BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24772_g3_i6 len=1349 path=[1:0-284 286:285-472 474:473-514
516:515-537 539:538-642 34319:643-661 663:662-741 743:742-745
747:746-835 34499:836-841 18787:842-868 18814:869-952 18898:953-1039
18985:1040-1070 19016:1071-1174 19120:1175-1210 19156:1211-1223
19169:1224-1265 19211:1266-1348]

Length=1349
                                                                      Score     E

ref|XP_004252759.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    313   4e-100   
ref|XP_006342636.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    309   2e-98    
ref|XP_011069667.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    308   6e-98    
ref|XP_007026181.1|  Ribosomal protein L4/L1 family isoform 1           305   9e-97    
ref|XP_009758874.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    305   1e-96    
ref|XP_009592582.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    305   2e-96    
gb|KHG30769.1|  50S ribosomal L4                                        303   6e-96    
ref|XP_009610537.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    300   1e-94    
ref|XP_006298209.1|  hypothetical protein CARUB_v10014259mg             295   7e-93    
gb|EYU24034.1|  hypothetical protein MIMGU_mgv1a010625mg                295   9e-93    
ref|XP_010553457.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    294   2e-92    
ref|XP_010553456.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    293   2e-92    
ref|XP_010533789.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    294   2e-92    
ref|XP_006383860.1|  hypothetical protein POPTR_0004s00660g             292   1e-91    
ref|XP_011046992.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    291   3e-91    
gb|KDO78367.1|  hypothetical protein CISIN_1g021591mg                   290   3e-91    
ref|XP_010065410.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    291   3e-91    
gb|KDO78366.1|  hypothetical protein CISIN_1g021591mg                   291   3e-91    
gb|KDP20700.1|  hypothetical protein JCGZ_21171                         290   6e-91    
ref|XP_002518422.1|  50S ribosomal protein L4, putative                 289   7e-91    Ricinus communis
ref|XP_006467374.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    289   2e-90    
ref|XP_004134779.1|  PREDICTED: 50S ribosomal protein L4-like           289   2e-90    
ref|NP_565463.1|  large subunit ribosomal protein L4                    287   5e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAM62769.1|  50S ribosomal protein L4                                287   5e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502936.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    287   7e-90    
ref|XP_008440040.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    288   9e-90    
gb|EYU36343.1|  hypothetical protein MIMGU_mgv1a010848mg                286   2e-89    
gb|EYU36344.1|  hypothetical protein MIMGU_mgv1a010848mg                285   3e-89    
ref|XP_002886003.1|  50S ribosomal protein L4                           283   2e-88    
ref|XP_010456595.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    281   9e-88    
emb|CDY13887.1|  BnaA09g43890D                                          280   3e-87    
ref|XP_004293324.1|  PREDICTED: 50S ribosomal protein L4-like           280   4e-87    
ref|XP_008231665.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    280   4e-87    
ref|XP_006383859.1|  ribosomal protein L4                               278   1e-86    
ref|XP_006408921.1|  hypothetical protein EUTSA_v10002043mg             280   1e-86    
emb|CDY31994.1|  BnaA07g00010D                                          278   2e-86    
ref|XP_009117510.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    277   3e-86    
gb|AHA84219.1|  50S ribosomal protein L4                                278   4e-86    
emb|CDY05720.1|  BnaC07g00830D                                          276   7e-86    
gb|EPS72544.1|  hypothetical protein M569_02212                         276   1e-85    
ref|XP_007147686.1|  hypothetical protein PHAVU_006G146000g             276   2e-85    
ref|XP_007134426.1|  hypothetical protein PHAVU_010G046600g             275   4e-85    
ref|XP_003634850.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    275   6e-85    
ref|XP_010099157.1|  50S ribosomal protein L4                           274   7e-85    
ref|XP_010252520.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    274   1e-84    
emb|CAN77922.1|  hypothetical protein VITISV_027648                     272   2e-84    Vitis vinifera
ref|XP_010514578.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    273   2e-84    
ref|XP_003534682.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    272   7e-84    
ref|XP_010416335.1|  PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma...    268   1e-82    
ref|NP_001242456.1|  uncharacterized protein LOC100804238               267   7e-82    
ref|XP_004486189.1|  PREDICTED: 50S ribosomal protein L4-like           266   7e-82    
emb|CDX81955.1|  BnaC08g36460D                                          266   1e-81    
ref|XP_008384099.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    266   2e-81    
ref|XP_010914092.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    264   4e-81    
ref|XP_010914093.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    264   5e-81    
gb|KDO78369.1|  hypothetical protein CISIN_1g021591mg                   262   7e-81    
ref|XP_009357493.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    264   1e-80    
ref|XP_006597049.1|  PREDICTED: uncharacterized protein LOC100804...    264   1e-80    
ref|XP_009356763.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    264   1e-80    
ref|XP_009410210.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    263   1e-80    
ref|XP_006836271.1|  hypothetical protein AMTR_s00101p00151570          262   2e-80    
ref|XP_002463709.1|  hypothetical protein SORBIDRAFT_01g004650          262   2e-80    Sorghum bicolor [broomcorn]
ref|NP_001147335.1|  LOC100280943                                       262   3e-80    Zea mays [maize]
ref|XP_002446335.1|  hypothetical protein SORBIDRAFT_06g014470          262   6e-80    Sorghum bicolor [broomcorn]
tpg|DAA52004.1|  TPA: 50S ribosomal protein L4                          261   7e-80    
emb|CDP01309.1|  unnamed protein product                                258   7e-80    
ref|XP_008787312.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    261   2e-79    
ref|XP_006663555.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    260   3e-79    
ref|NP_001068165.1|  Os11g0585700                                       258   7e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979576.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    258   1e-78    
ref|XP_009357492.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    258   2e-78    
ref|XP_003577421.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    257   2e-78    
ref|XP_010685040.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    257   2e-78    
gb|EEE52352.1|  hypothetical protein OsJ_34399                          259   3e-78    Oryza sativa Japonica Group [Japonica rice]
gb|AFK36510.1|  unknown                                                 256   6e-78    
ref|XP_004962972.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    253   9e-77    
ref|XP_007220702.1|  hypothetical protein PRUPE_ppa021068mg             253   2e-76    
dbj|BAK00507.1|  predicted protein                                      251   4e-76    
ref|XP_008224759.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...    250   5e-76    
gb|AES73712.2|  50S ribosomal protein L4, bacterial/organelle pro...    253   6e-76    
ref|XP_003603461.1|  50S ribosomal protein L4                           252   2e-75    
gb|ACU18021.1|  unknown                                                 242   1e-73    Glycine max [soybeans]
ref|XP_006383858.1|  hypothetical protein POPTR_0004s00660g             238   2e-71    
ref|XP_010252525.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    238   3e-71    
gb|ADE77062.1|  unknown                                                 235   1e-69    
ref|XP_010490301.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    231   7e-69    
ref|XP_009610538.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...    228   4e-67    
gb|KDO78368.1|  hypothetical protein CISIN_1g021591mg                   221   2e-65    
gb|EMS55866.1|  50S ribosomal protein L4                                220   2e-64    
gb|EMT27905.1|  50S ribosomal protein L4                                220   2e-64    
gb|EEC68430.1|  hypothetical protein OsI_36619                          218   1e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_008778736.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    208   7e-61    
gb|KHN32994.1|  50S ribosomal protein L4                                209   9e-61    
gb|EEC69298.1|  hypothetical protein OsI_38360                          207   2e-60    Oryza sativa Indica Group [Indian rice]
gb|ACN26135.1|  unknown                                                 206   4e-60    Zea mays [maize]
gb|EMT16009.1|  50S ribosomal protein L4                                200   8e-57    
gb|EMS66148.1|  50S ribosomal protein L4                                191   6e-53    
gb|EYU31362.1|  hypothetical protein MIMGU_mgv1a014658mg                184   6e-52    
ref|XP_001773052.1|  predicted protein                                  180   3e-49    
ref|XP_006377175.1|  hypothetical protein POPTR_0011s01580g             171   6e-47    
ref|XP_002969851.1|  hypothetical protein SELMODRAFT_227946             158   1e-41    
ref|XP_002985293.1|  hypothetical protein SELMODRAFT_181558             156   4e-41    
ref|XP_005850361.1|  hypothetical protein CHLNCDRAFT_142203             155   2e-39    
ref|XP_010467942.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    141   2e-36    
ref|XP_007212503.1|  hypothetical protein PRUPE_ppa017710mg             144   9e-36    
gb|ABC24932.1|  plastid 50S ribosomal protein L4 family                 139   1e-34    Prototheca wickerhamii
gb|KFM28200.1|  50S ribosomal protein L4                                138   1e-33    
emb|CEF99633.1|  Ribosomal protein L4/L1e                               132   2e-31    
ref|WP_038530645.1|  50S ribosomal protein L4                           127   1e-30    
ref|WP_014241037.1|  50S ribosomal protein L4                           127   2e-30    
ref|WP_011390437.1|  50S ribosomal protein L4                           126   3e-30    
ref|WP_009541273.1|  50S ribosomal protein L4                           126   3e-30    
ref|WP_038461578.1|  50S ribosomal protein L4                           125   5e-30    
gb|ABA98275.1|  ribosomal protein L4/L1 family protein                  127   7e-30    Oryza sativa Japonica Group [Japonica rice]
ref|WP_029013604.1|  50S ribosomal protein L4                           125   8e-30    
ref|WP_035675055.1|  50S ribosomal protein L4                           124   2e-29    
ref|WP_029009701.1|  50S ribosomal protein L4                           123   3e-29    
ref|WP_011114492.1|  50S ribosomal protein L4                           123   3e-29    
ref|WP_037352444.1|  50S ribosomal protein L4                           123   4e-29    
ref|NP_001066789.2|  Os12g0488600                                       126   6e-29    Oryza sativa Japonica Group [Japonica rice]
ref|WP_021999220.1|  50S ribosomal protein L4                           122   9e-29    
ref|WP_012565934.1|  50S ribosomal protein L4                           121   2e-28    
ref|WP_014746146.1|  50S ribosomal protein L4                           120   3e-28    
ref|WP_014246890.1|  50S ribosomal protein L4                           120   4e-28    
ref|WP_012973206.1|  50S ribosomal protein L4                           120   4e-28    
ref|WP_007678342.1|  50S ribosomal protein L4                           120   6e-28    
gb|EKE09117.1|  hypothetical protein ACD_16C00213G0040                  119   7e-28    
ref|WP_031934484.1|  50S ribosomal protein L4                           119   8e-28    
ref|XP_001420312.1|  Putative mitochondrial ribosomal protein L4        120   9e-28    Ostreococcus lucimarinus CCE9901
ref|WP_027302615.1|  50S ribosomal protein L4                           118   2e-27    
ref|WP_011385498.1|  50S ribosomal protein L4                           118   2e-27    
ref|WP_038603371.1|  50S ribosomal protein L4                           117   3e-27    
ref|WP_012880531.1|  50S ribosomal protein L4                           117   3e-27    
ref|WP_028466778.1|  50S ribosomal protein L4                           117   5e-27    
ref|WP_036480288.1|  50S ribosomal protein L4                           117   5e-27    
ref|WP_019646044.1|  50S ribosomal protein L4                           116   8e-27    
ref|WP_037453613.1|  50S ribosomal protein L4                           116   9e-27    
ref|WP_008615456.1|  50S ribosomal protein L4                           116   9e-27    
ref|WP_014414488.1|  50S ribosomal protein L4                           116   1e-26    
ref|WP_015468375.1|  50S ribosomal protein L4                           116   1e-26    
ref|WP_014103663.1|  50S ribosomal protein L4                           116   1e-26    
ref|WP_011477720.1|  50S ribosomal protein L4                           115   2e-26    
ref|WP_011450416.1|  50S ribosomal protein L4                           115   2e-26    
ref|WP_011581015.1|  50S ribosomal protein L4                           115   2e-26    
ref|WP_008494543.1|  MULTISPECIES: 50S ribosomal protein L4             115   2e-26    
ref|WP_011191090.1|  50S ribosomal protein L4                           115   3e-26    
gb|KDB57419.1|  50S ribosomal protein L4                                115   3e-26    
ref|WP_021799353.1|  50S ribosomal protein L4                           115   3e-26    
ref|WP_026873856.1|  50S ribosomal protein L4                           114   4e-26    
ref|WP_008597559.1|  50S ribosomal protein L4                           114   4e-26    
gb|EEE53224.1|  hypothetical protein OsJ_36122                          115   4e-26    Oryza sativa Japonica Group [Japonica rice]
ref|WP_027677428.1|  50S ribosomal protein L4                           114   5e-26    
ref|WP_028035639.1|  50S ribosomal protein L4                           114   5e-26    
ref|WP_007009513.1|  50S ribosomal protein L4                           114   7e-26    
ref|WP_010421659.1|  50S ribosomal protein L4                           114   9e-26    
ref|XP_003081980.1|  50S ribosomal protein L4 (ISS)                     115   9e-26    
ref|WP_008945160.1|  50S ribosomal protein L4                           113   9e-26    
ref|WP_007434865.1|  50S ribosomal protein L4                           114   1e-25    
gb|AHI06690.1|  50S ribosomal protein L4                                113   1e-25    
ref|WP_009452534.1|  50S ribosomal protein L4                           113   1e-25    
ref|WP_002725426.1|  MULTISPECIES: 50S ribosomal protein L4             113   2e-25    
ref|WP_019998905.1|  50S ribosomal protein L4                           113   2e-25    
ref|WP_007066364.1|  50S ribosomal protein L4                           112   2e-25    
ref|WP_014364921.1|  50S ribosomal protein L4                           112   2e-25    
ref|WP_012736946.1|  MULTISPECIES: 50S ribosomal protein L4             112   2e-25    
ref|WP_004997785.1|  MULTISPECIES: 50S ribosomal protein L4             112   2e-25    
ref|WP_012151151.1|  50S ribosomal protein L4                           112   2e-25    
ref|WP_014014636.1|  MULTISPECIES: 50S ribosomal protein L4             112   2e-25    
ref|WP_034837021.1|  50S ribosomal protein L4                           112   3e-25    
ref|WP_008339787.1|  50S ribosomal protein L4                           112   3e-25    
ref|WP_007004403.1|  50S ribosomal protein L4                           112   4e-25    
ref|WP_024847016.1|  50S ribosomal protein L4                           112   4e-25    
ref|WP_012719919.1|  50S ribosomal protein L4                           112   4e-25    
ref|WP_011256539.1|  50S ribosomal protein L4                           111   4e-25    
ref|WP_014412448.1|  50S ribosomal protein L4                           111   4e-25    
ref|WP_028843121.1|  50S ribosomal protein L4                           111   5e-25    
ref|WP_012811931.1|  50S ribosomal protein L4                           111   5e-25    
ref|WP_009209731.1|  MULTISPECIES: 50S ribosomal protein L4             111   5e-25    
gb|AIH04237.1|  50S ribosomal protein L4                                111   6e-25    
ref|WP_023507969.1|  50S ribosomal protein L4                           111   6e-25    
ref|WP_038062588.1|  50S ribosomal protein L4                           111   6e-25    
ref|WP_008580969.1|  MULTISPECIES: 50S ribosomal protein L4             111   8e-25    
ref|WP_011255725.1|  50S ribosomal protein L4                           110   8e-25    
ref|WP_011270631.1|  50S ribosomal protein L4                           110   8e-25    
ref|WP_014465733.1|  50S ribosomal protein L4                           110   9e-25    
ref|WP_004596200.1|  50S ribosomal protein L4                           110   9e-25    
ref|WP_013531423.1|  MULTISPECIES: 50S ribosomal protein L4             110   9e-25    
dbj|BAO99519.1|  50S ribosomal protein L4                               110   1e-24    
ref|WP_028000154.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_003536623.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_011975172.1|  MULTISPECIES: 50S ribosomal protein L4             110   1e-24    
ref|WP_024585424.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_003516147.1|  MULTISPECIES: 50S ribosomal protein L4             110   1e-24    
ref|WP_024270439.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_014408922.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_025593949.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_029620125.1|  MULTISPECIES: 50S ribosomal protein L4             110   1e-24    
ref|WP_028841346.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_024078298.1|  50S ribosomal protein L4                           110   1e-24    
ref|WP_039758109.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_029964936.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_006313970.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_010971963.1|  MULTISPECIES: 50S ribosomal protein L4             110   2e-24    
ref|WP_038448235.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_015092006.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_011165351.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_027154042.1|  50S ribosomal protein L4                           110   2e-24    
ref|WP_023799294.1|  50S ribosomal protein L4                           109   2e-24    
emb|CEG69999.1|  Putative 50S ribosomal protein L4/L1                   110   2e-24    
ref|WP_011155288.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_028795257.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_032138905.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_012707755.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_027026958.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_008039992.1|  50S ribosomal protein L4                           109   2e-24    
ref|WP_015589145.1|  50S ribosomal protein L4                           109   3e-24    
ref|WP_018505131.1|  50S ribosomal protein L4                           110   3e-24    
ref|WP_025426665.1|  50S ribosomal protein L4                           109   3e-24    
ref|WP_034795521.1|  50S ribosomal protein L4                           109   3e-24    
ref|WP_017442487.1|  50S ribosomal protein L4                           109   3e-24    
ref|WP_028096619.1|  50S ribosomal protein L4                           109   3e-24    
gb|EFA80316.1|  hypothetical protein PPL_07147                          111   4e-24    Heterostelium album PN500
ref|WP_007626084.1|  50S ribosomal protein L4                           109   4e-24    
ref|WP_011304723.1|  50S ribosomal protein L4                           108   4e-24    
emb|CDX21136.1|  50S ribosomal subunit protein L4                       108   4e-24    
ref|WP_027057017.1|  50S ribosomal protein L4                           108   4e-24    
ref|WP_010962756.1|  50S ribosomal protein L4                           108   4e-24    
ref|WP_032073486.1|  50S ribosomal protein L4                           108   4e-24    
ref|WP_014328065.1|  50S ribosomal protein L4                           108   4e-24    
ref|WP_012149904.1|  50S ribosomal protein L4                           108   4e-24    
emb|CEI99083.1|  Putative 50S ribosomal protein L4/L1                   110   4e-24    
ref|WP_003495173.1|  MULTISPECIES: 50S ribosomal protein L4             108   4e-24    
ref|WP_034859452.1|  50S ribosomal protein L4                           108   4e-24    
ref|WP_006333366.1|  50S ribosomal protein L4                           108   5e-24    
ref|WP_012153048.1|  50S ribosomal protein L4                           108   5e-24    
ref|WP_012673183.1|  MULTISPECIES: 50S ribosomal protein L4             108   5e-24    
ref|WP_027170368.1|  50S ribosomal protein L4                           108   5e-24    
ref|WP_023757977.1|  50S ribosomal protein L4                           108   5e-24    
ref|WP_012227956.1|  50S ribosomal protein L4                           108   5e-24    
ref|WP_023675140.1|  MULTISPECIES: 50S ribosomal protein L4             108   6e-24    
gb|EIE91456.1|  hypothetical protein RO3G_16167                         109   6e-24    
ref|WP_015470616.1|  50S ribosomal protein L4                           108   7e-24    
ref|WP_014365540.1|  50S ribosomal protein L4                           108   7e-24    
emb|CDX14122.1|  50S ribosomal subunit protein L4                       108   7e-24    
ref|WP_014764102.1|  50S ribosomal protein L4                           108   7e-24    
ref|WP_035741518.1|  50S ribosomal protein L4                           109   7e-24    
ref|WP_023672750.1|  MULTISPECIES: 50S ribosomal protein L4             108   8e-24    
ref|WP_018328284.1|  50S ribosomal protein L4                           108   8e-24    
ref|WP_023698816.1|  MULTISPECIES: 50S ribosomal protein L4             108   8e-24    
gb|ETZ04754.1|  50S ribosomal protein L4                                108   8e-24    
ref|WP_037133576.1|  50S ribosomal protein L4                           108   8e-24    
ref|WP_023818852.1|  50S ribosomal protein L4                           108   8e-24    
ref|WP_013895699.1|  MULTISPECIES: 50S ribosomal protein L4             108   9e-24    
ref|WP_008875667.1|  50S ribosomal protein L4                           108   9e-24    
gb|AHX04592.1|  50S ribosomal protein L4                                108   9e-24    
ref|WP_019857964.1|  MULTISPECIES: 50S ribosomal protein L4             108   9e-24    
ref|WP_005773269.1|  50S ribosomal protein L4                           108   9e-24    
ref|WP_015915739.1|  50S ribosomal protein L4                           108   9e-24    
ref|WP_006205466.1|  50S ribosomal protein L4                           108   1e-23    
ref|WP_024072231.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_020695007.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_018406020.1|  MULTISPECIES: 50S ribosomal protein L4             107   1e-23    
ref|WP_019171226.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_018427842.1|  50S ribosomal protein L4                           107   1e-23    
emb|CCF19208.1|  50S ribosomal subunit protein L4                       107   1e-23    
ref|WP_014409476.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_024924759.1|  MULTISPECIES: 50S ribosomal protein L4             107   1e-23    
ref|WP_037383029.1|  MULTISPECIES: 50S ribosomal protein L4             107   1e-23    
ref|WP_027028838.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_015317984.1|  MULTISPECIES: 50S ribosomal protein L4             107   1e-23    
ref|WP_015856586.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_012148993.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_027044975.1|  50S ribosomal protein L4                           107   1e-23    
gb|AHC73384.1|  50S ribosomal protein L4                                107   1e-23    
ref|WP_031550804.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_027489062.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_021296617.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_022854377.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_006116050.1|  50S ribosomal protein L4                           107   1e-23    
emb|CDX35492.1|  50S ribosomal subunit protein L4                       107   1e-23    
ref|WP_003587197.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_027145573.1|  50S ribosomal protein L4                           107   1e-23    
emb|CEI85299.1|  50S ribosomal protein L4                               107   1e-23    
ref|WP_019090047.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_012231996.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_006539133.1|  50S ribosomal protein L4                           108   1e-23    
ref|WP_020463477.1|  50S ribosomal protein L4                           108   1e-23    
ref|WP_029068951.1|  50S ribosomal protein L4                           108   1e-23    
ref|WP_003622706.1|  50S ribosomal protein L4                           107   1e-23    
ref|WP_027051774.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_035544091.1|  MULTISPECIES: 50S ribosomal protein L4             107   2e-23    
ref|WP_027281253.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_014392635.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_018239486.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_007347783.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_026617391.1|  MULTISPECIES: 50S ribosomal protein L4             107   2e-23    
ref|WP_013909554.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_037138168.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_004674918.1|  MULTISPECIES: 50S ribosomal protein L4             107   2e-23    
ref|WP_022710939.1|  50S ribosomal protein L4                           107   2e-23    
gb|KDO33439.1|  hypothetical protein SPRG_02246                         108   2e-23    
ref|WP_009109907.1|  50S ribosomal protein L4                           107   2e-23    
emb|CBK19667.2|  unnamed protein product                                105   2e-23    
ref|WP_013537017.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_025899914.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_029604136.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_028757607.1|  50S ribosomal protein L4                           105   2e-23    
ref|XP_008615260.1|  50S ribosomal protein L4                           108   2e-23    
ref|WP_037100582.1|  50S ribosomal protein L4                           107   2e-23    
ref|WP_035032270.1|  MULTISPECIES: 50S ribosomal protein L4             107   2e-23    
ref|WP_036334272.1|  50S ribosomal protein L4                           108   3e-23    
ref|WP_018131281.1|  50S ribosomal protein L4                           106   3e-23    
ref|WP_037169456.1|  MULTISPECIES: 50S ribosomal protein L4             106   3e-23    
ref|WP_024897011.1|  50S ribosomal protein L4                           106   3e-23    
ref|WP_027509259.1|  50S ribosomal protein L4                           106   3e-23    
dbj|GAK71236.1|  50S ribosomal protein L4                               106   3e-23    
ref|WP_037084733.1|  50S ribosomal protein L4                           106   3e-23    
ref|WP_007761052.1|  50S ribosomal protein L4                           106   3e-23    
ref|WP_013908068.1|  50S ribosomal protein L4                           106   3e-23    
ref|WP_038250268.1|  50S ribosomal protein L4                           106   4e-23    
ref|WP_019459501.1|  MULTISPECIES: 50S ribosomal protein L4             106   4e-23    
ref|WP_010909274.1|  50S ribosomal protein L4                           106   4e-23    
ref|WP_026397249.1|  50S ribosomal protein L4                           106   4e-23    
gb|KIE05824.1|  50S ribosomal protein L4                                106   4e-23    
ref|WP_039455032.1|  50S ribosomal protein L4                           106   4e-23    
ref|WP_038540054.1|  50S ribosomal protein L4                           105   5e-23    
ref|WP_014869306.1|  MULTISPECIES: 50S ribosomal protein L4             105   5e-23    
ref|WP_038054993.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_008852406.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_022847350.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_010666054.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_006925138.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_006924709.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_038559043.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_007690753.1|  MULTISPECIES: 50S ribosomal protein L4             105   6e-23    
ref|WP_029868123.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_012483480.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_003578669.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_003547549.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_008892175.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_003786068.1|  MULTISPECIES: 50S ribosomal protein L4             105   6e-23    
ref|WP_016917713.1|  50S ribosomal protein L4                           105   6e-23    
ref|WP_017963906.1|  50S ribosomal protein L4                           105   7e-23    
ref|WP_003573800.1|  50S ribosomal protein L4                           105   7e-23    
ref|WP_011251965.1|  50S ribosomal protein L4                           105   7e-23    
ref|WP_009403568.1|  MULTISPECIES: 50S ribosomal protein L4             105   7e-23    
ref|XP_001697061.1|  mitochondrial ribosomal protein L4                 103   7e-23    
ref|WP_015398169.1|  50S ribosomal protein L4                           105   7e-23    
ref|WP_007282722.1|  MULTISPECIES: 50S ribosomal protein L4             105   8e-23    
emb|CDG32765.1|  LSU ribosomal protein L4p (L1e)                        105   8e-23    
ref|WP_029312053.1|  50S ribosomal protein L4                           105   8e-23    
ref|WP_013637811.1|  50S ribosomal protein L4                           105   8e-23    
ref|WP_011452577.1|  50S ribosomal protein L4                           105   8e-23    
ref|WP_023943129.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_027190511.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_010502124.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_034906898.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_027365231.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_012757020.1|  50S ribosomal protein L4                           105   9e-23    
ref|WP_007531661.1|  MULTISPECIES: 50S ribosomal protein L4             105   1e-22    
ref|WP_035006083.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_014742857.1|  50S ribosomal protein L4                           106   1e-22    
ref|WP_016553550.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_017532486.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_037127203.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_007787743.1|  50S ribosomal protein L4                           105   1e-22    
ref|XP_002958096.1|  mitochondrial ribosomal protein L4                 107   1e-22    
ref|WP_007302533.1|  MULTISPECIES: 50S ribosomal protein L4             105   1e-22    
ref|WP_006012216.1|  MULTISPECIES: 50S ribosomal protein L4             105   1e-22    
ref|WP_007424174.1|  MULTISPECIES: 50S ribosomal protein L4             105   1e-22    
ref|WP_022718391.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_024314775.1|  MULTISPECIES: 50S ribosomal protein L4             105   1e-22    
ref|WP_037063276.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_007552542.1|  50S ribosomal protein L4                           105   1e-22    
ref|WP_007875344.1|  50S ribosomal protein L4                           104   1e-22    
ref|WP_003789296.1|  50S ribosomal protein L4                           105   1e-22    
gb|KFL88405.1|  LSU ribosomal protein L4p (L1e)                         104   1e-22    
ref|WP_020185791.1|  50S ribosomal protein L4                           104   1e-22    
ref|WP_019014635.1|  50S ribosomal protein L4                           104   1e-22    
ref|WP_025885434.1|  50S ribosomal protein L4                           104   1e-22    
dbj|GAJ29493.1|  50S ribosomal protein L4                               104   1e-22    
ref|WP_015087935.1|  50S ribosomal protein L4                           104   2e-22    
ref|XP_008863042.1|  50S ribosomal protein L4                           106   2e-22    
ref|WP_015339599.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_027289402.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_025811627.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_018900275.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_037199975.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_034507398.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_019221629.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_019218820.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_028753973.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_027134785.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_023979003.1|  MULTISPECIES: 50S ribosomal protein L4             104   2e-22    
ref|WP_034480412.1|  50S ribosomal protein L4                           104   2e-22    
emb|CBI81076.1|  50S ribosomal protein L4                               104   2e-22    
ref|WP_011631262.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_007167834.1|  50S ribosomal protein L4                           104   2e-22    
ref|WP_031479687.1|  50S ribosomal protein L4                           104   2e-22    
gb|AHJ64961.1|  LSU ribosomal protein L1E ( L4P)                        104   2e-22    
ref|WP_014105029.1|  50S ribosomal protein L4                           103   2e-22    
ref|WP_037151090.1|  50S ribosomal protein L4                           103   2e-22    
ref|WP_025822023.1|  50S ribosomal protein L4                           103   3e-22    
ref|XP_009820949.1|  50S ribosomal protein L4                           105   3e-22    
ref|WP_013948191.1|  MULTISPECIES: 50S ribosomal protein L4             103   3e-22    
ref|WP_026167532.1|  50S ribosomal protein L4                           103   3e-22    
ref|WP_014890762.1|  50S ribosomal protein L4                           103   3e-22    
ref|WP_006557757.1|  50S ribosomal protein L4                           103   3e-22    
ref|WP_022893881.1|  50S ribosomal protein L4                           103   3e-22    
ref|WP_021827269.1|  50S ribosomal protein L4                           103   3e-22    
ref|WP_020812522.1|  50S ribosomal protein L4                           100   3e-22    
ref|WP_011602301.1|  50S ribosomal protein L4                           104   3e-22    
ref|WP_035009263.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_006522870.1|  50S ribosomal protein L4                           103   4e-22    
gb|EJF90844.1|  50S ribosomal protein L4                                103   4e-22    
ref|WP_027718594.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_002715370.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_008124905.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_011778571.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_038487892.1|  50S ribosomal protein L4                           103   4e-22    
ref|WP_006168370.1|  MULTISPECIES: 50S ribosomal protein L4             103   5e-22    
ref|WP_034625895.1|  50S ribosomal protein L4                           103   5e-22    
ref|WP_007001479.1|  50S ribosomal protein L4                           103   5e-22    
ref|WP_021900992.1|  50S ribosomal protein L4                           103   6e-22    
ref|XP_007509406.1|  50S ribosomal protein L4                           105   6e-22    
ref|WP_008853156.1|  50S ribosomal protein L4                           103   6e-22    
ref|WP_011451664.1|  50S ribosomal protein L4                           103   6e-22    
ref|WP_006279219.1|  50S ribosomal protein L4                           102   6e-22    
ref|WP_011026337.1|  50S ribosomal protein L4                           103   6e-22    
ref|WP_006467029.1|  MULTISPECIES: 50S ribosomal protein L4             103   6e-22    
ref|WP_034459610.1|  50S ribosomal protein L4                           103   6e-22    
ref|WP_010659915.1|  MULTISPECIES: 50S ribosomal protein L4             102   7e-22    
ref|WP_006119603.1|  50S ribosomal protein L4                           102   7e-22    
ref|WP_039192539.1|  50S ribosomal protein L4                           102   7e-22    
ref|WP_004118386.1|  50S ribosomal protein L4                           102   7e-22    
ref|WP_028339314.1|  50S ribosomal protein L4                           102   7e-22    
ref|WP_036717362.1|  50S ribosomal protein L4                           102   8e-22    
ref|WP_025826970.1|  50S ribosomal protein L4                           102   8e-22    
emb|CBI79529.1|  50S ribosomal protein L4                               102   8e-22    
ref|WP_018447023.1|  50S ribosomal protein L4                           102   8e-22    
ref|WP_029965518.1|  50S ribosomal protein L4                           102   9e-22    
ref|WP_011207265.1|  50S ribosomal protein L4                           103   9e-22    
ref|WP_013735953.1|  50S ribosomal protein L4                           102   9e-22    
ref|WP_037177355.1|  50S ribosomal protein L4                           102   9e-22    
emb|CEG07622.1|  hypothetical protein BN961_01020                       102   9e-22    
ref|WP_037016930.1|  50S ribosomal protein L4                           102   9e-22    
ref|WP_027175326.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_015354685.1|  MULTISPECIES: 50S ribosomal protein L4             102   1e-21    
ref|WP_027276733.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_025840923.1|  50S ribosomal protein L4                           102   1e-21    
gb|ENN95022.1|  50S ribosomal protein L4                                102   1e-21    
ref|WP_026501320.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_012301379.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_026075342.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_007812861.1|  MULTISPECIES: 50S ribosomal protein L4             102   1e-21    
ref|WP_022253576.1|  50S ribosomal protein L4                           102   1e-21    
ref|XP_002906814.1|  50S ribosomal protein L4                           103   1e-21    
ref|WP_035642545.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_015399171.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_020178164.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_029355694.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_019222542.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_029057581.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_028735904.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_008934163.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_024840311.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_036285001.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_008182924.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_013166263.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_009740527.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_036704919.1|  MULTISPECIES: 50S ribosomal protein L4             102   1e-21    
ref|WP_002964361.1|  MULTISPECIES: 50S ribosomal protein L4             102   1e-21    
ref|WP_005865055.1|  50S ribosomal protein L4                           102   1e-21    
ref|WP_034454689.1|  50S ribosomal protein L4                           102   2e-21    
ref|WP_011180913.1|  50S ribosomal protein L4                           102   2e-21    
ref|WP_034654917.1|  50S ribosomal protein L4                           102   2e-21    
ref|WP_034941981.1|  50S ribosomal protein L4                           102   2e-21    
ref|WP_018699164.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_010703883.1|  50S ribosomal protein L4                           101   2e-21    
ref|XP_002113245.1|  hypothetical protein TRIADDRAFT_27010              102   2e-21    
ref|WP_022165563.1|  50S ribosomal protein L4                           101   2e-21    
gb|AHI26162.1|  50S ribosomal protein L4                                101   2e-21    
ref|WP_035528282.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_010506735.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_015755961.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_031223886.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_009199258.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_021479875.1|  50S ribosomal protein L4                           102   2e-21    
ref|WP_015752490.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_011739058.1|  50S ribosomal protein L4                           102   2e-21    
emb|CCA14163.1|  50S ribosomal protein L4 putative                      103   2e-21    
emb|CBN78400.1|  50S ribosomal protein L4P                              103   2e-21    
ref|XP_009515921.1|  hypothetical protein PHYSODRAFT_552366             102   2e-21    
ref|XP_001640605.1|  predicted protein                                  103   2e-21    
ref|WP_004859204.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_015851068.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_007477066.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_026877496.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_009341058.1|  50S ribosomal protein L4                           101   2e-21    
ref|WP_006284344.1|  50S ribosomal protein L4                           101   2e-21    



>ref|XP_004252759.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Solanum lycopersicum]
Length=305

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 183/236 (78%), Gaps = 9/236 (4%)
 Frame = -2

Query  1204  LRSLSGSTA------SNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTK  1043
             LR+LS S          V+  +  AF K+E +F A RR+STS+L PDS DG FPSDLL+K
Sbjct  19    LRTLSASNVKANILGDGVSCVESSAFRKDESLFLACRRYSTSLLTPDSSDGSFPSDLLSK  78

Query  1042  KRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQ  863
             KRV T +RE+GL QDLV+PVTNF NEDKGFM LAGDVFDVPIRKDIIHRVVRWQLAKRQQ
Sbjct  79    KRVSTPEREIGLLQDLVIPVTNFNNEDKGFMCLAGDVFDVPIRKDIIHRVVRWQLAKRQQ  138

Query  862   GTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKV  683
             GTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV
Sbjct  139   GTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKV  197

Query  682   CRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              RLGLK+    +  + GK   F       +HKTKNIV+Y  ++EN KK+L+VDGGP
Sbjct  198   RRLGLKI-ALSARAAEGKLLVFEDLEIP-THKTKNIVNYFNQLENTKKLLVVDGGP  251


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  ++    ++E LK ATQN+HY NVLP
Sbjct  212  EGKLLVFEDLEIPTH-KTKNIVNYFNQLENTKKLLVVDGGPISEKLKFATQNVHYVNVLP  270

Query  459  SI  454
            SI
Sbjct  271  SI  272



>ref|XP_006342636.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Solanum 
tuberosum]
Length=305

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 180/236 (76%), Gaps = 9/236 (4%)
 Frame = -2

Query  1204  LRSLSGSTA------SNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTK  1043
             LR LS S          V+  +   F K+E +F A RR+STS+L PDS DG FPSDLL+K
Sbjct  19    LRPLSASNVKANILGDGVSWVESSVFRKDESLFLACRRYSTSLLTPDSSDGSFPSDLLSK  78

Query  1042  KRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQ  863
             KRV   +RE+GL QDLV+PVTNF NEDKGFM LAGDVFDVPIRKDIIHRVVRWQLAKRQQ
Sbjct  79    KRVSIPEREIGLLQDLVIPVTNFNNEDKGFMCLAGDVFDVPIRKDIIHRVVRWQLAKRQQ  138

Query  862   GTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKV  683
             GTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV
Sbjct  139   GTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKV  197

Query  682   CRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              RLGLK+    +  + GK   F       SHKTKN+V+Y  ++EN KK+L+VDGGP
Sbjct  198   RRLGLKI-ALSARAAEGKLLVFEDLEIP-SHKTKNVVNYFNQLENTKKLLVVDGGP  251


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VFED+E+PSH     +    +     K   +    ++E LKLATQN+HY NVLPS
Sbjct  212  EGKLLVFEDLEIPSHKTKNVVNYFNQLENTKKLLVVDGGPISEKLKLATQNVHYVNVLPS  271

Query  456  I  454
            I
Sbjct  272  I  272



>ref|XP_011069667.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
 ref|XP_011069668.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
 ref|XP_011069669.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
Length=305

 Score =   308 bits (789),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 184/234 (79%), Gaps = 4/234 (2%)
 Frame = -2

Query  1216  PAGLLRSLSGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKR  1037
             P  L  +L G   ++ +S+KQ +  +  P F A RRFST+IL PDS +G FPS LL+ KR
Sbjct  22    PFSLSNALHGHGFTDSSSSKQSSVLRKAP-FDAYRRFSTTILTPDSSEGSFPSHLLSSKR  80

Query  1036  VLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGT  857
             VLT DRE+GLYQDLV+PVTNF NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGT
Sbjct  81    VLTPDREIGLYQDLVIPVTNFHNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGT  140

Query  856   HSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCR  677
             HSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV R
Sbjct  141   HSTKTISEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRR  199

Query  676   LGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             LGLK+    +  + GK   F       SHKTKNIV+Y  +MEN KK+LLVDGGP
Sbjct  200   LGLKI-ALSARAAEGKLTVFEDLEVP-SHKTKNIVNYVHQMENTKKLLLVDGGP  251


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL VFED+E+PSH K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  212  EGKLTVFEDLEVPSH-KTKNIVNYVHQMENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  270

Query  459  SI  454
            SI
Sbjct  271  SI  272



>ref|XP_007026181.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 ref|XP_007026182.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 ref|XP_007026183.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28803.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28804.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28805.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
Length=315

 Score =   305 bits (782),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 176/223 (79%), Gaps = 3/223 (1%)
 Frame = -2

Query  1183  TASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLY  1004
             +  N+  A+ F+F+K    F A R+F+T+IL PDS +  FPSDLL+ K VLT DR +GLY
Sbjct  42    SGDNLPHAECFSFSKGGLSFLACRKFATTILTPDSAESAFPSDLLSAKTVLTPDRTIGLY  101

Query  1003  QDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG  824
             QDLV+PVTNF NEDKG MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG
Sbjct  102   QDLVIPVTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG  161

Query  823   TGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSS  644
             TGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+    +S
Sbjct  162   TGRKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALSAS  219

Query  643   CSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              + GK   F       +HKTKNIV+Y  +ME  KK+LLVDGGP
Sbjct  220   AAEGKLLVFEDLEVP-THKTKNIVNYVNQMEKTKKLLLVDGGP  261


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNYVNQMEKTKKLLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  459  SI  454
            SI
Sbjct  281  SI  282



>ref|XP_009758874.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009758875.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Nicotiana 
sylvestris]
Length=309

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 174/220 (79%), Gaps = 3/220 (1%)
 Frame = -2

Query  1174  NVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDL  995
             +V   +   F K+E  F + RR+STSIL PDS DG FPSDLLTKKRV T +RE+GL+QDL
Sbjct  39    DVPCVESSVFRKDESFFLSCRRYSTSILTPDSSDGSFPSDLLTKKRVSTPEREIGLHQDL  98

Query  994   VVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR  815
             V+PVTN  NEDKGFM LAGDVFDVPIRKDIIHRVVRWQLAK QQGTHSTKTISEVSGTGR
Sbjct  99    VIPVTNLHNEDKGFMCLAGDVFDVPIRKDIIHRVVRWQLAKLQQGTHSTKTISEVSGTGR  158

Query  814   KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
             KP+ QKGTGRARHGTLRG QFRGG  MH PKPRSHA IKLNKKV RLGLK+    +  + 
Sbjct  159   KPWRQKGTGRARHGTLRGAQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAE  216

Query  634   GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             GK   F     + SHKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  217   GKLMVFEDLEIS-SHKTKNIVNYFNQLENTKKLLLVDGGP  255


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLMVFED+E+ SH K + +     +    KK  L+    ++E LKLATQN+HY NVLP
Sbjct  216  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNVHYVNVLP  274

Query  459  SI  454
            SI
Sbjct  275  SI  276



>ref|XP_009592582.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009592583.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009592584.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=309

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 172/209 (82%), Gaps = 3/209 (1%)
 Frame = -2

Query  1141  KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNED  962
             K+E  F + RR+ST+IL PDS DG FPSDLLTKKRV TL+RE+GL+QDLV+PVTNF NED
Sbjct  50    KDESFFLSCRRYSTTILTPDSSDGSFPSDLLTKKRVSTLEREIGLHQDLVIPVTNFHNED  109

Query  961   KGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRA  782
             KGFM LAGDVFDVPIRKDIIHRVVR QLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRA
Sbjct  110   KGFMCLAGDVFDVPIRKDIIHRVVRCQLAKRQQGTHSTKTISEVSGTGRKPWRQKGTGRA  169

Query  781   RHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGT  602
             RHGTLRG QFRGG  MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F     
Sbjct  170   RHGTLRGAQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLMVFEDLEI  227

Query  601   TFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             + SHKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  228   S-SHKTKNIVNYFNQLENTKKLLLVDGGP  255


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLMVFED+E+ SH K + +     +    KK  L+    ++E LKLATQN+HY NVLP
Sbjct  216  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNVHYVNVLP  274

Query  459  SI  454
            SI
Sbjct  275  SI  276



>gb|KHG30769.1| 50S ribosomal L4 [Gossypium arboreum]
Length=315

 Score =   303 bits (776),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 179/229 (78%), Gaps = 6/229 (3%)
 Frame = -2

Query  1195  LSGSTA-SNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDR  1019
             LSG  A  N+  A+ F+F+K  P F   RRFST+IL PDS  G FPSDLL+ K VLT +R
Sbjct  37    LSGRIAGDNLLHAECFSFSKGGPSFLGFRRFSTTILTPDSNGGAFPSDLLSSKTVLTPER  96

Query  1018  ELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI  839
              +GLY+DLVVPVTNF NED G MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI
Sbjct  97    TIGLYEDLVVPVTNFHNEDHGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI  156

Query  838   SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  659
             SEVSGTGRKP+ QKG GRARHG+LRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  157   SEVSGTGRKPWQQKGLGRARHGSLRGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLKIA  215

Query  658   CFVSSC-SRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               +S+C + GK   F       +HKTKNIV+Y  +MEN KK+LLVDGGP
Sbjct  216   --LSACAAEGKLLVFEDLEVP-THKTKNIVNYVNQMENTKKLLLVDGGP  261


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNYVNQMENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  459  SI  454
            SI
Sbjct  281  SI  282



>ref|XP_009610537.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=306

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 173/220 (79%), Gaps = 3/220 (1%)
 Frame = -2

Query  1174  NVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDL  995
             +V   +   F K+E  F + RR+STSI+ PDS DG FPS LLTKK V T +RE+GL+QDL
Sbjct  36    DVACVESSVFRKDESFFLSCRRYSTSIMTPDSSDGSFPSYLLTKKCVSTPEREIGLHQDL  95

Query  994   VVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR  815
             V+PV NF NEDKGFM LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR
Sbjct  96    VIPVMNFLNEDKGFMCLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR  155

Query  814   KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
             KP+ QKGTGRARHGTLRG QFRGG  MH PKPRSHA I+LNKKV RLGLK+    +  + 
Sbjct  156   KPWRQKGTGRARHGTLRGAQFRGGATMHGPKPRSHA-IQLNKKVRRLGLKI-ALSARAAE  213

Query  634   GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             GK   F     + SHKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  214   GKLMVFEDLEIS-SHKTKNIVNYFNQLENTKKLLLVDGGP  252


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLMVFED+E+ SH K + +     +    KK  L+    ++E LKLATQN+HY NVLP
Sbjct  213  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNLHYVNVLP  271

Query  459  SI  454
            SI
Sbjct  272  SI  273



>ref|XP_006298209.1| hypothetical protein CARUB_v10014259mg [Capsella rubella]
 gb|EOA31107.1| hypothetical protein CARUB_v10014259mg [Capsella rubella]
Length=303

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 174/226 (77%), Gaps = 8/226 (4%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDREL  1013
             SG+  S++TS  ++  A       + R+ STSIL PDS D  FPSDLLTK  VLT DR +
Sbjct  32    SGNGLSSLTSDLKYGMA-----LLSSRKLSTSILTPDSSDDTFPSDLLTKTTVLTPDRTI  86

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G YQDLV+PVTNF+NEDKG MVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SE
Sbjct  87    GQYQDLVIPVTNFQNEDKGLMVLAGDVFDVPIRKDIIHHVVRWQLAKRQQGTHSTKTLSE  146

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+   
Sbjct  147   VSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-AL  204

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +  + GK   F       +HKTKNIV+Y  +MEN KKVL+V+GGP
Sbjct  205   TARAAEGKLLVFDDLALP-THKTKNIVNYYNQMENTKKVLVVEGGP  249


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N++P
Sbjct  210  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  268

Query  459  SI  454
            SI
Sbjct  269  SI  270



>gb|EYU24034.1| hypothetical protein MIMGU_mgv1a010625mg [Erythranthe guttata]
Length=307

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 3/203 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F   R++ST+IL P+S +G FPS LL+ K VL  +RE+GLYQDLV+PVTNF NEDKGFMV
Sbjct  53    FDVYRKYSTTILTPNSSEGAFPSHLLSSKHVLAPEREIGLYQDLVIPVTNFANEDKGFMV  112

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTK +SEVSGTGRKP+PQKGTGRARHGTL
Sbjct  113   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKNLSEVSGTGRKPWPQKGTGRARHGTL  172

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG AMH P+PRSHA IKLNKKV RLGLK+    +  + GK   F       SHK
Sbjct  173   RGPQFRGGCAMHGPRPRSHA-IKLNKKVRRLGLKV-ALSARAAEGKLLIFDDMEVP-SHK  229

Query  586   TKNIVSYGQKMENAKKVLLVDGG  518
             TKNIV+Y  +ME+AKK+LLVDGG
Sbjct  230   TKNIVNYANQMEDAKKLLLVDGG  252


 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLL-MVALNENLKLATQNIHYGNVLP  460
            EGKL++F+DME+PSH K + +   A +    KK  L+   ++NE LKLATQN+HY NVLP
Sbjct  214  EGKLLIFDDMEVPSH-KTKNIVNYANQMEDAKKLLLVDGGSINEKLKLATQNVHYVNVLP  272

Query  459  SI  454
            +I
Sbjct  273  AI  274



>ref|XP_010553457.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X2 [Tarenaya hassleriana]
Length=298

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 172/232 (74%), Gaps = 8/232 (3%)
 Frame = -2

Query  1213  AGLLRSLSGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRV  1034
             A L   +SG   S+++S       K        R+ STS+L PDS DG FPSDLL+KK V
Sbjct  20    ADLFTRVSGDVLSSLSSN-----LKARTALLTHRKLSTSVLTPDSSDGAFPSDLLSKKAV  74

Query  1033  LTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTH  854
             +T DR +GLYQDLV+PVTNF NEDKGFMVL+G VFDVPIRKDIIH VVRWQLAKRQQGTH
Sbjct  75    ITPDRTIGLYQDLVIPVTNFENEDKGFMVLSGGVFDVPIRKDIIHHVVRWQLAKRQQGTH  134

Query  853   STKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRL  674
             STKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RL
Sbjct  135   STKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRL  193

Query  673   GLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
             GLK+    +  + GK   F   G   +HKTKNIV Y  +ME  KK+LLVDG 
Sbjct  194   GLKI-ALTARAAEGKLIVFDDLGVP-THKTKNIVKYYNQMEKTKKLLLVDGA  243


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ +P+H K + +     +    KK  L+  A ++E LKLATQN+HY N+LP
Sbjct  205  EGKLIVFDDLGVPTH-KTKNIVKYYNQMEKTKKLLLVDGASIDEKLKLATQNLHYVNILP  263

Query  459  SI  454
            SI
Sbjct  264  SI  265



>ref|XP_010553456.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X1 [Tarenaya hassleriana]
Length=299

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 173/232 (75%), Gaps = 7/232 (3%)
 Frame = -2

Query  1213  AGLLRSLSGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRV  1034
             A L   +SG   S+++S  + A           R+ STS+L PDS DG FPSDLL+KK V
Sbjct  20    ADLFTRVSGDVLSSLSSNLKQA----RTALLTHRKLSTSVLTPDSSDGAFPSDLLSKKAV  75

Query  1033  LTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTH  854
             +T DR +GLYQDLV+PVTNF NEDKGFMVL+G VFDVPIRKDIIH VVRWQLAKRQQGTH
Sbjct  76    ITPDRTIGLYQDLVIPVTNFENEDKGFMVLSGGVFDVPIRKDIIHHVVRWQLAKRQQGTH  135

Query  853   STKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRL  674
             STKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RL
Sbjct  136   STKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRL  194

Query  673   GLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
             GLK+    +  + GK   F   G   +HKTKNIV Y  +ME  KK+LLVDG 
Sbjct  195   GLKI-ALTARAAEGKLIVFDDLGVP-THKTKNIVKYYNQMEKTKKLLLVDGA  244


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ +P+H K + +     +    KK  L+  A ++E LKLATQN+HY N+LP
Sbjct  206  EGKLIVFDDLGVPTH-KTKNIVKYYNQMEKTKKLLLVDGASIDEKLKLATQNLHYVNILP  264

Query  459  SI  454
            SI
Sbjct  265  SI  266



>ref|XP_010533789.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Tarenaya 
hassleriana]
Length=303

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
                 R+ ST+IL PDS DG FPSDLL KK V+T DR +GLYQDLV+P+TNF+NEDKGFMV
Sbjct  49    LLTYRKLSTTILTPDSSDGPFPSDLLAKKTVITPDRTIGLYQDLVIPMTNFQNEDKGFMV  108

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  109   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTL  168

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       +HK
Sbjct  169   RGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALTARAAEGKLIVFDDLELQ-THK  225

Query  586   TKNIVSYGQKMENAKKVLLVDGG  518
             TKNIV +  +MEN KK+LLVDG 
Sbjct  226   TKNIVKFYNQMENTKKLLLVDGA  248


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+EL +H K + +     +    KK  L+  A ++E LKL+TQN+HY +VLP
Sbjct  210  EGKLIVFDDLELQTH-KTKNIVKFYNQMENTKKLLLVDGASIDEKLKLSTQNLHYVDVLP  268

Query  459  SI  454
            SI
Sbjct  269  SI  270



>ref|XP_006383860.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
 gb|ERP61657.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
Length=317

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = -2

Query  1165  SAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVP  986
             SA+  +F K      A RR STS +  +S DG FPSDLL+ K V+T  RE+GLYQDLV+P
Sbjct  50    SAESSSFIKGAVSSLAHRRLSTSNVTSESTDGSFPSDLLSAKNVVTPQREIGLYQDLVIP  109

Query  985   VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
             VTNF NEDKG MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY
Sbjct  110   VTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  169

Query  805   PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
              QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+    +  + GK 
Sbjct  170   RQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHA-FKLNKKVRRLGLKI-ALTARAAEGKL  227

Query  625   HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               F       +HKTKNIV+Y  +MEN KK+L+VDGGP
Sbjct  228   LVFEDLEVP-THKTKNIVNYVIEMENTKKLLVVDGGP  263


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  ++    +NE LKLATQN+HY N+LP
Sbjct  224  EGKLLVFEDLEVPTH-KTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLP  282

Query  459  SI  454
            SI
Sbjct  283  SI  284



>ref|XP_011046992.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Populus euphratica]
 ref|XP_011046993.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Populus euphratica]
Length=317

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 167/217 (77%), Gaps = 3/217 (1%)
 Frame = -2

Query  1165  SAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVP  986
             SA+  +F K      A RR  TS +  +S DG FPSDLL+ K V+T  RE+GLYQDLV+P
Sbjct  50    SAESSSFIKGAVSSLAHRRLLTSNVTSESNDGSFPSDLLSAKNVVTPQREIGLYQDLVIP  109

Query  985   VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
             VTNF NEDKG MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY
Sbjct  110   VTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  169

Query  805   PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
              QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+    +  + GK 
Sbjct  170   RQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHA-FKLNKKVRRLGLKI-ALSARAAEGKL  227

Query  625   HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               F       SHKTKNIV+Y  +MEN KK+L+VDGGP
Sbjct  228   LVFEDLEVP-SHKTKNIVNYVNEMENTKKLLVVDGGP  263


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +     +    KK  ++    +NE LKLATQN+HY N+LP
Sbjct  224  EGKLLVFEDLEVPSH-KTKNIVNYVNEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLP  282

Query  459  SI  454
            SI
Sbjct  283  SI  284



>gb|KDO78367.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=299

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R+FST+IL PDS +G FPSDLL KK VLT D  +GL+QDLV+PVTNF NEDKGFMV
Sbjct  56    FLASRKFSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQDLVIPVTNFFNEDKGFMV  115

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTL
Sbjct  116   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTL  175

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       SHK
Sbjct  176   RGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-SHK  232

Query  586   TKNIVSYGQKMENAKKVLLVDGG  518
             TK IV+Y  +MEN KKVLL DGG
Sbjct  233   TKFIVNYYNQMENTKKVLLCDGG  255


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +     +    KK  L     ++E LKLATQN+HY NVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  459  SIVSIRTTSVSLMVYTHLSALD  394
            S+V  R+T+ S ++Y +    D
Sbjct  276  SVV--RSTTQSFLIYYYFLDFD  295



>ref|XP_010065410.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Eucalyptus 
grandis]
 gb|KCW62860.1| hypothetical protein EUGRSUZ_G00454 [Eucalyptus grandis]
Length=315

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 178/228 (78%), Gaps = 5/228 (2%)
 Frame = -2

Query  1195  LSGSTASNVTSAKQFAFAKNEPIFFA-LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDR  1019
             L G  +    S  +F+ +  +  FF+  RR STSIL P+ G+ +FPSDLL+KK+V+  DR
Sbjct  38    LRGLISQQSLSTVEFSQSLRDGAFFSGHRRLSTSILTPN-GEADFPSDLLSKKKVIVPDR  96

Query  1018  ELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI  839
             E+GLYQDLV+PVTNF +E+KG MVLAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTI
Sbjct  97    EIGLYQDLVIPVTNFLSEEKGLMVLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTI  156

Query  838   SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  659
             SEVSGTGRKP+ QKGTGRARHG+ RGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  157   SEVSGTGRKPWKQKGTGRARHGSRRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  214

Query  658   CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                +  + GK   F       +HKTKN+V+Y ++MEN KKVLLVDGGP
Sbjct  215   ALTARAAEGKLLIFDDMEIP-THKTKNVVNYVEQMENTKKVLLVDGGP  261


 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++F+DME+P+H K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  222  EGKLLIFDDMEIPTH-KTKNVVNYVEQMENTKKVLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  459  SI  454
            SI
Sbjct  281  SI  282



>gb|KDO78366.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=310

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R+FST+IL PDS +G FPSDLL KK VLT D  +GL+QDLV+PVTNF NEDKGFMV
Sbjct  56    FLASRKFSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQDLVIPVTNFFNEDKGFMV  115

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTL
Sbjct  116   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTL  175

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       SHK
Sbjct  176   RGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-SHK  232

Query  586   TKNIVSYGQKMENAKKVLLVDGG  518
             TK IV+Y  +MEN KKVLL DGG
Sbjct  233   TKFIVNYYNQMENTKKVLLCDGG  255


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +     +    KK  L     ++E LKLATQN+HY NVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  459  SI  454
            S+
Sbjct  276  SV  277



>gb|KDP20700.1| hypothetical protein JCGZ_21171 [Jatropha curcas]
Length=315

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 169/216 (78%), Gaps = 3/216 (1%)
 Frame = -2

Query  1162  AKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPV  983
             A+  +F K E      R FSTSIL P S DG FPSDLL+ K VLT +R +GLYQDLV+PV
Sbjct  49    AESSSFIKGEAASLPYRSFSTSILTPGSSDGAFPSDLLSTKAVLTPERNIGLYQDLVIPV  108

Query  982   TNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYP  803
             TNF NEDKGFMVLAGDVFDVPI+K I+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 
Sbjct  109   TNFLNEDKGFMVLAGDVFDVPIKKHIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYR  168

Query  802   QKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAH  623
             QKGTGRARHGTLRGPQFRGG AMH PKPRSHA IK NKKV RLGLK+    +  + GK  
Sbjct  169   QKGTGRARHGTLRGPQFRGGAAMHGPKPRSHA-IKCNKKVRRLGLKI-ALTARAAEGKLL  226

Query  622   GF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              F       +HKTKNIV+  ++ME+ KK+L+VDGGP
Sbjct  227   VFEDLEVP-THKTKNIVNCVKQMEDTKKLLVVDGGP  261


 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +    ++    KK  ++    +NE LKLATQN+HY NVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNCVKQMEDTKKLLVVDGGPINEKLKLATQNLHYVNVLP  280

Query  459  SI  454
            SI
Sbjct  281  SI  282



>ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus communis]
 gb|EEF43809.1| 50S ribosomal protein L4, putative [Ricinus communis]
Length=294

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 169/217 (78%), Gaps = 3/217 (1%)
 Frame = -2

Query  1165  SAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVP  986
             S +  +F KN     A R+ STSIL P S D  FPSDLL+ K +LT +RE+GL++DLV+P
Sbjct  27    SHESSSFIKNGAASLACRKLSTSILTPGSSDDAFPSDLLSTKTLLTPEREIGLHEDLVIP  86

Query  985   VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
             VTNF NEDKGFMVLAGDVFDVPI+K IIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KPY
Sbjct  87    VTNFLNEDKGFMVLAGDVFDVPIKKHIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPY  146

Query  805   PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
              QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK NKKV RLGLK+    +  + GK 
Sbjct  147   RQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKCNKKVRRLGLKI-ALTARAAEGKL  204

Query  625   HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               F       +HKTKNIV+Y ++ME  KK+LLVDGGP
Sbjct  205   LVFEDLEIP-THKTKNIVNYVKQMEETKKLLLVDGGP  240


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +    ++    KK  L+    +NE LKLA QN+HY NVLP
Sbjct  201  EGKLLVFEDLEIPTH-KTKNIVNYVKQMEETKKLLLVDGGPINEKLKLAAQNLHYVNVLP  259

Query  459  SI  454
            SI
Sbjct  260  SI  261



>ref|XP_006467374.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Citrus 
sinensis]
Length=310

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 164/203 (81%), Gaps = 3/203 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R+FST+IL PDS +G FPSDLL KK VLT D  +GL+QDLV+PVTNF NEDKGFMV
Sbjct  56    FLASRKFSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQDLVIPVTNFFNEDKGFMV  115

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTL
Sbjct  116   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTL  175

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       SHK
Sbjct  176   RGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-SHK  232

Query  586   TKNIVSYGQKMENAKKVLLVDGG  518
             TK IV+Y  +MEN KKVLL DGG
Sbjct  233   TKFIVNYYNQMENTKKVLLCDGG  255


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +     +    KK  L     ++E LKLATQN+HY NVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  459  SI  454
            S+
Sbjct  276  SV  277



>ref|XP_004134779.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus]
 ref|XP_004172499.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus]
 gb|KGN49080.1| hypothetical protein Csa_6G513440 [Cucumis sativus]
Length=315

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R F TSIL P+S +  FPS+LL+ K V + +R++GLYQDL++PVTNF NEDKGFMV
Sbjct  61    FLASRGFCTSILTPESSNNAFPSELLSAKPVASEERKIGLYQDLMIPVTNFENEDKGFMV  120

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  121   LAGDVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWKQKGTGRARHGTL  180

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSHA  KLNKKV RLGL +    +  + GK   F     T +HK
Sbjct  181   RGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLMI-ALSARVAEGKLLVFDNLDVT-THK  237

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKN+V Y  KMEN KKVLLVDGGP
Sbjct  238   TKNMVKYVSKMENTKKVLLVDGGP  261



>ref|NP_565463.1| large subunit ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAL62411.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAD24390.2| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAN72167.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AEC06960.1| large subunit ribosomal protein L4 [Arabidopsis thaliana]
Length=300

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 175/226 (77%), Gaps = 11/226 (5%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDREL  1013
             SG+  +++T+  ++  A       + R+ STSIL PD     FPSDLLTKK VLT DR +
Sbjct  32    SGNGLASLTNDLKYGMA-----LLSNRKLSTSILTPDD---SFPSDLLTKKTVLTPDRTI  83

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G YQDLV+PVTNF+NE+KGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SE
Sbjct  84    GQYQDLVIPVTNFQNEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSE  143

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+   
Sbjct  144   VSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-AL  201

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +  + GK   F   G   +HKTKNIV+Y  +MEN KKVL+V+GGP
Sbjct  202   TARAAEGKLLVFDDLGLP-THKTKNIVNYYNQMENTKKVLVVEGGP  246


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N++P
Sbjct  207  EGKLLVFDDLGLPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  265

Query  459  SI  454
            SI
Sbjct  266  SI  267



>gb|AAM62769.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
Length=300

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 175/226 (77%), Gaps = 11/226 (5%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDREL  1013
             SG+  +++T+  ++  A       + R+ STSIL PD     FPSDLLTKK VLT DR +
Sbjct  32    SGNGLASLTNDLKYGMA-----LLSNRKLSTSILTPDD---SFPSDLLTKKTVLTPDRTI  83

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G YQDLV+PVTNF+NE+KGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SE
Sbjct  84    GQYQDLVIPVTNFQNEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSE  143

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+   
Sbjct  144   VSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-AL  201

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +  + GK   F   G   +HKTKNIV+Y  +MEN KKVL+V+GGP
Sbjct  202   TARAAEGKLLVFDDLGLP-THKTKNIVNYYNQMENTKKVLVVEGGP  246


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N++P
Sbjct  207  EGKLLVFDDLGLPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  265

Query  459  SI  454
            SI
Sbjct  266  SI  267



>ref|XP_010502936.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
 ref|XP_010502937.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=301

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 6/228 (3%)
 Frame = -2

Query  1198  SLSGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDR  1019
             +L  +T+ N  ++      KN    F+ R+FSTSIL PD     FPSDLLT+K VLT DR
Sbjct  26    NLPVNTSGNGLASLTSDHLKNGMALFSNRKFSTSILTPDD---TFPSDLLTQKTVLTPDR  82

Query  1018  ELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI  839
              +G YQDLV+PVTNF+NEDKGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+
Sbjct  83    TIGQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTL  142

Query  838   SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  659
             SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  143   SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  200

Query  658   CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                +  + GK   F       +HKTKNIV+Y  +ME  KKVL+V+GGP
Sbjct  201   ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVVEGGP  247


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VF+D+ LP+H     +    +  +  K   +    ++E LKLATQN+HY N++PS
Sbjct  208  EGKLLVFDDLALPTHKTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIPS  267

Query  456  I  454
            I
Sbjct  268  I  268



>ref|XP_008440040.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Cucumis melo]
Length=331

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R F +SIL P+S +  FPS+LL+ K V + +R++GLYQDL++PVTNF+NEDKGFM+
Sbjct  77    FLASRGFCSSILTPESSNNAFPSELLSAKPVASEERKIGLYQDLMIPVTNFQNEDKGFML  136

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  137   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWKQKGTGRARHGTL  196

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSHA  KLNKKV RLGL +    +  + GK   F     T +HK
Sbjct  197   RGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLMI-ALSARVAEGKLLVFDNLDVT-THK  253

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV Y   MEN KKVLLVDGGP
Sbjct  254   TKNIVKYVNTMENTKKVLLVDGGP  277



>gb|EYU36343.1| hypothetical protein MIMGU_mgv1a010848mg [Erythranthe guttata]
Length=300

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -2

Query  1129  IFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFM  950
             +F   RR+ST+IL  +S +G FPS     K VL  DR+LGLYQDLV+PVTNF NEDKGFM
Sbjct  50    VFDVCRRYSTTILTLNSSEGTFPS-----KDVLVPDRKLGLYQDLVIPVTNFSNEDKGFM  104

Query  949   VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGT  770
             VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTK +SEVSGTGRKP+PQKGTGRARHGT
Sbjct  105   VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKNLSEVSGTGRKPWPQKGTGRARHGT  164

Query  769   LRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSH  590
             LRGPQFRGG  MH P+PRSHA IKLNKKV RLGLK+    +  + GK   F       SH
Sbjct  165   LRGPQFRGGCTMHGPRPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLMIFDDLEVP-SH  221

Query  589   KTKNIVSYGQKMENAKKVLLVDGGP  515
             KTKNIV+Y ++ME+AKK+LLVDGGP
Sbjct  222   KTKNIVNYAKQMEDAKKLLLVDGGP  246


 Score = 63.5 bits (153),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLM+F+D+E+PSH K + +   A++    KK  L+    LNE LKLATQN+HY NVLP
Sbjct  207  EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  265

Query  459  SI  454
            SI
Sbjct  266  SI  267



>gb|EYU36344.1| hypothetical protein MIMGU_mgv1a010848mg [Erythranthe guttata]
Length=299

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -2

Query  1129  IFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFM  950
             +F   RR+ST+IL  +S +G FPS     K VL  DR+LGLYQDLV+PVTNF NEDKGFM
Sbjct  49    VFDVCRRYSTTILTLNSSEGTFPS-----KDVLVPDRKLGLYQDLVIPVTNFSNEDKGFM  103

Query  949   VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGT  770
             VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTK +SEVSGTGRKP+PQKGTGRARHGT
Sbjct  104   VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKNLSEVSGTGRKPWPQKGTGRARHGT  163

Query  769   LRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSH  590
             LRGPQFRGG  MH P+PRSHA IKLNKKV RLGLK+    +  + GK   F       SH
Sbjct  164   LRGPQFRGGCTMHGPRPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLMIFDDLEVP-SH  220

Query  589   KTKNIVSYGQKMENAKKVLLVDGGP  515
             KTKNIV+Y ++ME+AKK+LLVDGGP
Sbjct  221   KTKNIVNYAKQMEDAKKLLLVDGGP  245


 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLM+F+D+E+PSH K + +   A++    KK  L+    LNE LKLATQN+HY NVLP
Sbjct  206  EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  264

Query  459  SI  454
            SI
Sbjct  265  SI  266



>ref|XP_002886003.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62262.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
Length=297

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 173/226 (77%), Gaps = 11/226 (5%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDREL  1013
             SG+  S++TS  ++  A       + R+ ST IL PD     FPSDLLTKK VLT DR +
Sbjct  29    SGNGLSSLTSDLKYGMA-----LLSNRKLSTCILTPDD---TFPSDLLTKKTVLTPDRTI  80

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G YQDLV+PVTNF++E+KGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SE
Sbjct  81    GQYQDLVIPVTNFQSEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSE  140

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+   
Sbjct  141   VSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-AL  198

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +  + GK   F       +HKTKNIV+Y  +MEN KKVL+V+GGP
Sbjct  199   TARAAEGKLLVFDDLALP-THKTKNIVNYYNQMENTKKVLVVEGGP  243


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N++P
Sbjct  204  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  262

Query  459  SI  454
            SI
Sbjct  263  SI  264



>ref|XP_010456595.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=299

 Score =   281 bits (720),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 166/210 (79%), Gaps = 6/210 (3%)
 Frame = -2

Query  1141  KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKR-VLTLDRELGLYQDLVVPVTNFRNE  965
             KN    F+ R+ STSIL PD  D  FPSDLLT+K  VLT DR +G YQDLV+PVTNF+NE
Sbjct  41    KNGMALFSNRKLSTSILPPD--DDTFPSDLLTQKTTVLTPDRTIGQYQDLVIPVTNFQNE  98

Query  964   DKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGR  785
             DKGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SEVSGTGRKP+ QKGTGR
Sbjct  99    DKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSEVSGTGRKPWNQKGTGR  158

Query  784   ARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYG  605
             ARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+    +  + GK   F    
Sbjct  159   ARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-ALTARAAEGKLLVFDDLA  216

Query  604   TTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                +HKTKNIV+Y  +ME  KKVL+V+GGP
Sbjct  217   LP-THKTKNIVNYYNQMEKTKKVLVVEGGP  245


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VF+D+ LP+H     +    +  +  K   +    ++E LKLATQN+HY N++PS
Sbjct  206  EGKLLVFDDLALPTHKTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIPS  265

Query  456  I  454
            I
Sbjct  266  I  266



>emb|CDY13887.1| BnaA09g43890D [Brassica napus]
Length=288

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 161/200 (81%), Gaps = 6/200 (3%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGD  935
             R+ STSIL PD     FP DLL KK+V+T DR +G YQDLV+PVTNF+NEDKGFMVLAGD
Sbjct  41    RKHSTSILTPDD---NFPYDLLAKKKVITPDRTIGQYQDLVIPVTNFQNEDKGFMVLAGD  97

Query  934   VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQ  755
             VFDVPIRKDIIH VVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQ
Sbjct  98    VFDVPIRKDIIHHVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQ  157

Query  754   FRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNI  575
             FRGG  MH PKPRSHA IK+NK+V RLGLK+    +  + GK   F       +HKTKNI
Sbjct  158   FRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-ALSARAAEGKLVVFDDMALP-THKTKNI  214

Query  574   VSYGQKMENAKKVLLVDGGP  515
             V+Y  +MEN KKVL+V+GGP
Sbjct  215   VNYYNQMENTKKVLVVEGGP  234


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+DM LP+H K + +     +    KK  ++    ++E LKLATQN+HY N+LP
Sbjct  195  EGKLVVFDDMALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  253

Query  459  SI  454
            SI
Sbjct  254  SI  255



>ref|XP_004293324.1| PREDICTED: 50S ribosomal protein L4-like [Fragaria vesca subsp. 
vesca]
Length=307

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 151/234 (65%), Positives = 171/234 (73%), Gaps = 5/234 (2%)
 Frame = -2

Query  1216  PAGLLRSLSGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKR  1037
             P+ L  SL  S     +     A  K     FA RR ST  L P+S  G FPSDLL++K 
Sbjct  25    PSILYPSLRASHGVISSYEDSSAVIKGVSSSFAYRRLST--LTPESSGGAFPSDLLSQKP  82

Query  1036  VLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGT  857
             V+  + ++G YQDLV+PVTNF NEDKG MVL GDVFDVPIRKDI+HRVV WQLAKRQQGT
Sbjct  83    VVASEHKIGNYQDLVIPVTNFHNEDKGLMVLPGDVFDVPIRKDIVHRVVLWQLAKRQQGT  142

Query  856   HSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCR  677
             HSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV R
Sbjct  143   HSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRR  201

Query  676   LGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             LGLK+    +  + GK   F       +HKTKNIV+Y ++MENAKKVL+VDGGP
Sbjct  202   LGLKV-ALTARAAEGKLLVFEDLEVP-THKTKNIVNYVKQMENAKKVLVVDGGP  253


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +    ++    KK  ++    +++NLKLATQNIHY NVLP
Sbjct  214  EGKLLVFEDLEVPTH-KTKNIVNYVKQMENAKKVLVVDGGPISDNLKLATQNIHYVNVLP  272

Query  459  SI  454
            SI
Sbjct  273  SI  274



>ref|XP_008231665.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Prunus 
mume]
Length=307

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 175/233 (75%), Gaps = 6/233 (3%)
 Frame = -2

Query  1216  PAGLLRSLSGSTASNVTSAKQF-AFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKK  1040
             P+ L  SL  S    V S ++F A +K    F A RR STSI +P+S  G FPS+LL+ K
Sbjct  25    PSSLYPSLHASLG--VVSPEEFSAVSKAGSSFLANRRLSTSIPSPESSGGAFPSNLLSAK  82

Query  1039  RVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQG  860
              V+  +R +GLYQDLV+PVTNF NEDKGF VLAGDVFDVPIRKDIIHRVV WQLAKRQQG
Sbjct  83    PVVASERNIGLYQDLVIPVTNFHNEDKGFTVLAGDVFDVPIRKDIIHRVVLWQLAKRQQG  142

Query  859   THSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVC  680
             THSTKTISEVSGTGRKP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV 
Sbjct  143   THSTKTISEVSGTGRKPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVR  201

Query  679   RLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
             RLGLK+    +  + GK   F  +    +HKTKNI +Y Q+ME++KK+LLVDG
Sbjct  202   RLGLKI-ALTARAAEGKLLIFDDFEVP-THKTKNIANYVQQMEDSKKLLLVDG  252


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL++F+D E+P+H K + +    ++    KK  L+   L E LKLATQN+HY NVLP+
Sbjct  215  EGKLLIFDDFEVPTH-KTKNIANYVQQMEDSKKLLLVDGFLPEKLKLATQNLHYVNVLPA  273

Query  456  I  454
            +
Sbjct  274  V  274



>ref|XP_006383859.1| ribosomal protein L4 [Populus trichocarpa]
 gb|ERP61656.1| ribosomal protein L4 [Populus trichocarpa]
Length=285

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 159/204 (78%), Gaps = 6/204 (3%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGD  935
             R+ STS +  +S DG FPSDLL+ K V+T  RE+GLYQDLV+PVTNF NEDKG MVLAGD
Sbjct  30    RQLSTSNVTSESTDGSFPSDLLSAKNVVTPQREIGLYQDLVIPVTNFHNEDKGLMVLAGD  89

Query  934   VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQ  755
             VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRGPQ
Sbjct  90    VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYRQKGTGRARHGTLRGPQ  149

Query  754   FRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD----CFVSSCSRGKAHGF*GYGTTFSHK  587
             FRGG  MH PKPRSHA  KLNKKV RLGLK+       +      +   F       +HK
Sbjct  150   FRGGAVMHGPKPRSHA-FKLNKKVRRLGLKIALTAPIILIEFLNAQLLVFEDLEVP-THK  207

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV+Y  +MEN KK+L+VDGGP
Sbjct  208   TKNIVNYVIEMENTKKLLVVDGGP  231



>ref|XP_006408921.1| hypothetical protein EUTSA_v10002043mg [Eutrema salsugineum]
 gb|ESQ50374.1| hypothetical protein EUTSA_v10002043mg [Eutrema salsugineum]
Length=320

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
               + R+ STSIL PDS D  FP  LLTKK V+T DR +G YQDLV+PVTNF+NEDKGFMV
Sbjct  66    LLSNRKLSTSILTPDSSDDSFPCGLLTKKTVITPDRTIGQYQDLVIPVTNFQNEDKGFMV  125

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIH VV+WQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  126   LAGDVFDVPIRKDIIHNVVKWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTL  185

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             R  QFRGG  MH PKPRSHA IK+NK+V RLGLK+    +  + GK   F       +HK
Sbjct  186   RSNQFRGGCIMHGPKPRSHA-IKMNKQVRRLGLKI-ALTARAAEGKLIVFDDM-VLPTHK  242

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV+Y  +MEN KKVL+V+GGP
Sbjct  243   TKNIVNYYNQMENTKKVLVVEGGP  266



>emb|CDY31994.1| BnaA07g00010D [Brassica napus]
Length=296

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 162/204 (79%), Gaps = 6/204 (3%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
               + R+ STSIL PD     FP DLL++K V+T DR +G YQDLV+PVTNF+NEDKGFMV
Sbjct  45    LLSNRKLSTSILTPDD---SFPRDLLSQKTVITPDRTIGQYQDLVIPVTNFQNEDKGFMV  101

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVP+RKDIIH VVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  102   LAGDVFDVPVRKDIIHHVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTL  161

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH P+PRSHA IK+NK+V RLGLK+    +  + GK   F       +HK
Sbjct  162   RGPQFRGGCVMHGPRPRSHA-IKMNKQVRRLGLKI-ALTARAAEGKLLVFDDLALP-THK  218

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV+Y  +MEN KKVL+V+GGP
Sbjct  219   TKNIVNYYNQMENTKKVLVVEGGP  242


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N+LP
Sbjct  203  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  261

Query  459  SI  454
            SI
Sbjct  262  SI  263



>ref|XP_009117510.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Brassica 
rapa]
Length=289

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 160/200 (80%), Gaps = 6/200 (3%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGD  935
             R+ STSIL PD     FP DLL KK ++T DR +G YQDLV+PVTNF+NEDKGFMVLAGD
Sbjct  42    RKHSTSILTPDD---NFPYDLLAKKTLITPDRTIGQYQDLVIPVTNFQNEDKGFMVLAGD  98

Query  934   VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQ  755
             VFDVPIRKDIIH VVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQ
Sbjct  99    VFDVPIRKDIIHHVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQ  158

Query  754   FRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNI  575
             FRGG  MH PKPRSHA IK+NK+V RLGLK+    +  + GK   F       +HKTKNI
Sbjct  159   FRGGCVMHGPKPRSHA-IKINKQVRRLGLKI-ALSARAAEGKLLVFDDMALP-THKTKNI  215

Query  574   VSYGQKMENAKKVLLVDGGP  515
             V+Y  +MEN KKVL+V+GGP
Sbjct  216   VNYYNQMENTKKVLVVEGGP  235


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+DM LP+H K + +     +    KK  ++    ++E LKLATQN+HY N+LP
Sbjct  196  EGKLLVFDDMALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  254

Query  459  SI  454
            SI
Sbjct  255  SI  256



>gb|AHA84219.1| 50S ribosomal protein L4 [Phaseolus vulgaris]
Length=313

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 167/217 (77%), Gaps = 3/217 (1%)
 Frame = -2

Query  1165  SAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVP  986
             S ++   A+   +   +R+FSTSIL P   +G FPSDLL+KK + T +R +GL QDL++P
Sbjct  46    SGERLLSAEYSLVRSMIRQFSTSILTPGPDEGAFPSDLLSKKTLATSERTIGLCQDLLIP  105

Query  985   VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
             VTNF NEDKGFMVL GDVFD+PIRKDIIHRVVRWQLAKRQQGTH TKTISEVSGTGRKP+
Sbjct  106   VTNFHNEDKGFMVLHGDVFDLPIRKDIIHRVVRWQLAKRQQGTHCTKTISEVSGTGRKPW  165

Query  805   PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
              QKGTG+ARHGTLRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+    +  + GK 
Sbjct  166   NQKGTGKARHGTLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-ALSARAAEGKL  223

Query  625   HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               F       +HKTKNIV+Y  +MEN KK+LLVDGGP
Sbjct  224   LIFEDLEVP-THKTKNIVNYYNQMENTKKLLLVDGGP  259


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++FED+E+P+H K + +     +    KK  L+    ++E LKL+TQN+HY N+LP
Sbjct  220  EGKLLIFEDLEVPTH-KTKNIVNYYNQMENTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  459  SI  454
            +I
Sbjct  279  AI  280



>emb|CDY05720.1| BnaC07g00830D [Brassica napus]
Length=292

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 175/236 (74%), Gaps = 11/236 (5%)
 Frame = -2

Query  1207  LLRSLSGSTA---SNVTSAKQFAFA--KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTK  1043
             +LR+    TA   SN T+A    ++  K      + R+ STSIL PD     FP DLL++
Sbjct  9     VLRTFGSFTALGRSNATNASGNGYSDLKCGMGLLSNRKLSTSILTPDD---SFPHDLLSQ  65

Query  1042  KRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQ  863
             K V+T DR +G YQDLV+PVTNF+NEDKGFMVLAGDVFDVP+RKDIIH VVRWQLAKRQQ
Sbjct  66    KTVITPDRTIGQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPVRKDIIHHVVRWQLAKRQQ  125

Query  862   GTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKV  683
             GTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH P+PRSHA IK+NK+V
Sbjct  126   GTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPRPRSHA-IKMNKQV  184

Query  682   CRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              RLGLK+    +  + GK   F       +HKTKNIV+Y  +ME  KKVL+V+GGP
Sbjct  185   RRLGLKI-ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMETTKKVLVVEGGP  238


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ LP+H K + +     +    KK  ++    ++E LKLATQN+HY N+LP
Sbjct  199  EGKLLVFDDLALPTH-KTKNIVNYYNQMETTKKVLVVEGGPIDEKLKLATQNLHYVNILP  257

Query  459  SI  454
            SI
Sbjct  258  SI  259



>gb|EPS72544.1| hypothetical protein M569_02212, partial [Genlisea aurea]
Length=295

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 168/218 (77%), Gaps = 8/218 (4%)
 Frame = -2

Query  1156  QFAFAKNEP----IFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVV  989
             QF   +N P    +F   R +ST++L P+  +G+ P  LL+ ++VLT DR++GLYQDLV+
Sbjct  28    QFCL-RNAPRENFLFGIFRLYSTTVLTPNPDEGKIPPHLLSTRQVLTPDRKIGLYQDLVI  86

Query  988   PVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
             PVTNFR E++GFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP
Sbjct  87    PVTNFRFENRGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  146

Query  808   YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
             + QKGTGRARHGTLRGPQFRGG   H PKPRSHA  KLNKKV RLGLK+    +  + GK
Sbjct  147   WRQKGTGRARHGTLRGPQFRGGATKHGPKPRSHA-FKLNKKVRRLGLKI-ALTARAAEGK  204

Query  628   AHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                        SHKTKNIV+Y  +ME +KK+LLVDGGP
Sbjct  205   LLVLEDLEVP-SHKTKNIVNYANQMEGSKKLLLVDGGP  241


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+V ED+E+PSH K + +   A +    KK  L+    + ENLKLATQN+HY NVLP
Sbjct  202  EGKLLVLEDLEVPSH-KTKNIVNYANQMEGSKKLLLVDGGPIKENLKLATQNLHYVNVLP  260

Query  459  SI  454
            SI
Sbjct  261  SI  262



>ref|XP_007147686.1| hypothetical protein PHAVU_006G146000g [Phaseolus vulgaris]
 gb|ESW19680.1| hypothetical protein PHAVU_006G146000g [Phaseolus vulgaris]
Length=313

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 160/201 (80%), Gaps = 3/201 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +R+FSTSIL P   +G FPSDLL+KK +   +R +GL QDL++PVTNF NEDKGFMVL G
Sbjct  62    IRQFSTSILTPGPDEGAFPSDLLSKKTLAASERTIGLCQDLLIPVTNFHNEDKGFMVLHG  121

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTH TKTISEVSGTGRKP+ QKGTG+ARHGTLRGP
Sbjct  122   DVFDLPIRKDIIHRVVRWQLAKRQQGTHCTKTISEVSGTGRKPWNQKGTGKARHGTLRGP  181

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
             QFRGG  MH PKPRSHA  K+NKKV RLGLK+    +  + GK   F       +HKTKN
Sbjct  182   QFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-ALSARAAEGKLLIFEDLEVP-THKTKN  238

Query  577   IVSYGQKMENAKKVLLVDGGP  515
             IV+Y  +MEN KK+LLVDGGP
Sbjct  239   IVNYYNQMENTKKLLLVDGGP  259


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++FED+E+P+H K + +     +    KK  L+    ++E LKL+TQN+HY N+LP
Sbjct  220  EGKLLIFEDLEVPTH-KTKNIVNYYNQMENTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  459  SI  454
            +I
Sbjct  279  AI  280



>ref|XP_007134426.1| hypothetical protein PHAVU_010G046600g [Phaseolus vulgaris]
 gb|ESW06420.1| hypothetical protein PHAVU_010G046600g [Phaseolus vulgaris]
Length=313

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 161/201 (80%), Gaps = 3/201 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +R+FSTSIL P S +G FPSDLL+K  + T +R +GL QDL++PVTNF NE+KGFMVL G
Sbjct  62    IRQFSTSILTPGSDEGAFPSDLLSKNTLATSERTIGLCQDLLIPVTNFHNENKGFMVLPG  121

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTG+ARHGTLRGP
Sbjct  122   DVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGKARHGTLRGP  181

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
             QFRGG  MH PKPRSHA  K+NKKV RLGLK+    +  + GK   F       +HKTKN
Sbjct  182   QFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-THKTKN  238

Query  577   IVSYGQKMENAKKVLLVDGGP  515
             +V+Y  +ME  KK+LLVDGGP
Sbjct  239   MVNYYNQMEKTKKLLLVDGGP  259


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  L+    ++E LKL+TQN+HY N+LP
Sbjct  220  EGKLLVFEDLEVPTH-KTKNMVNYYNQMEKTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  459  SI  454
            SI
Sbjct  279  SI  280



>ref|XP_003634850.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 ref|XP_010645348.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 ref|XP_010645350.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 emb|CBI32995.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -2

Query  1105  STSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFD  926
             +T+IL P+S    FP +LL+ K VLT +R  G YQDLV+PVTNF NEDKGFMVLAGDVFD
Sbjct  68    TTTILTPESSGVAFPPELLSTKTVLTPERTPGHYQDLVIPVTNFHNEDKGFMVLAGDVFD  127

Query  925   VPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRG  746
             VPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRG
Sbjct  128   VPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWRQKGTGRARHGTLRGPQFRG  187

Query  745   GTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSY  566
             G  MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       SHKTKNIV+Y
Sbjct  188   GAIMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARTAEGKLLVFDDLEVP-SHKTKNIVNY  244

Query  565   GQKMENAKKVLLVDGGP  515
              ++MEN KK+LLVDGGP
Sbjct  245   VKEMENTKKLLLVDGGP  261


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+E+PSH K + +    ++    KK  L+    + E LKLATQN+HY NVLP
Sbjct  222  EGKLLVFDDLEVPSH-KTKNIVNYVKEMENTKKLLLVDGGPITEKLKLATQNLHYVNVLP  280

Query  459  SI  454
            SI
Sbjct  281  SI  282



>ref|XP_010099157.1| 50S ribosomal protein L4 [Morus notabilis]
 gb|EXB77029.1| 50S ribosomal protein L4 [Morus notabilis]
Length=297

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 161/220 (73%), Gaps = 22/220 (10%)
 Frame = -2

Query  1174  NVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDL  995
             ++ SA      K    F + R+ ST +L P+S +G FPSDLL+ K V+  DRE+GLYQD+
Sbjct  46    SLLSADSSGILKGGSSFLSHRKLST-VLTPESSEGVFPSDLLSAKPVVAADREIGLYQDM  104

Query  994   VVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR  815
             V+PVTNF NEDKGFMVLAGDVFDVPIRKDIIHRVV WQLAKRQQGTHSTKTISEVSGTGR
Sbjct  105   VIPVTNFHNEDKGFMVLAGDVFDVPIRKDIIHRVVLWQLAKRQQGTHSTKTISEVSGTGR  164

Query  814   KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
             KP+PQKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKK+       D  V +   
Sbjct  165   KPWPQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKLLVFE---DLEVPT---  217

Query  634   GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                           HKTKNIV+Y  +MEN KK+LLVDG P
Sbjct  218   --------------HKTKNIVNYVSQMENTKKLLLVDGSP  243


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  630  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLPSI  454
            KL+VFED+E+P+H K + +     +    KK  L+  + + E LKLATQN+HY NVLPSI
Sbjct  206  KLLVFEDLEVPTH-KTKNIVNYVSQMENTKKLLLVDGSPIGEKLKLATQNLHYVNVLPSI  264



>ref|XP_010252520.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252521.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252523.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252524.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
Length=314

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 161/212 (76%), Gaps = 3/212 (1%)
 Frame = -2

Query  1150  AFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFR  971
             +  K  P F   R  STS+L P + +G  P +LL+KK VLT DR  G Y+DL++PVTNF 
Sbjct  52    SLCKIGPSFLTGRSISTSVLTPQAYEGAIPPELLSKKIVLTPDRTQGCYEDLIIPVTNFH  111

Query  970   NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGT  791
             NEDKGFMVLAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGT
Sbjct  112   NEDKGFMVLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGT  171

Query  790   GRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*G  611
             GRARHGTLRGPQFR G  MH PKPR+HA IKL KKV RLGLK+    +    GK   F  
Sbjct  172   GRARHGTLRGPQFRHGATMHGPKPRTHA-IKLQKKVRRLGLKI-ALSARIVEGKLLVFED  229

Query  610   YGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                  +HKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  230   LEVP-THKTKNIVNYVSQIENTKKLLLVDGGP  260


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  221  EGKLLVFEDLEVPTH-KTKNIVNYVSQIENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  279

Query  459  SI  454
            SI
Sbjct  280  SI  281



>emb|CAN77922.1| hypothetical protein VITISV_027648 [Vitis vinifera]
Length=278

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 158/197 (80%), Gaps = 3/197 (2%)
 Frame = -2

Query  1105  STSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFD  926
             +T++L P+S    FP +LL+ K VLT +R  G YQDLV+PVTNF NEDKGFM LAGDVFD
Sbjct  31    TTTMLTPESSGVAFPPELLSTKTVLTPERTPGHYQDLVIPVTNFHNEDKGFMXLAGDVFD  90

Query  925   VPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRG  746
             VPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTLRGPQFRG
Sbjct  91    VPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTLRGPQFRG  150

Query  745   GTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSY  566
             G  MH PKPRSHA IKLNKKV RLGLK+    +  + GK   F       SHKTKNIV+Y
Sbjct  151   GAIMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARTAEGKLLVFDDLEVP-SHKTKNIVNY  207

Query  565   GQKMENAKKVLLVDGGP  515
              ++MEN KK+LLVDGGP
Sbjct  208   VKEMENXKKLLLVDGGP  224


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+E+PSH K + +    ++    KK  L+    + E LKLATQN+HY NVLP
Sbjct  185  EGKLLVFDDLEVPSH-KTKNIVNYVKEMENXKKLLLVDGGPITEKLKLATQNLHYVNVLP  243

Query  459  SI  454
            SI
Sbjct  244  SI  245



>ref|XP_010514578.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
 ref|XP_010514579.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=295

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 169/226 (75%), Gaps = 16/226 (7%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDREL  1013
             SG+  +++TS+      KN    F+ R+ STSIL PD     FPSDLLT       DR +
Sbjct  32    SGNGLASLTSSD----LKNGMALFSNRKLSTSILTPDD---TFPSDLLTP------DRTI  78

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G YQDLV+PVTNF+NEDKGFMVLAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKT+SE
Sbjct  79    GQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSE  138

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+   
Sbjct  139   VSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-AL  196

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +  + GK   F       +HKTKNIV+Y  +ME  KKVL+V+GGP
Sbjct  197   TARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVVEGGP  241


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VF+D+ LP+H     +    +  +  K   +    ++E LKLATQN+HY N++PS
Sbjct  202  EGKLLVFDDLALPTHKTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIPS  261

Query  456  I  454
            I
Sbjct  262  I  262



>ref|XP_003534682.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Glycine max]
 gb|KHN40857.1| 50S ribosomal protein L4 [Glycine soja]
Length=310

 Score =   272 bits (695),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 3/204 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +R+FSTSIL P   D  FPSDLL+KK + T +R +GL QDL++PVTNF NEDKG+MVL G
Sbjct  60    VRQFSTSILTPGDDDSAFPSDLLSKKILATSERTIGLCQDLLIPVTNFHNEDKGYMVLPG  119

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG+LRGP
Sbjct  120   DVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGSLRGP  179

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
             QFRGG  MH PKPRSHA  K+NKKV RLGLK+    +  + GK   F       +HKTKN
Sbjct  180   QFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-ALSARAAEGKLLVFEDLAVP-THKTKN  236

Query  577   IVSYGQKMENAKKVLLVDGGPQRK  506
             IV+Y  +ME+ KK+LLVDG    K
Sbjct  237   IVNYYNQMEDTKKLLLVDGAIDEK  260


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VFED+ +P+H K + +     +    KK  L+  A++E LKL+TQN+HY NVLPS
Sbjct  218  EGKLLVFEDLAVPTH-KTKNIVNYYNQMEDTKKLLLVDGAIDEKLKLSTQNLHYVNVLPS  276

Query  456  I  454
            I
Sbjct  277  I  277



>ref|XP_010416335.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L4, chloroplastic-like 
[Camelina sativa]
Length=302

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 170/228 (75%), Gaps = 13/228 (6%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSD--LLTKKRVLTLDR  1019
             SG+  S++TS  ++  A      F+ R+ STSIL PD     FPSD   LT+K VLT D+
Sbjct  32    SGNGLSSLTSDLKYGMA-----LFSNRKLSTSILTPDD---TFPSDDTFLTEKTVLTPDQ  83

Query  1018  ELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTI  839
              +G YQDLV+PVTNF+NEDKGFMVLAGDVFDVPIRKDI H VVRWQLAKRQQGTH TKT+
Sbjct  84    TIGQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPIRKDIXHNVVRWQLAKRQQGTHLTKTL  143

Query  838   SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  659
             SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+  RLGLK+ 
Sbjct  144   SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQFRRLGLKI-  201

Query  658   CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                +  + GK   F       +HKT+NIV+Y  +ME  KKVL+V+GGP
Sbjct  202   ALTARAAEGKLLVFDDLPFP-THKTRNIVNYYNQMEKTKKVLVVEGGP  248


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+  P+H K R +     +    KK  ++    ++E LKLATQN+HY N++P
Sbjct  209  EGKLLVFDDLPFPTH-KTRNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  267

Query  459  SI  454
            SI
Sbjct  268  SI  269



>ref|NP_001242456.1| uncharacterized protein LOC100804238 [Glycine max]
 gb|ACU18017.1| unknown [Glycine max]
Length=312

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 159/204 (78%), Gaps = 3/204 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +R+FSTSIL P + D  FPSDLL+KK + T +R +GL QDL++PVTNF NEDKG+MV  G
Sbjct  62    VRQFSTSILTPGADDSAFPSDLLSKKTLATSERTIGLCQDLLIPVTNFHNEDKGYMVFPG  121

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG+LRGP
Sbjct  122   DVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGSLRGP  181

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
             QFRGG  MH PKPRSHA  K+NKKV  LGLK+    +  + GK   F       +HKTKN
Sbjct  182   QFRGGATMHGPKPRSHA-FKVNKKVRCLGLKI-ALSARAAEGKLLVFEDLEVP-THKTKN  238

Query  577   IVSYGQKMENAKKVLLVDGGPQRK  506
             IV+Y  +ME+ KK+LLVDG    K
Sbjct  239   IVNYYNQMEDTKKLLLVDGTIDEK  262


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VFED+E+P+H K + +     +    KK  L+   ++E LKL+TQN+HY NVLPS
Sbjct  220  EGKLLVFEDLEVPTH-KTKNIVNYYNQMEDTKKLLLVDGTIDEKLKLSTQNLHYVNVLPS  278

Query  456  I  454
            I
Sbjct  279  I  279



>ref|XP_004486189.1| PREDICTED: 50S ribosomal protein L4-like [Cicer arietinum]
Length=312

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 158/201 (79%), Gaps = 3/201 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +RRF TSIL P + +G  PSDLL+KK + T +R++GL QDLV+PVTNF NEDKGF+VLAG
Sbjct  61    IRRFCTSILTPGNDEGAIPSDLLSKKPLATSERDIGLCQDLVIPVTNFHNEDKGFLVLAG  120

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKG GRAR GTLRGP
Sbjct  121   DVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGLGRARQGTLRGP  180

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
              FRGG   H PKPRSHA  KLNKKV RLGLK+    +  + GK   F       +HKTK 
Sbjct  181   HFRGGATKHGPKPRSHA-FKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-THKTKT  237

Query  577   IVSYGQKMENAKKVLLVDGGP  515
             IV+Y  +ME+ KK+L+VDGGP
Sbjct  238   IVNYFNQMEDTKKLLIVDGGP  258


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K +T+     +    KK  ++    +NE LKLATQN+HY NVLP
Sbjct  219  EGKLLVFEDLEVPTH-KTKTIVNYFNQMEDTKKLLIVDGGPINEKLKLATQNLHYVNVLP  277

Query  459  SI  454
            +I
Sbjct  278  AI  279



>emb|CDX81955.1| BnaC08g36460D [Brassica napus]
Length=297

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -2

Query  1069  EFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVV  890
             +FP DLL KK V+T DR +G YQDLV+PVTNF+NEDKGFMVLAGDVFDVPIRKDIIH VV
Sbjct  62    KFPYDLLAKKTVITPDRTIGQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPIRKDIIHHVV  121

Query  889   RWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSH  710
             RWQL+KRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSH
Sbjct  122   RWQLSKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSH  181

Query  709   ATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLL  530
             A IK+NK+V RLGLK+    +  + GK   F       +HKTKNIV+Y  +MEN KKVL+
Sbjct  182   A-IKMNKQVRRLGLKI-ALSARAAEGKLLVFDEMALP-THKTKNIVNYYNQMENTKKVLV  238

Query  529   VDGGP  515
             V+GGP
Sbjct  239   VEGGP  243



>ref|XP_008384099.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Malus 
domestica]
Length=324

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R  STS   P+S  G FPS+LL+ K V+  DR +GL QDLV+PVTNF  EDKGF V
Sbjct  63    FLANRSLSTSNPTPESSGGAFPSNLLSAKPVIASDRSIGLGQDLVIPVTNFHYEDKGFTV  122

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVV WQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  123   LAGDVFDVPIRKDIIHRVVLWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTL  182

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSH   KLNKKV RLGLK+    +  + GK   F  +    +HK
Sbjct  183   RGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-ALTARAAEGKLLVFEDFEVP-THK  239

Query  586   TKNIVSYGQKMENAKKVLLVDG  521
             TKNIV+Y Q+ME +KK LLVDG
Sbjct  240   TKNIVNYVQQMEGSKKFLLVDG  261


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA--------LNENLKLATQNI  481
            EGKL+VFED E+P+H K + +    ++    KKF L+           L E LKLATQN+
Sbjct  224  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  282

Query  480  HYGNVLPSI  454
            HY NVLP++
Sbjct  283  HYVNVLPAV  291



>ref|XP_010914092.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Elaeis guineensis]
Length=299

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 155/204 (76%), Gaps = 5/204 (2%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F + +RFST  L   + +G  P +LLT + VL  D ++G Y DLV  VTNF NEDKGFMV
Sbjct  47    FISSKRFST--LESQANEGLIPPELLTNQTVLRPDHDIGQYADLVTRVTNFHNEDKGFMV  104

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTG+KPY QKGTGRARHGTL
Sbjct  105   LAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPYRQKGTGRARHGTL  164

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFR G  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       SHK
Sbjct  165   RGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFEDLAIP-SHK  221

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV+Y  +MEN KK+LLVDGGP
Sbjct  222   TKNIVNYVSQMENTKKILLVDGGP  245



>ref|XP_010914093.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X2 
[Elaeis guineensis]
Length=296

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 155/204 (76%), Gaps = 5/204 (2%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F + +RFST  L   + +G  P +LLT + VL  D ++G Y DLV  VTNF NEDKGFMV
Sbjct  44    FISSKRFST--LESQANEGLIPPELLTNQTVLRPDHDIGQYADLVTRVTNFHNEDKGFMV  101

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTG+KPY QKGTGRARHGTL
Sbjct  102   LAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPYRQKGTGRARHGTL  161

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFR G  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       SHK
Sbjct  162   RGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFEDLAIP-SHK  218

Query  586   TKNIVSYGQKMENAKKVLLVDGGP  515
             TKNIV+Y  +MEN KK+LLVDGGP
Sbjct  219   TKNIVNYVSQMENTKKILLVDGGP  242



>gb|KDO78369.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=251

 Score =   262 bits (669),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R+FST+IL PDS +G FPSDLL KK VLT D  +GL+QDLV+PVTNF NEDKGFMV
Sbjct  56    FLASRKFSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQDLVIPVTNFFNEDKGFMV  115

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTL
Sbjct  116   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTL  175

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             RGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+
Sbjct  176   RGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI  209



>ref|XP_009357493.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X2 [Pyrus x bretschneideri]
Length=324

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = -2

Query  1129  IFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFM  950
              F A RR STS   P+S  G FPS+LL+ + V   DR +GL QDLV+PVTNF  EDKGF 
Sbjct  62    FFLANRRLSTSNPTPESSGGAFPSNLLSARPVDASDRSIGLGQDLVIPVTNFHYEDKGFT  121

Query  949   VLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGT  770
             VLAGDVFDVPIRKDIIHRVV WQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGT
Sbjct  122   VLAGDVFDVPIRKDIIHRVVLWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGT  181

Query  769   LRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSH  590
             LRGPQFRGG  MH PKPRSH   KLNKKV RLGLK+    +  + GK   F  +    +H
Sbjct  182   LRGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-ALTARAAEGKLLVFEDFEVP-TH  238

Query  589   KTKNIVSYGQKMENAKKVLLVDG  521
             KTKNIV+Y Q+ME +KK LLVDG
Sbjct  239   KTKNIVNYVQQMEGSKKFLLVDG  261


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA--------LNENLKLATQNI  481
            EGKL+VFED E+P+H K + +    ++    KKF L+           L E LKLATQN+
Sbjct  224  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  282

Query  480  HYGNVLPSI  454
            HY NVLP++
Sbjct  283  HYVNVLPAV  291



>ref|XP_006597049.1| PREDICTED: uncharacterized protein LOC100804238 isoform X1 [Glycine 
max]
Length=317

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 160/209 (77%), Gaps = 8/209 (4%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELG-----LYQDLVVPVTNFRNEDKGF  953
             +R+FSTSIL P + D  FPSDLL+KK + T +R +G     L QDL++PVTNF NEDKG+
Sbjct  62    VRQFSTSILTPGADDSAFPSDLLSKKTLATSERTIGNLDGGLCQDLLIPVTNFHNEDKGY  121

Query  952   MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
             MV  GDVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG
Sbjct  122   MVFPGDVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHG  181

Query  772   TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFS  593
             +LRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+    +  + GK   F       +
Sbjct  182   SLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-T  238

Query  592   HKTKNIVSYGQKMENAKKVLLVDGGPQRK  506
             HKTKNIV+Y  +ME+ KK+LLVDG    K
Sbjct  239   HKTKNIVNYYNQMEDTKKLLLVDGTIDEK  267


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VFED+E+P+H K + +     +    KK  L+   ++E LKL+TQN+HY NVLPS
Sbjct  225  EGKLLVFEDLEVPTH-KTKNIVNYYNQMEDTKKLLLVDGTIDEKLKLSTQNLHYVNVLPS  283

Query  456  I  454
            I
Sbjct  284  I  284



>ref|XP_009356763.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009356834.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009356895.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
Length=324

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A RR STS   P+S  G  PS+LL+ K V+  +R +GL QDLV+PVTNF  EDKGF V
Sbjct  63    FLANRRLSTSNPTPESSGGALPSNLLSAKPVVASERSIGLCQDLVIPVTNFHYEDKGFTV  122

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVV WQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHGTL
Sbjct  123   LAGDVFDVPIRKDIIHRVVLWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGTL  182

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             RGPQFRGG  MH PKPRSH  IKLNKKV RLGLK+    +  + GK   F  +    +HK
Sbjct  183   RGPQFRGGCTMHGPKPRSHE-IKLNKKVRRLGLKI-ALTARAAEGKLLVFEDFEVP-THK  239

Query  586   TKNIVSYGQKMENAKKVLLVDG  521
             TK IV+Y Q+ME +KK LLVDG
Sbjct  240   TKKIVNYVQQMEGSKKFLLVDG  261



>ref|XP_009410210.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 166/238 (70%), Gaps = 20/238 (8%)
 Frame = -2

Query  1183  TASNVTSAKQFAFA--------KNEPIFF-------ALRRFSTSILAPDSGDGEFPSDLL  1049
              A N+  +++ +FA        + +P FF         + FST  L      G  PS+LL
Sbjct  7     VAWNLRQSRRLSFAIPPSISATQIDPSFFKRGLPFTTCKGFST--LETQESGGLIPSELL  64

Query  1048  TKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKR  869
             TKK VL  DR++G Y DLV  VTNF  EDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKR
Sbjct  65    TKKTVLRPDRDIGQYADLVTRVTNFHGEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKR  124

Query  868   QQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNK  689
             QQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRGPQFR G  MH PKPRSHA IKL K
Sbjct  125   QQGTHSTKTISEVSGTGRKPYRQKGTGRARHGTLRGPQFRHGAIMHGPKPRSHA-IKLQK  183

Query  688   KVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             KV RLGLK+    +  + GK   F       SHKTKNIV+Y  +MEN KKVLLVDGGP
Sbjct  184   KVRRLGLKI-ALSARTAEGKLIVFEDLALP-SHKTKNIVNYVTQMENTKKVLLVDGGP  239


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+ LPSH K + +     +    KK  L+    +++ LKLAT+N+HY NVLP
Sbjct  200  EGKLIVFEDLALPSH-KTKNIVNYVTQMENTKKVLLVDGGPIDDKLKLATRNLHYVNVLP  258

Query  459  SI  454
            SI
Sbjct  259  SI  260



>ref|XP_006836271.1| hypothetical protein AMTR_s00101p00151570 [Amborella trichopoda]
 gb|ERM99124.1| hypothetical protein AMTR_s00101p00151570 [Amborella trichopoda]
Length=279

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -2

Query  1123  FALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVL  944
             F  R  ST++L P + +G+ P + LT+K V+T +R  GLY+DLV  VTNF NED G MVL
Sbjct  26    FLTRSISTTVLTPQTSEGDIPREFLTQKEVVTPERTPGLYEDLVARVTNFHNEDMGLMVL  85

Query  943   AGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLR  764
             AGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKT+SEVSGTG+KP+PQKG+GRARHGTLR
Sbjct  86    AGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTLSEVSGTGKKPWPQKGSGRARHGTLR  145

Query  763   GPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKT  584
             GPQFR G  MH PKPRSHA  KL KKV RLGLK+    +  + GK   F       SHKT
Sbjct  146   GPQFRHGATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSARVAEGKLLVFEDLEVP-SHKT  202

Query  583   KNIVSYGQKMENAKKVLLVDGG  518
             KN+VSY  +ME  KK+LLVDGG
Sbjct  203   KNVVSYVSQMEGVKKLLLVDGG  224


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + + +   +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  186  EGKLLVFEDLEVPSH-KTKNVVSYVSQMEGVKKLLLVDGGHINEKLKLATQNLHYVNVLP  244

Query  459  SI  454
            SI
Sbjct  245  SI  246



>ref|XP_002463709.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
 gb|EER90707.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
Length=294

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 168/239 (70%), Gaps = 14/239 (6%)
 Frame = -2

Query  1213  AGLLRSLSGSTASNVTSAKQF-------AFAKNEPIFFALRRFSTSILAPDSGDGEFPSD  1055
             A LLR  +GS  + V               AKN   FF    +ST +LAP S +   P +
Sbjct  8     ASLLRRAAGSAPTTVALHHNHLPRGVGPCLAKNPGFFF--NGYST-LLAPPS-EVLIPPE  63

Query  1054  LLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLA  875
             LL+ + V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDVPIRKDI+HRVVRWQLA
Sbjct  64    LLSSRTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLA  123

Query  874   KRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKL  695
             KRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL
Sbjct  124   KRQQGTHSTKTISEVSGTGRKPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKL  182

Query  694   NKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
              KKV RLGLK+    +  + GK   F       SHKTKNIV Y ++M++ KKVLLVDGG
Sbjct  183   QKKVRRLGLKI-ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYIRQMDDTKKVLLVDGG  239


 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +    R+    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  201  EGKLLVFEDLEVPSH-KTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  259

Query  459  SI  454
            SI
Sbjct  260  SI  261



>ref|NP_001147335.1| LOC100280943 [Zea mays]
 gb|ACG26922.1| 50S ribosomal protein L4 [Zea mays]
Length=293

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 171/237 (72%), Gaps = 11/237 (5%)
 Frame = -2

Query  1213  AGLLRSLSGS---TASNVTSAKQF--AFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLL  1049
             A LLR  SGS   TAS     +       KN P FF    +ST +LAP + +   P +LL
Sbjct  8     ASLLRRASGSAPTTASLYHPPRNVGPCLVKNLPGFF-FNGYST-LLAPPN-EVLIPPELL  64

Query  1048  TKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKR  869
             + + V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDVPIRKDI+HRVVRWQLAKR
Sbjct  65    SSRTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKR  124

Query  868   QQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNK  689
             QQGTHSTKTISEVSGTGRKPYPQKGTG+ARHGTLRG QFRGG  MH PKPRSHA IKL K
Sbjct  125   QQGTHSTKTISEVSGTGRKPYPQKGTGKARHGTLRGAQFRGGATMHGPKPRSHA-IKLQK  183

Query  688   KVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
             KV RLGLK+    +  + GK   F       SHKTKNIV Y ++M+++KKVLLVDGG
Sbjct  184   KVRRLGLKI-ALSARTAEGKLLIFEDLEVP-SHKTKNIVQYIRQMDDSKKVLLVDGG  238


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++FED+E+PSH K + +    R+    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  200  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  258

Query  459  SI  454
            SI
Sbjct  259  SI  260



>ref|XP_002446335.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
 gb|EES10663.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
Length=333

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 160/210 (76%), Gaps = 6/210 (3%)
 Frame = -2

Query  1147  FAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRN  968
              AKN P FF    +ST +LAP S +   P +LL+ + V T DRELG Y+DLV  VTNF N
Sbjct  75    LAKNLPGFF-FNGYST-LLAPPS-EVLIPPELLSSRTVWTPDRELGQYEDLVARVTNFHN  131

Query  967   EDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTG  788
             EDKGFMVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTG
Sbjct  132   EDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYKQKGTG  191

Query  787   RARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GY  608
             RARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F   
Sbjct  192   RARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFEDL  249

Query  607   GTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                 SHKTKNIV Y ++M++ KKVLLVDGG
Sbjct  250   EVP-SHKTKNIVQYIRQMDDTKKVLLVDGG  278


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +    R+    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  240  EGKLLVFEDLEVPSH-KTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  298

Query  459  SI  454
            SI
Sbjct  299  SI  300



>tpg|DAA52004.1| TPA: 50S ribosomal protein L4 [Zea mays]
Length=293

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 171/237 (72%), Gaps = 11/237 (5%)
 Frame = -2

Query  1213  AGLLRSLSGS---TASNVTSAKQF--AFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLL  1049
             A LLR  +GS   TAS     +       KN P FF    +ST +LAP + +   P +LL
Sbjct  8     ASLLRRAAGSAPTTASLYHPPRNVGPCLVKNLPGFF-FNGYST-LLAPPN-EVLIPPELL  64

Query  1048  TKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKR  869
             + + V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDVPIRKDI+HRVVRWQLAKR
Sbjct  65    SSRTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKR  124

Query  868   QQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNK  689
             QQGTHSTKTISEVSGTGRKPYPQKGTG+ARHGTLRG QFRGG  MH PKPRSHA IKL K
Sbjct  125   QQGTHSTKTISEVSGTGRKPYPQKGTGKARHGTLRGAQFRGGATMHGPKPRSHA-IKLQK  183

Query  688   KVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
             KV RLGLK+    +  + GK   F       SHKTKNIV Y ++M+++KKVLLVDGG
Sbjct  184   KVRRLGLKI-ALSARTAEGKLLIFEDLEVP-SHKTKNIVQYIRQMDDSKKVLLVDGG  238


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++FED+E+PSH K + +    R+    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  200  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  258

Query  459  SI  454
            SI
Sbjct  259  SI  260



>emb|CDP01309.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 147/183 (80%), Gaps = 2/183 (1%)
 Frame = -2

Query  1174  NVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDL  995
             +V S +  A  KNE +  A R FSTSIL P S +  FPSDLL++KRV   +R +GL QDL
Sbjct  36    SVFSVELSALQKNELLIAACRGFSTSILTPGSCEDAFPSDLLSRKRVFPPERTVGLCQDL  95

Query  994   VVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGR  815
             V+PVTNF NEDKG MVLAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGR
Sbjct  96    VIPVTNFSNEDKGLMVLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGR  155

Query  814   KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
             KP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+    +  + 
Sbjct  156   KPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-ALSARAAE  213

Query  634   GKA  626
             GKA
Sbjct  214   GKA  216



>ref|XP_008787312.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Phoenix 
dactylifera]
Length=332

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 161/222 (73%), Gaps = 10/222 (5%)
 Frame = -2

Query  1180  ASNVTSAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQ  1001
             A  V   KQ  F      F   RRFST  L   + +G+ P +LLT + VLT DR +G Y 
Sbjct  67    AIGVEINKQHGFP-----FINCRRFST--LESQANEGQIPPELLTNRTVLTPDRVIGQYA  119

Query  1000  DLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGT  821
             DLV  VTNF +EDKG++VL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSG+
Sbjct  120   DLVTRVTNFYDEDKGYIVLGGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGS  179

Query  820   GRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSC  641
             GRKPY QKGTGRARHGTLRGPQFR G AMH PKPRSHA IKL KKV RLGLK+    +  
Sbjct  180   GRKPYRQKGTGRARHGTLRGPQFRHGAAMHGPKPRSHA-IKLQKKVRRLGLKV-ALSART  237

Query  640   SRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             + GK   F       SHKTKNIV+Y  ++EN KKVLLVDGGP
Sbjct  238   AEGKLLVFEDLAVP-SHKTKNIVNYVSQLENTKKVLLVDGGP  278



>ref|XP_006663555.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Oryza 
brachyantha]
Length=318

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 153/195 (78%), Gaps = 4/195 (2%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             +++LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDV
Sbjct  73    STLLAP-ANEVLIPQELLSSKTVWTPDRELGQYEDLVSRVTNFHNEDKGFMVLDGDVFDV  131

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRGPQFRGG
Sbjct  132   PIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYNQKGTGRARHGTLRGPQFRGG  191

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  192   ATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYI  248

Query  562   QKMENAKKVLLVDGG  518
             ++ME+ KKVLLVDGG
Sbjct  249   RQMEDTKKVLLVDGG  263


 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + +    R+    KK  L+    ++  LKLATQN+HY NVLP
Sbjct  225  EGKLLVFEDLEVPSH-KTKNIVQYIRQMEDTKKVLLVDGGDIDTKLKLATQNLHYVNVLP  283

Query  459  SI  454
            SI
Sbjct  284  SI  285



>ref|NP_001068165.1| Os11g0585700 [Oryza sativa Japonica Group]
 gb|ABA94446.1| ribosomal protein L4/L1 family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28528.1| Os11g0585700 [Oryza sativa Japonica Group]
Length=286

 Score =   258 bits (659),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 156/208 (75%), Gaps = 6/208 (3%)
 Frame = -2

Query  1141  KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNED  962
             KN P    L  +ST +LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF NED
Sbjct  30    KNLPAV-CLNGYST-LLAP-ANEVLIPQELLSSKTVWTPDRELGQYEDLVARVTNFHNED  86

Query  961   KGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRA  782
             KGFMVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRA
Sbjct  87    KGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYNQKGTGRA  146

Query  781   RHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGT  602
             RHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F     
Sbjct  147   RHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFDDLEV  204

Query  601   TFSHKTKNIVSYGQKMENAKKVLLVDGG  518
               SHKTKNIV Y  +ME  KKVLLVDGG
Sbjct  205   P-SHKTKNIVQYIGQMEGTKKVLLVDGG  231


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+E+PSH K + +     +    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  193  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  251

Query  459  SI  454
            SI
Sbjct  252  SI  253



>ref|XP_004979576.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Setaria 
italica]
Length=294

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 158/211 (75%), Gaps = 6/211 (3%)
 Frame = -2

Query  1150  AFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFR  971
             + AKN P F     +ST +LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF 
Sbjct  35    SLAKNLPAF-CFNGYST-LLAP-ANEVLIPPELLSSKTVWTPDRELGQYEDLVARVTNFH  91

Query  970   NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGT  791
             NEDKGFMVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGT
Sbjct  92    NEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYAQKGT  151

Query  790   GRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*G  611
             GRARHGTLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F  
Sbjct  152   GRARHGTLRGCQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFED  209

Query  610   YGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                  SHKTKNIV Y  +M++ KKVLLVDGG
Sbjct  210   LEVP-SHKTKNIVQYISQMDDTKKVLLVDGG  239


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VFED+E+PSH     +  +++     K   +    +++ LKLATQN+HY NVLPS
Sbjct  201  EGKLLVFEDLEVPSHKTKNIVQYISQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPS  260

Query  456  I  454
            I
Sbjct  261  I  261



>ref|XP_009357492.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X1 [Pyrus x bretschneideri]
Length=328

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 157/212 (74%), Gaps = 7/212 (3%)
 Frame = -2

Query  1144  AKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELG----LYQDLVVPVTN  977
             +K    F A RR STS   P+S  G FPS+LL+ + V   DR +G    L QDLV+PVTN
Sbjct  57    SKAGSFFLANRRLSTSNPTPESSGGAFPSNLLSARPVDASDRSIGTRKGLGQDLVIPVTN  116

Query  976   FRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQK  797
             F  EDKGF VLAGDVFDVPIRKDIIHRVV WQLAKRQQGTHSTKTISEVSGTGRKP+ QK
Sbjct  117   FHYEDKGFTVLAGDVFDVPIRKDIIHRVVLWQLAKRQQGTHSTKTISEVSGTGRKPWNQK  176

Query  796   GTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF  617
             GTGRARHGTLRGPQFRGG  MH PKPRSH   KLNKKV RLGLK+    +  + GK   F
Sbjct  177   GTGRARHGTLRGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-ALTARAAEGKLLVF  234

Query  616   *GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
               +    +HKTKNIV+Y Q+ME +KK LLVDG
Sbjct  235   EDFEVP-THKTKNIVNYVQQMEGSKKFLLVDG  265


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA--------LNENLKLATQNI  481
            EGKL+VFED E+P+H K + +    ++    KKF L+           L E LKLATQN+
Sbjct  228  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  286

Query  480  HYGNVLPSI  454
            HY NVLP++
Sbjct  287  HYVNVLPAV  295



>ref|XP_003577421.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Brachypodium 
distachyon]
Length=289

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             +++LAP + +G  PS+LL+ K V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDV
Sbjct  44    STLLAP-ANEGMIPSELLSSKTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDV  102

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRG QFRGG
Sbjct  103   PIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYAQKGTGRARHGTLRGCQFRGG  162

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  163   ATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFDDLDLP-SHKTKNIVQYI  219

Query  562   QKMENAKKVLLVDGG  518
             ++M+  KKVLLVDGG
Sbjct  220   KQMDETKKVLLVDGG  234


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +F+D++LPSH K + +    ++    KK  L+    +++ LKLATQN+HY NV+P
Sbjct  196  EGKLCIFDDLDLPSH-KTKNIVQYIKQMDETKKVLLVDGGDIDKKLKLATQNLHYVNVIP  254

Query  459  SI  454
            SI
Sbjct  255  SI  256



>ref|XP_010685040.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 156/201 (78%), Gaps = 4/201 (2%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTL-DRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             R FST+ + P+S DGE PSDLL  K+ +++ DR  G+YQDLV+PVTNF  EDKG M LAG
Sbjct  29    RLFSTTTVTPNSSDGEIPSDLLMPKKSVSISDRSQGVYQDLVIPVTNFHFEDKGLMALAG  88

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTG+KPYPQKGTGRAR G+ R  
Sbjct  89    DVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPYPQKGTGRARLGSRRSN  148

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKN  578
             Q RGG  MH PKPRSHA  KLNKKV RLGLK+    +  + GK   F    T  +HKTKN
Sbjct  149   QQRGGATMHGPKPRSHAH-KLNKKVRRLGLKI-ALSARAAEGKLLVFDDL-TVPTHKTKN  205

Query  577   IVSYGQKMENAKKVLLVDGGP  515
             IV++  +ME++KK+LLVD GP
Sbjct  206   IVNWVDEMEDSKKLLLVDDGP  226


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+ +P+H K + +     +    KK  L+    ++E LKLATQN+HY NVLP
Sbjct  187  EGKLLVFDDLTVPTH-KTKNIVNWVDEMEDSKKLLLVDDGPISEKLKLATQNLHYVNVLP  245

Query  459  SI  454
            S+
Sbjct  246  SV  247



>gb|EEE52352.1| hypothetical protein OsJ_34399 [Oryza sativa Japonica Group]
Length=353

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             +++LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDV
Sbjct  108   STLLAP-ANEVLIPQELLSSKTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDV  166

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRGPQFRGG
Sbjct  167   PIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYNQKGTGRARHGTLRGPQFRGG  226

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  227   ATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFDDLEVP-SHKTKNIVQYI  283

Query  562   QKMENAKKVLLVDGG  518
              +ME  KKVLLVDGG
Sbjct  284   GQMEGTKKVLLVDGG  298


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+E+PSH K + +     +    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  260  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  318

Query  459  SI  454
            SI
Sbjct  319  SI  320



>gb|AFK36510.1| unknown [Lotus japonicus]
Length=305

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 169/229 (74%), Gaps = 7/229 (3%)
 Frame = -2

Query  1192  SGSTASNVTSAKQFAFAKNEPIFFA---LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLD  1022
             S    S+++  ++F+ A+   +  A   ++RF TS+  P   +G FPSDLL+ K + T +
Sbjct  27    SRDICSSLSGERRFS-AQRPGLLLARSMIQRFCTSVSVPGYHEGAFPSDLLSNKPLATSE  85

Query  1021  RELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKT  842
             R++GL QDL++PVTNF NEDKG MVLAGDVFDVPIRKDIIHRVVRWQLA+RQQGTHSTKT
Sbjct  86    RDIGLCQDLLIPVTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLARRQQGTHSTKT  145

Query  841   ISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             +SEV GTGRK Y QKG G+ARHG+ R   FRGG AMH PKPRSHA  KLNKKV RLGLK+
Sbjct  146   VSEVRGTGRKMYKQKGLGKARHGSQRVHLFRGGAAMHGPKPRSHA-FKLNKKVRRLGLKI  204

Query  661   DCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                 +  + GK   F       +HKTKNIV+Y ++ME++KK+LLVDGGP
Sbjct  205   -ALSARAAEGKLLVFEDL-DVLTHKTKNIVNYFKQMEDSKKLLLVDGGP  251


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+++ +H K + +    ++    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  212  EGKLLVFEDLDVLTH-KTKNIVNYFKQMEDSKKLLLVDGGPINEKLKLATQNLHYVNVLP  270

Query  459  SI  454
            SI
Sbjct  271  SI  272



>ref|XP_004962972.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Setaria 
italica]
Length=294

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 158/208 (76%), Gaps = 6/208 (3%)
 Frame = -2

Query  1141  KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNED  962
             KN P F +  R+ST ++AP S +   P +LL+ + V T  R +G Y+DLV  VTNF NED
Sbjct  38    KNIPTFCS-SRYST-LVAP-SNEVLIPPELLSSQTVGTPKRTIGQYEDLVARVTNFHNED  94

Query  961   KGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRA  782
             KG+MVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRA
Sbjct  95    KGYMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYKQKGTGRA  154

Query  781   RHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGT  602
             RHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F     
Sbjct  155   RHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-TLSARTAEGKLFVFEDLEV  212

Query  601   TFSHKTKNIVSYGQKMENAKKVLLVDGG  518
               SHKTKNIV+Y  +M+N KKVLLVDGG
Sbjct  213   P-SHKTKNIVNYISQMDNTKKVLLVDGG  239


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL VFED+E+PSH     +  +++     K   +    +++ LKLATQN+HY NVLPS
Sbjct  201  EGKLFVFEDLEVPSHKTKNIVNYISQMDNTKKVLLVDGGDIDKKLKLATQNLHYVNVLPS  260

Query  456  I  454
            I
Sbjct  261  I  261



>ref|XP_007220702.1| hypothetical protein PRUPE_ppa021068mg [Prunus persica]
 gb|EMJ21901.1| hypothetical protein PRUPE_ppa021068mg [Prunus persica]
Length=318

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 157/218 (72%), Gaps = 19/218 (9%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A RR STSI +P+S  G FPS+LL+ K V+  +  +GLYQDLV+PVTNF NEDKGF V
Sbjct  49    FLANRRLSTSIPSPESSGGAFPSNLLSAKPVVASESNIGLYQDLVIPVTNFHNEDKGFTV  108

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQ----------------GTHSTKTISEVSGTGR  815
             LAGDVFDVPIRKDIIHRVV WQLA   +                GTHSTKTISEVSGTGR
Sbjct  109   LAGDVFDVPIRKDIIHRVVLWQLANGNRKAAMPLGSWKYRVFHLGTHSTKTISEVSGTGR  168

Query  814   KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
             KP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+    +  + 
Sbjct  169   KPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKI-ALTARAAE  226

Query  634   GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
             GK   F  +    +HKTKNI +Y Q+ME++KK+LLVDG
Sbjct  227   GKLLIFDDFEVP-THKTKNIANYVQQMEDSKKLLLVDG  263


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL++F+D E+P+H K + +    ++    KK  L+   L E LKLATQN+HY NVLP+
Sbjct  226  EGKLLIFDDFEVPTH-KTKNIANYVQQMEDSKKLLLVDGILPEKLKLATQNLHYVNVLPA  284

Query  456  I  454
            +
Sbjct  285  V  285



>dbj|BAK00507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 151/195 (77%), Gaps = 4/195 (2%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             ++++AP + +   P +LL+ K V T DRELG Y+DLV  VTNF NEDKGFMVL GDVFDV
Sbjct  44    STLMAP-ANEVLIPPELLSSKTVWTPDRELGQYEDLVARVTNFHNEDKGFMVLDGDVFDV  102

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY QKGTGRARHGTLRG QFRGG
Sbjct  103   PIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYKQKGTGRARHGTLRGCQFRGG  162

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  163   ATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYI  219

Query  562   QKMENAKKVLLVDGG  518
             ++M++ KK+LLVDGG
Sbjct  220   KQMDDTKKILLVDGG  234


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +FED+E+PSH K + +    ++    KK  L+    +++ LKLATQN+HY NV+P
Sbjct  196  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  254

Query  459  SI  454
            SI
Sbjct  255  SI  256



>ref|XP_008224759.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L4, mitochondrial-like 
[Prunus mume]
Length=275

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 151/202 (75%), Gaps = 3/202 (1%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A RR  TSI  P+S  G F S+LL+ K V+  +   GL QDLV+ VTNF  EDKGF V
Sbjct  22    FLANRRLLTSISTPESSGGAFSSNLLSAKPVVASEGTTGLCQDLVIQVTNFHYEDKGFTV  81

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
               GDVFDVPIRKDI+HRVV WQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRAR G+L
Sbjct  82    FPGDVFDVPIRKDIVHRVVLWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARQGSL  141

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHK  587
             R PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+    +  + GK   F  +    +HK
Sbjct  142   RSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKI-ALTAXAAEGKLLVFDDFEVP-THK  198

Query  586   TKNIVSYGQKMENAKKVLLVDG  521
             TKNIV+Y Q+M N+KK+LLVDG
Sbjct  199   TKNIVNYVQQMGNSKKLLLVDG  220


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VF+D E+P+H K + +    ++    KK  L+   L E LKLATQN+HY NVLP+
Sbjct  183  EGKLLVFDDFEVPTH-KTKNIVNYVQQMGNSKKLLLVDGMLPEKLKLATQNLHYVNVLPA  241

Query  456  I  454
            +
Sbjct  242  V  242



>gb|AES73712.2| 50S ribosomal protein L4, bacterial/organelle protein [Medicago 
truncatula]
Length=347

 Score =   253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGD  935
             +RFSTS     + +  FPSDLL+KK + T +R++GL QDL++PVTNF NEDKGFMVLAGD
Sbjct  97    QRFSTS-----TDEAAFPSDLLSKKPLATSERDIGLCQDLLIPVTNFHNEDKGFMVLAGD  151

Query  934   VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQ  755
             VFD+PIRKDI+HRVV WQ AKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG+LRGPQ
Sbjct  152   VFDMPIRKDIVHRVVLWQRAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGSLRGPQ  211

Query  754   FRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNI  575
             FRGG A H PKPRSHA  KLNKKV RLGLK+    +  + GK   F       +HKTKN 
Sbjct  212   FRGGEAKHGPKPRSHA-FKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-THKTKNF  268

Query  574   VSYGQKMENAKKVLLVDGGP  515
             +++  ++E+ KK+L+VD GP
Sbjct  269   LNFFNQLEDTKKLLIVDDGP  288


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K +       +    KK  ++    +NE LKLATQN+HY N+LP
Sbjct  249  EGKLLVFEDLEVPTH-KTKNFLNFFNQLEDTKKLLIVDDGPVNEKLKLATQNLHYVNLLP  307

Query  459  SI  454
            SI
Sbjct  308  SI  309



>ref|XP_003603461.1| 50S ribosomal protein L4 [Medicago truncatula]
Length=366

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 156/200 (78%), Gaps = 8/200 (4%)
 Frame = -2

Query  1114  RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGD  935
             +RFSTS     + +  FPSDLL+KK + T +R++GL QDL++PVTNF NEDKGFMVLAGD
Sbjct  97    QRFSTS-----TDEAAFPSDLLSKKPLATSERDIGLCQDLLIPVTNFHNEDKGFMVLAGD  151

Query  934   VFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQ  755
             VFD+PIRKDI+HRVV WQ AKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG+LRGPQ
Sbjct  152   VFDMPIRKDIVHRVVLWQRAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGSLRGPQ  211

Query  754   FRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNI  575
             FRGG A H PKPRSHA  KLNKKV RLGLK+    +  + GK   F       +HKTKN 
Sbjct  212   FRGGEAKHGPKPRSHA-FKLNKKVRRLGLKI-ALSARAAEGKLLVFEDLEVP-THKTKNF  268

Query  574   VSYGQKMENAKKVLLVDGGP  515
             +++  ++E+ KK+L+VD GP
Sbjct  269   LNFFNQLEDTKKLLIVDDGP  288


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K +       +    KK  ++    +NE LKLATQN+HY N+LP
Sbjct  249  EGKLLVFEDLEVPTH-KTKNFLNFFNQLEDTKKLLIVDDGPVNEKLKLATQNLHYVNLLP  307

Query  459  SIVSIRTTSVSLMVYTHLSALDTWLLDL  376
            SIVSI  T V+ +++     + T L+D+
Sbjct  308  SIVSISFTRVASIIFLMEVIIITLLVDI  335



>gb|ACU18021.1| unknown [Glycine max]
Length=224

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAG  938
             +R+FSTSIL P   D  FPSDLL+KK + T +R +GL QDL++PVTNF NEDKG+MVL G
Sbjct  60    VRQFSTSILTPGDDDSAFPSDLLSKKILATSERTIGLCQDLLIPVTNFHNEDKGYMVLPG  119

Query  937   DVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGP  758
             DVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG+LRGP
Sbjct  120   DVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHGSLRGP  179

Query  757   QFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QFRGG  MH PKPRSHA  K+NKKV RLGLK+
Sbjct  180   QFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI  210



>ref|XP_006383858.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
 gb|ERP61655.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
Length=277

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 141/217 (65%), Gaps = 43/217 (20%)
 Frame = -2

Query  1165  SAKQFAFAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVP  986
             SA+  +F K      A RR STS +  +S DG FPSDLL+ K V+T  RE+GLYQDLV+P
Sbjct  50    SAESSSFIKGAVSSLAHRRLSTSNVTSESTDGSFPSDLLSAKNVVTPQREIGLYQDLVIP  109

Query  985   VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
             VTNF NEDKG MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY
Sbjct  110   VTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  169

Query  805   PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
              QKGTGRARHGTLRGPQ      + VP                                 
Sbjct  170   RQKGTGRARHGTLRGPQLLVFEDLEVP---------------------------------  196

Query  625   HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
                       +HKTKNIV+Y  +MEN KK+L+VDGGP
Sbjct  197   ----------THKTKNIVNYVIEMENTKKLLVVDGGP  223



>ref|XP_010252525.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X2 
[Nelumbo nucifera]
Length=284

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 135/166 (81%), Gaps = 3/166 (2%)
 Frame = -2

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G Y+DL++PVTNF NEDKGFMVLAGDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISE
Sbjct  68    GCYEDLIIPVTNFHNEDKGFMVLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISE  127

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTG+KP+ QKGTGRARHGTLRGPQFR G  MH PKPR+HA IKL KKV RLGLK+   
Sbjct  128   VSGTGKKPWRQKGTGRARHGTLRGPQFRHGATMHGPKPRTHA-IKLQKKVRRLGLKI-AL  185

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
              +    GK   F       +HKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  186   SARIVEGKLLVFEDLEVP-THKTKNIVNYVSQIENTKKLLLVDGGP  230


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+P+H K + +     +    KK  L+    +NE LKLATQN+HY NVLP
Sbjct  191  EGKLLVFEDLEVPTH-KTKNIVNYVSQIENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  249

Query  459  SI  454
            SI
Sbjct  250  SI  251



>gb|ADE77062.1| unknown [Picea sitchensis]
Length=323

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 149/213 (70%), Gaps = 18/213 (8%)
 Frame = -2

Query  1063  PSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRW  884
             PS+LL  +      R  G ++DL + VTN RNEDKG +VLAGDVFDVPIRKDIIHRVVRW
Sbjct  90    PSELLAAQAAYAAQRVQGKFEDLTLRVTNMRNEDKGMIVLAGDVFDVPIRKDIIHRVVRW  149

Query  883   QLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHAT  704
             QLAKR+QGTHSTKTISEVSGTGRKP+PQKGTG+ARHGTLRGPQFR G  MH PKPRSHA 
Sbjct  150   QLAKRRQGTHSTKTISEVSGTGRKPWPQKGTGKARHGTLRGPQFRHGATMHGPKPRSHA-  208

Query  703   IKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVD  524
             IKL KKV RLGLK+    +  + GK   F  +  T +HKTK +  Y  ++EN KK+LLV+
Sbjct  209   IKLQKKVRRLGLKI-ALSARAAEGKLMVFDTFDLT-THKTKEVAKYVSQLENCKKILLVE  266

Query  523   GGPQRK---------------PQVGHSKYTLWQ  470
             GGP  K               P +G + Y++ Q
Sbjct  267   GGPVNKKLGLATQNLHYANVLPSIGLNVYSILQ  299



>ref|XP_010490301.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like, partial 
[Camelina sativa]
Length=269

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 135/175 (77%), Gaps = 11/175 (6%)
 Frame = -2

Query  1015  LGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTIS  836
             LG YQDLV+PVTNF+NEDKGFMVLAGDVFDVPIRKDIIH VVRWQLAK QQGTHSTK +S
Sbjct  47    LGQYQDLVIPVTNFQNEDKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKHQQGTHSTKALS  106

Query  835   EVSGTGRKPYPQKGTGRARHGTLRGPQ--------FRGGTAMHVPKPRSHATIKLNKKVC  680
             EVSGTGRKP+ QKGTGRARHGTLRGPQ        FRGG  MH P PRSHA IK+NK+V 
Sbjct  107   EVSGTGRKPWNQKGTGRARHGTLRGPQINQFFDFKFRGGCVMHGPIPRSHA-IKMNKQVR  165

Query  679   RLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
             RLGLK+    +  + GK   F       +HKTKNIV+Y  +ME  KKVL+V+GGP
Sbjct  166   RLGLKI-ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVVEGGP  218


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPS  457
            EGKL+VF+D+ LP+H     +    +  +  K   +    ++E LKLATQN+HY N++PS
Sbjct  179  EGKLLVFDDLALPTHKTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIPS  238

Query  456  I  454
            I
Sbjct  239  I  239



>ref|XP_009610538.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L4, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=290

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = -2

Query  1015  LGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTIS  836
              GL+QDLV+ VTNF NEDKGFM LAGDVFDVPIRKDIIH VVRWQLAKRQQGTHSTKTIS
Sbjct  100   FGLHQDLVIRVTNFLNEDKGFMCLAGDVFDVPIRKDIIHHVVRWQLAKRQQGTHSTKTIS  159

Query  835   EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  656
             EVSGTGRK    KGTGRARHGTLRG QF GG  MH PKPRSHA I+LNKKV RLGLK+  
Sbjct  160   EVSGTGRKSXRXKGTGRARHGTLRGAQFLGGATMHGPKPRSHA-IQLNKKVRRLGLKI-A  217

Query  655   FVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGP  515
               +  + GK   F     + SHKTKNIV+Y  ++EN KK+LLVDGGP
Sbjct  218   LSARAAEGKLMVFEDLEIS-SHKTKNIVNYFNQLENTKKLLLVDGGP  263


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLMVFED+E+ SH K + +     +    KK  L+    ++E LKLATQN+HY NVLP
Sbjct  224  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNLHYVNVLP  282

Query  459  SIVSIR  442
            SIVS +
Sbjct  283  SIVSFQ  288



>gb|KDO78368.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=221

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = -2

Query  1126  FFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMV  947
             F A R+FST+IL PDS +G FPSDLL KK VLT D  +GL+QDLV+PVTNF NEDKGFMV
Sbjct  56    FLASRKFSTTILTPDSSEGAFPSDLLLKKTVLTPDITIGLHQDLVIPVTNFFNEDKGFMV  115

Query  946   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTL  767
             LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTG+KP+ QKGTGRARHGTL
Sbjct  116   LAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKKPWRQKGTGRARHGTL  175

Query  766   RGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF  617
             RGPQ   G   +          K+ ++     ++ DC + S SR KA GF
Sbjct  176   RGPQ---GWYYNARSKAQKPCYKVEQEGAAAWVE-DCSICSSSRRKALGF  221



>gb|EMS55866.1| 50S ribosomal protein L4 [Triticum urartu]
Length=265

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 149/226 (66%), Gaps = 29/226 (13%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             +++LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF NED GFMVL GDVFDV
Sbjct  30    STLLAP-ANEALIPPELLSSKTVWTPDRELGQYEDLVARVTNFHNEDNGFMVLDGDVFDV  88

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRV          GTHSTKTISEVSGTGRKPY QKGTGRARHGTLRG QFRGG
Sbjct  89    PIRKDIVHRV----------GTHSTKTISEVSGTGRKPYKQKGTGRARHGTLRGCQFRGG  138

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  139   ATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYI  195

Query  562   QKMENAKKVLLVDGGPQRK---------------PQVGHSKYTLWQ  470
             ++M++ KKVLLVDGG   K               P +G + Y++ Q
Sbjct  196   KQMDDTKKVLLVDGGDIDKKLKLATKNLHYVNVIPSIGLNVYSILQ  241


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +FED+E+PSH K + +    ++    KK  L+    +++ LKLAT+N+HY NV+P
Sbjct  172  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKVLLVDGGDIDKKLKLATKNLHYVNVIP  230

Query  459  SI  454
            SI
Sbjct  231  SI  232



>gb|EMT27905.1| 50S ribosomal protein L4 [Aegilops tauschii]
Length=265

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 140/195 (72%), Gaps = 14/195 (7%)
 Frame = -2

Query  1102  TSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDV  923
             +++LAP + +   P +LL+ K V T DRELG Y+DLV  VTNF NED GFMVL GDVFDV
Sbjct  30    STLLAP-ANEALIPPELLSSKTVWTPDRELGQYEDLVARVTNFHNEDNGFMVLDGDVFDV  88

Query  922   PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGG  743
             PIRKDI+HRV          GTHSTKTISEVSGTGRKPY QKGTGRARHGTLRG QFRGG
Sbjct  89    PIRKDIVHRV----------GTHSTKTISEVSGTGRKPYKQKGTGRARHGTLRGCQFRGG  138

Query  742   TAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYG  563
               MH PKPRSHA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y 
Sbjct  139   ATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYI  195

Query  562   QKMENAKKVLLVDGG  518
             ++M++ KKVLLVDGG
Sbjct  196   KQMDDTKKVLLVDGG  210


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +FED+E+PSH K + +    ++    KK  L+    +++ LKLAT+N+HY NV+P
Sbjct  172  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKVLLVDGGDIDKKLKLATKNLHYVNVIP  230

Query  459  SI  454
            SI
Sbjct  231  SI  232



>gb|EEC68430.1| hypothetical protein OsI_36619 [Oryza sativa Indica Group]
Length=273

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 144/208 (69%), Gaps = 19/208 (9%)
 Frame = -2

Query  1141  KNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNED  962
             KN P    L  +ST +LAP + +   P +LL+ K V T DR+   Y+DLV  VTNF NED
Sbjct  30    KNLPAV-CLNGYST-LLAP-ANEVLIPQELLSSKTVWTPDRQ---YEDLVARVTNFHNED  83

Query  961   KGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRA  782
             KGFMVL GDVFDVPIRKDI+HRV          GTHSTKTISEVSGTGRKPY QKGTGRA
Sbjct  84    KGFMVLDGDVFDVPIRKDIVHRV----------GTHSTKTISEVSGTGRKPYNQKGTGRA  133

Query  781   RHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGT  602
             RHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F     
Sbjct  134   RHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFDDLEV  191

Query  601   TFSHKTKNIVSYGQKMENAKKVLLVDGG  518
               SHKTKNIV Y  +ME  KKVLLVDGG
Sbjct  192   P-SHKTKNIVQYIGQMEGTKKVLLVDGG  218


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VF+D+E+PSH K + +     +    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  180  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  238

Query  459  SI  454
            SI
Sbjct  239  SI  240



>ref|XP_008778736.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Phoenix 
dactylifera]
Length=197

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = -2

Query  952  MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
            MVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSG+GRKPY QKGTGRARHG
Sbjct  1    MVLGGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGSGRKPYKQKGTGRARHG  60

Query  772  TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFS  593
            TLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       S
Sbjct  61   TLRGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKV-ALSARTAEGKLLVFEDLAVP-S  117

Query  592  HKTKNIVSYGQKMENAKKVLLVDGGP  515
            HKTKNIV+Y  ++EN KKVLLVDGGP
Sbjct  118  HKTKNIVNYVSQLENTKKVLLVDGGP  143



>gb|KHN32994.1| 50S ribosomal protein L4 [Glycine soja]
Length=217

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 133/209 (64%), Gaps = 49/209 (23%)
 Frame = -2

Query  1117  LRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELG-----LYQDLVVPVTNFRNEDKGF  953
             +R+FSTSIL P + D  FPSDLL+KK + T +R +G     L QDL++PVTNF NEDKG+
Sbjct  13    VRQFSTSILTPGADDSAFPSDLLSKKTLATSERTIGNLDGGLCQDLLIPVTNFHNEDKGY  72

Query  952   MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
             MV  GDVFD+PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP+ QKGTGRARHG
Sbjct  73    MVFPGDVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPWNQKGTGRARHG  132

Query  772   TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFS  593
             +LRGPQ      + VP                                           +
Sbjct  133   SLRGPQLV-FEDLEVP-------------------------------------------T  148

Query  592   HKTKNIVSYGQKMENAKKVLLVDGGPQRK  506
             HKTKNIV+Y  +ME+ KK+LLVDG    K
Sbjct  149   HKTKNIVNYYNQMEDTKKLLLVDGTIDEK  177


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  633  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPSI  454
            G  +VFED+E+P+H K + +     +    KK  L+   ++E LKL+TQN+HY NVLPSI
Sbjct  136  GPQLVFEDLEVPTH-KTKNIVNYYNQMEDTKKLLLVDGTIDEKLKLSTQNLHYVNVLPSI  194

Query  453  VSIRTTSVSLMV  418
            VS     V+ ++
Sbjct  195  VSFNFIHVASII  206



>gb|EEC69298.1| hypothetical protein OsI_38360 [Oryza sativa Indica Group]
Length=197

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 116/145 (80%), Gaps = 3/145 (2%)
 Frame = -2

Query  952  MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
            MVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTK ISEVSGTGRKPY QKGTGRARHG
Sbjct  1    MVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKIISEVSGTGRKPYKQKGTGRARHG  60

Query  772  TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFS  593
            TLRGPQFRGG  MH PKPRSH TIKL KKV RLGLK+    +  + GK   F       S
Sbjct  61   TLRGPQFRGGATMHGPKPRSH-TIKLQKKVRRLGLKI-ALSARTAEGKLLVFEDLEVP-S  117

Query  592  HKTKNIVSYGQKMENAKKVLLVDGG  518
            HKTKN+VSY  +ME+ KKVLLVDGG
Sbjct  118  HKTKNVVSYISQMEDTKKVLLVDGG  142


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + + +   +    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  104  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  162

Query  459  SI  454
            SI
Sbjct  163  SI  164



>gb|ACN26135.1| unknown [Zea mays]
Length=197

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = -2

Query  952  MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
            MVL GDVFDVPIRKDI+HRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTG+ARHG
Sbjct  1    MVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGKARHG  60

Query  772  TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFS  593
            TLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       S
Sbjct  61   TLRGAQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLIFEDLEVP-S  117

Query  592  HKTKNIVSYGQKMENAKKVLLVDGG  518
            HKTKNIV Y ++M+++KKVLLVDGG
Sbjct  118  HKTKNIVQYIRQMDDSKKVLLVDGG  142


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL++FED+E+PSH K + +    R+    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  104  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  162

Query  459  SI  454
            SI
Sbjct  163  SI  164



>gb|EMT16009.1| 50S ribosomal protein L4 [Aegilops tauschii]
Length=276

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 120/163 (74%), Gaps = 13/163 (8%)
 Frame = -2

Query  1006  YQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVS  827
             Y+DLV  VTNF NEDKGFMVL GDVFDVPIRKDI+HRV          GTHSTKTISEVS
Sbjct  72    YEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRV----------GTHSTKTISEVS  121

Query  826   GTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVS  647
             GTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+    +
Sbjct  122   GTGRKPYKQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-ALSA  179

Query  646   SCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
               + GK   F       SHKTKNIV Y ++M++ KK+LLVDGG
Sbjct  180   RTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKKILLVDGG  221


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +FED+E+PSH K + +    ++    KK  L+    +++ LKLATQN+HY NV+P
Sbjct  183  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  241

Query  459  SI  454
            SI
Sbjct  242  SI  243



>gb|EMS66148.1| 50S ribosomal protein L4 [Triticum urartu]
Length=291

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 121/185 (65%), Gaps = 33/185 (18%)
 Frame = -2

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G Y+DLV  VTNF NEDKGFMVL GDVFDVPIRKDI+HRV          GTHSTKTISE
Sbjct  65    GQYEDLVARVTNFHNEDKGFMVLDGDVFDVPIRKDIVHRV----------GTHSTKTISE  114

Query  832   VSGTGRKPYPQKGTGRARHGTLRG--------------------PQFRGGTAMHVPKPRS  713
             VSGTGRKPY QKGTGRARHGTLRG                     QFRGG  MH PKPRS
Sbjct  115   VSGTGRKPYKQKGTGRARHGTLRGCQALEISYLLWAPTKLRFKLKQFRGGATMHGPKPRS  174

Query  712   HATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVL  533
             HA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y ++M++ KK+L
Sbjct  175   HA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKKIL  231

Query  532   LVDGG  518
             LVDGG
Sbjct  232   LVDGG  236


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL +FED+E+PSH K + +    ++    KK  L+    +++ LKLATQN+HY NV+P
Sbjct  198  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  256

Query  459  SI  454
            SI
Sbjct  257  SI  258



>gb|EYU31362.1| hypothetical protein MIMGU_mgv1a014658mg [Erythranthe guttata]
Length=182

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 3/131 (2%)
 Frame = -2

Query  907  IIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHV  728
            +IHRVVRWQLAKRQQGTHSTK +SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG  MH 
Sbjct  1    MIHRVVRWQLAKRQQGTHSTKNLSEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGCTMHG  60

Query  727  PKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMEN  548
            P+PRSHA IKLNKKV RLGLK+    +  + GK   F       SHKTKNIV+Y ++ME+
Sbjct  61   PRPRSHA-IKLNKKVRRLGLKI-ALSARAAEGKLMIFDDLEVP-SHKTKNIVNYAKQMED  117

Query  547  AKKVLLVDGGP  515
            AKK+LLVDGGP
Sbjct  118  AKKLLLVDGGP  128


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKLM+F+D+E+PSH K + +   A++    KK  L+    LNE LKLATQN+HY NVLP
Sbjct  89   EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  147

Query  459  SI  454
            SI
Sbjct  148  SI  149



>ref|XP_001773052.1| predicted protein [Physcomitrella patens]
 gb|EDQ62092.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = -2

Query  1012  GLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             G  +D+ V VTNF++EDKG   LAGDVFDVPIR D++HRVVRWQLAKR+QGT STK I E
Sbjct  52    GQLKDVEVKVTNFQSEDKGLATLAGDVFDVPIRPDVVHRVVRWQLAKRRQGTASTKGIHE  111

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCF  653
             VSGTGRKP PQKG+GRARHG+LRGPQFRGG   H PKPRSH  I L K+V RLGLK+   
Sbjct  112   VSGTGRKPGPQKGSGRARHGSLRGPQFRGGATQHGPKPRSH-EIGLQKQVRRLGLKV-AL  169

Query  652   VSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVD  524
              S  + GK   F       + KT+ +      +E  KKVL+VD
Sbjct  170   SSRVAEGKLKVFDSVEPP-TLKTREMERLIADIEGCKKVLIVD  211



>ref|XP_006377175.1| hypothetical protein POPTR_0011s01580g, partial [Populus trichocarpa]
 gb|ERP54972.1| hypothetical protein POPTR_0011s01580g, partial [Populus trichocarpa]
Length=170

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 108/156 (69%), Gaps = 22/156 (14%)
 Frame = -2

Query  1093  LAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIR  914
             + P+S DG FPSDLL+ K V+T   E+GLYQDL          DKG MVLAGDVFD PIR
Sbjct  4     VQPESTDGLFPSDLLSAKNVVTPQCEIGLYQDL----------DKGLMVLAGDVFDFPIR  53

Query  913   KDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAM  734
              DIIHRV          G HSTKTISEVSGTGRKPY QK TGRAR+GTL  PQFRGG  M
Sbjct  54    NDIIHRV----------GAHSTKTISEVSGTGRKPYRQKSTGRARYGTLCWPQFRGGAVM  103

Query  733   HVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             H PKP+SHA I+LNKKV RLGLK+    +  + GKA
Sbjct  104   HGPKPQSHA-IELNKKVRRLGLKI-ALSARAAEGKA  137



>ref|XP_002969851.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
 gb|EFJ28975.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
Length=215

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 112/161 (70%), Gaps = 4/161 (2%)
 Frame = -2

Query  1003  QDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG  824
             +D+V+PVTN+  EDKG + +AGD+FDVPIRKDI+H VV+WQ AKR++GTHSTKT  EV+G
Sbjct  2     RDVVLPVTNWEQEDKGTVTIAGDIFDVPIRKDIVHHVVKWQRAKRRKGTHSTKTRGEVAG  61

Query  823   TGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSS  644
             + RK + QKGTG+ARHG+ R PQFRGG   H PKPRS+   KLNKKV RLGLK+      
Sbjct  62    STRKIHKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYE-YKLNKKVRRLGLKIALSARV  120

Query  643   CSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
               R K   F       +HKT+ ++     +   ++VL+VDG
Sbjct  121   AER-KLMLFDNVDLP-THKTRQLMKLVPNL-GCRRVLIVDG  158



>ref|XP_002985293.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
 gb|EFJ13787.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
Length=215

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 111/161 (69%), Gaps = 4/161 (2%)
 Frame = -2

Query  1003  QDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG  824
             +D+V+PVTN+  EDKG + +AGD+FDVPIRKDI+H VV+WQ AKR++GTHSTKT  EV+G
Sbjct  2     RDVVLPVTNWEQEDKGTVTIAGDIFDVPIRKDIVHHVVKWQRAKRRKGTHSTKTRGEVAG  61

Query  823   TGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSS  644
             + RK   QKGTG+ARHG+ R PQFRGG   H PKPRS+   KLNKKV RLGLK+      
Sbjct  62    STRKINKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYE-YKLNKKVRRLGLKIALSARV  120

Query  643   CSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
               R K   F       +HKT+ ++     +   ++VL+VDG
Sbjct  121   AER-KLMLFDNVDLP-THKTRQLMKLVPNL-GCRRVLIVDG  158



>ref|XP_005850361.1| hypothetical protein CHLNCDRAFT_142203 [Chlorella variabilis]
 gb|EFN58259.1| hypothetical protein CHLNCDRAFT_142203 [Chlorella variabilis]
Length=322

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = -2

Query  1060  SDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQ  881
              DLL     L      GLY+DL+VP+ +   +  G + L GD+FDVPIR+DI+HRVVRWQ
Sbjct  78    EDLLLPAIPLEQQERQGLYRDLIVPLYDLSRQPVGTVTLGGDIFDVPIRRDILHRVVRWQ  137

Query  880   LAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATI  701
             LAKRQQGTH TKT SEV G GRKP PQKG+GR+R GT+R PQ+RGG   H P PRSH   
Sbjct  138   LAKRQQGTHKTKTRSEVRGGGRKPRPQKGSGRSRQGTIRAPQWRGGGVAHGPVPRSHEH-  196

Query  700   KLNKKVCRLGLKLDCFVSS  644
              L K+V RLGL+  C +S+
Sbjct  197   DLPKRVRRLGLQ--CALSA  213



>ref|XP_010467942.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Camelina 
sativa]
Length=136

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 86/143 (60%), Gaps = 43/143 (30%)
 Frame = -2

Query  943  AGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLR  764
            AGDVFDVPIRKDIIH VVRWQLAKRQQGTHST+T+SEVSGTGRKP+ QKGTGRARHGTLR
Sbjct  34   AGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTETLSEVSGTGRKPWNQKGTGRARHGTLR  93

Query  763  GPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKT  584
            GPQ                            L  D                     +HKT
Sbjct  94   GPQL---------------------------LVFDDL----------------ALHTHKT  110

Query  583  KNIVSYGQKMENAKKVLLVDGGP  515
            KNIV+Y  +ME  KKVL+V+GGP
Sbjct  111  KNIVNYYNQMEKTKKVLVVEGGP  133



>ref|XP_007212503.1| hypothetical protein PRUPE_ppa017710mg [Prunus persica]
 gb|EMJ13702.1| hypothetical protein PRUPE_ppa017710mg [Prunus persica]
Length=271

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 117/212 (55%), Gaps = 47/212 (22%)
 Frame = -2

Query  1147  FAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRN  968
             F+K    F A RR  TSI  P+S  G FPS+LL+ K V+  +  +G              
Sbjct  55    FSKARSSFLANRRLLTSISTPESSGGAFPSNLLSAKPVVASEGTIG--------------  100

Query  967   EDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTG  788
               KG   L G                          THSTKTISEVSGTGRKP+ QKGTG
Sbjct  101   TRKGHKTLLG--------------------------THSTKTISEVSGTGRKPWNQKGTG  134

Query  787   RARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFV-----SSCSRGKAH  623
             RAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+          +C + +  
Sbjct  135   RARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKIALTAREQRERNCMKLQLL  193

Query  622   GF*GYGTTFSHKTKNIVSYGQKMENAKKVLLV  527
              F  +    +HKTKNIV+Y Q+M+N+KK+LL+
Sbjct  194   VFDDFEVP-THKTKNIVNYVQQMDNSKKLLLL  224



>gb|ABC24932.1| plastid 50S ribosomal protein L4 family [Prototheca wickerhamii]
Length=228

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 101/166 (61%), Gaps = 14/166 (8%)
 Frame = -2

Query  1156  QFAFAKNEPIFFAL--RRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPV  983
             + A  +  P+F +L  RR STS++       + P+ L +         E     DLVVP+
Sbjct  25    RVATLQPAPVFASLFARRNSTSLI-------QEPTTLSSTPAAPAFGSE----ADLVVPL  73

Query  982   TNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYP  803
              N R    G   L GDVF+  +R DI+HRVVRWQLA RQQGTH TKT +EV G GRKP P
Sbjct  74    LNHRGRSVGSFTLGGDVFNTVVRPDILHRVVRWQLAARQQGTHKTKTRTEVRGGGRKPRP  133

Query  802   QKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKG G +R G++R PQ+RGG   H P PRSHA IKL K + RLGL+
Sbjct  134   QKGGGVSRQGSIRAPQWRGGGVAHGPVPRSHA-IKLLKSIRRLGLR  178



>gb|KFM28200.1| 50S ribosomal protein L4 [Auxenochlorella protothecoides]
Length=282

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  1060  SDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQ  881
             S LL +    T     G   DLVVP+ N R    G   L GDVF+  +R+DI+HRVVRWQ
Sbjct  46    SSLLQEASASTSTPAFGTEADLVVPLLNQRGRQVGTYTLGGDVFNTEVRRDILHRVVRWQ  105

Query  880   LAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATI  701
             LA RQQGTH TKT +EV G GRKP PQKG G +R G++R PQ+RGG   H P  RSHA I
Sbjct  106   LAARQQGTHKTKTRTEVRGGGRKPRPQKGGGVSRQGSIRAPQWRGGGVAHGPVTRSHA-I  164

Query  700   KLNKKVCRLGL  668
             KL K++ RLGL
Sbjct  165   KLLKRIRRLGL  175



>emb|CEF99633.1| Ribosomal protein L4/L1e [Ostreococcus tauri]
Length=331

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 97/168 (58%), Gaps = 6/168 (4%)
 Frame = -2

Query  1120  ALRRFSTSILAPDSGDGEFPSDLLTKKRVL----TLDRELGLYQDLVVPVTNFRNEDKGF  953
             A R   TS  A D+ D    +D    + V+    T+  E G  +D+VVP+  +    +G 
Sbjct  52    ATRAAKTSTEAEDASDAGEDADAAIDQGVMAVRWTVPEEQGSARDVVVPMHGWDGSVRGE  111

Query  952   MVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHG  773
               L G +FD P+R D+ HRVVRWQ AK + GTH TKT  EVSGT RK  PQKG GRAR G
Sbjct  112   ATLPGRIFDQPLRVDVAHRVVRWQRAKARAGTHKTKTRGEVSGTTRKARPQKGQGRARVG  171

Query  772   TLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
              LR PQ RGG   H P PRSHA   L KKV R+GLK+    +  + GK
Sbjct  172   MLRAPQMRGGGVAHGPVPRSHA-YALPKKVRRMGLKV-ALSARAAEGK  217



>ref|WP_038530645.1| 50S ribosomal protein L4 [Azospirillum brasilense]
 gb|EZQ08073.1| 50S ribosomal protein L4 [Azospirillum brasilense]
 gb|AIB11122.1| 50S ribosomal protein L4 [Azospirillum brasilense]
Length=206

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NE  G + LA +VF +P R DI+ R+V WQLAKR+ GTH TKTISE+SGTG+KPY
Sbjct  5    IKNLNNETVGEIELADEVFGLPSRTDILARMVNWQLAKRRAGTHKTKTISEISGTGKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R  QFRGG  +  P  RSH    L KKV +L LK     +  + GK 
Sbjct  65   RQKGTGRARQGSMRSAQFRGGATIFGPVVRSHEH-DLTKKVRKLALK-TALSTKAAEGKL  122

Query  625  HGF*GYGTTFSHKTKNI  575
                   +  SHKTK +
Sbjct  123  LVL-DAASAESHKTKEL  138



>ref|WP_014241037.1| 50S ribosomal protein L4 [Azospirillum brasilense]
 ref|YP_005032207.1| 50S ribosomal subunit protein L4 [Azospirillum brasilense Sp245]
 emb|CCC98837.1| 50S ribosomal subunit protein L4 [Azospirillum brasilense Sp245]
Length=208

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NE  G + LA ++F +P R DI+ R+V WQLAKR+ GTH TKTISE+SGTG+KPY
Sbjct  7    IKNLNNETVGEIELADEIFGLPSRTDILARMVNWQLAKRRAGTHKTKTISEISGTGKKPY  66

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R  QFRGG  +  P  RSH    L KKV +L LK     +  + GK 
Sbjct  67   RQKGTGRARQGSMRSAQFRGGATIFGPVVRSHEH-DLTKKVRKLALK-TALSTKAAEGKL  124

Query  625  HGF*GYGTTFSHKTKNI  575
                   +  SHKTK +
Sbjct  125  LVL-DAASAESHKTKEL  140



>ref|WP_011390437.1| 50S ribosomal protein L4 [Rhodospirillum rubrum]
 ref|YP_427771.1| 50S ribosomal protein L4 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006049019.1| 50S ribosomal protein L4 [Rhodospirillum rubrum F11]
 sp|Q2RQW1.1|RL4_RHORT RecName: Full=50S ribosomal protein L4 [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC23484.1| LSU ribosomal protein L4P [Rhodospirillum rubrum ATCC 11170]
 gb|AEO49222.1| 50S ribosomal protein L4 [Rhodospirillum rubrum F11]
Length=206

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 110/186 (59%), Gaps = 18/186 (10%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+  VF +P+R D++HR+VRWQLA+RQ GTH TK ISE+SGT  KP+
Sbjct  5    VKTLDGKDAGSIELSDSVFGLPVRTDLLHRMVRWQLARRQAGTHKTKGISEISGTTAKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTG AR G+ R PQFRGG  +  P  RSHA   LNKKV +LGLK    +S+ ++   
Sbjct  65   KQKGTGHARQGSKRSPQFRGGATIFGPVVRSHAH-DLNKKVRKLGLK--TALSAKAQAGQ  121

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGPQRKPQVGHSKYTLWQRFAFYCKY  446
                    + S KTK++++   K+   +KVL +DG     P+V        ++FA   + 
Sbjct  122  LIVLDQAISESGKTKDLLAQ-LKVLGLEKVLFIDG-----PEVN-------EKFALAAR-  167

Query  445  *NYIGI  428
             N IG+
Sbjct  168  -NIIGL  172



>ref|WP_009541273.1| 50S ribosomal protein L4 [Caenispirillum salinarum]
 gb|EKV29308.1| LSU ribosomal protein L4p (L1e) [Caenispirillum salinarum AK4]
Length=206

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 95/157 (61%), Gaps = 4/157 (3%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V    N+  G + LA D+F + +R D++HRVVRWQLAKRQ GTH TK ISE+SGT +K
Sbjct  3    VDVITLDNKSAGSVELAEDIFGLDVRADLLHRVVRWQLAKRQAGTHKTKGISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            P+ QKGTG AR G++R PQFRGG  +  P  RSHA   L KKV +LGLK     +    G
Sbjct  63   PFRQKGTGHARQGSMRSPQFRGGATIFGPVVRSHAH-DLPKKVRKLGLKT-ALSAKAKDG  120

Query  631  KAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
            K        T+ S KTK++V     +      L++DG
Sbjct  121  KLVVL-DTATSESGKTKDLVKQLAAL-GWSSALIIDG  155



>ref|WP_038461578.1| 50S ribosomal protein L4 [Candidatus Caedibacter acanthamoebae]
 gb|AIL12571.1| 50S ribosomal protein L4 [Candidatus Caedibacter acanthamoebae]
Length=206

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 95/160 (59%), Gaps = 4/160 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N+  G + LA ++F +P+R+DI+ RVV WQLAKR+ GTH T+ IS++SGT RKP+
Sbjct  5    IINLENKKIGQIELASEIFGLPLRRDILARVVNWQLAKRRAGTHKTRGISDISGTTRKPW  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+LR PQFRGG  +  P  R H    L KKV RLGL +    S  S GK 
Sbjct  65   KQKGTGRARQGSLRSPQFRGGAVIFGPVVRDHGY-SLQKKVRRLGL-MTALSSKLSEGKL  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGPQRK  506
                      S KT++ +   +K+   K  L VDG    K
Sbjct  123  FIVDSLEQQ-SPKTQDAIKNLEKL-GLKNALFVDGAEVNK  160



>gb|ABA98275.1| ribosomal protein L4/L1 family protein [Oryza sativa Japonica 
Group]
Length=288

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 117/213 (55%), Gaps = 22/213 (10%)
 Frame = -2

Query  1147  FAKNEPIFFALRRFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRN  968
              A N P      R+ST  L   S +   P +LL+ + V T +R++G Y+DLV  +TNF  
Sbjct  40    LAMNIPAV-CFSRYST--LVTPSDEVLVPPELLSSRTVGTPERKIGQYEDLVARITNFTM  96

Query  967   EDKG---FMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQK  797
               +    +MV+            ++ +  R    +   G       + +     KPY QK
Sbjct  97    RIRATWCWMVMY-----------LMFQSGRTLFIELYVGNLLNG--NSILCIYIKPYKQK  143

Query  796   GTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF  617
             GTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F
Sbjct  144   GTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVF  201

Query  616   *GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                    SHKTKN+VSY  +ME+ KKVLLVDGG
Sbjct  202   EDLEVP-SHKTKNVVSYISQMEDTKKVLLVDGG  233


 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 89/175 (51%), Gaps = 18/175 (10%)
 Frame = -3

Query  969  MKIRVLWCWLVMFSMCQLGRTLYIVL*DGSLLNGSREHIrlkllvrsvglggsLIRRRVQ  790
            M+IR  WCW+VM+ M Q GRTL+I L  G+LLNG+                   I  +  
Sbjct  96   MRIRATWCWMVMYLMFQSGRTLFIELYVGNLLNGN---------------SILCIYIKPY  140

Query  789  VEQGMGHSVALSFVAVQL---CMFQSPEVMLLSS*TRRFVDla*s*ialsaraAEGKLMV  619
             ++G G +   +    Q         P+    +   ++ V      IALSAR AEGKL+V
Sbjct  141  KQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV  200

Query  618  FEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVALNENLKLATQNIHYGNVLPSI  454
            FED+E+PSH     +  +++     K   +    +++ LKLATQN+HY NVLPSI
Sbjct  201  FEDLEVPSHKTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSI  255



>ref|WP_029013604.1| 50S ribosomal protein L4 [Niveispirillum irakense]
Length=206

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 97/157 (62%), Gaps = 6/157 (4%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V N +NE  G + L+ DVF +P R+DI+ R+V WQLAKR+ GTH TK ISE+SGT +KP+
Sbjct  5    VKNLKNETVGEIELSEDVFGLPARQDILARMVLWQLAKRRAGTHKTKGISEISGTTKKPW  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R PQFRGG  +  P  RSH    + KKV +L LK    V +   GK 
Sbjct  65   RQKGTGRARQGSVRSPQFRGGARIFGPVVRSHEH-DMTKKVRKLALKTALSVKAAE-GKL  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQ-KMENAKKVLLVDGG  518
                    T +HKTK  V +GQ +    K  L++DG 
Sbjct  123  VVL-ESAATETHKTK--VLFGQLQALGLKSALIIDGA  156



>ref|WP_035675055.1| 50S ribosomal protein L4 [Azospirillum brasilense]
Length=206

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NE  G + LA ++F +P R DI+ R+V WQLAKR+ G H TKT+SE+SGTG+KPY
Sbjct  5    IKNLNNETVGEIELADEIFGLPSRTDILARMVNWQLAKRRAGNHKTKTVSEISGTGKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R  QFRGG  +  P  RSH    L KKV +L LK     +  + GK 
Sbjct  65   RQKGTGRARQGSMRSAQFRGGATIFGPVVRSHEH-DLTKKVRKLALK-TALSTKAAEGKL  122

Query  625  HGF*GYGTTFSHKTKNI  575
                   +  SHKTK +
Sbjct  123  LVL-DAASAESHKTKEL  138



>ref|WP_029009701.1| 50S ribosomal protein L4 [Azospirillum halopraeferens]
Length=206

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 4/156 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NED G + L+  +F + +R D++HR+V WQLAKR+ G H TK ISE+SGT +KPY
Sbjct  5    IKNLNNEDVGEIELSDAIFGLAVRTDLLHRMVNWQLAKRRAGNHKTKGISEISGTTKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+ R PQFRGG  +  P  RSHA   L KKV +L LK     +  + GK 
Sbjct  65   RQKGTGRARQGSTRSPQFRGGATIFGPVVRSHAH-DLTKKVRKLALK-TALSAKAADGKL  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                      +HKTK + S    +  A   L++DG 
Sbjct  123  IVL-DDAKAETHKTKELASRLSNLGLA-SALIIDGA  156



>ref|WP_011114492.1| 50S ribosomal protein L4 [Anaplasma marginale]
 ref|YP_154076.1| 50S ribosomal protein L4 [Anaplasma marginale str. St. Maries]
 ref|YP_002563787.1| 50S ribosomal protein L4 [Anaplasma marginale str. Florida]
 ref|YP_008769655.1| 50S ribosomal protein L4 [Anaplasma marginale str. Dawn]
 ref|YP_008786214.1| 50S ribosomal protein L4 [Anaplasma marginale str. Gypsy Plains]
 sp|Q5PA59.1|RL4_ANAMM RecName: Full=50S ribosomal protein L4 [Anaplasma marginale str. 
St. Maries]
 sp|B9KJ69.1|RL4_ANAMF RecName: Full=50S ribosomal protein L4 [Anaplasma marginale str. 
Florida]
 gb|AAV86821.1| 50S ribosomal protein L4 [Anaplasma marginale str. St. Maries]
 gb|ACM49531.1| 50S ribosomal protein L4 (rplD) [Anaplasma marginale str. Florida]
 gb|AGZ79026.1| 50S ribosomal protein L4 [Anaplasma marginale str. Gypsy Plains]
 gb|AGZ79836.1| 50S ribosomal protein L4 [Anaplasma marginale str. Dawn]
Length=208

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N +NE  G + L+ +VF V +R+D++  VV WQLAKR+ GTH T+ IS+VSGT  K
Sbjct  3    VNVVNIKNEVVGKVQLSAEVFGVQLRRDVLRDVVTWQLAKRRAGTHKTRCISDVSGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVVFGPVNRSHA-YSLNKKVRRLGLKV  111



>ref|WP_037352444.1| 50S ribosomal protein L4 [Anaplasma marginale]
Length=208

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N +NE  G + L+ +VF V +R+D++  VV WQLAKR+ GTH T+ IS+VSGT  K
Sbjct  3    VNVVNIKNEVVGKVQLSAEVFGVQLRRDVLRDVVTWQLAKRRAGTHKTRCISDVSGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVVFGPVNRSHA-YSLNKKVRRLGLKV  111



>ref|NP_001066789.2| Os12g0488600 [Oryza sativa Japonica Group]
 dbj|BAF29808.2| Os12g0488600 [Oryza sativa Japonica Group]
Length=346

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 125/239 (52%), Gaps = 36/239 (15%)
 Frame = -2

Query  1111  RFSTSILAPDSGDGEFPSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKG---FMVLA  941
             R+ST  L   S +   P +LL+ + V T +R++G Y+DLV  +TNF    +    +MV+ 
Sbjct  86    RYST--LVTPSDEVLVPPELLSSRTVGTPERKIGQYEDLVARITNFTMRIRATWCWMVMY  143

Query  940   GDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRG  761
                        ++ +  R    +   G       + +     KPY QKGTGRARHGTLRG
Sbjct  144   -----------LMFQSGRTLFIELYVGNLLNG--NSILCIYIKPYKQKGTGRARHGTLRG  190

Query  760   PQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTK  581
             PQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + GK   F       SHKTK
Sbjct  191   PQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAEGKLLVFEDLEVP-SHKTK  247

Query  580   NIVSYGQKMENAKKVLLVDGGPQRK---------------PQVGHSKYTLWQRFAFYCK  449
             N+VSY  +ME+ KKVLLVDGG   K               P +G + Y++ Q    + K
Sbjct  248   NVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVYSILQHDTLWLK  306


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 99/200 (50%), Gaps = 28/200 (14%)
 Frame = -3

Query  972  VMKIRVLWCWLVMFSMCQLGRTLYIVL*DGSLLNGSREHIrlkllvrsvglggsLIRRRV  793
             M+IR  WCW+VM+ M Q GRTL+I L  G+LLNG+                   I  + 
Sbjct  130  TMRIRATWCWMVMYLMFQSGRTLFIELYVGNLLNGN---------------SILCIYIKP  174

Query  792  QVEQGMGHSVALSFVAVQL---CMFQSPEVMLLSS*TRRFVDla*s*ialsaraAEGKLM  622
              ++G G +   +    Q         P+    +   ++ V      IALSAR AEGKL+
Sbjct  175  YKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLL  234

Query  621  VFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLPSIVSI  445
            VFED+E+PSH K + + +   +    KK  L+    +++ LKLATQN+HY NVLPSI   
Sbjct  235  VFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSI---  290

Query  444  RTTSVSLMVYTHLSALDTWL  385
                  L VY+ L     WL
Sbjct  291  -----GLNVYSILQHDTLWL  305



>ref|WP_021999220.1| 50S ribosomal protein L4 [Acetobacter sp. CAG:977]
 emb|CCZ21535.1| 50S ribosomal protein L4 [Acetobacter sp. CAG:977]
Length=206

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 93/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N++ G + L+  VF V +R DI+ RVV WQLA R+ GTH TKTI+EVSGT +KPY
Sbjct  5    IVNLDNQNVGSIELSDSVFGVDVRSDILSRVVNWQLANRRAGTHKTKTIAEVSGTTKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+LR  QFRGG     P  RSHA   L KK+ RLG++  C +SS ++   
Sbjct  65   KQKGTGRARQGSLRATQFRGGGISFGPVVRSHAQ-DLPKKIRRLGMR--CALSSKAQNGK  121

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                        KTK +VS  +KM   K  L V G 
Sbjct  122  LVVVDALKLPEVKTKELVSKMEKM-GLKSALFVGGA  156



>ref|WP_012565934.1| 50S ribosomal protein L4 [Rhodospirillum centenum]
 ref|YP_002296956.1| 50S ribosomal protein L4 [Rhodospirillum centenum SW]
 sp|B6IRQ7.1|RL4_RHOCS RecName: Full=50S ribosomal protein L4 [Rhodospirillum centenum 
SW]
 gb|ACI98143.1| ribosomal protein L4 [Rhodospirillum centenum SW]
Length=206

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 4/156 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V N  NE  G + LA +VF +P R+DI+ R+V WQLAKR+QGTH TK ISE++GT +KP+
Sbjct  5    VKNLNNETVGEIELADEVFGLPTRQDILTRMVLWQLAKRRQGTHKTKGISEIAGTTKKPW  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+ R PQFRGG  +  P  RSH    L KKV +L LK     +  + GK 
Sbjct  65   RQKGTGRARQGSTRSPQFRGGARIFGPVVRSHEH-DLTKKVRKLALK-TALSTKAAEGKL  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                      +HKTK + +  + +      L++DG 
Sbjct  123  FVL-EAAKADTHKTKALAAQLKTL-GLTSALIIDGA  156



>ref|WP_014746146.1| 50S ribosomal protein L4 [Tistrella mobilis]
 ref|YP_006372053.1| 50S ribosomal protein L4P [Tistrella mobilis KA081020-065]
 gb|AFK54469.1| 50S ribosomal protein L4P [Tistrella mobilis KA081020-065]
Length=207

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V    NED G + LA +VF +P R DI+HR+VR+QLAKR+ GTH  KTISE++G+  K
Sbjct  3    VKVITLDNEDAGTIALADEVFGLPARVDILHRMVRYQLAKRRAGTHKVKTISEIAGSTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARHG  R   FRGG  +H P  RSHA   L KKV RL LK
Sbjct  63   IYRQKGTGRARHGAKRANIFRGGATVHGPVVRSHAH-DLPKKVRRLALK  110



>ref|WP_014246890.1| 50S ribosomal protein L4 [Azospirillum lipoferum]
 ref|YP_005038088.1| 50S ribosomal protein L4 [Azospirillum lipoferum 4B]
 emb|CBS85835.1| 50S ribosomal subunit protein L4 [Azospirillum lipoferum 4B]
Length=209

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 3/139 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NE  G + L+  VF +P R D++ R+V WQLAKR+ G H TK ISE+SGT +KPY
Sbjct  8    IKNLNNEAVGEIELSDAVFGLPTRTDLLARMVNWQLAKRRSGNHKTKGISEISGTTKKPY  67

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R PQFRGG  +  P  RSHA   L KKV +L LK     +  + GK 
Sbjct  68   SQKGTGRARQGSIRSPQFRGGATIFGPVVRSHAH-DLTKKVRKLALK-TALSAKAAEGKL  125

Query  625  HGF*GYGTTFSHKTKNIVS  569
                      +HKTK + +
Sbjct  126  IVL-EAAAAETHKTKELAA  143



>ref|WP_012973206.1| 50S ribosomal protein L4 [Azospirillum lipoferum]
 ref|YP_003447764.1| 50S ribosomal protein L4 [Azospirillum sp. B510]
 dbj|BAI71220.1| large subunit ribosomal protein L4 [Azospirillum sp. B510]
Length=206

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 85/139 (61%), Gaps = 3/139 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  NE  G + L+  VF +P R D++ R+V WQLAKR+ G H TK ISE+SGT +KPY
Sbjct  5    IKNLNNEAVGEIELSDAVFGLPARTDLLARMVNWQLAKRRSGNHKTKGISEISGTTKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R PQFRGG  +  P  RSHA  +L KKV +L LK     +  + GK 
Sbjct  65   GQKGTGRARQGSIRSPQFRGGATIFGPVVRSHAH-ELTKKVRKLALK-TALSAKAAEGKL  122

Query  625  HGF*GYGTTFSHKTKNIVS  569
                      +HKTK + +
Sbjct  123  IVL-EAAAAETHKTKELAA  140



>ref|WP_007678342.1| 50S ribosomal protein L4 [alpha proteobacterium BAL199]
 gb|EDP62456.1| 50S ribosomal protein L2 [alpha proteobacterium BAL199]
Length=206

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VTN   E  G + L   +F +  R+DI+ RVV WQLAKR+ G H TK+ISE+SGT +K
Sbjct  3    LEVTNLDAEKTGEIDLDDSIFGLDPRRDILARVVNWQLAKRRSGNHKTKSISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            P+ QKGTGRAR G++R  QFRGG  +H P  RSHA   L KKV +LGLK  C +S+  + 
Sbjct  63   PFRQKGTGRARQGSIRATQFRGGQTVHGPVVRSHAH-DLPKKVRKLGLK--CALSAKLKS  119

Query  631  KAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
                     +T   KTK + +  +K+   + VL++DG
Sbjct  120  GQLIVLDAASTDEAKTKLLAAKFEKL-GWQSVLVIDG  155



>gb|EKE09117.1| hypothetical protein ACD_16C00213G0040 [uncultured bacterium]
Length=206

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (60%), Gaps = 8/157 (5%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V NF N+  G + L+ ++F  P+R+DI+ R+V WQLAKR+ G H+TK IS++SGT +KP+
Sbjct  5    VRNFDNKKVGEIKLSPEIFSAPLRQDILARMVHWQLAKRRSGNHATKGISQISGTTKKPW  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+LR PQFRGG  +  P  RSH +  L KKV +L LK     ++ S   A
Sbjct  65   RQKGTGRARQGSLRSPQFRGGAVIFGPVTRSH-SYSLPKKVRQLALK-----TALSSKAA  118

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMEN--AKKVLLVDG  521
             G            K      +K+EN   +  L++DG
Sbjct  119  SGALLVVEDLKAGVKKTKDLAKKLENLGLRSALIIDG  155



>ref|WP_031934484.1| 50S ribosomal protein L4 [Candidatus Hepatobacter penaei]
Length=205

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V +  +++ G + L   VF  P+R DI+ RVVRWQLAKRQ GTH TK IS VSGT RK
Sbjct  3    VSVCSIESKEVGHLDLDPRVFLRPLRSDILARVVRWQLAKRQAGTHQTKGISNVSGTTRK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QKGTGRAR G+LR PQFRGG  +  P+ RSHA   L K+V RLGL +
Sbjct  63   PYKQKGTGRARQGSLRSPQFRGGGIIFGPQVRSHAH-ALPKRVRRLGLSV  111



>ref|XP_001420312.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO98605.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus lucimarinus 
CCE9901]
Length=224

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = -2

Query  1030  TLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHS  851
             T+    G  +D VVPV +F  E +G + L G +FD P+R D+ HRVVRWQ AK ++G H 
Sbjct  6     TIAEGQGRGEDAVVPVYSFDGEARGSVELPGRIFDQPLRVDVAHRVVRWQRAKARKGLHK  65

Query  850   TKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLG  671
             TK+  EV+G+ RK  PQKG+GRAR G L+ PQ RGG   H P  RSHA   L KKV R+G
Sbjct  66    TKSRGEVAGSTRKVRPQKGSGRARVGNLKAPQMRGGGTAHGPVVRSHAH-ALPKKVRRMG  124

Query  670   LKLDCFVSSCSRGK  629
             LK+    +  + GK
Sbjct  125   LKV-ALSAKAAEGK  137



>ref|WP_027302615.1| 50S ribosomal protein L4 [Rhodospirillales bacterium URHD0088]
Length=206

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + + N  N+D G + L+ DVF V +R DI+ R+V WQLAKR+ GTH TK IS++ GT +K
Sbjct  3    LTMKNLDNQDAGEIELSDDVFGVAVRPDILARMVNWQLAKRRAGTHKTKGISDIQGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            P+ QKG GRAR G+LR PQFRGG  +  P  RSHA   L KKV RL LK
Sbjct  63   PFKQKGGGRARQGSLRSPQFRGGAVIFGPVVRSHA-FGLQKKVRRLALK  110



>ref|WP_011385498.1| 50S ribosomal protein L4 [Magnetospirillum magneticum]
 ref|YP_422492.1| 50S ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
 sp|Q2W2J2.1|RL4_MAGSA RecName: Full=50S ribosomal protein L4 [Magnetospirillum magneticum 
AMB-1]
 dbj|BAE51933.1| Ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
Length=206

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +  N+  G + LA ++F VP+R DI+ R V WQLAKRQ G H TKTISE+SGT +KP+
Sbjct  5    VISLDNQTVGEIELADEIFGVPVRGDILFRAVNWQLAKRQSGNHKTKTISEISGTTKKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKG GRAR G+LR  QFRGG+ +  P  RSHA   L KKV +L LK
Sbjct  65   AQKGGGRARQGSLRSAQFRGGSTIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_038603371.1| 50S ribosomal protein L4 [Rickettsiales bacterium Ac37b]
 gb|AIL65576.1| Ribosomal protein L4 [Rickettsiales bacterium Ac37b]
Length=206

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +  N+  G + L+ ++F++P R+DI+HRV+ WQ AKR+ GTH TKT+ EVSGT +KPY
Sbjct  5    VLSLENKVVGEIQLSQEIFNLPNREDILHRVIEWQRAKRRAGTHKTKTVGEVSGTTKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTG AR G+LR  QFRGG  +  P  RSHA   L KKV +LGLK
Sbjct  65   KQKGTGHARQGSLRSGQFRGGATIFGPNVRSHA-YDLPKKVRKLGLK  110



>ref|WP_012880531.1| 50S ribosomal protein L4 [Anaplasma centrale]
 ref|YP_003328372.1| 50S ribosomal protein L4 [Anaplasma centrale str. Israel]
 gb|ACZ49058.1| 50S ribosomal protein L4 [Anaplasma centrale str. Israel]
Length=208

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N +NE  G + L   VF V  R+D++  VV WQLAKR+ GTH T+ IS+V GT  K
Sbjct  3    VNVVNIKNEVVGQLELNASVFGVQPRRDVLRDVVDWQLAKRRAGTHKTRCISDVRGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVVFGPVNRSHA-YSLNKKVRRLGLKV  111



>ref|WP_028466778.1| 50S ribosomal protein L4 [Nisaea denitrificans]
Length=205

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            +PVT   N+  G + +A  VF V  R+DI+ RVV WQLAKR+ GTH+TKT+S+VSGT +K
Sbjct  3    LPVTTLDNKKSGDIEVADSVFAVEPRRDILARVVNWQLAKRRAGTHATKTVSQVSGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            P+ QKGTGRAR G+LR  Q+RGG   H P  R H    L KKV +LG++     S+ S  
Sbjct  63   PFKQKGTGRARAGSLRATQYRGGGISHGPMSRDHG-FALPKKVRKLGMR-----SALSAK  116

Query  631  KAHG  620
            +A G
Sbjct  117  QAEG  120



>ref|WP_036480288.1| 50S ribosomal protein L4 [Nitratireductor basaltis]
 gb|KFB09930.1| 50S ribosomal protein L4 [Nitratireductor basaltis]
Length=206

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V VT    +D G + L+  +F +  R+DIIHRV+RWQLAKRQQGTH TK  +E++ TG K
Sbjct  3    VKVTTLAGKDAGKVALSDAIFGLDPREDIIHRVIRWQLAKRQQGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA  +L KKV  LGLK
Sbjct  63   MYRQKGTGRARHSSARVPQFRGGGRAHGPVVRSHAH-ELPKKVRALGLK  110



>ref|WP_019646044.1| 50S ribosomal protein L4 [Novispirillum itersonii]
Length=205

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V    N+  G + L  ++F + +R DI+ RVVRWQLAKRQ GTH TKTISE+SGT +K
Sbjct  3    LDVITLDNKAVGTVELPENIFGLEVRSDILQRVVRWQLAKRQAGTHKTKTISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            P+ QKGTGRAR G+ R  QFRGG+ +  P  RSHA   L KK   LGLK
Sbjct  63   PFKQKGTGRARQGSTRSAQFRGGSTIFGPVVRSHAH-DLTKKFRALGLK  110



>ref|WP_037453613.1| 50S ribosomal protein L4 [Skermanella stibiiresistens]
 gb|EWY39879.1| 50S ribosomal protein L4 [Skermanella stibiiresistens SB22]
Length=206

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V N  NE+ G + L   VF VP+R D++ R++ +QLAKR+ G H TK ISE++GT +KP+
Sbjct  5    VKNLNNEEVGEIELDEAVFGVPLRTDLLARMINYQLAKRRSGNHKTKGISEIAGTTKKPH  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G+ R PQFRGG  +  P  RSHA   LNKKV +L LK     +  + GK 
Sbjct  65   RQKGTGRARQGSTRSPQFRGGAVIFGPVVRSHAH-DLNKKVRKLALK-TALSTKLAEGKL  122

Query  625  HGF*GYGTTFSHKTKNI  575
                      SHKTK++
Sbjct  123  VVL-ETAAVDSHKTKDM  138



>ref|WP_008615456.1| 50S ribosomal protein L4 [Magnetospirillum sp. SO-1]
 gb|EME70956.1| 50S ribosomal protein L4 [Magnetospirillum sp. SO-1]
Length=206

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +  N+  G + LA ++F +P+R DI+ R V WQLAKRQ G H TKTISE+SGT +KP+
Sbjct  5    VISLDNQTVGEIELADEIFGLPVRGDILFRAVNWQLAKRQSGNHKTKTISEISGTTKKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKG GRAR G+LR  QFRGG  +  P  RSHA   L KKV +L LK
Sbjct  65   AQKGGGRARQGSLRSAQFRGGATIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_014414488.1| 50S ribosomal protein L4 [Rhodospirillum photometricum]
 ref|YP_005416819.1| 50S ribosomal protein L4 [Rhodospirillum photometricum DSM 122]
 emb|CCG07849.1| 50S ribosomal protein L4 [Rhodospirillum photometricum DSM 122]
Length=206

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 105/186 (56%), Gaps = 18/186 (10%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V      + G + L+  VF +P+R D++HR+VRWQLAKRQ GTH TK ISE+SGT  KP+
Sbjct  5    VKTLDGANAGSVELSEAVFGLPVRADLLHRLVRWQLAKRQAGTHKTKGISEISGTTAKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTG AR G+ R PQFRGG  +  P  RSHA   L KKV +LGLK     +  + G+ 
Sbjct  65   KQKGTGNARQGSKRSPQFRGGATIFGPVVRSHAH-DLPKKVRKLGLK-TALSAKVAAGEI  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGPQRKPQVGHSKYTLWQRFAFYCKY  446
                    + + KTK++++  + +    K L +DG     P+V        ++FA   + 
Sbjct  123  LIL-DQAKSENGKTKDLLAQVKAL-GLNKALFIDG-----PEVD-------EKFALAAR-  167

Query  445  *NYIGI  428
             N +GI
Sbjct  168  -NIVGI  172



>ref|WP_015468375.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus]
 ref|YP_007643476.1| LSU ribosomal protein L4p (L1e) [Micavibrio aeruginosavorus EPB]
 gb|AGH98856.1| LSU ribosomal protein L4p (L1e) [Micavibrio aeruginosavorus EPB]
Length=207

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N +N++ G + L   +F + +R DI+HR+V +QL KR+ GTH TK I EVSGTG+K
Sbjct  3    VAVKNLQNKEVGQIDLDDAIFGMSVRNDILHRMVHFQLNKRRAGTHDTKEIGEVSGTGKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            P+ QKGTG  R G+LR PQ RGG  +  P PRSHAT  L KKV  L LK
Sbjct  63   PFKQKGTGNGRQGSLRSPQMRGGAVIFGPTPRSHAT-DLPKKVRALALK  110



>ref|WP_014103663.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus]
 ref|YP_004866442.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus ARL-13]
 gb|AEP10440.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus ARL-13]
Length=207

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N +N++ G + L   +F + +R DI+HR+V +QL KR+ GTH TK I EVSGTG+K
Sbjct  3    VAVKNLQNKEVGQIDLDDAIFGMSVRNDILHRMVHFQLNKRRAGTHDTKEIGEVSGTGKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            P+ QKGTG  R G+LR PQ RGG  +  P PRSHAT  L KKV  L LK
Sbjct  63   PFKQKGTGNGRQGSLRSPQMRGGAVIFGPTPRSHAT-DLPKKVRALALK  110



>ref|WP_011477720.1| 50S ribosomal protein L4 [Rickettsia bellii]
 ref|YP_538231.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 ref|YP_001495829.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
 sp|Q1RHM2.1|RL4_RICBR RecName: Full=50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 sp|A8GVB5.1|RL4_RICB8 RecName: Full=50S ribosomal protein L4 [Rickettsia bellii OSU 
85-389]
 gb|ABE05142.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 gb|ABV78792.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
Length=207

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 5/157 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + N  NE+ G + L  D+F V  IR DII +VV WQ AK   GTH TKT+SEVSGT +KP
Sbjct  5    ILNLANEEIGEISLNEDIFAVEFIRDDIIKQVVDWQRAKAMAGTHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG  +H P  RSHAT KL KKV +LGL +       S GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVIHGPVVRSHAT-KLPKKVRKLGL-IHALSEKFSEGK  122

Query  628  AHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
                       + KT N+V+   K +  K   ++DG 
Sbjct  123  LLVIDSLKLE-TPKTSNLVNILNKFQ-GKSFFVIDGN  157



>ref|WP_011450416.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum]
 ref|YP_504893.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. HZ]
 ref|YP_008332423.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. HZ2]
 ref|YP_008333669.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. JM]
 ref|YP_008334929.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. Dog2]
 sp|Q2GL58.1|RL4_ANAPZ RecName: Full=50S ribosomal protein L4 [Anaplasma phagocytophilum 
str. HZ]
 gb|ABD43319.1| ribosomal protein L4 [Anaplasma phagocytophilum str. HZ]
 gb|EOA61856.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. HGE1]
 gb|AGR78698.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. HZ2]
 gb|AGR79945.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. JM]
 gb|AGR81200.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. Dog2]
 gb|KDB55487.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. Norway 
variant2]
 gb|KDB56589.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. MRK]
 emb|CEG21043.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum]
Length=208

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V + N  NE  G + L   VF +  R+D++  VV WQLAKR+ GTH  K IS++SGT  K
Sbjct  3    VNIVNIANEVVGSIDLNPQVFGLEPRRDVLKEVVNWQLAKRRAGTHKAKGISDISGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P PRSH    LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVPRSH-EYSLNKKVRRLGLKV  111



>ref|WP_011581015.1| 50S ribosomal protein L4 [Chelativorans sp. BNC1]
 ref|YP_674237.1| 50S ribosomal protein L4 [Chelativorans sp. BNC1]
 sp|Q11HQ3.1|RL4_CHESB RecName: Full=50S ribosomal protein L4 [Chelativorans sp. BNC1]
 gb|ABG63072.1| LSU ribosomal protein L4P [Chelativorans sp. BNC1]
Length=206

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT    +D G + ++ ++F +  R+DI+HRVVRWQLAKRQQGTH  K  +E++ TG K
Sbjct  3    LKVTTLAGKDAGKVEVSDEIFGLDPREDILHRVVRWQLAKRQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P P SHA   L KKV  LGLK
Sbjct  63   MYRQKGTGRARHSSARAPQFRGGGKAHGPVPHSHAH-DLPKKVRALGLK  110



>ref|WP_008494543.1| MULTISPECIES: 50S ribosomal protein L4 [Acidocella]
 gb|EKM99183.1| 50S ribosomal protein L4 [Acidocella sp. MX-AZ02]
Length=204

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 98/188 (52%), Gaps = 23/188 (12%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +F  +  G + L  ++F    R DII RV+ WQLAKR+ GTH  K + EVSGT RKPY
Sbjct  5    VVDFDAKAAGSVELPDELFAAEPRVDIIARVIHWQLAKRRAGTHKVKGMGEVSGTTRKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTG AR G+LR PQFR G A+H P  R H    LNKKV RLGL +    +  + GK 
Sbjct  65   KQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YSLNKKVRRLGL-ISALSAKAAEGKL  122

Query  625  HGF*GYGTTFSHKTKNIVSYGQKMEN--AKKVLLVDGGPQRK--------------PQVG  494
                G       KTK++ +   K+ N   K  L+VD   + K              P VG
Sbjct  123  VVLDGVAAL--DKTKDVAA---KVANFGWKSALIVDAAVEEKFGRASRNVKGLDVLPVVG  177

Query  493  HSKYTLWQ  470
             + Y + Q
Sbjct  178  ANVYDIMQ  185



>ref|WP_011191090.1| 50S ribosomal protein L4 [Rickettsia typhi]
 ref|YP_067595.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
 ref|YP_005427714.1| 50S ribosomal protein L4 [Rickettsia typhi str. TH1527]
 ref|YP_005423953.1| 50S ribosomal protein L4 [Rickettsia typhi str. B9991CWPP]
 sp|Q68W79.1|RL4_RICTY RecName: Full=50S ribosomal protein L4 [Rickettsia typhi str. 
Wilmington]
 gb|AAU04113.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
 gb|AFE54492.1| 50S ribosomal protein L4 [Rickettsia typhi str. TH1527]
 gb|AFE55331.1| 50S ribosomal protein L4 [Rickettsia typhi str. B9991CWPP]
Length=207

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H PK RSHA IKL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSIQMRGGGISHGPKVRSHA-IKLPKKVRKLGL-IHALSEKCAAGK  122



>gb|KDB57419.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. CRT35]
Length=208

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V + N  NE  G + L   VF +  R+D++  VV WQLAKR+ GTH  K IS++SGT  K
Sbjct  3    VNIVNIANEVVGSIDLNPRVFGLEPRRDVLKEVVNWQLAKRRAGTHKAKGISDISGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P PRSH    LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVPRSH-EYSLNKKVRRLGLKV  111



>ref|WP_021799353.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum]
 gb|EOA63078.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum str. CRT38]
Length=208

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V + N  NE  G + L   VF +  R+D++  VV WQLAKR+ GTH  K IS++SGT  K
Sbjct  3    VNIVNIANEVVGSIDLNPRVFGLEPRRDVLKEVVNWQLAKRRAGTHKAKGISDISGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            PY QK TGRAR G+LR PQFRGG  +  P PRSH    LNKKV RLGLK+
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVPRSHG-YSLNKKVRRLGLKV  111



>ref|WP_026873856.1| 50S ribosomal protein L4 [Inquilinus limosus]
Length=206

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V  F N   G + L   VF + +R D++HR+V WQLAKR+ G H TK ISE+SGT +K
Sbjct  3    VAVKTFDNTTAGEIDLDDSVFGLEVRTDLLHRMVNWQLAKRRSGNHKTKGISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            PY QKGTG AR G++R PQFRGG  +  P  RSHA   L KKV +L L+     +  + G
Sbjct  63   PYKQKGTGHARQGSMRSPQFRGGARIFGPVVRSHAH-DLPKKVRKLALR-HALSAKAAEG  120

Query  631  KAHGF*GYGTTFSHKTKNIVS  569
            K           SHKTK + +
Sbjct  121  KLVVV-DAVVADSHKTKGLAA  140



>ref|WP_008597559.1| 50S ribosomal protein L4 [Nitratireductor pacificus]
 gb|EKF18437.1| 50S ribosomal protein L4 [Nitratireductor pacificus pht-3B]
Length=206

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT     D G + ++ ++F +  R DI+HRVVRWQLAK+QQGTH +K  +E+S TG K
Sbjct  3    IKVTTLTGTDAGKLKISDEIFGLEPRDDILHRVVRWQLAKKQQGTHKSKGRAEISRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLK  110



>gb|EEE53224.1| hypothetical protein OsJ_36122 [Oryza sativa Japonica Group]
Length=227

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = -2

Query  814  KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  635
            +PY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + 
Sbjct  77   QPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAE  134

Query  634  GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGG  518
            GK   F       SHKTKN+VSY  +ME+ KKVLLVDGG
Sbjct  135  GKLLVFEDLEVP-SHKTKNVVSYISQMEDTKKVLLVDGG  172


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -3

Query  636  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKFCLLMVA-LNENLKLATQNIHYGNVLP  460
            EGKL+VFED+E+PSH K + + +   +    KK  L+    +++ LKLATQN+HY NVLP
Sbjct  134  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  192

Query  459  SI  454
            SI
Sbjct  193  SI  194



>ref|WP_027677428.1| 50S ribosomal protein L4 [Agrobacterium larrymoorei]
Length=206

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH +K  SEVS TG K Y
Sbjct  5    VKTLEGKDAGKVALSDEIFGLDPRQDILARVVRWQLAKKQQGTHKSKNRSEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+L
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLRL  111



>ref|WP_028035639.1| 50S ribosomal protein L4 [Chelativorans sp. J32]
Length=206

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT     D G + ++ ++F +  R+DI+HRVVRWQLAKRQQGTH  K  +E++ TG K
Sbjct  3    LKVTTLAGADAGKLEVSDEIFGLDPREDILHRVVRWQLAKRQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P P SH   +L KKV  LGLK
Sbjct  63   MYRQKGTGRARHSSARAPQFRGGGKAHGPVPHSHEH-ELPKKVRALGLK  110



>ref|WP_007009513.1| 50S ribosomal protein L4 [Nitratireductor aquibiodomus]
 gb|EIM73281.1| 50S ribosomal protein L4 [Nitratireductor aquibiodomus RA22]
Length=206

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT    +D G + ++ ++F +  R+DI+HRVVRWQLAK+QQGTH TK  SE+S TG K
Sbjct  3    IKVTTLAGKDAGKLKISDEIFGLDPREDILHRVVRWQLAKKQQGTHKTKGRSEISRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  R H+   L KKV  LGLK
Sbjct  63   MYRQKGTGRARHSSARVPQFRGGGRAHGPVVRDHSH-DLPKKVRALGLK  110



>ref|WP_010421659.1| 50S ribosomal protein L4 [Rickettsia helvetica]
Length=207

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L+ D+F V  IR DII RV+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLSEDIFAVEFIRDDIIKRVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|XP_003081980.1| 50S ribosomal protein L4 (ISS) [Ostreococcus tauri]
Length=275

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -2

Query  961  KGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRA  782
            +G   L G +FD P+R D+ HRVVRWQ AK + GTH TKT  EVSGT RK  PQKG GRA
Sbjct  53   RGEATLPGRIFDQPLRVDVAHRVVRWQRAKARAGTHKTKTRGEVSGTTRKARPQKGQGRA  112

Query  781  RHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            R G LR PQ RGG   H P PRSHA   L KKV R+GLK+    +  + GK
Sbjct  113  RVGMLRAPQMRGGGVAHGPVPRSHA-YALPKKVRRMGLKV-ALSARAAEGK  161



>ref|WP_008945160.1| 50S ribosomal protein L4 [Oceanibaculum indicum]
 gb|EKE73565.1| 50S ribosomal protein L4 [Oceanibaculum indicum P24]
Length=205

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N    D G + L   VF V +R D++ RVV WQLAKR+ G H TK ISE++GT +K
Sbjct  3    VTVKNLEAADVGAIELDEAVFGVDVRADLLSRVVHWQLAKRRSGNHKTKGISEIAGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            PY QKGTGRAR G+ R PQFRGG  +  P  R H    L KKV +LGLK
Sbjct  63   PYKQKGTGRARQGSTRSPQFRGGATIFGPVVRDHG-YDLPKKVRKLGLK  110



>ref|WP_007434865.1| 50S ribosomal protein L4 [Acetobacteraceae bacterium AT-5844]
 gb|EHM03061.1| 50S ribosomal protein L4 [Acetobacteraceae bacterium AT-5844]
Length=222

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            VPV    N   G + L  DVF    R DI+ RVV WQLAKR+ GTH  K + EVSGT +K
Sbjct  19   VPVITLDNGKAGDIDLPDDVFATSPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTTKK  78

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            PY QKGTG AR G+LR PQFR G  +H P  R H    LNKKV RLGL     +S+ S+ 
Sbjct  79   PYRQKGTGNARQGSLRAPQFRTGGVVHGPVVRDHG-YSLNKKVRRLGL-----ISALSQK  132

Query  631  KAHG  620
             A G
Sbjct  133  AAEG  136



>gb|AHI06690.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus W]
Length=210

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N++ E  G + LA DVF+ P++KDI+H VV+WQLA R+QGTH TKT   VSG G+K
Sbjct  4    VNVLNWKKEKVGSVELAADVFETPVKKDILHTVVQWQLASRRQGTHMTKTKGLVSGGGKK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            P+ QKGTG AR G+ R     GG     P+PRS+A + L KKV RLGL +
Sbjct  64   PFKQKGTGNARQGSSRSILMPGGGTAFGPQPRSYAFV-LPKKVRRLGLSM  112



>ref|WP_009452534.1| 50S ribosomal protein L4 [Nitratireductor indicus]
 gb|EKF40357.1| 50S ribosomal protein L4 [Nitratireductor indicus C115]
Length=206

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT     D G + L+ ++F +  R+DI+HRVVRWQLAK+Q GTH TK  +E++ TG K
Sbjct  3    LKVTTLAGADAGKLKLSDEIFGLDPREDILHRVVRWQLAKKQAGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGLK
Sbjct  63   MYKQKGTGRARHSSARVPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLK  110



>ref|WP_002725426.1| MULTISPECIES: 50S ribosomal protein L4 [Phaeospirillum]
 emb|CCG39741.1| 50S ribosomal subunit protein L4 [Phaeospirillum molischianum 
DSM 120]
 gb|EPY01581.1| 50S ribosomal protein L4 [Phaeospirillum fulvum MGU-K5]
Length=206

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +  N+  G + LA  VF +P+R DI+ R+V WQLAKR+ G H TK I E+SGT +KP+
Sbjct  5    VISLENQTVGEIELAETVFGLPVRTDILARMVNWQLAKRRSGNHKTKGIKEISGTTKKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKG GRAR G+LR PQFRGG  +  P  RSHA   L KKV +L LK
Sbjct  65   AQKGGGRARQGSLRSPQFRGGATIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_019998905.1| 50S ribosomal protein L4 [Aureimonas ureilytica]
Length=206

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T     + G + LA ++F +  R+DI+ RVVRWQLAKRQQGTH +   +E++ TG K
Sbjct  3    IKITTLSGGEAGSVTLADEIFGLEPREDILQRVVRWQLAKRQQGTHQSLGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARHG+ R PQFRGG   H P  RSHA   L KK+  LGLK
Sbjct  63   LYKQKGTGRARHGSARAPQFRGGGKAHGPVSRSHAH-DLPKKLRALGLK  110



>ref|WP_007066364.1| 50S ribosomal protein L4 [Fulvimarina pelagi]
 gb|EAU42390.1| 50S ribosomal protein L4 [Fulvimarina pelagi HTCC2506]
Length=206

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V +      D G + L+  +F +  R+DI+HR+VR+QLAKRQQGTHST   S+V+ TG K
Sbjct  3    VTIKKLDGADAGTVTLSEAIFGLDPRQDILHRMVRYQLAKRQQGTHSTLGRSDVARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH T + PQFRGG   H P PRSHA I L KK+  L LK
Sbjct  63   MYRQKGTGRARHSTAKAPQFRGGGIAHGPTPRSHA-IDLPKKLRALALK  110



>ref|WP_014364921.1| 50S ribosomal protein L4 [Rickettsia philipii]
 ref|YP_005301088.1| 50S ribosomal protein L4 [Rickettsia philipii str. 364D]
 gb|AFB26631.1| 50S ribosomal protein L4 [Rickettsia philipii str. 364D]
Length=207

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_012736946.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|YP_002916827.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
 ref|YP_005295716.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hlp#2]
 sp|C4K2H8.1|RL4_RICPU RecName: Full=50S ribosomal protein L4 [Rickettsia peacockii 
str. Rustic]
 gb|ACR47775.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
 gb|AFB29296.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hlp#2]
Length=207

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_004997785.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|NP_360642.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 ref|YP_005066101.1| 50S ribosomal protein L4 [Rickettsia slovaca 13-B]
 ref|YP_005393247.1| 50S ribosomal protein L4 [Rickettsia parkeri str. Portsmouth]
 ref|YP_005426745.1| 50S ribosomal protein L4 [Rickettsia slovaca str. D-CWPP]
 sp|Q92GW7.1|RL4_RICCN RecName: Full=50S ribosomal protein L4 [Rickettsia conorii str. 
Malish 7]
 gb|AAL03543.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 gb|EAA26259.1| 50S ribosomal protein L4 [Rickettsia sibirica 246]
 gb|AEV92533.1| 50S ribosomal protein L4 [Rickettsia slovaca 13-B]
 gb|AFC75188.1| 50S ribosomal protein L4 [Rickettsia parkeri str. Portsmouth]
 gb|AFD20014.1| 50S ribosomal protein L4 [Rickettsia slovaca str. D-CWPP]
Length=207

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_012151151.1| 50S ribosomal protein L4 [Rickettsia rickettsii]
 ref|YP_001495101.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila 
Smith']
 ref|YP_001650375.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Iowa]
 ref|YP_005286569.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Colombia]
 ref|YP_005287915.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Arizona]
 ref|YP_005289267.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hauke]
 ref|YP_005292306.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Brazil]
 ref|YP_005294403.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hino]
 sp|A8GT68.1|RL4_RICRS RecName: Full=50S ribosomal protein L4 [Rickettsia rickettsii 
str. 'Sheila Smith']
 sp|B0BUQ9.1|RL4_RICRO RecName: Full=50S ribosomal protein L4 [Rickettsia rickettsii 
str. Iowa]
 gb|ABV76593.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila 
Smith']
 gb|ABY72969.1| LSU ribosomal protein L1E (= L4P) [Rickettsia rickettsii str. 
Iowa]
 gb|AFB21835.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Brazil]
 gb|AFB23945.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Colombia]
 gb|AFB25291.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Arizona]
 gb|AFB27970.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hino]
 gb|AFB30631.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hauke]
Length=207

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_014014636.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|YP_004764684.1| 50S ribosomal protein L4 [Rickettsia heilongjiangensis 054]
 ref|YP_004885099.1| 50S ribosomal protein L4 [Rickettsia japonica YH]
 gb|AEK75006.1| 50S ribosomal protein L4 [Rickettsia heilongjiangensis 054]
 dbj|BAK96960.1| 50S ribosomal protein L4 [Rickettsia japonica YH]
Length=207

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_034837021.1| 50S ribosomal protein L4 [Inquilinus limosus]
 gb|KGM33902.1| 50S ribosomal protein L4 [Inquilinus limosus MP06]
Length=206

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 82/141 (58%), Gaps = 3/141 (2%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V  F N   G + L   VF + +R D++ R+V WQLAKR+ G H TK ISE+SGT +K
Sbjct  3    IAVKTFDNTSAGEIDLDDSVFGLEVRTDLLFRMVNWQLAKRRSGNHKTKGISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            PY QKGTG AR G++R PQFRGG  +  P  RSHA   L KKV +L L+     S  + G
Sbjct  63   PYKQKGTGHARQGSMRSPQFRGGARIFGPVVRSHAH-DLPKKVRKLALR-HALSSKAAEG  120

Query  631  KAHGF*GYGTTFSHKTKNIVS  569
            K           SHKTK + +
Sbjct  121  KLVVV-DAVVADSHKTKGLAA  140



>ref|WP_008339787.1| 50S ribosomal protein L4 [Alicyclobacillus acidocaldarius]
 gb|EED07176.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius LAA1]
Length=206

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 93/158 (59%), Gaps = 6/158 (4%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N   +  G + L   +F  PIR D++H VV   LA R++GTH TKT +EVSG GRK
Sbjct  4    VAVLNTAGQQVGEIELNEKIFGAPIRPDLMHIVVLQYLAARRRGTHKTKTRAEVSGGGRK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            P+ QKGTGRAR G++R PQ+RGG  +H P PRS+A  K+ KKV R  L      S    G
Sbjct  64   PWRQKGTGRARQGSIRAPQWRGGGVVHGPVPRSYA-FKVPKKVRRAAL-YSALSSKVQEG  121

Query  631  KAHGF*GYGTTFSH-KTKNIVSYGQKMENAKKVLLVDG  521
            K       G  F   KTK++V   + + N +K L+VDG
Sbjct  122  KIVVV--EGLEFERPKTKDMVGVLRNL-NVEKALIVDG  156



>ref|WP_007004403.1| 50S ribosomal protein L4 [Roseomonas cervicalis]
 gb|EFH11763.1| 50S ribosomal protein L4 [Roseomonas cervicalis ATCC 49957]
Length=206

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            +PV    N   G + L   +F    R DI+ RVV WQLAKR+ GTH  K + EVSGT +K
Sbjct  3    LPVITLDNGQAGEIDLPDALFAAAPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            PY QKGTG AR G+LR PQFR G A+H P  R H    LNKKV RLGL     +S+ S+ 
Sbjct  63   PYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YSLNKKVRRLGL-----ISALSQK  116

Query  631  KAHG  620
             A G
Sbjct  117  AAEG  120



>ref|WP_024847016.1| 50S ribosomal protein L4 [Aminobacter sp. J41]
Length=208

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V +T    +  G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH +++ ++VS TG K
Sbjct  3    VKITTLAGDAAGNIKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHQSQSRADVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGLK
Sbjct  63   MYKQKGTGRARHSSARAPQFRGGGKAHGPVARSHAH-DLPKKVRALGLK  110



>ref|WP_012719919.1| 50S ribosomal protein L4 [Rickettsia africae]
 ref|YP_002845509.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
 sp|C3PPA6.1|RL4_RICAE RecName: Full=50S ribosomal protein L4 [Rickettsia africae ESF-5]
 gb|ACP53766.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
Length=207

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    IFSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>ref|WP_011256539.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Brugia malayi]
 ref|YP_198171.1| 50S ribosomal protein L4 [Wolbachia endosymbiont strain TRS of 
Brugia malayi]
 sp|Q5GSU5.1|RL4_WOLTR RecName: Full=50S ribosomal protein L4 [Wolbachia endosymbiont 
strain TRS of Brugia malayi]
 gb|AAW70929.1| Ribosomal protein L4 [Wolbachia endosymbiont strain TRS of Brugia 
malayi]
Length=204

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N D G   L   +F V  +  I+H +VRWQLAKR+ GTH  K IS+VSGT  KPY
Sbjct  5    LVNLSNNDVGTTQLNPLIFSVEQKLSILHDIVRWQLAKRRAGTHKVKGISDVSGTTAKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV + GLK+
Sbjct  65   SQKRTGRARQGSLRSPQFRGGGVIFGPIVRSHAY-SLNKKVRKFGLKV  111



>ref|WP_014412448.1| 50S ribosomal protein L4 [Rickettsia australis]
 ref|YP_005414760.1| 50S ribosomal protein L4 [Rickettsia australis str. Cutlack]
 gb|AFC70917.1| 50S ribosomal protein L4 [Rickettsia australis str. Cutlack]
Length=207

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRNDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_028843121.1| 50S ribosomal protein L4 [Thermodesulfobacterium thermophilum]
Length=202

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (61%), Gaps = 5/150 (3%)
 Frame = -2

Query  958  GFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRAR  779
            G M L  D++ V  ++ I+H +VRWQ+A+ + GT  TKT  EV G GRKP+PQK TGRAR
Sbjct  9    GEMDLPLDIYGVYPKEGILHEIVRWQMARWRAGTACTKTRGEVRGGGRKPWPQKHTGRAR  68

Query  778  HGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTT  599
             G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+    S     K     G+   
Sbjct  69   QGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-ALSSRALTNKIFVAEGFPVA  126

Query  598  FSHKTKNIVSYGQKMENAKKVLLVDGGPQR  509
               KTK + SY + +   + +++V   P+R
Sbjct  127  EQPKTKLLKSYLETLGINEALIIV---PER  153



>ref|WP_012811931.1| 50S ribosomal protein L4 [Alicyclobacillus acidocaldarius]
 ref|YP_003186103.1| 50S ribosomal protein L4 [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius DSM 446]
 gb|ACV59714.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius DSM 446]
Length=206

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 93/158 (59%), Gaps = 6/158 (4%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N   +  G + L   +F  PIR D++H VV   LA R++GTH TKT +EVSG GRK
Sbjct  4    VAVLNTAGQQVGEIELNEKIFGAPIRPDLMHIVVLQYLAARRRGTHKTKTRAEVSGGGRK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRG  632
            P+ QKGTGRAR G++R PQ+RGG  +H P PRS+A  K+ KKV R  L      S    G
Sbjct  64   PWRQKGTGRARQGSIRAPQWRGGGVVHGPVPRSYA-FKVPKKVRRAAL-YSALSSKVQEG  121

Query  631  KAHGF*GYGTTFSH-KTKNIVSYGQKMENAKKVLLVDG  521
            K       G  F   KTK++V   + + N +K L++DG
Sbjct  122  KIVVV--EGLEFERPKTKDMVGVLRNL-NVEKALIIDG  156



>ref|WP_009209731.1| MULTISPECIES: 50S ribosomal protein L4 [Aurantimonas]
 gb|EAS51085.1| ribosomal protein L4 [Aurantimonas manganoxydans SI85-9A1]
Length=206

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V + +   +D G   LA D+F +  R+DI+ R+VRWQLAKRQQG+H T   +E++ TG K
Sbjct  3    VTIKSLDGKDAGTATLADDIFGLEPREDILQRMVRWQLAKRQQGSHQTLGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARHG+ R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  63   LYRQKGTGRARHGSARAPQFRGGGKAHGPVSRSHAH-DLPKKVRALALR  110



>gb|AIH04237.1| 50S ribosomal protein L4 [Thermodesulfobacterium commune DSM 
2178]
Length=210

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = -2

Query  958  GFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRAR  779
            G M L  D++ V  ++ I+H +VRWQ+A+ + GT  TKT  EV G GRKP+PQK TGRAR
Sbjct  17   GEMELPLDIYGVYPKEGILHEIVRWQMARWRAGTACTKTRGEVRGGGRKPWPQKHTGRAR  76

Query  778  HGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTT  599
             G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+    S     K     G+   
Sbjct  77   QGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-ALSSRALTNKLFVAEGFPVV  134

Query  598  FSHKTKNIVSY  566
               KTK + SY
Sbjct  135  EKPKTKLLKSY  145



>ref|WP_023507969.1| 50S ribosomal protein L4 [Rickettsia monacensis]
 emb|CDI29733.1| 50S ribosomal protein L4 [Rickettsia monacensis IrR/Munich]
Length=207

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_038062588.1| 50S ribosomal protein L4 [Thermodesulfobacterium commune]
Length=202

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 2/131 (2%)
 Frame = -2

Query  958  GFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRAR  779
            G M L  D++ V  ++ I+H +VRWQ+A+ + GT  TKT  EV G GRKP+PQK TGRAR
Sbjct  9    GEMELPLDIYGVYPKEGILHEIVRWQMARWRAGTACTKTRGEVRGGGRKPWPQKHTGRAR  68

Query  778  HGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTT  599
             G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+    S     K     G+   
Sbjct  69   QGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-ALSSRALTNKLFVAEGFPVV  126

Query  598  FSHKTKNIVSY  566
               KTK + SY
Sbjct  127  EKPKTKLLKSY  137



>ref|WP_008580969.1| MULTISPECIES: 50S ribosomal protein L4 [Rickettsia]
 ref|XP_002401694.1| ribosomal protein L4, putative [Ixodes scapularis]
 gb|EEC11380.1| ribosomal protein L4, putative [Ixodes scapularis]
 gb|EER22618.1| ribosomal protein L4/L1 family protein [Rickettsia endosymbiont 
of Ixodes scapularis]
 gb|KDO03530.1| ribosomal protein L4 [Rickettsia sp. ISO7]
Length=207

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_011255725.1| 50S ribosomal protein L4 [Ehrlichia ruminantium]
 ref|YP_196554.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Gardel]
 sp|Q5FFU1.1|RL4_EHRRG RecName: Full=50S ribosomal protein L4 [Ehrlichia ruminantium 
str. Gardel]
 emb|CAI28080.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Gardel]
Length=205

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N  +++ G + L   +F V  R DI+  VV WQL+KR+ G H TKTI +VSGT  K
Sbjct  3    VNVINIESQNIGKIDLNPLIFSVNYRPDILKMVVEWQLSKRRVGAHKTKTIGDVSGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFV-SSCSR  635
            PY QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV  LGLK+   + +SC++
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRSHAY-SLNKKVRNLGLKVALSLKNSCNK  121



>ref|WP_011270631.1| 50S ribosomal protein L4 [Rickettsia felis]
 ref|YP_246295.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 sp|Q4UMS8.1|RL4_RICFE RecName: Full=50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 gb|AAY61130.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 gb|KHO03330.1| 50S ribosomal protein L4 [Rickettsia felis str. LSU]
Length=207

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_014465733.1| 50S ribosomal protein L4 [Alicyclobacillus acidocaldarius]
 ref|YP_005519444.1| 50S ribosomal protein L4 [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius Tc-4-1]
 gb|AEJ44925.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius Tc-4-1]
Length=203

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V N   +  G + L   +F  PIR D++H VV   LA R++GTH TKT +EVSG GRKP+
Sbjct  3    VLNTAGQQVGEIELNEKIFGAPIRPDLMHIVVLQYLAARRRGTHKTKTRAEVSGGGRKPW  62

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTGRAR G++R PQ+RGG  +H P PRS+A  K+ KKV R  L      S    GK 
Sbjct  63   RQKGTGRARQGSIRAPQWRGGGVVHGPVPRSYA-FKVPKKVRRAAL-YSALSSKVQEGKI  120

Query  625  HGF*GYGTTFSH-KTKNIVSYGQKMENAKKVLLVDG  521
                  G  F   KTK++V   + + N +K L+VDG
Sbjct  121  VVV--EGLEFERPKTKDMVGVLRNL-NVEKALIVDG  153



>ref|WP_004596200.1| 50S ribosomal protein L4 [Rickettsia prowazekii]
 ref|NP_221022.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Madrid E]
 ref|YP_005404329.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvV257]
 ref|YP_005405736.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Chernikova]
 ref|YP_005406580.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Katsinyian]
 ref|YP_005407419.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Dachau]
 ref|YP_005413243.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. BuV67-CWPP]
 ref|YP_005414079.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. RpGvF24]
 ref|YP_005999099.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Rp22]
 ref|YP_007749736.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. NMRC Madrid 
E]
 ref|YP_007751151.1| 50S ribosomal protein L3 [Rickettsia prowazekii str. Breinl]
 sp|Q9ZCQ6.1|RL4_RICPR RecName: Full=50S ribosomal protein L4 [Rickettsia prowazekii 
str. Madrid E]
 emb|CAA15098.1| 50S RIBOSOMAL PROTEIN L4 (rplD) [Rickettsia prowazekii str. Madrid 
E]
 gb|ADE30201.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Rp22]
 gb|AFE52251.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvV257]
 gb|AFE53652.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. RpGvF24]
 gb|AFE49458.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Chernikova]
 gb|AFE50302.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Katsinyian]
 gb|AFE51148.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. BuV67-CWPP]
 gb|AFE51984.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Dachau]
 gb|AGJ01682.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. NMRC Madrid 
E]
 gb|AGJ03097.1| 50S ribosomal protein L3 [Rickettsia prowazekii str. Breinl]
 gb|EOB10614.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvF12]
 gb|EOB10842.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Cairo 3]
Length=207

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAMFGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H PK RSHA IKL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGISHGPKVRSHA-IKLPKKVRKLGL  110



>ref|WP_013531423.1| MULTISPECIES: 50S ribosomal protein L4 [Mesorhizobium]
 ref|YP_004142797.1| 50S ribosomal protein L4 [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
 gb|ADV12747.1| ribosomal protein L4/L1e [Mesorhizobium ciceri biovar biserrulae 
WSM1271]
 gb|ESZ24994.1| 50S ribosomal protein L4 [Mesorhizobium sp. L2C084A000]
Length=206

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH TK  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVELSDEIFGLDPREDILQRVVRWQLAKKQQGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH   +L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-ELPKKVRALGLK  110



>dbj|BAO99519.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Cimex lectularius]
Length=204

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N++ G   L   +F V  +  I+H +V+WQLAKR+ GTH  K IS+VSGT  KPY
Sbjct  5    LVNLSNDNIGIAQLNPSIFSVKQKLSILHDIVKWQLAKRRAGTHKAKGISDVSGTTAKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QK TGRAR G+LR PQFRGG  +  P  RSHA   LNKKV + GLK+
Sbjct  65   SQKRTGRARQGSLRSPQFRGGGVIFGPVVRSHAY-SLNKKVRKFGLKV  111



>ref|WP_028000154.1| 50S ribosomal protein L4 [Sinorhizobium arboris]
Length=206

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH +K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKSKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKIRALGLR  110



>ref|WP_003536623.1| 50S ribosomal protein L4 [Sinorhizobium meliloti]
 ref|NP_385463.1| 50S ribosomal protein L4 [Sinorhizobium meliloti 1021]
 ref|YP_004548515.1| 50S ribosomal protein L4 [Sinorhizobium meliloti AK83]
 ref|YP_005713156.1| 50S ribosomal protein L4 [Sinorhizobium meliloti BL225C]
 ref|YP_005720737.1| 50S ribosomal protein L4 [Sinorhizobium meliloti SM11]
 ref|YP_006839959.1| 50S ribosomal protein L4 [Sinorhizobium meliloti Rm41]
 ref|YP_007189926.1| 50S ribosomal protein L4, bacterial/organelle [Sinorhizobium 
meliloti GR4]
 ref|YP_007574621.1| putative 50S ribosomal protein L4 [Sinorhizobium meliloti 2011]
 sp|Q92QG9.1|RL4_RHIME RecName: Full=50S ribosomal protein L4 [Sinorhizobium meliloti 
1021]
 emb|CAC45936.1| Probable 50S ribosomal protein L4 [Sinorhizobium meliloti 1021]
 gb|AEG03913.1| ribosomal protein L4/L1e [Sinorhizobium meliloti BL225C]
 gb|AEG52901.1| ribosomal protein L4/L1e [Sinorhizobium meliloti AK83]
 gb|AEH79476.1| 50S ribosomal protein L4 [Sinorhizobium meliloti SM11]
 gb|EHK73790.1| 50S ribosomal protein L4 [Sinorhizobium meliloti CCNWSX0020]
 emb|CCM67133.1| 50S ribosomal protein L4 [Sinorhizobium meliloti Rm41]
 gb|AGA06327.1| 50S ribosomal protein L4, bacterial/organelle [Sinorhizobium 
meliloti GR4]
 gb|AGG73936.1| putative 50S ribosomal protein L4 [Sinorhizobium meliloti 2011]
 emb|CDH85245.1| 50S ribosomal protein L4 [Sinorhizobium meliloti RU11/001]
 gb|AIL99179.1| 50S ribosomal protein L4 [Sinorhizobium meliloti]
Length=206

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH +K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKSKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKIRALGLR  110



>ref|WP_011975172.1| MULTISPECIES: 50S ribosomal protein L4 [Sinorhizobium]
 ref|YP_001326675.1| 50S ribosomal protein L4 [Sinorhizobium medicae WSM419]
 sp|A6U860.1|RL4_SINMW RecName: Full=50S ribosomal protein L4 [Sinorhizobium medicae 
WSM419]
 gb|ABR59840.1| ribosomal protein L4/L1e [Sinorhizobium medicae WSM419]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH  K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLR  110



>ref|WP_024585424.1| 50S ribosomal protein L4 [Aliihoeflea sp. 2WW]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E+S TG K
Sbjct  3    LKVTTLSGDDAGKLKLSEEIFGLEPREDILQRVVRWQLAKKQQGTHKAKGRAEISRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLR  110



>ref|WP_003516147.1| MULTISPECIES: 50S ribosomal protein L4 [Agrobacterium]
 ref|YP_004279199.1| 50S ribosomal protein L4 [Agrobacterium sp. H13-3]
 gb|ADY64879.1| 50S ribosomal protein L4 [Agrobacterium sp. H13-3]
 gb|EHJ97908.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens 5A]
 gb|AHK01787.1| LSU ribosomal protein L4p (L1e) [Agrobacterium tumefaciens LBA4213 
(Ach5)]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH TKT +EVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKTKTRAEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_024270439.1| 50S ribosomal protein L4 [Shinella sp. DD12]
 gb|EYR82320.1| 50S ribosomal protein L4 [Shinella sp. DD12]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT    +D G + L+  +F +  R+DII RV+RWQLAK+QQGTH + T  EVS TG K
Sbjct  3    LKVTTLDGKDAGKVSLSDAIFGLEPREDIIARVIRWQLAKKQQGTHQSLTRGEVSRTGSK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L K+V  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGAKAHGPVSRSHAH-DLPKQVRALGLR  110



>ref|WP_014408922.1| 50S ribosomal protein L4 [Rickettsia rhipicephali]
 ref|YP_005390810.1| 50S ribosomal protein L4 [Rickettsia rhipicephali str. 3-7-female6-CWPP]
 gb|AFC72737.1| 50S ribosomal protein L4 [Rickettsia rhipicephali str. 3-7-female6-CWPP]
Length=207

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  N++ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANKEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCTEGK  122



>ref|WP_025593949.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH TKT +EVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSEEIFGLDPRQDILARMVRWQLAKKQQGTHKTKTRAEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_029620125.1| MULTISPECIES: 50S ribosomal protein L4 [Rhizobium]
 gb|KEQ06770.1| 50S ribosomal protein L4 [Rhizobium sp. R1-200B2]
 gb|KEQ08613.1| 50S ribosomal protein L4 [Rhizobium sp. R2-400B4]
Length=206

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH TKT +EVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDEIFGLDPREDILARMVRWQLAKKQQGTHKTKTRAEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_028841346.1| 50S ribosomal protein L4 [Thermodesulfobacterium hveragerdense]
Length=202

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (61%), Gaps = 5/150 (3%)
 Frame = -2

Query  958  GFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRAR  779
            G M L  D++ V  ++ I+H +VRWQ+A+ + GT  TKT  EV G GRKP+PQK TGRAR
Sbjct  9    GEMDLPLDIYGVYPKEGILHEIVRWQMARWRAGTACTKTRGEVRGGGRKPWPQKHTGRAR  68

Query  778  HGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTT  599
             G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+    S     +     G+   
Sbjct  69   QGSIRAPQWVGGGIVHGPKPRSY-EFKLNKKVRRLGLKM-ALSSRALTNRIFVAEGFPVA  126

Query  598  FSHKTKNIVSYGQKMENAKKVLLVDGGPQR  509
               KTK + SY + +   + +++V   P+R
Sbjct  127  EQPKTKLLKSYLETLGINEALIIV---PER  153



>ref|WP_024078298.1| 50S ribosomal protein L4 [Magnetospirillum gryphiswaldense]
 ref|YP_008935914.1| 50S ribosomal subunit protein L4 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CAM77749.1| 50S ribosomal protein L4 [Magnetospirillum gryphiswaldense MSR-1]
 emb|CDK97254.1| 50S ribosomal subunit protein L4 [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=205

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V +  N+  G + L+ DVF + +R D++HR+V +QL+KR+ GTH TK ISE+SGT +KP+
Sbjct  5    VISLDNQSVGEIDLSDDVFGLAVRNDLLHRMVSYQLSKRRSGTHKTKGISEISGTTKKPF  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
             QKG GRAR G+LR  QFRGG  +  P  RSHA   + KKV +L LK+    +  + GK
Sbjct  65   NQKGGGRARQGSLRSAQFRGGATIFGPVVRSHA-FDMPKKVRKLALKV-ALSAKAAEGK  121



>ref|WP_039758109.1| 50S ribosomal protein L4 [Bartonella queenslandensis]
Length=206

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = -2

Query  1000 DLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGT  821
            DLV+   +    + G + ++  +FD+  R+DI+ RVVRWQLA+RQQGTH ++  S+VS T
Sbjct  2    DLVIKTLD--GNEAGKLKVSESIFDLVPREDILQRVVRWQLARRQQGTHQSQGRSDVSRT  59

Query  820  GRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSC  641
            G K + QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+L   +S+ 
Sbjct  60   GAKMFKQKGTGRARHSSARAPQFRGGGKAHGPVFRSHAH-DLPKKIRALGLRLA--LSAK  116

Query  640  SRGKAHGF*GYGTTFSHKTKNIVSYGQKM  554
             + K        +    KTKN+VS+  K+
Sbjct  117  LKAKDLIVVDELSVKDAKTKNLVSHFSKL  145



>ref|WP_029964936.1| 50S ribosomal protein L4 [Ensifer sp. USDA 6670]
Length=206

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH  K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKIRALGLR  110



>ref|WP_006313970.1| 50S ribosomal protein L4 [Agrobacterium sp. ATCC 31749]
 gb|EGL63417.1| 50S ribosomal protein L4 [Agrobacterium sp. ATCC 31749]
Length=206

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH TK  SEVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKTKNRSEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_010971963.1| MULTISPECIES: 50S ribosomal protein L4 [Agrobacterium tumefaciens 
complex]
 ref|NP_354922.1| 50S ribosomal protein L4 [Agrobacterium fabrum str. C58]
 sp|Q8UE19.1|RL4_AGRT5 RecName: Full=50S ribosomal protein L4 [Agrobacterium fabrum 
str. C58]
 gb|AAK87707.1| 50S ribosomal protein L4 [Agrobacterium fabrum str. C58]
 gb|KEY51529.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens]
Length=206

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH TK  SEVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKTKNRSEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_038448235.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus]
 gb|AHZ83375.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus]
Length=209

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N++ E  G + LA DVF+ P++K+++H VV+WQLA R+QGTH TKT   VSG G+K
Sbjct  4    VNVLNWKKEKVGSVELAADVFETPVKKEVLHTVVQWQLAARRQGTHMTKTKGLVSGGGKK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            P+ QKGTG AR G+ R     GG     P+PRS+A + L KKV RLGL +
Sbjct  64   PFKQKGTGGARQGSSRSILMPGGGTAFGPQPRSYAFV-LPKKVRRLGLSM  112



>ref|WP_015092006.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus]
 ref|YP_007023852.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus str. Tiberius]
 gb|AFY02585.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus str. Tiberius]
Length=209

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N++ E  G + LA DVF+ P++K+++H VV+WQLA R+QGTH TKT   VSG G+K
Sbjct  4    VNVLNWKKEKVGSVELAADVFETPVKKEVLHTVVQWQLAARRQGTHMTKTKGLVSGGGKK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            P+ QKGTG AR G+ R     GG     P+PRS+A + L KKV RLGL +
Sbjct  64   PFKQKGTGGARQGSSRSILMPGGGTAFGPQPRSYAFV-LPKKVRRLGLSM  112



>ref|WP_011165351.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus]
 ref|NP_969754.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus HD100]
 sp|P61061.1|RL4_BDEBA RecName: Full=50S ribosomal protein L4 [Bdellovibrio bacteriovorus 
HD100]
 emb|CAE80747.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus HD100]
Length=209

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N++ E  G + LA DVF+ P++K+++H VV+WQLA R+QGTH TKT   VSG G+K
Sbjct  4    VNVLNWKKEKVGSVELAADVFETPVKKEVLHTVVQWQLAARRQGTHMTKTKGLVSGGGKK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
            P+ QKGTG AR G+ R     GG     P+PRS+A + L KKV RLGL +
Sbjct  64   PFKQKGTGGARQGSSRSILMPGGGTAFGPQPRSYAFV-LPKKVRRLGLSM  112



>ref|WP_027154042.1| 50S ribosomal protein L4 [Mesorhizobium sp. WSM2561]
Length=206

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH TK  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>ref|WP_023799294.1| 50S ribosomal protein L4 [Mesorhizobium sp. L48C026A00]
 gb|ESZ19903.1| 50S ribosomal protein L4 [Mesorhizobium sp. L48C026A00]
Length=206

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH TK  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>emb|CEG69999.1| Putative 50S ribosomal protein L4/L1 [Rhizopus microsporus]
Length=248

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -2

Query  970  NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGT  791
            NE    + L  DVF  PIR+DI+HRVV WQ    +QGTHSTKT  EV+GTG+K  PQKG 
Sbjct  49   NEPISIIDLEKDVFGAPIRRDILHRVVVWQRDAMRQGTHSTKTRGEVTGTGKKAAPQKGR  108

Query  790  GRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*G  611
            G+AR G  + PQFR G     PKPR H+T  L +KV  LGL+     +  ++ +      
Sbjct  109  GKARVGDRKAPQFRSGGIAFGPKPRDHST-DLPRKVQDLGLRA-ALSAKYAQDQLIVVDS  166

Query  610  YGTTFSHKTKNIVSYGQKMENAKKVLLV  527
                 SHKT+++    Q   +  K+L+V
Sbjct  167  LQHVESHKTRDLAQILQNAYDGSKMLIV  194



>ref|WP_011155288.1| 50S ribosomal protein L4 [Ehrlichia ruminantium]
 ref|YP_180471.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 ref|YP_197513.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 sp|Q5HAS3.1|RL4_EHRRW RecName: Full=50S ribosomal protein L4 [Ehrlichia ruminantium 
str. Welgevonden]
 emb|CAH58338.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 emb|CAI27131.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
Length=205

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N  +++ G + L   +F V  R DI+  VV WQL+KR+ G H TKTI +VSGT  K
Sbjct  3    VNVINIESQNIGKIDLNPLIFSVNYRPDILKMVVEWQLSKRRIGAHKTKTIGDVSGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFV-SSCSR  635
            PY QK TGRAR G+LR PQFRGG  +  P  R+HA   LNKKV  LGLK+   + +SC++
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRTHAY-SLNKKVRNLGLKVALSLKNSCNK  121



>ref|WP_028795257.1| 50S ribosomal protein L4 [Thalassobaculum salexigens]
Length=206

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VTN   E  G + L   +F +  R+DI+ R+V WQLAKR+ G H  KTISE+SGT +K
Sbjct  3    IDVTNLDAEKTGEIDLDDAIFGLDPRQDILARMVNWQLAKRRGGNHKVKTISEISGTTKK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
            P+ QKGTGRAR G+LR  Q+RGG  +H P  R HA   L KK  +LGLK
Sbjct  63   PFRQKGTGRARAGSLRATQYRGGQTVHGPVVRDHAH-DLTKKFRKLGLK  110



>ref|WP_032138905.1| 50S ribosomal protein L4 [Rickettsia tamurae]
Length=207

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGGISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G++R  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSIRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_012707755.1| 50S ribosomal protein L4 [Sinorhizobium fredii]
 ref|YP_002825727.1| 50S ribosomal protein L4 [Sinorhizobium fredii NGR234]
 sp|C3MAY1.1|RL4_RHISN RecName: Full=50S ribosomal protein L4 [Sinorhizobium fredii 
NGR234]
 gb|ACP24974.1| 50S ribosomal protein L4 [Sinorhizobium fredii NGR234]
Length=206

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH  K  +EV+ TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEVARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLR  110



>ref|WP_027026958.1| 50S ribosomal protein L4 [Mesorhizobium sp. URHA0056]
Length=206

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH TK  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKTKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>ref|WP_008039992.1| 50S ribosomal protein L4 [Bartonella tamiae]
 gb|EJF88985.1| 50S ribosomal protein L4 [Bartonella tamiae Th239]
 gb|EJF94765.1| 50S ribosomal protein L4 [Bartonella tamiae Th307]
Length=206

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            +     ++ G + L+  VF +  R+DI+ RVVRWQLA+RQQGTH T++ ++VS TG K Y
Sbjct  5    IMTLEGKETGKVTLSDAVFGLDPREDILQRVVRWQLARRQQGTHQTQSRADVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+ 
Sbjct  65   KQKGTGRARHSSARAPQFRGGGKAHGPVARSHAH-DLPKKVRALGLRF  111



>ref|WP_015589145.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila 
simulans]
 ref|YP_007889202.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila 
simulans wHa]
 gb|AGK00025.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila 
simulans wHa]
Length=204

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N++ G   L   +F    +  I+H +VRWQLAKR+ GTH TK IS+VSGT  KPY
Sbjct  5    LVNLSNDNVGTAQLNPLIFSAKQKLSILHDIVRWQLAKRRAGTHKTKGISDVSGTTAKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QK TGRAR G+LR PQFRGG  +  P  RSH T  LNKKV + GLK+
Sbjct  65   DQKRTGRARQGSLRSPQFRGGGIIFGPVVRSH-TYSLNKKVRKFGLKI  111



>ref|WP_018505131.1| 50S ribosomal protein L4 [Frankia sp. BCU110501]
Length=239

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 97/179 (54%), Gaps = 6/179 (3%)
 Frame = -2

Query  1063  PSDLLTKKRVLTLDRELGLYQDLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRW  884
             P+  +TK+     D  +    D  VPV      D G + L G VFDVP+   +IH+VV  
Sbjct  3     PTATITKEAPAEADAPV----DRTVPVHAPAGGDAGSVELPGAVFDVPVNVPLIHQVVVA  58

Query  883   QLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHAT  704
             QLA  +QGTHSTKT  EV G GRKPY QKGTGRAR G+LR PQF GG  +H P PR++  
Sbjct  59    QLAAARQGTHSTKTRGEVRGGGRKPYRQKGTGRARQGSLRAPQFTGGGIVHGPTPRNYDQ  118

Query  703   IKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLV  527
              +  KK+    L+           + H      T  +  TK+ V+    + +A++VL+V
Sbjct  119   -RTPKKMKAAALR-GALSDRARNNRLHVVSSLVTGDTPSTKSAVAALTSLVDARRVLVV  175



>ref|WP_025426665.1| 50S ribosomal protein L4 [Ensifer adhaerens]
 gb|AHK44098.1| 50S ribosomal protein L4 [Ensifer adhaerens OV14]
Length=206

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAK+QQGTH  K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKKQQGTHKAKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLR  110



>ref|WP_034795521.1| 50S ribosomal protein L4 [Ensifer adhaerens]
 gb|KDP74475.1| 50S ribosomal protein L4 [Ensifer adhaerens]
Length=206

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+  +F +  R+DII RVVRWQLAK+QQGTH  K  +EVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKKQQGTHKAKGRAEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLR  110



>ref|WP_017442487.1| 50S ribosomal protein L4 [Candidatus Rickettsia gravesii]
Length=207

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR DII +V+ WQ AK   G H TKTISEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTISEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_028096619.1| 50S ribosomal protein L4 [Dongia sp. URHE0060]
Length=210

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 95/161 (59%), Gaps = 8/161 (5%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVF-DV---PIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSG  824
            + VT+  ++  G + LA +VF D+   P+R+DI+ R V WQLAKR+ G H TK I ++SG
Sbjct  3    LKVTDIDSKAHGEIDLADEVFKDIFGRPVRRDILARCVNWQLAKRRSGNHKTKEIGDISG  62

Query  823  TGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSS  644
            T +KPY QKGTG AR G+LR PQFRGG  +  P  RSHA   L KKV +L LK     S 
Sbjct  63   TTKKPYSQKGTGNARQGSLRSPQFRGGATIFGPVVRSHAH-DLTKKVRKLALKT-ALSSK  120

Query  643  CSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDG  521
               GK   + G     S KTK++ +   K      +L++DG
Sbjct  121  VKDGKLIIWDGTAGA-SGKTKDLTAK-LKTLGLTSLLVIDG  159



>gb|EFA80316.1| hypothetical protein PPL_07147 [Polysphondylium pallidum PN500]
Length=318

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -2

Query  1009  LYQDLVVPVTNFRN-EDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISE  833
             L     VPV NF++ E+ G + L   +F VP+R DI+HR+VRWQ AK  QGTH  + + +
Sbjct  105   LTSSFSVPVVNFKSKENVGEIQLLKSIFSVPLRVDILHRIVRWQRAKAMQGTHYAQNMGD  164

Query  832   VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             +  T +KP+ QKGTGRAR GT    Q +GG     PKPR H +  L KKV RLGLK+
Sbjct  165   IDRTNKKPFSQKGTGRARQGTNHAIQMKGGARAFPPKPRDH-SFSLPKKVRRLGLKV  220



>ref|WP_007626084.1| 50S ribosomal protein L4 [Rhizobium sp. CCGE 510]
 gb|EJT07069.1| 50S ribosomal protein L4 [Rhizobium sp. CCGE 510]
Length=206

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+  +F +  R+DII RVVRWQLAK+QQGTH  K  +EVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKKQQGTHKAKGRAEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGL+L
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLRL  111



>ref|WP_011304723.1| 50S ribosomal protein L4 [Ehrlichia canis]
 ref|YP_303243.1| 50S ribosomal protein L4 [Ehrlichia canis str. Jake]
 sp|Q3YRL0.1|RL4_EHRCJ RecName: Full=50S ribosomal protein L4 [Ehrlichia canis str. 
Jake]
 gb|AAZ68645.1| LSU ribosomal protein L4P [Ehrlichia canis str. Jake]
Length=205

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V + N  ++  G + L   +F V  R DI+  VV WQL+KR+ GTH  KTI ++SGT  K
Sbjct  3    VSIINVNSDKIGTIDLNPLIFSVDYRPDILKMVVNWQLSKRRAGTHKAKTIGDISGTTAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFV-SSCSR  635
            PY QK TGRAR G+LR PQFRGG  +  P  R+HA   LNKKV +LGLK+   + +SC++
Sbjct  63   PYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRNHAY-SLNKKVRKLGLKVALSLKNSCNK  121



>emb|CDX21136.1| 50S ribosomal subunit protein L4 [Mesorhizobium sp. SOD10]
 emb|CDX31215.1| 50S ribosomal subunit protein L4 [Mesorhizobium plurifarium]
 emb|CDX57678.1| 50S ribosomal subunit protein L4 [Mesorhizobium plurifarium]
 emb|CDX18783.1| 50S ribosomal subunit protein L4 [Mesorhizobium plurifarium]
Length=206

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH   +L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-ELPKKVRALGLK  110



>ref|WP_027057017.1| 50S ribosomal protein L4 [Mesorhizobium loti]
Length=206

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVELSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH   +L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-ELPKKVRALGLK  110



>ref|WP_010962756.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila 
melanogaster]
 ref|NP_966444.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila 
melanogaster]
 sp|P61071.1|RL4_WOLPM RecName: Full=50S ribosomal protein L4 [Wolbachia endosymbiont 
of Drosophila melanogaster]
 gb|AAS14378.1| ribosomal protein L4 [Wolbachia endosymbiont of Drosophila melanogaster]
 gb|ERN55613.1| 50S ribosomal protein L4 [Wolbachia pipientis wMelPop]
Length=204

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N++ G   L   +F    +  I+H +VRWQLAKR+ GTH TK IS+VSGT  KPY
Sbjct  5    LVNLSNDNVGAAQLNPLIFSAKQKLSILHDIVRWQLAKRRAGTHKTKGISDVSGTTAKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QK TGRAR G+LR PQFRGG  +  P  RSH T  LNKKV + GLK+
Sbjct  65   GQKRTGRARQGSLRSPQFRGGGIIFGPVVRSH-TYSLNKKVRKFGLKI  111



>ref|WP_032073486.1| 50S ribosomal protein L4 [Rickettsia aeschlimannii]
Length=207

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  DVF V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANEEVGEISLNEDVFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110



>ref|WP_014328065.1| 50S ribosomal protein L4 [Sinorhizobium fredii]
 ref|YP_005188400.1| 50S ribosomal protein L4 BL4 [Sinorhizobium fredii HH103]
 emb|CCE95575.1| 50S ribosomal protein L4 BL4 [Sinorhizobium fredii HH103]
Length=206

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RV+RWQLAKRQQGTH  K  +EV+ TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVIRWQLAKRQQGTHKAKGRAEVARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKIRALGLR  110



>ref|WP_012149904.1| 50S ribosomal protein L4 [Rickettsia akari]
 ref|YP_001493782.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
 sp|A8GPE9.1|RL4_RICAH RecName: Full=50S ribosomal protein L4 [Rickettsia akari str. 
Hartford]
 gb|ABV75274.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
Length=207

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  NE+ G + L  D+F V  IR D+I +V+ WQ AK   G H TKT+SEVSGT +KP
Sbjct  5    ILSLANEEVGEISLNEDIFAVEFIRDDVIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  668
            + QKGTG AR G+LR  Q RGG   H P+ RSH T KL KKV +LGL
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHVT-KLPKKVRKLGL  110



>emb|CEI99083.1| Putative 50S ribosomal protein L4/L1 [Rhizopus microsporus]
Length=267

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 2/148 (1%)
 Frame = -2

Query  970  NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGT  791
            NE    + L  DVF  PIR+DI+HRVV WQ    +QGTHSTKT  EV+GTG+K  PQKG 
Sbjct  68   NEPISIIDLEKDVFGAPIRRDILHRVVVWQRDAMRQGTHSTKTRGEVTGTGKKAAPQKGR  127

Query  790  GRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*G  611
            G+AR G  + PQFR G     PKPR H+T  L +KV  LGL+     +  ++ +      
Sbjct  128  GKARVGDRKAPQFRSGGIAFGPKPRDHST-DLPRKVQDLGLRA-ALSAKYAQDQLIVVDS  185

Query  610  YGTTFSHKTKNIVSYGQKMENAKKVLLV  527
                 SHKT+++    Q   +  K+L+V
Sbjct  186  LQHVESHKTRDLAQILQNAYDGSKMLIV  213



>ref|WP_003495173.1| MULTISPECIES: 50S ribosomal protein L4 [Rhizobium/Agrobacterium 
group]
 ref|YP_008632967.1| 50S ribosomal subunit protein L4 [Rhizobium sp. IRBG74]
 gb|EGP56653.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens F2]
 gb|EHH04479.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens CCNWGS0286]
 gb|EKJ96934.1| 50S ribosomal protein L4 [Rhizobium lupini HPC(L)]
 gb|EMS98240.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens str. Cherry 
2E-2-2]
 emb|CDI08938.1| 50S ribosomal subunit protein L4 [Rhizobium sp. IRBG74]
 gb|KAJ32737.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens]
 emb|CDN94256.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens]
 gb|KDR88148.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens GW4]
 gb|KGE80846.1| 50S ribosomal protein L4 [Rhizobium sp. H41]
Length=206

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V     +D G + L+ ++F +  R+DI+ R+VRWQLAK+QQGTH +K  SEVS TG K Y
Sbjct  5    VKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKSKNRSEVSRTGAKMY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  L L+
Sbjct  65   KQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALALR  110



>ref|WP_034859452.1| 50S ribosomal protein L4 [Ensifer sojae]
Length=206

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RVVRWQLAKRQQGTH  K  +E++ TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSHA   L KK+  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKIRALGLR  110



>ref|WP_006333366.1| 50S ribosomal protein L4 [Mesorhizobium sp. STM 4661]
 emb|CCV13525.1| 50S ribosomal subunit protein L4 [Mesorhizobium sp. STM 4661]
Length=206

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVELSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH   +L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-ELPKKVRALGLK  110



>ref|WP_012153048.1| 50S ribosomal protein L4 [Rickettsia massiliae]
 ref|YP_001499629.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
 gb|ABV85082.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
Length=209

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            V +  N++ G + L  ++F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  7    VLSLANKEVGEISLNENIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  66

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  67   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  124



>ref|WP_012673183.1| MULTISPECIES: 50S ribosomal protein L4 [Wolbachia]
 ref|YP_002727091.1| ribosomal protein L4 [Wolbachia sp. wRi]
 sp|C0R308.1|RL4_WOLWR RecName: Full=50S ribosomal protein L4 [Wolbachia sp. wRi]
 gb|ACN95300.1| ribosomal protein L4 [Wolbachia sp. wRi]
 emb|CDR78988.1| 50S ribosomal protein L4,50S ribosomal protein L4,50S ribosomal 
protein L4,50S ribosomal protein L4,Ribosomal protein L4/L1 
family [Wolbachia]
Length=204

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            + N  N++ G   L   +F    +  I+H +VRWQLAKR+ GTH TK IS+VSGT  KPY
Sbjct  5    LVNLSNDNVGTAQLNPLIFSAKQKLSILHDIVRWQLAKRRAGTHKTKGISDVSGTTAKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QK TGRAR G+LR PQFRGG  +  P  RSH T  LNKKV + GLK+
Sbjct  65   GQKRTGRARQGSLRSPQFRGGGIIFGPVVRSH-TYSLNKKVRKFGLKI  111



>ref|WP_027170368.1| 50S ribosomal protein L4 [Mesorhizobium sp. WSM3224]
Length=206

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    IKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>ref|WP_023757977.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNHC252B00]
 gb|ESY75021.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNHC252B00]
Length=206

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH   +L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-ELPKKVRALGLK  110



>ref|WP_012227956.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus]
 ref|YP_001603634.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 ref|YP_002277312.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 sp|A9H3R2.1|RL4_GLUDA RecName: Full=50S ribosomal protein L4 [Gluconacetobacter diazotrophicus 
PA1 5]
 emb|CAP57346.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 gb|ACI52697.1| ribosomal protein L4/L1e [Gluconacetobacter diazotrophicus PA1 
5]
Length=204

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 74/122 (61%), Gaps = 6/122 (5%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            +    N   G  VL  ++F V  R DI+ RVV WQLAKR+ GTH  K + EVSGT +KPY
Sbjct  5    IKTLDNGSAGTAVLPDEIFGVTPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTTKKPY  64

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKA  626
             QKGTG AR G+LR PQ+R G A+H P  R H    L KKV RLGL     +S+ S+  A
Sbjct  65   RQKGTGSARQGSLRAPQYRTGGAVHGPVVRDHG-YDLPKKVRRLGL-----ISALSQKAA  118

Query  625  HG  620
             G
Sbjct  119  EG  120



>ref|WP_023675140.1| MULTISPECIES: 50S ribosomal protein L4 [Mesorhizobium]
 gb|ESW91419.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC280B00]
 gb|ESX82166.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC420B00]
Length=206

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKLKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>gb|EIE91456.1| hypothetical protein RO3G_16167 [Rhizopus delemar RA 99-880]
Length=247

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 2/148 (1%)
 Frame = -2

Query  970  NEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGT  791
            NE    + L  +VF VPIR+DI+HRVV WQ    +QGT STKT +EVSGTG+K  PQKG 
Sbjct  48   NEPVSIINLEKEVFGVPIRRDILHRVVVWQRDSMRQGTSSTKTRAEVSGTGKKAAPQKGR  107

Query  790  GRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*G  611
            G+AR G ++ P FR G     PKPR H+T  L +KV  LGL++    +  ++ +      
Sbjct  108  GKARVGDMKAPHFRSGGIAFGPKPRDHST-DLPRKVQDLGLRV-ALSAKYAQDQLIVVES  165

Query  610  YGTTFSHKTKNIVSYGQKMENAKKVLLV  527
                 SHKT+++    +    + K+L++
Sbjct  166  LQNLESHKTRDLADIIKNSYESSKILII  193



>ref|WP_015470616.1| 50S ribosomal protein L4 [Bdellovibrio exovorus]
 ref|YP_007645733.1| 50S ribosomal protein L4 [Bdellovibrio exovorus JSS]
 gb|AGH96126.1| 50S ribosomal protein L4 [Bdellovibrio exovorus JSS]
Length=208

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 105/205 (51%), Gaps = 36/205 (18%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            V V N++ E  G + LA +VF+V ++ +++H VVRWQLA R+QGTH TKT   VSG G+K
Sbjct  4    VNVINWKKEKVGQVDLAANVFEVEVKNEVLHSVVRWQLASRRQGTHMTKTKGLVSGGGKK  63

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL-----------K  665
            P+ QKGTG AR G+ R P   GG  M  P PR++A + L KK+ ++GL           K
Sbjct  64   PFKQKGTGNARQGSTRSPLMPGGGTMFGPVPRNYAYV-LPKKMRKVGLSMALSHLFKEGK  122

Query  664  LDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLVDGGPQRKPQVGHSK  485
            L    S  S GK           +   K + S+G      KK +LVD       +V   K
Sbjct  123  LFVVDSMASEGKT----------AELNKRLKSFG-----IKKAVLVD-------EVSDEK  160

Query  484  YTLWQRFAFYCKY*NYIGI--FDGL  416
            + L  R     KY    GI  FD L
Sbjct  161  FQLAARNLQNFKYAPVAGINVFDLL  185



>ref|WP_014365540.1| 50S ribosomal protein L4 [Rickettsia massiliae]
 ref|YP_005301887.1| 50S ribosomal protein L4 [Rickettsia massiliae str. AZT80]
 gb|AFB31427.1| 50S ribosomal protein L4 [Rickettsia massiliae str. AZT80]
Length=207

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVP-IRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKP  809
            + +  N++ G + L  ++F V  IR DII +V+ WQ AK   G H TKT+SEV GT +KP
Sbjct  5    ILSLANKEVGEISLNENIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP  64

Query  808  YPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  629
            + QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL +      C+ GK
Sbjct  65   FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IHALSEKCAEGK  122



>emb|CDX14122.1| 50S ribosomal subunit protein L4 [Mesorhizobium sp. ORS3324]
Length=206

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAK+QQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGLK
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLK  110



>ref|WP_014764102.1| 50S ribosomal protein L4 [Sinorhizobium fredii]
 ref|YP_006398708.1| 50S ribosomal protein L4 [Sinorhizobium fredii USDA 257]
 gb|AFL51951.1| 50S ribosomal protein L4 [Sinorhizobium fredii USDA 257]
Length=206

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + V     +D G + L+  +F +  R+DII RV+RWQLAKRQQGTH  K  +EVS TG K
Sbjct  3    LTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVIRWQLAKRQQGTHKAKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLR  110



>ref|WP_035741518.1| 50S ribosomal protein L4 [Frankia sp. BMG5.12]
Length=243

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 2/158 (1%)
 Frame = -2

Query  1000 DLVVPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGT  821
            D  VPV      D G + L G VFDVP+   +IH+VV  QLA  +QGTHSTKT  EV G 
Sbjct  20   DRTVPVHAPAGGDAGSVELPGAVFDVPVNVPLIHQVVVAQLAAARQGTHSTKTRGEVRGG  79

Query  820  GRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSC  641
            GRKPY QKGTGRAR G+LR PQF GG  +H P PR++   +  KK+    L+        
Sbjct  80   GRKPYRQKGTGRARQGSLRAPQFTGGGIVHGPTPRNYDQ-RTPKKMKAAALR-GALSDRA  137

Query  640  SRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKVLLV  527
               + H         +  TK+ V+    + +A++VL+V
Sbjct  138  RNNRVHVVSSLVAGDAPSTKSAVAALTSLVDARRVLVV  175



>ref|WP_023672750.1| MULTISPECIES: 50S ribosomal protein L4 [Mesorhizobium]
 gb|ESW68630.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC277A00]
 gb|ESW71558.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC285A00]
 gb|ESW88297.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC269B00]
 gb|ESX05958.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC268A00]
 gb|ESX14579.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC255A00]
 gb|ESX21167.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC264A00]
 gb|ESX26396.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC440B00]
 gb|ESX33129.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC432A00]
 gb|ESX36539.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC440A00]
 gb|ESX49965.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC426A00]
 gb|ESX57397.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC424B00]
 gb|ESX62318.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC422A00]
 gb|ESX75030.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC416B00]
 gb|ESX79821.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC414A00]
 gb|ESX86182.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSHC412B00]
 gb|ESX92293.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC403B00]
 gb|ESX95973.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC405B00]
 gb|ESY03212.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC399B00]
 gb|ESY14274.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC395A00]
 gb|ESY20407.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC394B00]
 gb|ESY24544.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC391B00]
 gb|ESY35237.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC384A00]
 gb|ESY46987.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC380A00]
 gb|ESY51477.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC374B00]
 gb|ESY58361.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC372A00]
 gb|ESZ06583.1| 50S ribosomal protein L4 [Mesorhizobium sp. L2C089B000]
 gb|ESZ17191.1| 50S ribosomal protein L4 [Mesorhizobium sp. L2C085B000]
 gb|ESZ30905.1| 50S ribosomal protein L4 [Mesorhizobium sp. L2C067A000]
 gb|ESZ44793.1| 50S ribosomal protein L4 [Mesorhizobium sp. L103C565B0]
 gb|ESZ48113.1| 50S ribosomal protein L4 [Mesorhizobium sp. L2C054A000]
 gb|ESZ54997.1| 50S ribosomal protein L4 [Mesorhizobium sp. L103C120A0]
 gb|ESZ64185.1| 50S ribosomal protein L4 [Mesorhizobium sp. L103C131B0]
 gb|ESZ70829.1| 50S ribosomal protein L4 [Mesorhizobium sp. L103C105A0]
Length=206

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAKRQQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKRQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLR  110



>ref|WP_018328284.1| 50S ribosomal protein L4 [Rhizobium giardinii]
Length=206

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + VT    ++ G + L+  +F +  R+DII RVVRWQLAK+QQGTH  K  +EVS TG K
Sbjct  3    LKVTTLEGKEAGQVSLSDAIFGLEPREDIIARVVRWQLAKKQQGTHKAKGRAEVSRTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             + QKGTGRARH + R PQFRGG   H P  RSHA   L KKV  LGL+
Sbjct  63   MFKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAH-DLPKKVRALGLR  110



>ref|WP_023698816.1| MULTISPECIES: 50S ribosomal protein L4 [Mesorhizobium]
 gb|ESX03488.1| 50S ribosomal protein L4 [Mesorhizobium sp. LSJC265A00]
 gb|ESY10010.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC398B00]
 gb|ESY35698.1| 50S ribosomal protein L4 [Mesorhizobium sp. LNJC386A00]
 gb|ESZ68416.1| 50S ribosomal protein L4 [Mesorhizobium sp. L103C119B0]
Length=206

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = -2

Query  991  VPVTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK  812
            + +T    +D G + L+ ++F +  R+DI+ RVVRWQLAKRQQGTH  K  +E++ TG K
Sbjct  3    LKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKRQQGTHKAKGRAEIARTGAK  62

Query  811  PYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  665
             Y QKGTGRARH + R PQFRGG   H P  RSH    L KKV  LGL+
Sbjct  63   MYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEH-DLPKKVRALGLR  110



>gb|ETZ04754.1| 50S ribosomal protein L4 [Holospora undulata HU1]
 dbj|GAJ46018.1| 50S ribosomal protein L4 [Holospora elegans E1]
Length=217

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -2

Query  985  VTNFRNEDKGFMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY  806
            V N++ E  G + L+  +F   +RKDI+ RVV WQLAKR+ G H TK IS++SGT RKPY
Sbjct  15   VLNWQWESVGEVELSPFIFQQGVRKDILTRVVLWQLAKRRSGNHKTKGISDISGTTRKPY  74

Query  805  PQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  662
             QKGTG ARHG+ R PQF GG  +  P  RSH    LNKKV   GL++
Sbjct  75   RQKGTGNARHGSRRSPQFVGGAVIFGPVVRSHEH-SLNKKVKSFGLRV  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3548154421548