Sbjct  24   AQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKN  83

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
             Y   +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HL
Sbjct  84   KYKPSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHL  143

Query  476  VHVSNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA  643
            VH S++      IAV+   Y+IG  P+  LS +   +K L E   +K GI  ++P  ++ 
Sbjct  144  VHQSSNPNAKYPIAVVGFFYKIGR-PDSFLSKLNRKIKALNEKKEIKAGI--INPRWIKN  200

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
             G +YYRY+GSLT PPCTEGV+W + + I +V+++QV L+R+A+HD ++ NARP+Q  N 
Sbjct  201  GGMKYYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNG  260

Query  824  RFV  832
            R +
Sbjct  261  RHI  263



>ref|XP_004249474.1| PREDICTED: alpha carbonic anhydrase 7-like [Solanum lycopersicum]
Length=269

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/260 (42%), Positives = 163/260 (63%), Gaps = 5/260 (2%)
 Frame = +2

Query  56   MDMLKLFSIAFLLLSV-THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  232
            M   +  SI F+++   T  IK+QEV+DE  F Y E S++GP  WG+L+ EW  C+ G+M
Sbjct  1    MKQQRYLSILFIIIFFSTTFIKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEM  60

Query  233  QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            Q+PID+  + V      P + +Y    AT++N G+ + L W      + ING  Y  +Q 
Sbjct  61   QSPIDMSHERVRIIQ-KPDKRHYKLCNATVKNRGHDISLQWHGDAGSVTINGTNYPLQQA  119

Query  413  HWHFPSEHVVNGTRYDLEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLA  586
            HWH PSEH VNG RYD+E H+VH++ +   +I V+ V+Y+IG+ P+  LS +  ++  + 
Sbjct  120  HWHSPSEHTVNGRRYDMEMHMVHLNENATNKIVVIGVLYKIGK-PDRFLSKLIRNISSMI  178

Query  587  ETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR  766
            +     K  G +DP  ++   R+YYRYMGSLT PPCTEGV+WT+ + +R+V++ QV ++R
Sbjct  179  DKKDEVKNAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLR  238

Query  767  NAIHDESKTNARPLQTINDR  826
             A+HD ++ N RPLQ  N R
Sbjct  239  EAVHDYAEKNGRPLQPKNKR  258



>ref|XP_008442725.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=274

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 162/257 (63%), Gaps = 9/257 (4%)
 Frame = +2

Query  77   SIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES  256
            ++ F +  +T  I +QEV+DE  F Y + S +GPS WG+++ EW +C  G MQ+PIDL +
Sbjct  10   ALVFFIFILTSAI-AQEVEDESEFDYRKGSKKGPSKWGDIKREWEKCKNGNMQSPIDLSN  68

Query  257  KPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSE  433
            K V V  +LG ++N Y   +A ++N G+ + + W      + ING  YL +Q HWH PSE
Sbjct  69   KRVKVVKSLGQLKNKYKPSIAIIKNRGHDISVKWEEDAGSIEINGTEYLLQQAHWHSPSE  128

Query  434  HVVNGTRYDLEAHLVHVSNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
            H +NG  YDLE HLVH S++      IAV+   Y+IG  P+  LS +   +K L E    
Sbjct  129  HTLNGRSYDLEVHLVHQSSNPNAKYPIAVVGFFYKIGR-PDSFLSKLTRKIKALNEKKET  187

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            K GI  ++P  ++  G +YYRY+GSLT PPCTEGV+W + + I +V+ +QV L+R+A+HD
Sbjct  188  KAGI--INPRWIKNGGMKYYRYIGSLTVPPCTEGVIWNINKKIGTVSGKQVKLLRSAVHD  245

Query  782  ESKTNARPLQTINDRFV  832
             ++ NARP+Q  N R V
Sbjct  246  SAEKNARPIQPHNGRHV  262



>gb|AAF79837.1|AC026875_17 T6D22.16 [Arabidopsis thaliana]
Length=263

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 162/258 (63%), Gaps = 14/258 (5%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
             + LFSI  ++   +      EV+DE  F+Y +N ++GP  WGEL+PEW  C  G+MQ+P
Sbjct  12   FVALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSP  71

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL ++ V + S+LG +   Y    ATL+N G+ +ML +  G   + ING  Y  +Q+HW
Sbjct  72   IDLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHW  131

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH +NG R            + R+AV+ V+Y+IG     I SL E +L+ +AE   
Sbjct  132  HSPSEHTINGRR------------NRRMAVVTVLYKIGRADTFIRSL-EKELEGIAEMEE  178

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++   R+YYRY GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+H
Sbjct  179  AEKNVGMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVH  238

Query  779  DESKTNARPLQTINDRFV  832
            D++ +NARP+Q  N R V
Sbjct  239  DDANSNARPVQPTNKRIV  256



>ref|XP_008241384.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=288

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 172/262 (66%), Gaps = 9/262 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            +F + F  L+++ V+K+QEV+DE  F Y E S +GP++WGE++ EW  C  G MQ+PIDL
Sbjct  19   VFVLLFTHLTIS-VVKAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDL  77

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
              K   +  +L  ++  Y    ATL+N G+ + L W      + INGI+Y  +Q HWH P
Sbjct  78   PGKSFQILPSLVELKRTYKPSNATLKNRGHDIKLEWAGNAGSIEINGIQYFLKQSHWHSP  137

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRI----AVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            SEH +NG RYD+E H+V+ S D ++    AV+ V+YQIG  P+  LS +  D+  + +  
Sbjct  138  SEHSINGKRYDMELHMVYQSPDPKVESNTAVVGVLYQIGR-PDAFLSKLTRDIASMTDK-  195

Query  596  GVKKGIGYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
             +++ +G +DP  +++  G+ YYRY+GSLT PPCTEGV+W + +   +V+++Q+ L+R +
Sbjct  196  KIERSVGVIDPAEIVELDGKNYYRYIGSLTIPPCTEGVIWIMSKQFGTVSREQIDLLRVS  255

Query  773  IHDESKTNARPLQTINDRFVKV  838
            ++D ++TNARPLQ +N R +++
Sbjct  256  VYDYAETNARPLQPLNRRIIRL  277



>ref|XP_002268233.1| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI30161.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 161/243 (66%), Gaps = 3/243 (1%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y E S++GP HWGEL+ EW  C+ G +Q+PIDL ++ V V   LG +
Sbjct  26   IIAQEVEDEREFEYIEGSEKGPKHWGELKEEWAACNNGDLQSPIDLSNQRVKVIPKLGDL  85

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            +  Y    AT++N G+ + L W      + ING  Y  +Q HWH PSEH +NG RYDLE 
Sbjct  86   KRNYKLCNATVKNRGHDISLQWVGDAGSIRINGTEYKLQQGHWHAPSEHSINGRRYDLEL  145

Query  470  HLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG  649
            H+VHVS D  IAV+ ++Y+ G+ P+  LS +  ++  +A+    +K +G + P  ++  G
Sbjct  146  HMVHVSPDNNIAVVGLIYKTGQ-PDKFLSKMMSNITSMADKMEQRK-MGVIHPGDIKMGG  203

Query  650  RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF  829
            R+YY+YMGSLT PPCTEGV W + + IR+V+++QV  +R A+HD ++ NARP+Q +N R 
Sbjct  204  RKYYKYMGSLTVPPCTEGVTWIINKKIRTVSREQVKQLRLAVHDYAEMNARPVQPLNLRE  263

Query  830  VKV  838
            V++
Sbjct  264  VQL  266



>gb|KDP26093.1| hypothetical protein JCGZ_21126 [Jatropha curcas]
Length=269

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 162/255 (64%), Gaps = 14/255 (5%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            + SIAF            EV DE  F+YDE++ +GP HWG + PEW  C+ GK+Q+PIDL
Sbjct  16   IISIAF----------ESEVGDESPFTYDEDTGKGPKHWGNIEPEWQVCNNGKLQSPIDL  65

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
             +K V   S LG +   Y    A+++N G+ + + W      + ING  Y  +Q HWH P
Sbjct  66   LNKRVQTSSKLGKLHRCYKPAPASVKNRGHDIAVIWKGDAGKIKINGTDYKLQQCHWHSP  125

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH  NG+RY+LE HLVH S++G+IAV+ ++Y+ G   +P LS +   +K+  E   +  
Sbjct  126  SEHTFNGSRYELEIHLVHESSEGKIAVIGIVYKYGRH-DPFLSKLFQHIKRTVEKEEIDL  184

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
            GI  ++P  ++   R+YYRY GSLTTPPCTEGV+WT+++ +R+V+++QV  +R+A+HD  
Sbjct  185  GI--VNPGNIRFGSRKYYRYNGSLTTPPCTEGVIWTIVKKVRTVSREQVKALRDAVHDGF  242

Query  788  KTNARPLQTINDRFV  832
            + NARP Q ++ R V
Sbjct  243  EANARPSQPLDGRPV  257



>ref|XP_007132283.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
 gb|ESW04277.1| hypothetical protein PHAVU_011G081900g [Phaseolus vulgaris]
Length=274

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/255 (40%), Positives = 166/255 (65%), Gaps = 4/255 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            A +LLS   +  S+EV++E  F+YD  S  GP +WG++ PEW  C  G MQ+PI+  +  
Sbjct  16   ALVLLSCP-ITMSEEVENEKEFTYDMKSKSGPENWGDIEPEWNLCKKGSMQSPINFLNGV  74

Query  263  VVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV  442
               +NLG ++  Y      L N G+ + + W  G+  + ING +Y   Q HWH PSEH +
Sbjct  75   QKVNNLGELKINYKPSKVVLVNRGHDIKVKWVGGKSNIEINGTKYDLIQSHWHSPSEHAI  134

Query  443  NGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYL  622
            +GTR DLE H+VH +  G  AVL ++Y+ G   +P +SL+   LK +++  G ++ +  +
Sbjct  135  DGTRLDLELHMVHQTPSGEYAVLGIIYRAGRE-DPFVSLLSKGLKAISDHTGAEEEVAEV  193

Query  623  DPNLLQ--ARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTN  796
            DP++++  +    YYRY GSLTTPPC+E V+WTV+R +RS++++Q+ L++ A+ D+S++N
Sbjct  194  DPSMVKEGSSVSLYYRYTGSLTTPPCSENVIWTVLREVRSISQEQIKLLQEAVEDDSRSN  253

Query  797  ARPLQTINDRFVKVD  841
            ARPLQ +N+R V+++
Sbjct  254  ARPLQELNNRVVQLN  268



>ref|NP_172285.2| alpha carbonic anhydrase 5 [Arabidopsis thaliana]
 sp|F4HUC4.1|ATCA5_ARATH RecName: Full=Alpha carbonic anhydrase 5; Short=AtaCA5; Short=AtalphaCA5; 
AltName: Full=Alpha carbonate dehydratase 5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE28238.1| alpha carbonic anhydrase 5 [Arabidopsis thaliana]
Length=277

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 173/268 (65%), Gaps = 11/268 (4%)
 Frame = +2

Query  65   LKLFSIAF----LLLSVTHVIKSQ---EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +K+ SI +    + +S+T V  S    EV+DE  F+Y++  ++GP +WG L+PEW  C  
Sbjct  1    MKIPSIGYVFFLIFISITIVSSSPDHGEVEDETQFNYEKKGEKGPENWGRLKPEWAMCGK  60

Query  224  GKMQTPIDLESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGI--NGIR  394
            G MQ+PIDL  K V+   NLG +++ Y+   AT++N G+ +M+ +  G   LGI  NG  
Sbjct  61   GNMQSPIDLTDKRVLIDHNLGYLRSQYLPSNATIKNRGHDIMMKFEGGNAGLGITINGTE  120

Query  395  YLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDL  574
            Y  +Q+HWH PSEH +NG R+ LE H+VH S DGR AV+A  Y++G+ P+  L  +E  L
Sbjct  121  YKLQQIHWHSPSEHTLNGKRFVLEEHMVHQSKDGRNAVVAFFYKLGK-PDYFLLTLERYL  179

Query  575  KKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQV  754
            K++ +T   ++ +  + P       + YYR++GSLTTPPC+E V+WT+ + +R+VT +Q+
Sbjct  180  KRITDTHESQEFVEMVHPRTFGFESKHYYRFIGSLTTPPCSENVIWTISKEMRTVTLKQL  239

Query  755  ALIRNAIHDESKTNARPLQTINDRFVKV  838
             ++R  +HD+S +NARPLQ  N+R V +
Sbjct  240  IMLRVTVHDQSNSNARPLQRKNERPVAL  267



>ref|NP_001147028.1| carbonic anhydrase precursor [Zea mays]
 gb|ACF88000.1| unknown [Zea mays]
 gb|ACG25129.1| carbonic anhydrase precursor [Zea mays]
 gb|AFW61792.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 153/232 (66%), Gaps = 2/232 (1%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY    + GP HWG ++ EW  CSAG+MQ+PIDL  + V +  +LG + + Y    A +
Sbjct  38   FSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPAEAAI  97

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +     +L ING  Y  +Q+HWH P+EH V+G RYD+E HLVH S+  + 
Sbjct  98   ANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRYDMELHLVHESSANKA  157

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ ++Y+IG   +P L  +E  + ++A+    ++ IG +DP   + R   YYRY+GSLT
Sbjct  158  AVIGMLYEIG-AEDPFLQALEPSIHRIADRQDREEAIGVVDPRRARGRASVYYRYVGSLT  216

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPCTEGV+WTV++ +R+V++ Q+ L+R A+HD  + NARP+Q +NDR + +
Sbjct  217  TPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPVQDVNDRDISI  268



>gb|EMT00558.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=284

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/259 (41%), Positives = 164/259 (63%), Gaps = 2/259 (1%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
            L LFS + +L +V      QE + E  FSY  +++ GP+HWGE++ EW  C  G++Q+PI
Sbjct  18   LLLFSASIILSAVPAARAQQETEHEEEFSYSLDAENGPAHWGEIKEEWSACGKGEIQSPI  77

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            DL    V +   LG + + Y    A++ N G+ +M+ +      + I+G  Y  RQ+HWH
Sbjct  78   DLAGPRVTLVRRLGHLNHSYAPANASIVNRGHDIMVRFEGDAGSVSIDGTAYHLRQLHWH  137

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             P+EH VNG RYD+E H+VH S  G+ AV+ V+Y+IG   + +L  +E  L+ +A+    
Sbjct  138  APTEHSVNGRRYDMELHMVHQSAQGKAAVIGVLYEIG-ARDALLHKLEPYLEMIAKQRDR  196

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ +G +D    + R   YYRY+GSLTTPPCT+GV+WT+++ +R+V+K Q+ L+R A+HD
Sbjct  197  QEKVGVVDARGARGRASVYYRYVGSLTTPPCTQGVIWTIVKRVRTVSKHQLELLREAVHD  256

Query  782  ESKTNARPLQTINDRFVKV  838
            E + NARP Q +N R + +
Sbjct  257  EMEKNARPRQELNSRDISM  275



>ref|XP_002445625.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
 gb|EES15120.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
Length=281

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 156/242 (64%), Gaps = 1/242 (0%)
 Frame = +2

Query  116  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQ  292
            ++QE + E  FSY    + GP HWG ++ EW  C  G++Q+PIDL  + V +  +LG + 
Sbjct  31   RAQETEHEEEFSYIPGDEHGPEHWGRIKEEWAACGTGRLQSPIDLSHERVSLVRSLGYLH  90

Query  293  NYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAH  472
            + Y    A++ N G+ +M+ +      L ING  Y  +Q+HWH P+EH V+G RYD+E H
Sbjct  91   HSYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGRRYDMELH  150

Query  473  LVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGR  652
            LVH S D + AV+A++Y++G   +  L  +E  ++++A+    ++ +G +DP   +    
Sbjct  151  LVHESADKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREERVGVVDPRRARGTAS  210

Query  653  RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
             YYRYMGSLT PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ + NARPLQ  N+R +
Sbjct  211  VYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMENNARPLQEANNRHI  270

Query  833  KV  838
             +
Sbjct  271  SI  272



>ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN48196.1| hypothetical protein Csa_6G446560 [Cucumis sativus]
Length=276

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 166/254 (65%), Gaps = 9/254 (4%)
 Frame = +2

Query  86   FLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            F+LL   H   I +QEV+DE  F Y E S +GP HWGE++ EW  C+ G +Q+PIDL S+
Sbjct  12   FILLYFIHSSSISAQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSQ  71

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEH  436
             V +   LG ++  Y    AT++N G+ + + W      + ING  Y  +Q HWH PSEH
Sbjct  72   RVKIVPQLGELKRSYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQQSHWHSPSEH  131

Query  437  VVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
             VNG RYDLE H+VH S+D     +IAV+  +Y IG+ P+P ++ +  ++  + +    K
Sbjct  132  SVNGRRYDLELHMVHQSSDPTVKNKIAVVGQLYTIGQ-PDPFITQLSREILGMVDRKHEK  190

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K +G ++P  ++  G++YYRY+GSLT PPCTEGV+WT+ + IR+V+++QV L+R A+HD 
Sbjct  191  K-VGVMNPADIKFGGKKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHDY  249

Query  785  SKTNARPLQTINDR  826
            ++ NARPLQ +N R
Sbjct  250  AEFNARPLQPLNSR  263



>ref|XP_010267256.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 164/245 (67%), Gaps = 7/245 (3%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            SQEV+DE  F Y E S +GP HWGEL  EW  C  G MQ+PIDL +K V V   LG ++ 
Sbjct  28   SQEVEDEREFDYLEGSGKGPDHWGELHEEWAACKNGDMQSPIDLLNKRVQVIPALGRMKR  87

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
             Y   +ATL+N G+ + L W  G   + ING  Y+ +Q HWH PSEH +NG R+DLE H+
Sbjct  88   SYKPSIATLKNRGHDIALQWVGGGGSININGTDYVLQQSHWHSPSEHTINGRRFDLELHM  147

Query  476  VHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQA  643
            VHV++D     +IAV+ ++Y+IG  P+  LS +   +  +A++ G +  +G +DP  ++ 
Sbjct  148  VHVTSDTKAVNKIAVIGILYKIGR-PDDFLSELMKGIWSIADSKG-EVNVGVVDPRHIKI  205

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
              R+YYRYMGSLT PPCT+GV+WT+ + +R+VT+ QV  +R A+HD ++ N+RPLQ +N+
Sbjct  206  GSRKYYRYMGSLTVPPCTQGVIWTINKKVRTVTRGQVKALRVAVHDYAEENSRPLQLLNN  265

Query  824  RFVKV  838
            R +++
Sbjct  266  RNIQL  270



>ref|XP_006339092.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=269

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 160/254 (63%), Gaps = 7/254 (3%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            LF I F   +    IK+QEV+DE  F Y E S++GP  WG+L+ EW  C+ G+MQ+PID+
Sbjct  10   LFIIIFFSATF---IKAQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDM  66

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
              + V      P + +Y    AT++N G+ + L W      + ING  Y  +Q HWH PS
Sbjct  67   SHERVRIIQ-KPDKRHYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQAHWHSPS  125

Query  431  EHVVNGTRYDLEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            EH VNG RYD+E H+VH++ +   +I V+ V+Y+IG+ P+  LS +  ++  + +     
Sbjct  126  EHTVNGRRYDMEMHMVHLNENATNKIVVIGVLYKIGK-PDRFLSKLIRNISSMIDKKDEV  184

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K  G +DP  ++   R+YYRYMGSLT PPCTEGV+WT+ + +R+V++ QV ++R A+HD 
Sbjct  185  KNAGMIDPREIKIGSRKYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHDY  244

Query  785  SKTNARPLQTINDR  826
            ++ N RPLQ+ N R
Sbjct  245  AERNGRPLQSKNKR  258



>gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Erythranthe guttata]
Length=277

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 161/260 (62%), Gaps = 6/260 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
              +  +A L+L     I +QEV+DE  F Y E  ++GP  WG ++ EW  C+ G MQ+P+
Sbjct  11   FDILIVACLVLLAAKSIHAQEVEDEREFDYAEKGEKGPRKWGHIKEEWAACNNGTMQSPV  70

Query  245  DLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            D+ +  V   +  P +  Y    AT+ N G+ + + W      + ING  +  R  HWH 
Sbjct  71   DMSNARVRIIS-KPEKRIYRVSNATVRNRGHDIQIQWSGDAGSILINGTEFSLRYAHWHS  129

Query  425  PSEHVVNGTRYDLEAHLVHVSNDG----RIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            PSEH +NG RYD+E H+VH++ D     +IAV+ ++Y+IG+ P+  LS +  ++  + + 
Sbjct  130  PSEHTINGRRYDMELHMVHLNTDSNVTTKIAVVGILYKIGK-PDKFLSKLMRNISSIVDN  188

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
               +  IG ++PN ++ R +RYYRYMGSLT PPCTEGV+WT+ + +++V+++QV L+R A
Sbjct  189  KDEQVNIGMINPNDIKLRSKRYYRYMGSLTVPPCTEGVIWTLNKKVKTVSREQVNLLREA  248

Query  773  IHDESKTNARPLQTINDRFV  832
            +HD ++ NARPLQ  N R +
Sbjct  249  VHDYAEVNARPLQPHNKRGI  268



>gb|ADW27480.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 153/232 (66%), Gaps = 2/232 (1%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY    + GP HWG ++ EW  CSAG+MQ+PIDL  + V +  +LG + + Y    A +
Sbjct  38   FSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPAEAAI  97

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +     +L ING  Y  +Q+HWH P+EH V+G RYD+E HLVH S+  + 
Sbjct  98   ANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRYDMELHLVHESSANKA  157

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ ++Y+IG   +P L  +E  + ++A+    ++ IG +DP   + R   YYRY+GSLT
Sbjct  158  AVIGMLYEIG-GEDPFLQALEPSIHRIADRQDREEAIGVVDPRRARGRASVYYRYVGSLT  216

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPCTEGV+WTV++ +R+V++ Q+ L+R A+HD  + NARP+Q +NDR + +
Sbjct  217  TPPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPVQDVNDRDISI  268



>ref|XP_004973662.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=277

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 153/232 (66%), Gaps = 1/232 (0%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY    + GP HWGE++ EW  C AG+MQ+PIDL  + V +   LG + + Y    A++
Sbjct  36   FSYVHGDEHGPEHWGEIKAEWAACGAGRMQSPIDLHHERVSLVRGLGYLDHSYRPAQASI  95

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +      L ING  Y  +Q+HWH P+EH V+G RYDLE HLVH S + + 
Sbjct  96   VNRGHDIMVRFEGDAGSLVINGTAYHLKQLHWHSPTEHTVDGRRYDLELHLVHESAEKKA  155

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+A++Y+IG   +P+L  +E  ++++A+    ++ +  +DP  ++ R   YYRYMGSLT
Sbjct  156  AVIAILYEIGRGHDPLLHQMEPFIRQIADKRDREERVSVVDPRAVRGRASVYYRYMGSLT  215

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
             PPCTEGV+WT+++ + +V+K Q+ L+R A+HD+ + NARPLQ +N R V +
Sbjct  216  VPPCTEGVIWTIVKRVHTVSKYQLELLREAVHDDMEKNARPLQEVNSRDVSL  267



>ref|XP_002519458.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF42872.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 170/265 (64%), Gaps = 12/265 (5%)
 Frame = +2

Query  71   LFSIAFLL--LSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPI  244
             F+IA L+  L  +H +K+QEV+DE  F Y + S++GP  WGEL+ EW  C  G +Q+PI
Sbjct  9    FFTIATLISVLLFSHQVKAQEVEDEREFDYIQGSEKGPEKWGELKKEWASCKNGTLQSPI  68

Query  245  DLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRY--LGINGIRYLFRQVH  415
            D+ ++ V +    G ++  Y    +T++N G+ + L W  G +   + ING  Y  +Q H
Sbjct  69   DMSNQRVKIIPKSGDLKRNYRSCNSTVKNRGHDISLQWE-GHKAGSVNINGTGYFLQQCH  127

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            WH PSEH +NG RYD+E H+VH S D     +IAV  ++Y+IG+ P+  LS +  ++  +
Sbjct  128  WHSPSEHTINGRRYDMELHMVHESTDPNVKNKIAVTGILYKIGQ-PDAFLSKLLGNVISM  186

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
             +     + +G ++PN ++  G+RYYRY GSLT PPCTEGV+WT+ + IR+V+  QV  +
Sbjct  187  TDHKQ-DRNMGMINPNEIKMGGKRYYRYEGSLTVPPCTEGVIWTINKKIRTVSIDQVKAL  245

Query  764  RNAIHDESKTNARPLQTINDRFVKV  838
            R A+HD ++ N+RP+Q +N+R V++
Sbjct  246  REAVHDYAEKNSRPVQPLNEREVQL  270



>ref|XP_010696308.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=289

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 154/245 (63%), Gaps = 4/245 (2%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNLGPI  289
            I +QE +DE  F+Y +  + GP +WG ++PEW  C+ G+ Q+PI+L  S P    +   I
Sbjct  26   IVAQEAEDESEFNYIQGDEIGPENWGNIKPEWATCNTGRKQSPINLLASNPQRVPSSERI  85

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
              +Y      ++N G+ + L W  G   + ING+ Y+ RQ HWH PSEH +NG RY LEA
Sbjct  86   TRFYKPGQTIIKNRGHDIKLEWTEGSSRIQINGVDYILRQCHWHSPSEHTINGKRYALEA  145

Query  470  HLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI--GYLDPNLLQA  643
            HL H S D ++AV+  +YQ G +P+P LS IED ++ +A      + +  G + P+ ++ 
Sbjct  146  HLTHESVDNKVAVIGFLYQYG-SPDPFLSSIEDKIRSIANNASAHQDVMAGRISPSQVRM  204

Query  644  RGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTIND  823
             G +YY Y+GSLTTP C EGV+W V   + +V+K+QV L+R+A+ D S+TNARPLQ +N 
Sbjct  205  EGFQYYSYIGSLTTPACDEGVIWIVENKLGTVSKEQVKLLRDAVDDGSRTNARPLQPVNG  264

Query  824  RFVKV  838
            R V +
Sbjct  265  RCVNL  269



>emb|CDX94018.1| BnaC07g36520D [Brassica napus]
Length=268

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 163/258 (63%), Gaps = 6/258 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            + +F++ FL LS   +      E DDE  F+Y++N ++GP  W ++ P W  C+ GK+Q+
Sbjct  8    IMIFALFFLCLSFPSISLANDAEADDETPFTYEQNPEKGPEGWSKINPHWKVCNNGKLQS  67

Query  239  PIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            PIDL +  V   +    +  Y    A + N G+ +M+SW      L I  + +   Q HW
Sbjct  68   PIDLTNARVSLIHDEAWRREYKPAPAVIMNRGHDVMVSWKGDAGKLTIREMEFKLVQCHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH VNGTRYDLE H+VH S  GRIAV+ V+Y++G+ PN  L+ + D LK + +   
Sbjct  128  HSPSEHTVNGTRYDLELHMVHTSARGRIAVIGVLYKLGK-PNEFLTRLLDGLKTVGKE--  184

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +RNA+ 
Sbjct  185  -EKDLGIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISVEQIAALRNAVD  243

Query  779  DESKTNARPLQTINDRFV  832
            D  +TN+RP+Q  N R V
Sbjct  244  DGYETNSRPVQDTNGRPV  261



>ref|XP_007203913.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
 gb|EMJ05112.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
Length=340

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 162/260 (62%), Gaps = 11/260 (4%)
 Frame = +2

Query  80   IAFLLL---SVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            + F+LL   S   V+++QEV+DE  F Y E S +GP++WGE++ EW  C  G MQ+PIDL
Sbjct  15   LVFVLLFMHSTISVVEAQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDL  74

Query  251  ESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
              K   +  +L  ++  Y    ATL+N G+ + + W      + ING  Y F+Q HWH P
Sbjct  75   PRKSFQILPSLVELKRIYKPSNATLKNRGHDIKIEWEGDAGSIKINGTDYFFKQCHWHTP  134

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRI----AVLAVMYQIGETPNPILSLIEDDLKKLAETP  595
            SEH +NG RYDLE H+VH S D +I    AVLA +Y IG  PN  LS +  D+  ++E  
Sbjct  135  SEHSINGIRYDLELHMVHQSTDPKIRNSIAVLAFLYHIG-NPNLFLSKVNKDI--MSEVA  191

Query  596  GVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAI  775
              +  +G +DP  ++     +YRY+GSLT+PPC EGV+WT+   ++ V+++QV L++ A+
Sbjct  192  TKEVHLGVIDPREIKWTSFSFYRYVGSLTSPPCAEGVIWTINEKVKHVSREQVELLQEAV  251

Query  776  HDESKTNARPLQTINDRFVK  835
             D ++ N RPLQ +NDR +K
Sbjct  252  DDYAEMNTRPLQPLNDREIK  271



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 168/264 (64%), Gaps = 9/264 (3%)
 Frame = +2

Query  53   DMDMLKLFSIAF---LLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            +M +L+   + F   LLL+++   +S EVDDE  F+Y E + +GP  WG++ P W  C  
Sbjct  29   EMGILRSSFVFFALGLLLTLSSASES-EVDDETPFTYIEGTGKGPKEWGQIDPRWQACGM  87

Query  224  GKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            GK+Q+PIDL ++ V V+ NLG ++  Y    A + N G+ + + W      + ING  Y 
Sbjct  88   GKLQSPIDLLNERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYK  147

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
              Q HWH PSEH  NG+RYDLE H+VH+S+ G IAV+ ++Y+ G  P+P L+ + + +  
Sbjct  148  LLQCHWHSPSEHTFNGSRYDLELHMVHLSSHGEIAVIGIVYKYGR-PDPFLTKLLEHITV  206

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            + +       +G ++P +++   R+Y+RY+GSLT PPCTEGVVWT++R +R+V+++QV  
Sbjct  207  VGKE---DTDLGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEA  263

Query  761  IRNAIHDESKTNARPLQTINDRFV  832
            +R A+HD  + NARP Q ++ R V
Sbjct  264  LREAVHDGYEANARPTQQLDGRAV  287



>gb|KCW89335.1| hypothetical protein EUGRSUZ_A01626, partial [Eucalyptus grandis]
Length=249

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 151/239 (63%), Gaps = 8/239 (3%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRD  310
            DE  F Y   S++GP HWGELR EW  C  G+ Q+PIDL S+ V V   LG IQ  Y   
Sbjct  1    DEREFDYIAGSEKGPKHWGELRKEWEACKKGETQSPIDLSSRRVKVIPKLGGIQRSYKPS  60

Query  311  VATLENHGYGMMLSWPLGQ-RYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVS  487
             ATL+N G+ + L W +G    + ING  Y  +Q HWH PSEH +NG RY++E H+VHVS
Sbjct  61   NATLKNRGHDISLQWDVGNVGSVKINGTEYFLQQCHWHSPSEHTINGRRYEMELHMVHVS  120

Query  488  ND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
             D      IAV+ ++Y+ G  P+  LS +  +L  + +  G ++ +G  DP  ++  G+ 
Sbjct  121  TDPNVENNIAVVGLLYKTGR-PDAFLSKLMGNLWSMVDQEG-ERTMGVFDPRKIKMGGKS  178

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            Y RYMGSLT PPCTEGV+WT+ + I +V+K Q+ L+R A+HD ++ NARP+Q +N R +
Sbjct  179  YLRYMGSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHDHAEKNARPVQPLNRREI  237



>ref|XP_008462491.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 163/245 (67%), Gaps = 7/245 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y E S +GP HWGE++ EW  C+ G +Q+PIDL S+ V +   LG +
Sbjct  23   ISAQEVEDERDFDYVEWSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSERVKIVPQLGEL  82

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            +  Y    AT++N G+ + + W      + ING+ Y  +Q HWH PSEH +NG RYDLE 
Sbjct  83   KRNYYPCNATVKNRGHDISVYWYGKPGSIEINGVVYDLQQSHWHSPSEHSINGRRYDLEL  142

Query  470  HLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
            H+VH S+D     +IAV+  +Y IG+ P+P ++ +  ++  + +    KK +G ++P  +
Sbjct  143  HMVHQSSDPTVKNKIAVVGQLYTIGQ-PDPFITQLSREILGMVDRKHEKK-VGVMNPADI  200

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +  GR+YYRY+GSLT PPCTEGV+WT+ + IR+V+++QV L+R A+HD ++ NARPLQ +
Sbjct  201  KFGGRKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHDYAEFNARPLQPL  260

Query  818  NDRFV  832
            N R +
Sbjct  261  NSREI  265



>ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 156/240 (65%), Gaps = 8/240 (3%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            V+DE  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N Y 
Sbjct  32   VEDESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYK  91

Query  305  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  484
              +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HLVH 
Sbjct  92   PSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQ  151

Query  485  SNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGR  652
            S++      IAV+   Y+IG  P+  LS +   +K L E   +K GI  ++P  ++  G 
Sbjct  152  SSNPNAKYPIAVVGFFYKIGR-PDSFLSKLNRKIKALNEKKEIKAGI--INPRWIKNGGM  208

Query  653  RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            +YYRY+GSLT PPCTEGV+W + + I +V+++QV L+R+A+HD ++ NARP+Q  N R +
Sbjct  209  KYYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHI  268



>ref|XP_010036662.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW48290.1| hypothetical protein EUGRSUZ_K02021 [Eucalyptus grandis]
Length=277

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 159/258 (62%), Gaps = 5/258 (2%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
               L  +A  LL         EV DE  F+Y E + +GP  WG++ P W  CS GK+Q+P
Sbjct  12   FFALVFVAHGLLLTRSTASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACSTGKLQSP  71

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            IDL  + V V+ NLG ++  Y    A + N G+ + + W      + ING  Y   Q HW
Sbjct  72   IDLLDERVQVFPNLGKLKRDYKPAPAIVRNRGHDITVMWKGYAGQININGTYYKLLQCHW  131

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH  NG++YDLE H+VH+S+ G IAV+ ++Y+ G  P+P L+ + + +K + +   
Sbjct  132  HSPSEHTFNGSKYDLELHVVHLSSHGEIAVIGIVYKYGR-PDPFLTKLLEHIKVVRKE--  188

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
              + +G ++P +++   R+Y+RY+GSLT PPCTEGVVWT+IR +R+V+++QV  +R A+H
Sbjct  189  -DRDLGVINPGIIKFGSRKYFRYIGSLTVPPCTEGVVWTIIRKVRTVSREQVEALREAVH  247

Query  779  DESKTNARPLQTINDRFV  832
            D  + NARP Q ++ R V
Sbjct  248  DGYEANARPTQRLDRRAV  265



>ref|XP_003574630.1| PREDICTED: alpha carbonic anhydrase 7-like [Brachypodium distachyon]
Length=276

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 151/240 (63%), Gaps = 2/240 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +E D E  FSY  +++ GP+HWGE++ EW  C  G MQ+PIDL S  V +   LG + + 
Sbjct  29   EETDREEEFSYSLDAENGPAHWGEIKEEWSACGKGDMQSPIDLSSPRVSLVRGLGYLNHS  88

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    A++ N G+ +M+ +      + ING  Y  RQ+HWH PSEH +NG RYD+E H+V
Sbjct  89   YRPAQASIVNRGHDIMVRFEGDAGSVSINGTAYYLRQLHWHSPSEHSLNGRRYDMEMHMV  148

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H S   + AV+ V YQ+G   +  L  +E  L+ +A+    ++ +G +DP   + R   Y
Sbjct  149  HESAQNKAAVIGVFYQVG-AHDAFLHKLEPYLEMIADKKDREEKVGLIDPRGARGRASVY  207

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRYMGSLTTPPC EGV+WT+++ +R+V+  Q+ L+R A+HD+ + NARP Q  N+R + +
Sbjct  208  YRYMGSLTTPPCAEGVIWTIVKRVRTVSSAQLELLREAVHDDMEKNARPRQETNNRVISM  267



>ref|XP_008664513.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Zea mays]
 tpg|DAA48424.1| TPA: hypothetical protein ZEAMMB73_580242 [Zea mays]
Length=298

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 151/232 (65%), Gaps = 1/232 (0%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY    + GP HWG ++ EW  C AG+MQ+PIDL  + V +  +LG + + Y    A++
Sbjct  58   FSYVPGDEHGPEHWGSIKAEWAACGAGRMQSPIDLSHERVSLVRSLGYLSHSYRPAEASI  117

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +      L ING  Y  RQ+HWH P+EH V+G RYD+E HLVH S + + 
Sbjct  118  VNRGHDIMVRFEGDAGSLVINGTAYYLRQLHWHSPTEHTVDGRRYDMELHLVHESAENKA  177

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+AV+Y+IG   + +L  +E  ++++A+    +  +G +DP   + R   YYRY+GSLT
Sbjct  178  AVIAVLYEIGGHDDALLRQLEPAIRRVADVRDREMRVGVVDPRRARGRASVYYRYVGSLT  237

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
             PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ + NARPLQ  N R V +
Sbjct  238  APPCTEGVIWTIVKRVRSVSKHQLELLREAVHDDMENNARPLQEANHRDVSM  289



>ref|XP_002529417.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32943.1| carbonic anhydrase, putative [Ricinus communis]
Length=253

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 151/235 (64%), Gaps = 6/235 (3%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL---ESKPVVYSNLGPIQNYYM  304
            DE  FSY++N ++GP+ WGEL  EW  CS+G MQ+PIDL   +   +  S  G  +NY  
Sbjct  8    DEKEFSYEKNDEKGPARWGELTEEWKTCSSGSMQSPIDLPINQRVQLASSTEGLNRNYSA  67

Query  305  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  484
             D A L+N G+ + L W  G   + ING  Y  +Q+HWH PSEH +NG R+ LE H+VH 
Sbjct  68   SD-AILKNTGHDIELEWEAGAGTIEINGTEYTLKQLHWHSPSEHTINGRRFALEMHMVHE  126

Query  485  SNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG-RRYY  661
            S DG+IAV+A +Y IG  P+  LS + D ++K+A + G +  +G +DP   + +    YY
Sbjct  127  SKDGKIAVIAFLYTIGR-PDFFLSHLTDHIRKVAGSEGKETMVGTVDPEDFKIQNIMYYY  185

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            RYMGSLTTPPC E VVWTV++ +R+V+ QQV+L++ A+  E   NARP Q  N R
Sbjct  186  RYMGSLTTPPCHESVVWTVLKKVRTVSIQQVSLLQEAVDGEPGWNARPTQQTNGR  240



>ref|XP_009775004.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=272

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/256 (40%), Positives = 162/256 (63%), Gaps = 4/256 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            L    F+L   +  I++QEV+DE  F Y   S++GP  WG+++ EW  C+ G+MQ+PIDL
Sbjct  10   LVMFYFVLFFFSTSIRAQEVEDEREFDYAVKSEKGPRMWGKMKKEWEACNNGEMQSPIDL  69

Query  251  ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
             ++ V        +NY + + AT++N G+ + L W      L ING  Y  +Q HWH PS
Sbjct  70   SNERVRIIRKPEKRNYKLCN-ATVKNRGHDISLQWHGDAGSLLINGTEYPLQQAHWHSPS  128

Query  431  EHVVNGTRYDLEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            EH VNG RY +E H+VH++ +   +IAV+ V+Y+ G+ P+  LS +  ++  + +     
Sbjct  129  EHTVNGRRYAMEMHMVHLNENATNKIAVIGVLYKFGK-PDKFLSRLIRNISSMIDKKDEV  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K  G ++P  ++   RRYYRY+GSLT PPCTEGV+W++ + +R++++ QV L+R A+HD 
Sbjct  188  KNAGMINPREIKIGSRRYYRYLGSLTVPPCTEGVIWSIKKKVRTISRDQVKLLREAVHDY  247

Query  785  SKTNARPLQTINDRFV  832
            + +NARP+Q +N R V
Sbjct  248  AASNARPMQPLNKRPV  263



>ref|XP_008464600.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=278

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 152/238 (64%), Gaps = 4/238 (2%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            EV DE  FSY+E +  GP  WG+L+PEW  C  GK Q+PI++  + V V  NLG +   Y
Sbjct  38   EVGDESLFSYNEGNGNGPKEWGKLKPEWKSCGKGKYQSPINIVEEDVQVLPNLGKLTRDY  97

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
                A L+N G+ +++ W      + +NG +Y   Q HWH PSEH  NG RYDLE H+VH
Sbjct  98   NPAPAILKNRGHDILIRWEKDAGKITMNGTKYKLSQCHWHAPSEHSFNGKRYDLEMHIVH  157

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
             SN    AV+A++Y+ G  P+  LS +   +K + +    +K IG ++P  ++  GR+YY
Sbjct  158  TSNHNETAVVAILYKFGR-PDRFLSRLFHHIKSIGKKE--EKEIGMVNPGDIKFGGRKYY  214

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            RY+GSLT PPCTEGV+WT+ + +R+V+++QV  ++ AIHD  K NARP+Q ++ R ++
Sbjct  215  RYIGSLTVPPCTEGVIWTIQKKVRTVSREQVRALKTAIHDGLKKNARPIQALDGRRIQ  272



>ref|XP_002445628.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
 gb|EES15123.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
Length=281

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 157/243 (65%), Gaps = 2/243 (1%)
 Frame = +2

Query  116  KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQ  292
            ++QE + E  FSY    + GP HWG ++ EW  C  G+MQ+PIDL  + V +  +LG + 
Sbjct  30   RAQETEHEEEFSYIPGDEHGPEHWGHIKAEWAACGTGRMQSPIDLSHERVSLVRSLGYLH  89

Query  293  NYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAH  472
            + Y    A++ N G+ +M+ +      L ING  Y  +Q+HWH P+EH V+G R+D+E H
Sbjct  90   HSYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGHRHDMELH  149

Query  473  LVHVS-NDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG  649
            LVH S +D + AV+A++Y++G   +  L  +E  ++++A+    ++ +G +DP   +   
Sbjct  150  LVHESADDKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREERVGVVDPRRARGTA  209

Query  650  RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF  829
              YYRYMGSLT PPCTEGV+WT+++ +RSV+K Q+ L+R A+HD+ + NARPLQ  N+R 
Sbjct  210  SVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMEDNARPLQEANNRR  269

Query  830  VKV  838
            + +
Sbjct  270  ISI  272



>gb|EYU38572.1| hypothetical protein MIMGU_mgv1a011717mg [Erythranthe guttata]
Length=272

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 159/253 (63%), Gaps = 6/253 (2%)
 Frame = +2

Query  86   FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV  265
             +LL     I +QEV+DE  F Y +  ++GP  WGE++ EW  C+ G  Q+PID+ ++ V
Sbjct  11   IVLLFGAKSINAQEVEDEREFDYSKKGEKGPRKWGEIKKEWGACNNGSFQSPIDMSNERV  70

Query  266  VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVN  445
            V  +    +NY + + AT++N G+ + + W      + IN   Y  RQ HWH PSEH +N
Sbjct  71   VIFSRPEKRNYRLTN-ATIKNRGHDIQIEWFGDAGSIFINNTEYPLRQAHWHSPSEHTIN  129

Query  446  GTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  613
            G RYD+E HLVH++ D     RI V  ++Y+IG+ P+  LS +  ++  + +    +  +
Sbjct  130  GRRYDMELHLVHLNTDPNVKNRITVTGILYEIGK-PDKFLSKLMKNISSMIDKKDEEITV  188

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
            G +DP+ ++ R + +YRYMGSLT PPCT+GV+WT+ + +++V++ Q+ L+R A+HD ++ 
Sbjct  189  GKIDPDKIKLRSKMFYRYMGSLTVPPCTQGVIWTINKKVKTVSRDQIKLLREAVHDYAEE  248

Query  794  NARPLQTINDRFV  832
            NARPLQ  N R V
Sbjct  249  NARPLQPKNRRDV  261



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 157/251 (63%), Gaps = 5/251 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            +FL +    +  S EV DE  F+Y E + +GP  WG++ P+W  C  GKMQ+PIDL  + 
Sbjct  22   SFLTICNAALEDSDEVGDETAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPIDLLDQR  81

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V V+  LG ++  Y    A ++N G+ + + W        ING  Y   Q HWH PSEH 
Sbjct  82   VQVFPKLGKLKRXYKPAPAIVKNRGHDITMRWNGDAGKTKINGTDYRLLQCHWHSPSEHT  141

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
             NG+RY LE H+VHVS+ G+IAV+ ++Y+ G  P+P LS +   +K + +    +  IG 
Sbjct  142  FNGSRYALEFHIVHVSSTGKIAVIGIVYKYGR-PDPFLSKLFHHIKSVGKE---EVDIGI  197

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + NA
Sbjct  198  INPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVRALREAVHDGYEANA  257

Query  800  RPLQTINDRFV  832
            RP Q ++ R V
Sbjct  258  RPTQELDGRPV  268



>ref|XP_004973745.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=282

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 152/240 (63%), Gaps = 1/240 (0%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESKPVVYSNLGPIQNY  298
            QE +DE GFSY   S  GP  WG++   W +CS G+MQ+PIDL + +  +  +LG +   
Sbjct  34   QETEDEHGFSYVPGSPNGPDRWGKINTLWAECSNGEMQSPIDLSDDRVTLVRSLGFLNYS  93

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    A++ N G+ + + +      L ING  Y  RQ+HWH PSEH V+G RY +E HLV
Sbjct  94   YRPAEASIVNRGHDIQVKFSGDAGRLVINGTVYHLRQLHWHTPSEHTVDGRRYVMELHLV  153

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H + + + AV+ V Y+ G  P+  L  +E  ++++ +T   ++ IG +DPN  +A G  Y
Sbjct  154  HQTTENKTAVIGVFYETGNIPDLFLKTLEPSIRRIGDTRDREEPIGVVDPNGARATGSVY  213

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            YRYMGSLTTPPCTEGVVWTV +T+R V K Q+ ++R A+ D  + NARPLQ +N+R + +
Sbjct  214  YRYMGSLTTPPCTEGVVWTVFKTVRHVAKYQLDILREAVADGYEDNARPLQEVNNRDISI  273



>ref|XP_010279581.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=270

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 153/245 (62%), Gaps = 5/245 (2%)
 Frame = +2

Query  101  VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSN  277
            +T    + E++DE  F+Y+E S++GP HWGE+ P W  C  G+MQ+PIDL  K V V S 
Sbjct  22   ITTRAAASELEDEHEFTYEEGSEKGPEHWGEIDPHWRVCGNGEMQSPIDLLDKRVEVVSG  81

Query  278  LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY  457
            LG ++  Y    A + N G+ +M+ W      + IN   Y  +Q HWH PSEH  N +RY
Sbjct  82   LGKLKRDYRPAPAAVMNRGHDIMIEWKGDAGKININRTDYYLKQCHWHSPSEHTFNKSRY  141

Query  458  DLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
            +LE HLVH+++ GRIAV+ + Y+ G   +P L+ +   +        V+  +G ++P  +
Sbjct  142  NLELHLVHINSSGRIAVIGITYKYGRH-DPFLARL---IPYFGSVGSVENDVGIINPGDI  197

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +   R+YYRYMGSLT PPCTEGV+WT+++ +R+ +++QV  IR+A+HD  + NARP Q  
Sbjct  198  KFGSRKYYRYMGSLTVPPCTEGVIWTMVKKVRTASEEQVRAIRDAVHDGFEQNARPTQQQ  257

Query  818  NDRFV  832
            N R V
Sbjct  258  NGRTV  262



>ref|XP_006417731.1| hypothetical protein EUTSA_v10009315mg, partial [Eutrema salsugineum]
 gb|ESQ36084.1| hypothetical protein EUTSA_v10009315mg, partial [Eutrema salsugineum]
Length=250

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 157/239 (66%), Gaps = 3/239 (1%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            +FSI F ++S++    S  EV+DE  F+Y +N ++GP  WG+L+ EW  C  G +Q+PID
Sbjct  13   MFSIFFTIVSISSAASSHGEVEDEHEFNYKKNDEKGPERWGKLKSEWEMCGKGDIQSPID  72

Query  248  LESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            L ++ V   S+LG +   Y    ATL+N G+ +ML +  G   + +NG +Y  +Q+HWH 
Sbjct  73   LMNERVNTVSHLGRLNRDYRPSNATLKNRGHDIMLKFEDGAGSIKMNGFQYELQQLHWHS  132

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH +NG R+ LE H+VH    GR+AV+ V+Y+IG     I SL E +L+ +      +
Sbjct  133  PSEHTINGRRFALELHMVHEGKKGRMAVVTVLYKIGRADTFIRSL-EKELEAITNMEEAE  191

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            K +G +DP  ++   R+YYRY+GSLTTPPCT+ V W+V+R +R+VT++QV L+R A+HD
Sbjct  192  KNVGMIDPKQIKIGSRKYYRYIGSLTTPPCTQNVTWSVVRKVRTVTRKQVRLLRVAVHD  250



>ref|XP_007144381.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16375.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=295

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 145/236 (61%), Gaps = 2/236 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +E  DE  F Y   S++GP +WGEL+ EW  C  G MQ+PIDL    V +      +   
Sbjct  46   EETVDEREFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIPRCQQLYTD  105

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    AT+ N G+ + + W      + ING  +  +Q HWH PSEH +NG +YDLE H+V
Sbjct  106  YFSSNATIINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGRKYDLEMHMV  165

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            HVS + +I V+   Y+IG  P+  LS +E ++  L +   V++ IG  +P+ +Q RG  Y
Sbjct  166  HVSQEKKILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEE-VEREIGERNPSGIQTRGNMY  224

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            YRY+GSLTTPPCTEGV+W + R IR+V++ QV L+R A+HD ++ N+RP Q  N R
Sbjct  225  YRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSRPRQPRNQR  280



>ref|XP_010322405.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Solanum lycopersicum]
Length=255

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 160/244 (66%), Gaps = 24/244 (10%)
 Frame = +2

Query  116  KSQEVDDEWG-FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            +S EVDD    FSYD+ ++ GP+ WGE+      C+ G +Q+PIDL++K V V SNLG +
Sbjct  24   RSLEVDDTSDEFSYDQYANNGPAKWGEISS---NCN-GNLQSPIDLDNKVVEVVSNLGIL  79

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEA  469
            Q YY    ATL N G+ +ML W     YL IN  +Y   Q+HWH PSEH ++G RYD+EA
Sbjct  80   QKYYKPSNATLVNRGHDIMLRWDGDAGYLKINETQYQLLQIHWHTPSEHSIDGKRYDMEA  139

Query  470  HLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARG  649
            HLVH+S+DG+IAV+A++Y+IG  P+ +L+++E DL  +A+  G +K +G +DPN+++   
Sbjct  140  HLVHMSSDGKIAVIAILYEIGLLPDDLLTILEGDLIAVADKKGAEKPMGIIDPNIIKLDV  199

Query  650  RRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRF  829
              YYRY+GSLTTPPCT+GVVWT+                       ++NARP+Q +N+R 
Sbjct  200  NIYYRYIGSLTTPPCTQGVVWTIDGK------------------GFESNARPVQPLNERS  241

Query  830  VKVD  841
            +K++
Sbjct  242  IKLN  245



>ref|XP_007144380.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16374.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=280

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 145/236 (61%), Gaps = 2/236 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
            +E  DE  F Y   S++GP +WGEL+ EW  C  G MQ+PIDL    V +      +   
Sbjct  31   EETVDEREFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIPRCQQLYTD  90

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y    AT+ N G+ + + W      + ING  +  +Q HWH PSEH +NG +YDLE H+V
Sbjct  91   YFSSNATIINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGRKYDLEMHMV  150

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            HVS + +I V+   Y+IG  P+  LS +E ++  L +   V++ IG  +P+ +Q RG  Y
Sbjct  151  HVSQEKKILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEE-VEREIGERNPSGIQTRGNMY  209

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            YRY+GSLTTPPCTEGV+W + R IR+V++ QV L+R A+HD ++ N+RP Q  N R
Sbjct  210  YRYLGSLTTPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSRPRQPRNQR  265



>ref|XP_010050530.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89339.1| hypothetical protein EUGRSUZ_A01632 [Eucalyptus grandis]
Length=283

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 152/242 (63%), Gaps = 8/242 (3%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I+  +
Sbjct  32   ETEDEREFDYIPGSEKGPMHWGELRNDWEACKKGEMQSPIDLSSERVQVMPKLGEIERSH  91

Query  302  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
                ATL+N G+ + L W  G    + IN   Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLKNRGHDISLQWDTGNAGSIKINSTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  479  HVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
            HVS D      IAV+ ++Y+ G  P+  LS +   +  ++E    +K +G +DP  ++  
Sbjct  152  HVSTDPNVKNNIAVVGLLYKTG-VPDAFLSKLMGSVWSMSEKEDERK-MGTIDPREIKMG  209

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            G+ Y RYMGSLTTPPCTEGV+WT+ + + +V+K Q+ L+R A+HD ++ NARP+Q +N R
Sbjct  210  GKNYLRYMGSLTTPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNTR  269

Query  827  FV  832
             +
Sbjct  270  EI  271



>gb|KHG29611.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=278

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 164/259 (63%), Gaps = 8/259 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLES-  256
              FL LS +  + + E ++E  F Y ENS++GPSHWG+L+ EW  C  G +Q+PIDL S 
Sbjct  18   FTFLFLSYSASVSADEEENEREFDYLENSEKGPSHWGDLKMEWSACKNGVLQSPIDLSSQ  77

Query  257  KPVVYSNLGPIQNYYMRDVATLENHGYGMMLSW-PLGQRYLGINGIRYLFRQVHWHFPSE  433
            +  + +  G ++  Y    A L N G+ + L W       + ING  Y  +QVHWH PSE
Sbjct  78   RAKIVNKAGELKKTYKPCDAILRNRGHDISLKWHNCFAGLININGSEYSLQQVHWHSPSE  137

Query  434  HVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
            H +NG RY LE H+VH S D      +AV+ ++Y++G  P+  LS +  ++  +A+    
Sbjct  138  HTINGARYALELHMVHHSTDPNFNHSVAVIGLLYKLG-APDAFLSKLITNVTSMADEMQ-  195

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ +G +DPN++   G++YYRY+GSLT PPCTEGV+WT+ + IR+V+  QV  +R A+HD
Sbjct  196  EREVGVIDPNMIGIDGKQYYRYIGSLTVPPCTEGVIWTMNKMIRTVSIDQVLALRLAVHD  255

Query  782  ESKTNARPLQTINDRFVKV  838
             +++NARP+Q +N R +++
Sbjct  256  YAESNARPVQPLNHRQIEL  274



>ref|XP_009592985.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana tomentosiformis]
Length=272

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 160/253 (63%), Gaps = 4/253 (2%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
            I FLL      I++QEV+DE  F Y   S++GP  WG+L+ EW  C+ G+MQ+PIDL ++
Sbjct  13   IYFLLFLPATSIRAQEVEDEREFDYAAKSEKGPRMWGKLKKEWDACNKGEMQSPIDLSNE  72

Query  260  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
             V        +NY + + AT++N G+ + L W      + ING  Y  +Q HWH PSEH 
Sbjct  73   RVRIIRKPEKRNYKLCN-ATVKNRGHDISLQWHGNAGSVLINGTEYPLQQAHWHSPSEHT  131

Query  440  VNGTRYDLEAHLVHVSNDG--RIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGI  613
            VNG RY +E H+VH++ +   +IAV+ V+Y+ G+ P+  LS +  ++  + +     K  
Sbjct  132  VNGRRYAMEMHMVHLNENATNKIAVIGVLYKFGK-PDKFLSKLIRNISSMIDKKDEVKNA  190

Query  614  GYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKT  793
            G ++P  ++   R+YYRY+GSLT PPC EGV+W++ + +R++++ QV L+R A+HD + +
Sbjct  191  GMINPREIKIGSRKYYRYLGSLTVPPCIEGVIWSIKKKVRTISRDQVKLLREAVHDYAAS  250

Query  794  NARPLQTINDRFV  832
            NARP+Q +N R V
Sbjct  251  NARPMQPLNKRPV  263



>emb|CAM59682.1| a-type carbonic anhydrase [Lotus japonicus]
Length=269

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/257 (41%), Positives = 161/257 (63%), Gaps = 7/257 (3%)
 Frame = +2

Query  71   LFSIAFL---LLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            LFS+ FL   L S   +  +        + Y + +  GP +WG L+PEW  C  GK Q+P
Sbjct  9    LFSLVFLVTILCSSLFLTTTASESKGEEYIYTKGARNGPENWGSLKPEWEVCRNGKSQSP  68

Query  242  IDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWH  421
            ID+++    +S LG ++  Y    ATL+N G+ +ML W      L ING  Y F Q HWH
Sbjct  69   IDIKNVEG-FSQLGKLKKDYKVAPATLKNRGHDIMLQWDGDAGKLNINGTYYKFVQSHWH  127

Query  422  FPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
             PSEH +NG+++D+E H VH ++ G  AV+ + Y IG+ P+P+LS + D++K   +   +
Sbjct  128  TPSEHTLNGSKFDMEMHAVHENSKGERAVIGIWYTIGQ-PDPLLSKLLDNIKLSGDNKDI  186

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
              GI  L+P L++   R+YYRY+GSLTTPPC+EGV+WT+++ +R+V+++Q+  ++ A+HD
Sbjct  187  DLGI--LNPGLIKFGSRKYYRYVGSLTTPPCSEGVIWTIVKKVRTVSREQLKALKEAVHD  244

Query  782  ESKTNARPLQTINDRFV  832
              + NARP Q +N R V
Sbjct  245  GFEINARPTQELNGRKV  261



>ref|XP_010696307.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=279

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 152/240 (63%), Gaps = 4/240 (2%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            +QEVDDE  F Y   S+RGP  WG +R EW  C  G+ Q+PIDL  + V V      I  
Sbjct  27   AQEVDDETEFDYLRGSERGPDRWGHIREEWATCRTGRYQSPIDLLHRRVQVIPKSAEIVK  86

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
            +Y    AT+ N G+ +M+ W      + ING  Y+ RQ HWH PSEH +NG+R+  E HL
Sbjct  87   FYKAGNATVRNRGHDIMIEWEGEDSKIQINGTTYILRQCHWHSPSEHTINGSRFAAELHL  146

Query  476  VHVSNDGR-IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGR  652
            VH + D   IAV+ ++Y++G+ PN  L+ + + L+ +     +    G ++P  ++ RGR
Sbjct  147  VHQTPDNNSIAVIGLLYKLGK-PNRFLTTLMEKLELVPNALDLTNA-GEINPGEIKLRGR  204

Query  653  RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            +YYRYMGSLTTPPCTEGV+WT+ R I ++++ QVA +R  +HD+++ NARP+Q +N R V
Sbjct  205  KYYRYMGSLTTPPCTEGVLWTLDRRIATISEGQVAKMREVVHDDAERNARPVQPLNGRKV  264



>gb|KFK28694.1| hypothetical protein AALP_AA7G034200 [Arabis alpina]
Length=269

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 169/261 (65%), Gaps = 11/261 (4%)
 Frame = +2

Query  65   LKLFSIAFLLLSV----THVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKM  232
            + +F+I F  LS      H     EVDDE  F+Y E++++GP  WG++ P W  C+ GK 
Sbjct  8    ISVFAIFFFFLSSFPNNLHA-HDLEVDDETPFTY-EHTEKGPEGWGKIDPHWRICNTGKF  65

Query  233  QTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQV  412
            Q+PIDL ++ V   N G     Y   +A+L+N G+ +M+SW      + I    +   Q 
Sbjct  66   QSPIDLTNQRVSLINYGAWSRQYQPALASLKNRGHDIMVSWKGDAGKITIRQKEFKLVQC  125

Query  413  HWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            HWH PSEH VNGTRYD+E H+VH S+ G++AV+ V++++G+ PN  L+ + + +K + + 
Sbjct  126  HWHSPSEHTVNGTRYDMELHMVHQSDRGKLAVIGVLFKLGQ-PNKFLTKLLNGIKAIGKE  184

Query  593  PGVKKGIGYLDP-NLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
               +  IG ++P ++++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +RN
Sbjct  185  ---EINIGIVNPHDIIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISAEQIAALRN  241

Query  770  AIHDESKTNARPLQTINDRFV  832
            A+HD  +TN+RP+Q  + R V
Sbjct  242  AVHDGFETNSRPVQNTHSRTV  262



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 161/255 (63%), Gaps = 6/255 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            F++ FL LS +++   +  EVDDE  F+Y++N ++GP  WG++ P W  C+ GK Q+PID
Sbjct  11   FALFFLYLSFSNISLARGAEVDDETSFTYEKNPEKGPEGWGKINPHWKTCNIGKFQSPID  70

Query  248  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
            L +  V        +  Y    A + N G+ +M+SW      + I    Y   Q HWH P
Sbjct  71   LTNTRVSIIRDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSP  130

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH VNGTRYD+E H+VH S  G+  V+ V+Y++G+ PN  L+ + D +K + +    ++
Sbjct  131  SEHTVNGTRYDMELHMVHTSAGGKTVVIGVLYKLGK-PNEFLTRLLDGIKTVGKE---ER  186

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +R+A+ D  
Sbjct  187  DLGIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGY  246

Query  788  KTNARPLQTINDRFV  832
            +TN+RP+Q  N R V
Sbjct  247  ETNSRPVQERNGRSV  261



>ref|XP_002445624.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
 gb|EES15119.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
Length=280

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 153/232 (66%), Gaps = 2/232 (1%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY    + GP+HWG ++ EW  CSAG+MQ+PIDL  + V +  +LG + + Y    A++
Sbjct  41   FSYVVGDENGPAHWGGIKAEWANCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPADASI  100

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +M+ +      L I+G  Y  RQ+HWH P+EH V+G RYD+E HLVH +   + 
Sbjct  101  VNRGHDIMVRFNGDAGSLVIHGTAYYLRQMHWHSPTEHTVDGRRYDMELHLVHQTLANKT  160

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ ++Y+IG   +P L  +E  + ++A+    ++ +G +DP   + R   YYRYMGSLT
Sbjct  161  AVIGILYEIGGE-DPFLQALEPFIHRIADRKDREEPVGVVDPRRARGRASVYYRYMGSLT  219

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPCTEGV+WTV++ +R+V+K Q+ L+R A+HD  + NARP+Q +NDR + +
Sbjct  220  TPPCTEGVIWTVVKRVRTVSKHQMELLREAVHDGMEKNARPVQDVNDRDISI  271



>ref|XP_009137160.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=268

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 161/258 (62%), Gaps = 6/258 (2%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQT  238
            + +F++ FL LS   +      E DDE  F+Y++N ++GP  W ++ P W  C+ GK+Q+
Sbjct  8    IMIFALFFLCLSFPSISLANDAEADDETLFTYEQNPEKGPEGWSKINPHWKVCNNGKLQS  67

Query  239  PIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHW  418
            PIDL +  V   +    +  Y    A + N G+ +M+SW      + I  + +   Q HW
Sbjct  68   PIDLTNARVSLIHDEAWRREYKPAPAVIMNRGHDVMVSWKGDAGKITIRQMEFKLVQCHW  127

Query  419  HFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPG  598
            H PSEH VNGTRYDLE H+VH S  GRIAV+ V+Y++G+ PN  L+ + D LK + +   
Sbjct  128  HSPSEHTVNGTRYDLELHMVHTSARGRIAVIGVLYKLGK-PNEFLTRLLDGLKTVGKE--  184

Query  599  VKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIH  778
             +K +G +DP  ++ + +++YRY+GSLT PPCTEGV W V++ + +++ +Q+A +RNA+ 
Sbjct  185  -EKDLGIVDPRTIRFQTKKFYRYIGSLTVPPCTEGVFWPVVKRVNTISVEQIAALRNAVD  243

Query  779  DESKTNARPLQTINDRFV  832
            D  +TN+RP+Q  N R V
Sbjct  244  DGYETNSRPVQDTNGRPV  261



>ref|XP_007027463.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
 gb|EOY07965.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
Length=282

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 162/259 (63%), Gaps = 8/259 (3%)
 Frame = +2

Query  80   IAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESK  259
             A L LS +  + +QEV+DE  F Y ENS +GPS WG+L+ EW  C  G +Q+PID+ S 
Sbjct  16   FAVLFLSYSASVSAQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGGLQSPIDMSSL  75

Query  260  PV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWP-LGQRYLGINGIRYLFRQVHWHFPSE  433
             V V +  G ++  Y    A ++N G+ + L WP      +  NG  Y  +Q HWH PSE
Sbjct  76   RVKVINKSGELKKRYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYFLQQAHWHSPSE  135

Query  434  HVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGV  601
            H +NG RY LE H+VH   D      +AV+ ++Y+ G  P+  LS +  ++  + +    
Sbjct  136  HTINGRRYALELHMVHQCKDPNVKNNLAVVGLLYKFG-APDAFLSKLIGNITSMNDHVQ-  193

Query  602  KKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            ++ +G +DP+L++  G++YYRYMGSLT PPCTEGV+WT+ + IR+V++ QV  +R A+HD
Sbjct  194  ERYMGLIDPSLIKMGGKKYYRYMGSLTVPPCTEGVIWTMNKKIRTVSRDQVRALRIAVHD  253

Query  782  ESKTNARPLQTINDRFVKV  838
             ++ NARP+Q +N R +++
Sbjct  254  YAEANARPVQPLNRREIEL  272



>emb|CDP15287.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 162/278 (58%), Gaps = 28/278 (10%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVI--------KSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAG  226
            L S+  LLL VT ++        K+QEV+DE  F Y E S +GP  WG+L+ EW  CS G
Sbjct  12   LGSVILLLLVVTSILLLFGATSTKAQEVEDEREFDYAEGSKKGPKRWGKLKKEWAACSNG  71

Query  227  KMQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFR  406
              Q+PID+ ++ V   +  P +  Y    AT++N G+ + L W      + ING  Y  R
Sbjct  72   AFQSPIDMSNERVRLIS-KPERPIYKPTNATIKNRGHDISLQWGGDAGSIAINGTVYPLR  130

Query  407  QVHWHFPSEHVVNGTR--------------YDLEAHLVHVSND----GRIAVLAVMYQIG  532
            Q HWH PSEH + G R              YDLE H+VH+S D     +IAV+ V+Y+IG
Sbjct  131  QAHWHSPSEHTIRGRRHLSLFSGFLRSFFRYDLELHMVHLSTDPNLKNKIAVIGVLYKIG  190

Query  533  ETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVW  712
            + P+  LS +   +  + +    ++ +  +DP  ++   +RYYRYMGSLT PPCTEGV+W
Sbjct  191  K-PDKFLSKLTSYISTMIDEKDEQRSLDVVDPRQIEMHSKRYYRYMGSLTVPPCTEGVIW  249

Query  713  TVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            T+ R +R+V++ QV L+R A+HD ++ NARP+Q  N R
Sbjct  250  TINRKVRTVSRDQVMLLREAVHDYAERNARPIQQQNGR  287



>ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=352

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 156/240 (65%), Gaps = 8/240 (3%)
 Frame = +2

Query  128  VDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYM  304
            V++E  F Y + S +GPS WG+++ EW +C+ G MQ+PIDL +K V V  +LG ++N Y 
Sbjct  104  VENESEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYK  163

Query  305  RDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHV  484
              +A ++N G+ + + W      + ING  YL +Q HWH PSEH +NG RYDLE HLVH 
Sbjct  164  PSIAIIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQ  223

Query  485  SNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGR  652
            S++      IAV+   Y+IG  P+  LS +   +K L E   +K GI  ++P  ++  G 
Sbjct  224  SSNPNAKYPIAVVGFFYKIGR-PDSFLSKLNRKIKALNEKKEIKAGI--INPRWIKNGGM  280

Query  653  RYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            +YYRY+GSLT PPCTEGV+W + + I +V+++QV L+R+A+HD ++ NARP+Q  N R +
Sbjct  281  KYYRYIGSLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHI  340


 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +2

Query  68   KLFSIAFLLLSVTHVIKSQEVDDEWG----FSYDENSDRGPSHWGELRPEWWQCSAGKMQ  235
            + FS+AFL++  + ++ +  +  + G    F Y   S++GP+ WG ++ EW +C+ GKMQ
Sbjct  6    RTFSLAFLIILTSTLLWASVLSHQPGEVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQ  65

Query  236  TPIDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMML  349
            +PIDL +  + V ++LGP+   Y    ATL N G+ + +
Sbjct  66   SPIDLSTNTINVVNSLGPLNREYNPFSATLRNRGHDISV  104



>gb|KHG14539.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=289

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/261 (41%), Positives = 160/261 (61%), Gaps = 8/261 (3%)
 Frame = +2

Query  62   MLKLFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            +  +FS+ FL  S +     +EV+DE  F Y+ENS +GP HWG+L+ EW  C  G MQ+P
Sbjct  22   LFLIFSVLFLCFSASVAHNDEEVEDEREFDYNENSSKGPLHWGDLKTEWAACKNGAMQSP  81

Query  242  IDLESKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVH  415
            IDL +  V + +    ++  Y    + ++N G+ + L WP  +   + I+GI Y+  QVH
Sbjct  82   IDLTNDRVKIITKSVKLEKNYKPAESIIKNRGHDISLQWPDHKAGSIIIDGIEYVLLQVH  141

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKL  583
            WH PSEH +NG RY LEAH+VH + D      +AV A++Y+ G  PN  L  +  ++  +
Sbjct  142  WHSPSEHTINGKRYALEAHMVHKAADPNVKSSLAVSALLYEDG-LPNDFLQKLISNITDM  200

Query  584  AETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALI  763
             +    ++ +G  DPNL++     YYRY+GSLT PPCTE V+W + + I +V+K+QV  I
Sbjct  201  IDVVQ-QRSMGVTDPNLIEIDDVEYYRYIGSLTVPPCTENVIWIINKKIATVSKEQVHAI  259

Query  764  RNAIHDESKTNARPLQTINDR  826
            R A+HD ++ NARP+Q  N+R
Sbjct  260  REAVHDYAEQNARPVQANNER  280



>ref|XP_011033188.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
 ref|XP_011033189.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=330

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 164/257 (64%), Gaps = 6/257 (2%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLLLSVTHVIKSQ-EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSA  223
            I  M  L L S+  +  S+T  +  + EV+DE  F+Y+E +++GP +WG++ P W  C  
Sbjct  59   INMMSFLLLVSLIIVSYSLTISLAFESEVEDETQFTYEEGTEKGPKNWGKINPHWEACGK  118

Query  224  GKMQTPID-LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYL  400
            GKMQ+PID L+ +  V+ NLG ++  Y    A ++N G+ + + W      + IN   Y 
Sbjct  119  GKMQSPIDVLDRRVEVFPNLGRLRRDYQAAPAAVKNRGHDITVIWKGDAGKITINDTDYQ  178

Query  401  FRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKK  580
             +Q HWH PSEH  NGTR+DLE HLVH S+ G IAV+A++Y+ G  P+  LS +   L+ 
Sbjct  179  LQQCHWHSPSEHAFNGTRHDLELHLVHYSSQGGIAVVAIVYKYGR-PDRFLSKL---LRH  234

Query  581  LAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVAL  760
            +      ++ +G ++P  ++   R+YYRY+GSLT PPCTEGVVWT+++ +R+V+++QV  
Sbjct  235  INHVDHREREMGIVNPGDIKFGSRKYYRYIGSLTVPPCTEGVVWTIVKKVRTVSREQVKA  294

Query  761  IRNAIHDESKTNARPLQ  811
            +R+A+HD  + NARP Q
Sbjct  295  LRDAVHDGFEANARPAQ  311



>ref|XP_004300792.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=283

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 155/247 (63%), Gaps = 8/247 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y ++S +GP HWG+LR +W  C  G MQ+PIDL S+ V V  N G +
Sbjct  28   ITAQEVEDETEFDYLKDSGKGPEHWGDLREDWAACKNGTMQSPIDLRSEIVQVRPNKGEV  87

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            +  Y    AT+ N G+ + + W LG    + ING  Y   Q HWH PSEH +NG R+DLE
Sbjct  88   KLKYKPSNATIRNRGHDISIQWKLGDAGSVEINGTDYWLIQGHWHSPSEHTINGKRFDLE  147

Query  467  AHLVHVSNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL  634
             H+VH+  D      IAVLA +Y+IG+ P+  LS +  D+K L      ++ IG +DP  
Sbjct  148  LHMVHLIPDANVENNIAVLAYLYKIGK-PDKFLSEVSKDIKSLINVKE-ERHIGVVDPRN  205

Query  635  LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQT  814
            ++     +Y+Y GSLT PPCTEGV W V + + +V+++QV L+R A+ D ++TNARPLQ 
Sbjct  206  VRKGSANFYKYKGSLTVPPCTEGVTWIVDKELTTVSREQVELLREAVDDSAETNARPLQA  265

Query  815  INDRFVK  835
            +N R V+
Sbjct  266  LNGRKVQ  272



>ref|XP_011044414.1| PREDICTED: LOW QUALITY PROTEIN: alpha carbonic anhydrase 7 [Populus 
euphratica]
Length=262

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 157/258 (61%), Gaps = 10/258 (4%)
 Frame = +2

Query  74   FSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLE  253
             SI +L+++      S+++ DE  FSYD N  +GP+ WG + P+W  CS G MQ+PIDL 
Sbjct  4    VSIEYLIMT------SKQIQDETEFSYDPNGVKGPAQWGRIHPKWGACSQGXMQSPIDLM  57

Query  254  SKPV-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPS  430
            +  V V S+L  IQ  Y     +L N G+ M L W  G   + ING  Y+F+Q HWH PS
Sbjct  58   NNSVDVASHLRRIQRSYKPANPSLRNRGHDMTLKWEGGAGSIEINGTEYVFQQCHWHSPS  117

Query  431  EHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKG  610
            EH +NG R  LEAH+VH + DG++AV+ +MY IG  P+  LS + + LK ++ T      
Sbjct  118  EHTINGKRLPLEAHMVHANLDGKVAVVGIMYMIG-GPDSFLSSLTEPLKSVSGTNEQDTA  176

Query  611  IGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIR-NAIHDES  787
               +DP  ++     YY Y+ S TTPPCTE V  T++  + + T++QV L+R  A+HD+S
Sbjct  177  ASVVDPRSIKIGSIYYYSYIDSQTTPPCTENVPGTIVGKVSTATREQVRLLRIAAVHDDS  236

Query  788  KT-NARPLQTINDRFVKV  838
             T NARP Q IN+R VK+
Sbjct  237  DTINARPTQPINNRSVKI  254



>ref|XP_008360674.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 155/242 (64%), Gaps = 4/242 (2%)
 Frame = +2

Query  110  VIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGP  286
            V  S EV DE  F+Y E + +GP  WGE+ P W  C  GK+Q+PIDL  + V V+ +LG 
Sbjct  30   VEDSDEVGDETPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFPHLGK  89

Query  287  IQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            ++  Y    AT++N G+ + + W      + ING  Y   Q HWH PSEH  NG+RY LE
Sbjct  90   LKRGYKPAPATVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALE  149

Query  467  AHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
             H+VH+S+ G+IAV+ ++Y+ G  P+P+LS +   +K +     V   IG ++P  ++  
Sbjct  150  FHVVHLSSTGKIAVIGIVYKYGR-PDPLLSKLFHHIKSVGIEEEVD--IGIINPGDIKFG  206

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
             R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + NARP Q ++ R
Sbjct  207  SRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGR  266

Query  827  FV  832
             V
Sbjct  267  PV  268



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 161/255 (63%), Gaps = 6/255 (2%)
 Frame = +2

Query  74   FSIAFLLLSVTHV--IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
            F++ FL L  +++   +  EVDDE  F+Y++N ++GP  WG++ P W  C+ GK Q+PID
Sbjct  11   FALFFLYLCFSNISLARGAEVDDETPFTYEQNPEKGPEGWGKINPHWKTCNTGKFQSPID  70

Query  248  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
            L +  V        +  Y    A + N G+ +M+SW      + I    Y   Q HWH P
Sbjct  71   LTNARVSIIRDEAWRRQYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSP  130

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH VNGTRYD+E H+VH S  G+ AV+ V+Y++G+ PN  L+ + D +K + +    ++
Sbjct  131  SEHTVNGTRYDMELHMVHTSAGGKTAVIGVLYKLGK-PNEFLTRLLDGIKTVGKE---ER  186

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G ++P  ++ + +++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+A +R+A+ D  
Sbjct  187  DLGIVEPRTIRFQTKKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGY  246

Query  788  KTNARPLQTINDRFV  832
            +TN+RP+Q  N R V
Sbjct  247  ETNSRPVQERNGRSV  261



>ref|XP_002278815.1| PREDICTED: alpha carbonic anhydrase 4-like [Vitis vinifera]
Length=279

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 154/245 (63%), Gaps = 4/245 (2%)
 Frame = +2

Query  101  VTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSN  277
             T +  + EV+DE  FSY E S+ GP  WG ++ EW  C  GK Q+PIDL ++ V ++ +
Sbjct  25   CTSITIADEVEDESEFSYIEGSETGPEKWGTIKAEWKTCGKGKRQSPIDLRNRRVSIFPD  84

Query  278  LGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRY  457
             G ++  Y    A L+N G+ + + W      + ++G+ +   Q+HWH PSEH VNGT +
Sbjct  85   FGQLKRKYRPAHAVLKNRGHDVAVEWKGNAGKIKLHGVHFKLEQLHWHTPSEHTVNGTSF  144

Query  458  DLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLL  637
             +E HLVH S  G+IAV+   +++G  P+P L+ + D +  +    G +K IG +D N +
Sbjct  145  QMELHLVHKSARGKIAVIGKTFKLG-PPDPFLAKMIDHVTGIPA--GEEKDIGIVDANDI  201

Query  638  QARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTI  817
            +  GR+YYRY+GSLTTPPCTEGV+WT+ + + +V+K+QV  +R  +HD  + NARP Q +
Sbjct  202  KHWGRKYYRYIGSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEGNARPAQRL  261

Query  818  NDRFV  832
            N R V
Sbjct  262  NGRPV  266



>ref|XP_004303634.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=286

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 153/251 (61%), Gaps = 5/251 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL-ESK  259
            +F ++    +  S EV DE  F+Y E + +GP  WG++ P W  C  GKMQ+PIDL +S+
Sbjct  28   SFFIICRAALDDSGEVGDELPFAYVEGTGKGPKKWGDIDPHWKACDNGKMQSPIDLLDSR  87

Query  260  PVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
              V+ NLG ++  Y    AT+ N G+ + + W      + IN   Y   Q HWH P+EH 
Sbjct  88   VQVFPNLGKLKRDYKPSPATVRNRGHDITVRWKKDAGKININSTDYNLVQCHWHSPAEHT  147

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
             NG+RY LE H++H S+ G+IAV+ ++Y+ G  P+P LS +   +  + +    +  IG 
Sbjct  148  FNGSRYALELHIIHTSSIGKIAVIGIVYKYGR-PDPFLSKLFHHINSVGKE---EVDIGV  203

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+ +QV  IR  +HD  + NA
Sbjct  204  INPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSMEQVRAIRETVHDGYEANA  263

Query  800  RPLQTINDRFV  832
            RP Q  N R V
Sbjct  264  RPTQQFNGRPV  274



>ref|XP_010269790.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=274

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 151/239 (63%), Gaps = 5/239 (2%)
 Frame = +2

Query  119  SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQN  295
            + E +DE  F+Y E S+RGP HWG+++ +W  C  G+MQ+PIDL  + V V+S LG ++ 
Sbjct  28   ATEQEDEHEFTYKEGSERGPEHWGDIQSDWKICKKGEMQSPIDLLHERVQVFSGLGRLKR  87

Query  296  YYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHL  475
             Y    A  +N G+ +M+ W      + INGI Y  +Q HWH PSEH  NG+RY LE H+
Sbjct  88   DYQPAPAAAKNRGHDIMIEWKGDAGKININGINYSLKQCHWHSPSEHTFNGSRYKLELHM  147

Query  476  VHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRR  655
            VH+++ G IAV+ + Y+ G   +     ++  +  +      +K +G ++P  ++   R+
Sbjct  148  VHINSCGGIAVIGITYKYGRHDH----FLDKIIASIGSVGSEEKDLGIINPGDIKFGSRK  203

Query  656  YYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            YYRYMGSLT PPCTEGV+WT+ + +R+V+++QV  +R+A+ D  + NARP+Q  N R V
Sbjct  204  YYRYMGSLTVPPCTEGVIWTIEKKVRTVSREQVRALRDAVDDGYEENARPIQQKNGRTV  262



>emb|CBI33385.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 156/250 (62%), Gaps = 7/250 (3%)
 Frame = +2

Query  86   FLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV  265
            F+ LS  H I    ++DE  FSY E S+ GP  WG ++ EW  C  GK Q+PIDL ++ V
Sbjct  15   FVSLSAQHFI---SMEDESEFSYIEGSETGPEKWGTIKAEWKTCGKGKRQSPIDLRNRRV  71

Query  266  -VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVV  442
             ++ + G ++  Y    A L+N G+ + + W      + ++G+ +   Q+HWH PSEH V
Sbjct  72   SIFPDFGQLKRKYRPAHAVLKNRGHDVAVEWKGNAGKIKLHGVHFKLEQLHWHTPSEHTV  131

Query  443  NGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYL  622
            NGT + +E HLVH S  G+IAV+   +++G  P+P L+ + D +  +    G +K IG +
Sbjct  132  NGTSFQMELHLVHKSARGKIAVIGKTFKLG-PPDPFLAKMIDHVTGIPA--GEEKDIGIV  188

Query  623  DPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNAR  802
            D N ++  GR+YYRY+GSLTTPPCTEGV+WT+ + + +V+K+QV  +R  +HD  + NAR
Sbjct  189  DANDIKHWGRKYYRYIGSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEGNAR  248

Query  803  PLQTINDRFV  832
            P Q +N R V
Sbjct  249  PAQRLNGRPV  258



>ref|XP_009363226.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=280

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 157/251 (63%), Gaps = 5/251 (2%)
 Frame = +2

Query  83   AFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKP  262
            +F  +    +  S EV DE  F+Y E + +GP  WG++ P+W  C  GKMQ+PI+L  + 
Sbjct  22   SFFTICSAALEDSDEVGDETAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPINLLDQR  81

Query  263  V-VYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHV  439
            V V+  LG ++  Y    A ++N G+ + + W      + ING  Y   Q HWH PSEH 
Sbjct  82   VKVFPKLGKLKREYKPAPAIVKNRGHDITMRWNGDAGKIKINGTDYRLLQCHWHSPSEHT  141

Query  440  VNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGY  619
             NG+RY LE H+VHVS+  +IAV+ ++Y+ G  P+P+LS +   +K + +    +  IG 
Sbjct  142  FNGSRYALEFHIVHVSSTRKIAVIGIVYKYGR-PDPLLSKLFHHIKSVGKE---EVDIGI  197

Query  620  LDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNA  799
            ++P  ++   R+YYRY+GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + NA
Sbjct  198  INPGDIKFGSRKYYRYIGSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGYEANA  257

Query  800  RPLQTINDRFV  832
            RP Q ++ R V
Sbjct  258  RPTQELDGRPV  268



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 162/261 (62%), Gaps = 5/261 (2%)
 Frame = +2

Query  53   DMDMLKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  229
            + + +  F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG + PEW  C+ G+
Sbjct  4    NTNTVFFFALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCNTGR  63

Query  230  MQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  409
             Q+PIDL ++ V   +       Y    A + N G+ +M+SW      + I    +   Q
Sbjct  64   FQSPIDLTNERVSLIHDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKVTIRETDFKLVQ  123

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             HWH PSEH VNGTRYDLE H+VH S  GR AV+ V+Y++G+ PN  L+ + + +K + +
Sbjct  124  CHWHSPSEHTVNGTRYDLELHMVHTSAGGRTAVIGVLYKLGK-PNEFLTKLLNGIKAVGQ  182

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +  +G +DP  ++ + R+++RY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R 
Sbjct  183  K---EVDLGVIDPREIRFQTRKFFRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALRE  239

Query  770  AIHDESKTNARPLQTINDRFV  832
            A+HD  +TN+RP+Q    R V
Sbjct  240  AVHDGFETNSRPVQESKGRSV  260



>ref|XP_006391784.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
 gb|ESQ29070.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
Length=273

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 159/261 (61%), Gaps = 11/261 (4%)
 Frame = +2

Query  71   LFSIAFLLL-----SVTHVIK--SQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  229
             +++ FL L     S+   I     EVDDE  F+Y++N D+GP  W  + P W  CS GK
Sbjct  10   FYALVFLYLIFPNISLADTITPLKNEVDDETRFTYEQNPDKGPEGWSNVNPHWKVCSTGK  69

Query  230  MQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  409
             Q+PIDL ++ V   +    +  Y    A + N G+ +M+SW      + I    +   Q
Sbjct  70   FQSPIDLTNQRVSLLHDQAWKIEYKPAPAVILNRGHDIMVSWKGDAGKITIRDTEFKLVQ  129

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             HWH PSEH +NGTRYD+E H+VH S  G+ AV+ V+Y++GE PN  L+ + + +K + +
Sbjct  130  CHWHSPSEHTINGTRYDMELHMVHTSAQGKTAVIGVLYRLGE-PNEFLTKLLNGIKTVEK  188

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +K +G +DP  ++    ++YRY+GSLT PPCTEGV+WTV+  + +++K+Q+A +RN
Sbjct  189  E---EKNLGIVDPRTIRVENEKFYRYIGSLTVPPCTEGVIWTVVERVNTISKEQIAALRN  245

Query  770  AIHDESKTNARPLQTINDRFV  832
            A+ D  +TN+RP+Q ++ R V
Sbjct  246  AVDDGYETNSRPVQDLHGRLV  266



>dbj|BAK03530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 150/239 (63%), Gaps = 2/239 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNY  298
            QE+DDE  FSY   +  GP +WG  + EW  C  G+MQ+PIDL  +    S +LG + + 
Sbjct  31   QEIDDESEFSYIRGAKNGPENWGTFKEEWATCGTGQMQSPIDLSDRRASPSPDLGYLNHS  90

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y+   A++ N G+ + + +      L I+G  Y  RQVHWH PSEH VNG RY LE H+V
Sbjct  91   YVPADASIVNRGHDIAVMFHGDAGSLSIDGTAYHLRQVHWHAPSEHRVNGRRYSLELHMV  150

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H+S   + AV+ ++Y+IG   +  L  +E  L ++A+    ++ +G +DP   +  G  Y
Sbjct  151  HLSAQNKTAVIGLLYKIGRRDH-FLHKLEPYLMRMADMKEKEEKVGLVDPGEARGDGEAY  209

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVK  835
            YRYMGSLTTPPC EGV+WTVI+ + +V+  Q+ L+ +A+HD  + NARPLQ +NDR ++
Sbjct  210  YRYMGSLTTPPCDEGVIWTVIKRVATVSTDQLKLLTDAVHDGFEMNARPLQKVNDRDIR  268



>ref|XP_010050514.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89336.1| hypothetical protein EUGRSUZ_A01627 [Eucalyptus grandis]
Length=283

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 148/242 (61%), Gaps = 8/242 (3%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I   Y
Sbjct  32   ETEDEREFDYIAGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSQGVKVMPKLGEIDRSY  91

Query  302  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
                ATL N G+ + L W  G    + ING  Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLMNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  479  HVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
            HVS D      IAV+ ++Y+ G  P+  LS +   +  + +    +K +G +DP  ++  
Sbjct  152  HVSTDPNVKNNIAVIGLLYKTG-VPDAFLSKLMGSVWSMIDKEDERK-MGTIDPREIKMG  209

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            G+ Y RY GSLT PPCTEGV+WT+ + + +V+K Q+ L+R A+HD ++ NARP+Q +N R
Sbjct  210  GKNYLRYTGSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAENNARPVQQLNRR  269

Query  827  FV  832
             +
Sbjct  270  EI  271



>ref|XP_010904591.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=294

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 151/238 (63%), Gaps = 9/238 (4%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVY-SNLGPIQNYYMRD  310
            D+  F YDENS+ GP HWG+L P+W  C  G  Q+PID+  K +   S++G +   Y   
Sbjct  47   DDRHFDYDENSEFGPEHWGDLYPDWATCKDGNNQSPIDINHKDIEENSSIGSLMTRYDSS  106

Query  311  VATLENHGYGMMLSWPLG----QRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
             A ++N G+ +M++W  G      +L I+G  Y+ +Q HWH PSEH   G RY LE H+V
Sbjct  107  YAIMQNRGHDIMINWTEGTGPGAGFLLIDGKTYVLQQCHWHSPSEHKFFGERYPLELHMV  166

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            HVS+DG IAV+ +MYQ G  P+P LS ++  L+ L  T   +  +GYL P  ++ +G  Y
Sbjct  167  HVSSDGSIAVIGIMYQFG-CPDPFLSELKKYLEYLIMTQNDEVVVGYLSPPPIK-KGASY  224

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            YRY GSLTTPPCTE V W ++  +R+V++ Q+ L+R A+HD  K NARP+Q IN R V
Sbjct  225  YRYSGSLTTPPCTENVTWILLHEVRTVSEGQLRLLRTAVHD--KDNARPIQPINGRKV  280



>ref|XP_007028632.1| Carbonic anhydrase, putative [Theobroma cacao]
 gb|EOY09134.1| Carbonic anhydrase, putative [Theobroma cacao]
Length=273

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 159/257 (62%), Gaps = 10/257 (4%)
 Frame = +2

Query  80   IAFLLLSVTHV----IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
             A L+LS T      I SQ  D+   F+YDE S RGPS WG L+PEW  CS G +Q+PID
Sbjct  13   FASLVLSCTSFRPTRIHSQS-DEGDEFNYDEGSGRGPSRWGSLKPEWQTCSTGNLQSPID  71

Query  248  LESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHF  424
            +    V+ S  LG +Q  Y    A L+N G+ + + W      + ING  Y   Q HWH 
Sbjct  72   IPVGSVLLSPALGDLQTSYASSPAVLKNRGHDIAVMWNGDAGKVDINGTDYKILQCHWHS  131

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH  +GTR+DLE H+VH + + +IAV+++++Q G+ P+P LS +   +K +    G +
Sbjct  132  PSEHTFDGTRHDLEIHIVHQNANNQIAVVSMVFQFGQ-PDPFLSALLSSIKTVG---GGE  187

Query  605  KGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDE  784
            K +G ++P  +   GR+Y+RY GSL+TPPCTEGV+WTV + +++ + +QV  +++A+ ++
Sbjct  188  KELGNVNPGDIGFVGRQYFRYTGSLSTPPCTEGVIWTVFQQVKTASTEQVQALKDALTEQ  247

Query  785  SKTNARPLQTINDRFVK  835
             K N+RP Q +  R V 
Sbjct  248  FKENSRPTQPLGGRLVS  264



>ref|XP_010439535.1| PREDICTED: alpha carbonic anhydrase 4 [Camelina sativa]
Length=267

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 161/261 (62%), Gaps = 5/261 (2%)
 Frame = +2

Query  53   DMDMLKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGK  229
            + + +  F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG++ PEW  C+ G+
Sbjct  4    NTNTIFFFALFFIYLSFPEISLANSEVDDETSFTYEQKTEKGPEGWGQINPEWKVCNTGR  63

Query  230  MQTPIDLESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQ  409
             Q+PIDL ++ V   +       Y    A + N G+ +M+SW      + I    +   Q
Sbjct  64   FQSPIDLTNERVSLIHDQAWNRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTDFKLVQ  123

Query  410  VHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAE  589
             HWH PSEH VNGTRYDLE H+VH S  GR AV+ V+Y++G+ PN  L+ + + +K +  
Sbjct  124  CHWHSPSEHTVNGTRYDLELHMVHTSARGRTAVIGVLYKLGK-PNEFLTKLLNGIKAVGN  182

Query  590  TPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRN  769
                +  +G +DP  ++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R 
Sbjct  183  K---EVDLGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALRE  239

Query  770  AIHDESKTNARPLQTINDRFV  832
            A+ D  +TN+RP+Q    R V
Sbjct  240  AVDDGFETNSRPVQDSKGRSV  260



>gb|EEC83720.1| hypothetical protein OsI_29556 [Oryza sativa Indica Group]
Length=271

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 149/239 (62%), Gaps = 2/239 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYSNLGPIQNYY  301
            QE DDE  F Y   ++ GP +W  L P W +C+ G MQ+PIDL S   +  NLG +   Y
Sbjct  27   QETDDERKFGYVPGTENGPGNWSRLDPRWAKCNTGNMQSPIDL-SHERLMRNLGYLDYSY  85

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
            +   A++ N G+ + + +      + ING  Y  +Q+HWH PSEH VNG RYD+E HLVH
Sbjct  86   LPAEASMVNRGHDIEVKFMGNAGRVVINGKAYKLKQLHWHTPSEHTVNGRRYDMELHLVH  145

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
               +    V+  +YQIG  P+P L ++E  ++++A+T    + IG +DP L ++    YY
Sbjct  146  DDGNSNTVVIGNLYQIG-NPDPFLLMLEPFIRRIADTKDRSEPIGVVDPQLAKSPDAVYY  204

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            RYMGSLTTPPCTEGV+WTV +  ++V + Q+ L+R A+ D  + NARPLQ +N+R + +
Sbjct  205  RYMGSLTTPPCTEGVIWTVFKRAQTVAQYQLDLLREAVADGYENNARPLQKVNNRNISI  263



>dbj|BAK01826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 150/232 (65%), Gaps = 2/232 (1%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY  +++ GP+HWG+++ EW  C  G MQ+PIDL S  V +   LG + + Y+   AT+
Sbjct  36   FSYSLDAENGPAHWGDIKEEWSACGKGNMQSPIDLASPRVSLVRGLGYLNHSYVPSNATI  95

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +ML +      + I+G  Y  RQ+HWH P+EH +NG RYD+E H+ H S  G+ 
Sbjct  96   VNRGHDIMLKFEGDAGSVSIDGTPYYLRQMHWHSPTEHSLNGRRYDMELHMFHESAQGKA  155

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ V YQ+G+  +  L  +E  L+ +A+    ++ +G +DP   + +   YYRY+GSLT
Sbjct  156  AVIGVFYQVGDH-DAFLHKLEPYLEMIADRKDREEKMGMMDPRGARGKASVYYRYVGSLT  214

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPC EGV+WT+++ +R+V++ Q+ L+R A+HD+ + NARP Q +N R + +
Sbjct  215  TPPCAEGVIWTIVKRVRTVSRHQLELLREAVHDDMEKNARPRQEVNSRDISM  266



>gb|EMT11024.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=285

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/238 (43%), Positives = 152/238 (64%), Gaps = 2/238 (1%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPVVYS-NLGPIQNY  298
             E+DDE  F+Y   S  GP +WG+++ EW  C  G+MQ+PIDL       + NLG + + 
Sbjct  31   HEIDDESEFNYIRGSKNGPENWGKIKEEWATCGTGQMQSPIDLSDHRTSRAPNLGYLNHS  90

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y+   A++ N G+ +M+ +      L ING  Y  RQVHWH PSEH VNG RY+LE H+V
Sbjct  91   YLPVEASIVNRGHDIMVKFNGDAGSLWINGTAYHLRQVHWHSPSEHRVNGRRYNLELHMV  150

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H+S + + AV+ ++Y+IG   +  L  +E  L+++A+T   ++ +G +DP   +  G  Y
Sbjct  151  HLSAENKTAVIGILYKIGRRDH-FLHELESYLRRIADTKEKEEMVGVVDPWEARGDGEAY  209

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            YRYMGSLTTP C EGV+WTVI+ + +V+  Q+ L+ +A+HD  + NARPLQ +N R +
Sbjct  210  YRYMGSLTTPACDEGVIWTVIKRVATVSSHQLKLLTDAVHDGFEMNARPLQKVNGRDI  267



>ref|XP_006845943.1| hypothetical protein AMTR_s00157p00085110 [Amborella trichopoda]
 gb|ERN07618.1| hypothetical protein AMTR_s00157p00085110 [Amborella trichopoda]
Length=268

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/257 (42%), Positives = 157/257 (61%), Gaps = 11/257 (4%)
 Frame = +2

Query  71   LFSIAFLLLSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDL  250
            LF   FL+    HV K++       FSY E S  GP  WG +RPEW  CS G  Q+PID+
Sbjct  13   LFFYPFLVSCEDHVEKAE-------FSYVEGSSNGPKFWGRVRPEWVACSNGTTQSPIDI  65

Query  251  ESKPVVYS-NLGPIQNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHF  424
                 +Y  NL  ++  Y    ATL N G+ + L W  G    + ING ++L  + HWH 
Sbjct  66   IHANAIYDPNLKSLKARYEPAHATLANSGHDIGLEWEKGSAGAIHINGTQFLLEEFHWHS  125

Query  425  PSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVK  604
            PSEH ++G RYDLE H+VH S DGRIAV+AV+Y++G   + +L ++ D++  + +  G +
Sbjct  126  PSEHTLDGYRYDLEMHMVHRSADGRIAVVAVIYKVGLQDHFLLKVM-DEIDDINDEKGSE  184

Query  605  KGIGYLDPN-LLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHD  781
            + +G ++P+  +      YYRY GSLTTP C EGV WTVI+ +++V+K Q+ ++R A+ +
Sbjct  185  EKVGLVNPDHAIDLERESYYRYFGSLTTPSCDEGVTWTVIKEVKTVSKAQLRMLRAAVEE  244

Query  782  ESKTNARPLQTINDRFV  832
            E + NARP+Q +N R V
Sbjct  245  EFEKNARPIQPLNQRQV  261



>ref|XP_004304476.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 157/246 (64%), Gaps = 8/246 (3%)
 Frame = +2

Query  113  IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPI  289
            I +QEV+DE  F Y ++S++GP HWGELR EW  C  G +Q+P+DL S+ V V+ N G +
Sbjct  30   ITAQEVEDEREFDYLKDSEKGPKHWGELREEWAACKNGTLQSPVDLLSEIVEVHPNKGEV  89

Query  290  QNYYMRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLE  466
            +  Y    AT+ N G+ + + W LG    + ING  Y   Q HWH P+EH +NG  +DLE
Sbjct  90   RLKYRPSNATIRNRGHDISIQWKLGDAGSMEINGTDYWLDQCHWHSPTEHTINGKIFDLE  149

Query  467  AHLVHVSNDGR----IAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNL  634
             H+VH+  D +    I V+A +Y+IG+ P+  LS +  D+K + +    ++  G +DP  
Sbjct  150  LHMVHLIPDAKVENNIVVVAYLYKIGK-PDKFLSEVSKDIKSMIDVKE-ERHRGLVDPRN  207

Query  635  LQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQT  814
            ++  G ++Y+Y GSLT PPCTEGV W + + + +V+++Q+ L+R A+HD ++ NARPLQ 
Sbjct  208  VRKGGAKFYKYKGSLTVPPCTEGVTWIIHKKLTTVSREQMELLREAVHDSAELNARPLQA  267

Query  815  INDRFV  832
            +N R V
Sbjct  268  LNRRDV  273



>ref|XP_009358738.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=339

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 160/262 (61%), Gaps = 7/262 (3%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            L+ F++  +LL +  + + ++ +D E  F Y E S++GP HWGEL+ EW  C  GK Q+P
Sbjct  10   LQFFALTIILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSP  69

Query  242  IDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            IDL  +    V      +  ++    ATL+N G+ + L W      + ING  Y  +Q H
Sbjct  70   IDLMEDGATKVIPTFRDLTMHHKPSGATLKNDGHYVALEWEGDAGSIQINGTNYFLKQCH  129

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSND-GRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            WH PSEH +NG RYDLE H+VH S D   +AV+A +YQ+G  PNP L  +  D+  +  T
Sbjct  130  WHTPSEHTINGIRYDLELHMVHRSADKNSVAVIAFLYQVG-PPNPFLLKVSKDILSVIGT  188

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
               +K +G ++P+ ++    R+YRY+GSLTTPPCTEGV+WTV   +  V+++Q+ L++  
Sbjct  189  K--EKHLGVINPSEIKWPSLRFYRYVGSLTTPPCTEGVIWTVNEGVNIVSRRQLELLKQV  246

Query  773  IHDESKTNARPLQTINDRFVKV  838
            + D +  NARPLQ  NDR +K+
Sbjct  247  VDDYAVMNARPLQPANDRGIKL  268



>ref|XP_002323272.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
 gb|EEF05033.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
Length=283

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 164/258 (64%), Gaps = 8/258 (3%)
 Frame = +2

Query  47   IEDMDMLKLFSIAFLL--LSVTHVIKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCS  220
            I  M  L L S+  +   L+++  ++S EV+DE  F+Y+E ++ GP +WG++ P W  C 
Sbjct  12   INMMSFLLLVSLIIVSYSLAISLALES-EVEDETQFTYEEGTEEGPKNWGKINPHWEACG  70

Query  221  AGKMQTPID-LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRY  397
             GKMQ+PID L+ +  V+ NLG ++  Y    A ++N G+ + + W      + IN   Y
Sbjct  71   KGKMQSPIDVLDRRVEVFPNLGKLRRDYQAAPAAVKNRGHDITVIWKGDAGKITINDTDY  130

Query  398  LFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLK  577
              +Q HWH PSEH  NG+R+DLE HLVH S+ G IAV+A++Y+ G  P+  LS +   L+
Sbjct  131  QLQQCHWHSPSEHTFNGSRHDLELHLVHYSSQGGIAVVAIVYKYGR-PDRFLSKL---LR  186

Query  578  KLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVA  757
             +      ++ +G ++P  ++   R+YYRY+GSLT PPCTEGVVWT++  +R+V+++QV 
Sbjct  187  HINHVDHREREMGIVNPGDIKFGSRKYYRYVGSLTVPPCTEGVVWTIVMKVRTVSREQVK  246

Query  758  LIRNAIHDESKTNARPLQ  811
             +R+A+HD  + NARP Q
Sbjct  247  ALRDAVHDGFEANARPTQ  264



>ref|XP_010451325.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 157/255 (62%), Gaps = 5/255 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
             F++ F+ LS   + + + EVDDE  F+Y++ +++GP  WG + PEW  C+ G+ Q+PID
Sbjct  10   FFALFFIYLSFPKISLANSEVDDETPFTYEQKTEKGPEGWGNINPEWKVCNTGRFQSPID  69

Query  248  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
            L ++ V   +       Y    A + N G+ +M+SW      + I    +   Q HWH P
Sbjct  70   LTNERVSLIHDQAWHRQYQPAPAVITNRGHDIMVSWKGDAGKITIRQTDFKLVQCHWHSP  129

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH VNGTRYDLE H+VH S  GR AV+ V+Y++GE PN  L+ + + +K +      + 
Sbjct  130  SEHTVNGTRYDLELHMVHTSARGRTAVIGVLYKLGE-PNEFLTKLLNGIKAVGNK---EV  185

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++ + R++YRY+GSLT PPCTEGV+WTV++ + +++ +Q+  +R A+ D  
Sbjct  186  DLGVIDPREIRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVDDGF  245

Query  788  KTNARPLQTINDRFV  832
            +TN+RP+Q    R V
Sbjct  246  ETNSRPVQDSKGRSV  260



>ref|XP_008364026.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=246

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 151/234 (65%), Gaps = 4/234 (2%)
 Frame = +2

Query  134  DEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRD  310
            DE  F+Y E + +GP  WGE+ P W  C  GK+Q+PIDL  + V V+ +LG ++  Y   
Sbjct  4    DETPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFPHLGKLKRGYKPA  63

Query  311  VATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSN  490
             AT++N G+ + + W      + ING  Y   Q HWH PSEH  NG+RY LE H+VH+S+
Sbjct  64   PATVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFHVVHLSS  123

Query  491  DGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYM  670
             G+IAV+ ++Y+ G  P+P+LS +   +K +     V   IG ++P  ++   R+YYRY+
Sbjct  124  TGKIAVIGIVYKYGR-PDPLLSKLFHHIKSVGIEEEVD--IGIINPGDIKFGSRKYYRYI  180

Query  671  GSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            GSLT PPCTEGV+WT+++ +R+V+++QV  +R A+HD  + NARP Q ++ R V
Sbjct  181  GSLTVPPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGRPV  234



>ref|XP_006413835.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
 gb|ESQ55288.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
Length=268

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 159/255 (62%), Gaps = 5/255 (2%)
 Frame = +2

Query  71   LFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPID  247
             F + FL LS  ++ +   +  DE  F+Y++N D+GP  W ++ P W  C+ GK Q+PID
Sbjct  10   CFGLFFLYLSFPNISLADSDTKDETAFTYEQNPDKGPEGWSKVNPHWKVCNTGKFQSPID  69

Query  248  LESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFP  427
            L ++ V           Y    A + N G+ +M+SW      + I G  +   Q HWH P
Sbjct  70   LTNQRVSLIRDQAWSRDYKPAPAVIMNRGHDIMVSWKGDAGKITIRGTEFKLVQCHWHSP  129

Query  428  SEHVVNGTRYDLEAHLVHVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKK  607
            SEH VNGTRYD+E H+VH S  G+ AV+ V+Y++G+ PN  L+ + + +K + +    +K
Sbjct  130  SEHTVNGTRYDMELHMVHTSARGQTAVIGVLYRLGK-PNEFLTRLLNGIKTVEKE---EK  185

Query  608  GIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
             +G +DP  ++ + +++YRY+GSLT PPCTEGV+WT+++ + +++++Q+A +RNA+ D  
Sbjct  186  SLGIVDPRSIRFQTKKFYRYIGSLTVPPCTEGVIWTIVKKVNTISQEQIAALRNAVDDGY  245

Query  788  KTNARPLQTINDRFV  832
            +TN+RP+Q  + R +
Sbjct  246  ETNSRPVQDPHGRSI  260



>emb|CDY65169.1| BnaC05g49130D, partial [Brassica napus]
Length=254

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 148/223 (66%), Gaps = 3/223 (1%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            EV+DE  F+Y +N  +GP  WGE++ EW  C  G++Q+PIDL ++ V + S+LG +   Y
Sbjct  30   EVEDEHEFNYKKNDGKGPERWGEIKQEWEMCGKGEIQSPIDLMNERVKIVSHLGRLIRDY  89

Query  302  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
                AT++N G+ +ML +  G    + ING +Y  +Q+HWH PSEH +NG R+ LE H+V
Sbjct  90   EPSNATIKNRGHDIMLKFEDGAAGSIKINGFQYELQQLHWHSPSEHTINGRRFALELHMV  149

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H    GR+AV+ V+Y+IG     I SL E +L+ + +    +K +  +DP  ++   R+Y
Sbjct  150  HEGKKGRMAVVTVLYKIGRADTFIRSL-EKELEAITDLDDAEKHVRMIDPKQIKIGSRKY  208

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDES  787
            YRY+GSLTTPPCT+ V W+V+R IR+VT++QV L+R A+HD S
Sbjct  209  YRYIGSLTTPPCTQNVTWSVVRKIRTVTREQVRLLRVAVHDVS  251



>emb|CDP14170.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 152/237 (64%), Gaps = 4/237 (2%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            EV+DE  F+Y+E + +GP +WG + P+W  C  GK+Q+PIDL  + V ++  LG ++  Y
Sbjct  33   EVEDESPFTYEEGTGKGPKNWGHIDPQWQVCDKGKLQSPIDLLDERVQIFPGLGKLKRGY  92

Query  302  MRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVH  481
                A L+N G+ + + W      +  NG  Y   Q HWH PSEH +NGTR++LE H+VH
Sbjct  93   KPAAAVLKNRGHDISVEWRGDAGKIVANGTDYKVLQCHWHSPSEHTLNGTRHNLELHIVH  152

Query  482  VSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYY  661
             S+ G IAV+ ++Y+IG  P+  L+ +   +K+  E   +   +G + P  ++   R+YY
Sbjct  153  RSSSGGIAVVGILYKIGR-PDSFLAKLLHHIKRADEGDAID--LGVVSPGDIKFGSRKYY  209

Query  662  RYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFV  832
            RY+GSLT PPCTEGV+WT+++ +R+V+++Q+  IR+ +HD  + NARPLQ  N R V
Sbjct  210  RYIGSLTVPPCTEGVLWTIVKKVRTVSREQIRAIRDVVHDGFEANARPLQQENGRPV  266



>ref|XP_010098809.1| hypothetical protein L484_022574 [Morus notabilis]
 gb|EXB75897.1| hypothetical protein L484_022574 [Morus notabilis]
Length=243

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 152/233 (65%), Gaps = 9/233 (4%)
 Frame = +2

Query  158  ENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATLENHG  334
            + S++GP HWGEL+ EW  C  GK+Q+PIDL +  V V   LG I+  Y    AT++N G
Sbjct  2    QESEKGPRHWGELKKEWKACKHGKLQSPIDLLNHRVKVIPKLGDIKMNYKPANATIKNRG  61

Query  335  YGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSND----GRI  502
            + + + W      + ING  Y  +Q HWH PSEH +NG R DLE H+VH S D     RI
Sbjct  62   HDISIVWLDDAGSIQINGTDYFLQQCHWHSPSEHSINGRRLDLELHIVHSSPDVKIERRI  121

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPG-VKKGIGYLDPNLLQARGRRYYRYMGSL  679
            AV+A++Y+ G+ P+  LS    D+  + +T   V KG+  +DP  L+  G +YYRY+GSL
Sbjct  122  AVIAMLYKFGK-PDRFLSKFTKDMVSITDTKQEVHKGV--IDPRELKMGGLKYYRYIGSL  178

Query  680  TTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            T PPCTEGV+WT+ + I +V+++QV+L+R A+HD ++ NARPLQ +N+R + +
Sbjct  179  TIPPCTEGVIWTMNKRISTVSREQVSLLREAVHDHAEMNARPLQPLNERDIHI  231



>ref|XP_006489872.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=273

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 152/236 (64%), Gaps = 5/236 (2%)
 Frame = +2

Query  122  QEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNY  298
             EVDDE  FSY E + +GPS WG++ P W  C  GK+Q+PIDL ++ V V   LG ++  
Sbjct  30   SEVDDETPFSYKEETGKGPSEWGKISPHWRVCGIGKLQSPIDLLNQRVQVLPALGKLKRD  89

Query  299  YMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
            Y   +A ++N G+ + + W      + ING  Y   Q HWH PSEH +NG+ Y++E HLV
Sbjct  90   YKPALAVVKNRGHDICVWWRGDAGKMHINGTIYKLLQCHWHTPSEHTINGSSYEMELHLV  149

Query  479  HVSNDGRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRY  658
            H+S+DG++AV  ++Y+ G  P+P LS +   +K L +    +K +G ++P  ++   R+Y
Sbjct  150  HLSSDGKLAVTGIVYEYGR-PDPFLSKLLHHIKSLGKE---EKEVGIVNPGDIKFGSRKY  205

Query  659  YRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            YRY+GSLT PPCTEGV+WT+ + +R+V+++QV  ++  +HD  + NARP   +N R
Sbjct  206  YRYIGSLTVPPCTEGVIWTIGKKVRTVSREQVRALKEEVHDGYEKNARPTNELNGR  261



>dbj|BAK02152.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02420.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 149/232 (64%), Gaps = 2/232 (1%)
 Frame = +2

Query  146  FSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYYMRDVATL  322
            FSY  +++ GP+HWG+++ EW  C  G MQ+PIDL S  V +   LG + + Y+   AT+
Sbjct  37   FSYSLDAENGPAHWGDIKEEWSACGKGNMQSPIDLASPRVSLVRGLGYLNHSYVPSNATV  96

Query  323  ENHGYGMMLSWPLGQRYLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLVHVSNDGRI  502
             N G+ +ML +      + I G  Y  RQ+HWH P+EH +NG RYD+E H+ H S  G+ 
Sbjct  97   VNRGHDIMLKFEGDAGSVSIGGTPYYLRQMHWHSPTEHSLNGRRYDMELHMFHESARGKA  156

Query  503  AVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQARGRRYYRYMGSLT  682
            AV+ V YQ+G+  +  L  +E  L+ +A+    ++ +G +DP   + +   YYRY+GSLT
Sbjct  157  AVIGVFYQVGDH-DAFLHKLEPYLEMIADRKDREEKMGMMDPRGARGKASVYYRYVGSLT  215

Query  683  TPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDRFVKV  838
            TPPC EGV+WT+++ +R+V++ Q+ L+R A+HD+ + NARP Q +N R + +
Sbjct  216  TPPCAEGVIWTIVKRVRTVSRHQLELLREAVHDDMEKNARPRQEVNSRDISM  267



>ref|XP_010050524.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89338.1| hypothetical protein EUGRSUZ_A01630 [Eucalyptus grandis]
Length=283

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 149/242 (62%), Gaps = 8/242 (3%)
 Frame = +2

Query  125  EVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTPIDLESKPV-VYSNLGPIQNYY  301
            E +DE  F Y   S++GP HWGELR +W  C  G+MQ+PIDL S+ V V   LG I+  +
Sbjct  32   EAEDEREFDYIPGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSERVQVMPKLGEIERNH  91

Query  302  MRDVATLENHGYGMMLSWPLGQR-YLGINGIRYLFRQVHWHFPSEHVVNGTRYDLEAHLV  478
                ATL+N G+ + L W  G    + ING  Y  +Q HWH PSEH +NG RY LE H+V
Sbjct  92   KPSNATLKNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMV  151

Query  479  HVSND----GRIAVLAVMYQIGETPNPILSLIEDDLKKLAETPGVKKGIGYLDPNLLQAR  646
            HVS D      I V+ ++Y+ G  P+  LS +   +  + +    +K +G +DP  ++  
Sbjct  152  HVSTDPNVKNNITVVGLLYKTG-VPDAFLSKLMGSVWSMIDKEDERK-MGTIDPREIKMG  209

Query  647  GRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNAIHDESKTNARPLQTINDR  826
            G+ Y RY GSLT PPCTEGV+WT+ + + +V+K Q+ L+R A+HD ++ NARP+Q +N R
Sbjct  210  GKNYLRYTGSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNRR  269

Query  827  FV  832
             +
Sbjct  270  EI  271



>ref|XP_008383977.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=339

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 159/262 (61%), Gaps = 7/262 (3%)
 Frame = +2

Query  65   LKLFSIAFLLLSVTHV-IKSQEVDDEWGFSYDENSDRGPSHWGELRPEWWQCSAGKMQTP  241
            L+ F++  +LL +  + + ++ +D E  F Y E S++GP HWGEL+ EW  C  GK Q+P
Sbjct  10   LRFFALTIILLYLHPIALTAKPLDQEIEFDYREGSEKGPQHWGELKKEWTACKDGKSQSP  69

Query  242  IDL--ESKPVVYSNLGPIQNYYMRDVATLENHGYGMMLSWPLGQRYLGINGIRYLFRQVH  415
            IDL  +    V      +  ++    ATL+N G+ + L W      + ING  Y  +Q H
Sbjct  70   IDLMEDGATKVIPTFRDLTMHHKPSGATLKNEGHYIALEWEGDAGSIQINGTNYFLKQCH  129

Query  416  WHFPSEHVVNGTRYDLEAHLVHVSND-GRIAVLAVMYQIGETPNPILSLIEDDLKKLAET  592
            WH PSEH +NG RYDLE H+VH S D   +AV+A +YQ+G  PNP L  +  D+  +  T
Sbjct  130  WHTPSEHTINGIRYDLELHMVHRSADKNSVAVIAFLYQVG-PPNPFLLKVSKDILSVIGT  188

Query  593  PGVKKGIGYLDPNLLQARGRRYYRYMGSLTTPPCTEGVVWTVIRTIRSVTKQQVALIRNA  772
               +K +G ++P+ ++    R+YRY+GSLTTPPCTE V+WTV   +  V+++Q+ L++  
Sbjct  189  K--EKHLGVINPSEIKWPSLRFYRYVGSLTTPPCTEAVIWTVNEGVSIVSRRQLELLKQV  246

Query  773  IHDESKTNARPLQTINDRFVKV  838
            + D +  NARPLQ  NDR +K+
Sbjct  247  VDDYAVMNARPLQPXNDRGIKL  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3153915041376