BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24772_g3_i13 len=2352 path=[1:0-284 34146:285-298 21594:299-299
21595:300-401 474:402-443 17740:444-445 516:446-468 33936:469-469
539:470-574 34319:575-593 663:594-673 743:674-677 747:678-767
837:768-2351]

Length=2352
                                                                      Score     E

ref|XP_001773052.1|  predicted protein                                97.4    3e-37   
ref|XP_002518422.1|  50S ribosomal protein L4, putative                 147   1e-35   Ricinus communis
ref|XP_010065410.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    147   2e-35   
gb|KDP20700.1|  hypothetical protein JCGZ_21171                         147   2e-35   
ref|XP_011069667.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    146   4e-35   
emb|CDY72492.1|  BnaCnng77920D                                          139   7e-35   
ref|XP_009592582.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    145   7e-35   
gb|EYU31362.1|  hypothetical protein MIMGU_mgv1a014658mg                142   7e-35   
ref|XP_007026181.1|  Ribosomal protein L4/L1 family isoform 1           145   9e-35   
ref|XP_004293324.1|  PREDICTED: 50S ribosomal protein L4-like           145   1e-34   
ref|XP_009758874.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    145   1e-34   
ref|XP_009610537.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    144   1e-34   
gb|EYU36343.1|  hypothetical protein MIMGU_mgv1a010848mg                144   2e-34   
ref|XP_010252520.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    144   2e-34   
gb|EYU36344.1|  hypothetical protein MIMGU_mgv1a010848mg                144   2e-34   
ref|XP_010252525.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    143   3e-34   
ref|XP_006342636.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    143   5e-34   
ref|XP_003634850.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    143   7e-34   
emb|CAN77922.1|  hypothetical protein VITISV_027648                     142   8e-34   Vitis vinifera
gb|KHG30769.1|  50S ribosomal L4                                        142   9e-34   
ref|XP_004252759.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    142   1e-33   
emb|CDP01310.1|  unnamed protein product                                135   1e-33   
gb|EPS72544.1|  hypothetical protein M569_02212                         141   2e-33   
gb|EYU24034.1|  hypothetical protein MIMGU_mgv1a010625mg                141   2e-33   
ref|XP_006836271.1|  hypothetical protein AMTR_s00101p00151570          140   3e-33   
gb|ACN26135.1|  unknown                                                 137   3e-33   Zea mays [maize]
gb|EEC69298.1|  hypothetical protein OsI_38360                          137   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004486189.1|  PREDICTED: 50S ribosomal protein L4-like           140   5e-33   
gb|EEE53224.1|  hypothetical protein OsJ_36122                          138   5e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CDY05720.1|  BnaC07g00830D                                          139   7e-33   
gb|AFK36510.1|  unknown                                                 139   8e-33   
ref|XP_011046992.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    140   8e-33   
ref|XP_006663555.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    139   1e-32   
emb|CDY31994.1|  BnaA07g00010D                                          138   2e-32   
gb|ABA98275.1|  ribosomal protein L4/L1 family protein                  138   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006298209.1|  hypothetical protein CARUB_v10014259mg             138   3e-32   
emb|CDY13887.1|  BnaA09g43890D                                          137   3e-32   
ref|XP_008778736.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    135   3e-32   
ref|XP_006383860.1|  hypothetical protein POPTR_0004s00660g             138   3e-32   
gb|AAM62769.1|  50S ribosomal protein L4                                137   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410210.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    137   5e-32   
ref|XP_009117510.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    136   6e-32   
ref|XP_004962972.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    137   7e-32   
emb|CDX81955.1|  BnaC08g36460D                                          137   7e-32   
ref|XP_006408921.1|  hypothetical protein EUTSA_v10002043mg             137   8e-32   
ref|XP_010502936.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    136   9e-32   
ref|XP_010514578.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    136   1e-31   
ref|NP_565463.1|  large subunit ribosomal protein L4                    136   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463709.1|  hypothetical protein SORBIDRAFT_01g004650          136   1e-31   Sorghum bicolor [broomcorn]
ref|XP_010456595.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    136   1e-31   
ref|XP_002446335.1|  hypothetical protein SORBIDRAFT_06g014470          137   1e-31   Sorghum bicolor [broomcorn]
ref|XP_010416335.1|  PREDICTED: LOW QUALITY PROTEIN: 50S ribosoma...    136   1e-31   
ref|NP_001147335.1|  LOC100280943                                       135   1e-31   Zea mays [maize]
ref|XP_004134779.1|  PREDICTED: 50S ribosomal protein L4-like           136   1e-31   
tpg|DAA52004.1|  TPA: 50S ribosomal protein L4                          135   1e-31   
ref|XP_008440040.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    136   2e-31   
gb|EMS66148.1|  50S ribosomal protein L4                                135   2e-31   
gb|EMT16009.1|  50S ribosomal protein L4                                135   2e-31   
gb|KDO78366.1|  hypothetical protein CISIN_1g021591mg                   135   2e-31   
ref|XP_006467374.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    135   2e-31   
ref|XP_002886003.1|  50S ribosomal protein L4                           135   2e-31   
ref|XP_007134426.1|  hypothetical protein PHAVU_010G046600g             135   2e-31   
gb|AES73712.2|  50S ribosomal protein L4, bacterial/organelle pro...    136   3e-31   
dbj|BAK00507.1|  predicted protein                                      134   4e-31   
ref|XP_004979576.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    134   5e-31   
gb|EMS55866.1|  50S ribosomal protein L4                                133   6e-31   
ref|XP_010914093.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    133   1e-30   
gb|EEC68430.1|  hypothetical protein OsI_36619                          132   1e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010914092.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    133   1e-30   
ref|XP_010553457.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    133   1e-30   
ref|XP_006383858.1|  hypothetical protein POPTR_0004s00660g             132   1e-30   
ref|XP_010553456.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    133   1e-30   
ref|XP_003577421.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    132   1e-30   
ref|XP_008787312.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    134   2e-30   
ref|XP_007147686.1|  hypothetical protein PHAVU_006G146000g             133   2e-30   
ref|NP_001068165.1|  Os11g0585700                                       132   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099157.1|  50S ribosomal protein L4                           132   2e-30   
ref|XP_010685040.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    132   3e-30   
ref|XP_006383859.1|  ribosomal protein L4                               131   3e-30   
gb|EMT27905.1|  50S ribosomal protein L4                                131   4e-30   
gb|AHA84219.1|  50S ribosomal protein L4                                132   4e-30   
gb|EEE52352.1|  hypothetical protein OsJ_34399                          132   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533789.1|  PREDICTED: 50S ribosomal protein L4, chlorop...    131   7e-30   
ref|XP_002969851.1|  hypothetical protein SELMODRAFT_227946           84.0    2e-28   
gb|ADE77062.1|  unknown                                                 127   2e-28   
ref|XP_002985293.1|  hypothetical protein SELMODRAFT_181558           84.0    3e-28   
ref|NP_001242456.1|  uncharacterized protein LOC100804238               126   4e-28   
ref|XP_006597049.1|  PREDICTED: uncharacterized protein LOC100804...    126   5e-28   
ref|XP_003534682.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    125   1e-27   
gb|KDO78367.1|  hypothetical protein CISIN_1g021591mg                   122   9e-27   
ref|XP_008224759.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...    119   6e-26   
ref|XP_008231665.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    119   1e-25   
ref|XP_007220702.1|  hypothetical protein PRUPE_ppa021068mg             118   2e-25   
ref|XP_008384099.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    118   3e-25   
ref|XP_009357493.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    118   3e-25   
ref|XP_009357492.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    118   3e-25   
ref|XP_009356763.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    117   6e-25   
ref|XP_010490301.1|  PREDICTED: 39S ribosomal protein L4, mitocho...    115   1e-24   
ref|WP_038461578.1|  50S ribosomal protein L4                         71.6    8e-24   
ref|XP_007212503.1|  hypothetical protein PRUPE_ppa017710mg             111   2e-23   
ref|XP_003603461.1|  50S ribosomal protein L4                           110   2e-22   
ref|WP_002725426.1|  MULTISPECIES: 50S ribosomal protein L4           68.9    1e-21   
ref|WP_014246890.1|  50S ribosomal protein L4                         71.6    2e-21   
ref|XP_009610538.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...    105   3e-21   
ref|WP_012973206.1|  50S ribosomal protein L4                         70.5    4e-21   
ref|WP_011385498.1|  50S ribosomal protein L4                         67.4    5e-21   
ref|WP_007004403.1|  50S ribosomal protein L4                         72.0    6e-21   
ref|WP_011477720.1|  50S ribosomal protein L4                         69.7    8e-21   
ref|WP_040289942.1|  50S ribosomal protein L4                         69.7    2e-20   
ref|WP_040848409.1|  50S ribosomal protein L4                         68.6    2e-20   
gb|EHM03061.1|  50S ribosomal protein L4                              69.3    2e-20   
ref|WP_009868565.1|  50S ribosomal protein L4                         64.3    3e-20   
emb|CDP01309.1|  unnamed protein product                                100   3e-20   
ref|WP_011390437.1|  50S ribosomal protein L4                         67.4    5e-20   
ref|WP_011191090.1|  50S ribosomal protein L4                         71.6    5e-20   
ref|WP_008615456.1|  50S ribosomal protein L4                         63.9    6e-20   
ref|WP_040256138.1|  50S ribosomal protein L4                         69.3    6e-20   
ref|NP_001066789.2|  Os12g0488600                                       102   6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|WP_011270631.1|  MULTISPECIES: 50S ribosomal protein L4           69.3    6e-20   
ref|WP_014364921.1|  50S ribosomal protein L4                         69.7    7e-20   
gb|KDO78369.1|  hypothetical protein CISIN_1g021591mg                   100   8e-20   
ref|WP_012151151.1|  50S ribosomal protein L4                         69.7    8e-20   
ref|WP_014014636.1|  MULTISPECIES: 50S ribosomal protein L4           69.7    9e-20   
ref|WP_004997785.1|  MULTISPECIES: 50S ribosomal protein L4           69.7    1e-19   
ref|WP_012736946.1|  MULTISPECIES: 50S ribosomal protein L4           69.7    1e-19   
ref|WP_012719919.1|  50S ribosomal protein L4                         69.7    1e-19   
ref|WP_023507969.1|  50S ribosomal protein L4                         69.3    1e-19   
ref|WP_008494543.1|  MULTISPECIES: 50S ribosomal protein L4           73.6    1e-19   
ref|WP_010421659.1|  50S ribosomal protein L4                         69.3    1e-19   
gb|KIE05824.1|  50S ribosomal protein L4                              66.6    2e-19   
ref|WP_012153048.1|  50S ribosomal protein L4                         69.3    2e-19   
ref|WP_014365540.1|  50S ribosomal protein L4                         69.3    2e-19   
ref|WP_039455032.1|  50S ribosomal protein L4                         66.6    2e-19   
gb|KFM28200.1|  50S ribosomal protein L4                              63.9    2e-19   
ref|WP_014412448.1|  50S ribosomal protein L4                         69.3    2e-19   
ref|WP_014103663.1|  50S ribosomal protein L4                         69.3    2e-19   
ref|WP_008945160.1|  50S ribosomal protein L4                         66.6    2e-19   
ref|WP_032138905.1|  50S ribosomal protein L4                         68.6    2e-19   
ref|WP_015468375.1|  50S ribosomal protein L4                         69.3    2e-19   
ref|WP_038540054.1|  50S ribosomal protein L4                         66.6    3e-19   
ref|WP_036704919.1|  MULTISPECIES: 50S ribosomal protein L4           66.6    3e-19   
ref|WP_014408922.1|  50S ribosomal protein L4                         69.7    3e-19   
ref|WP_026397249.1|  50S ribosomal protein L4                         66.2    4e-19   
ref|WP_028795257.1|  50S ribosomal protein L4                         65.5    6e-19   
ref|WP_011952195.1|  MULTISPECIES: 50S ribosomal protein L4           73.6    6e-19   
ref|WP_027302615.1|  50S ribosomal protein L4                         66.2    7e-19   
ref|WP_032073486.1|  50S ribosomal protein L4                         66.6    7e-19   
ref|WP_004596200.1|  50S ribosomal protein L4                         69.7    7e-19   
ref|WP_012148993.1|  50S ribosomal protein L4                         65.9    7e-19   
ref|WP_017442487.1|  50S ribosomal protein L4                         66.6    8e-19   
ref|WP_014409476.1|  50S ribosomal protein L4                         66.6    8e-19   
ref|WP_022675062.1|  50S ribosomal protein L4                         73.2    8e-19   
ref|WP_027134785.1|  50S ribosomal protein L4                         62.0    1e-18   
ref|WP_038603371.1|  50S ribosomal protein L4                         66.2    1e-18   
ref|WP_007678342.1|  50S ribosomal protein L4                         69.3    2e-18   
ref|WP_012149904.1|  50S ribosomal protein L4                         67.8    2e-18   
gb|ACU18021.1|  unknown                                               96.3    2e-18   Glycine max [soybeans]
ref|WP_008580969.1|  MULTISPECIES: 50S ribosomal protein L4           69.3    2e-18   
ref|WP_011631262.1|  50S ribosomal protein L4                         68.6    2e-18   
ref|WP_025319712.1|  50S ribosomal protein L4                         68.6    2e-18   
ref|WP_028639308.1|  50S ribosomal protein L4                         72.0    3e-18   
ref|WP_036717362.1|  50S ribosomal protein L4                         64.3    3e-18   
ref|WP_023837788.1|  50S ribosomal protein L4                         73.2    4e-18   
ref|WP_008067248.1|  50S ribosomal protein L4                         71.2    4e-18   
ref|WP_008852406.1|  50S ribosomal protein L4                         63.9    5e-18   
ref|WP_011444908.1|  50S ribosomal protein L4                         70.9    5e-18   
ref|WP_012565934.1|  50S ribosomal protein L4                         63.2    5e-18   
ref|WP_020695007.1|  50S ribosomal protein L4                         62.0    6e-18   
ref|WP_012227956.1|  50S ribosomal protein L4                         66.2    6e-18   
ref|WP_014392635.1|  50S ribosomal protein L4                         64.7    7e-18   
ref|WP_028466778.1|  50S ribosomal protein L4                         62.4    8e-18   
ref|WP_017670445.1|  MULTISPECIES: 50S ribosomal protein L4           72.0    1e-17   
ref|WP_011909486.1|  50S ribosomal protein L4                         65.1    1e-17   
ref|WP_037499788.1|  50S ribosomal protein L4                         70.1    1e-17   
ref|WP_014746146.1|  50S ribosomal protein L4                         60.1    1e-17   
ref|WP_002722493.1|  MULTISPECIES: 50S ribosomal protein L4           65.1    1e-17   
ref|WP_008853156.1|  50S ribosomal protein L4                         62.4    1e-17   
ref|WP_033921122.1|  50S ribosomal protein L4                         72.4    2e-17   
ref|WP_008828237.1|  MULTISPECIES: 50S ribosomal protein L4           70.9    2e-17   
ref|WP_035406792.1|  50S ribosomal protein L4                         70.9    2e-17   
ref|WP_029421879.1|  50S ribosomal protein L4                         63.9    3e-17   
ref|WP_031934484.1|  50S ribosomal protein L4                         69.3    3e-17   
gb|AHC73384.1|  50S ribosomal protein L4                              64.3    3e-17   
gb|AIH04237.1|  50S ribosomal protein L4                              78.6    3e-17   
ref|WP_034335761.1|  50S ribosomal protein L4                         62.0    3e-17   
ref|WP_022734147.1|  50S ribosomal protein L4                         64.3    3e-17   
ref|WP_021233445.1|  50S ribosomal protein L4                         71.6    3e-17   
ref|XP_009515921.1|  hypothetical protein PHYSODRAFT_552366           59.7    4e-17   
ref|WP_009574005.1|  50S ribosomal protein L4                         65.9    4e-17   
ref|WP_023943129.1|  50S ribosomal protein L4                         63.9    4e-17   
ref|WP_007282722.1|  MULTISPECIES: 50S ribosomal protein L4           64.3    4e-17   
ref|WP_038062588.1|  50S ribosomal protein L4                         78.2    4e-17   
ref|XP_002066858.1|  GK24328                                          59.7    4e-17   Drosophila willistoni
ref|WP_028843121.1|  50S ribosomal protein L4                         78.6    4e-17   
ref|XP_002001866.1|  GI14673                                          59.7    4e-17   Drosophila mojavensis
ref|WP_010502124.1|  50S ribosomal protein L4                         64.3    4e-17   
ref|WP_029604136.1|  50S ribosomal protein L4                         65.1    4e-17   
ref|WP_007011871.1|  MULTISPECIES: 50S ribosomal protein L4           70.9    5e-17   
ref|XP_001988917.1|  GH11428                                          58.9    5e-17   Drosophila grimshawi
ref|WP_038144446.1|  50S ribosomal protein L4                         65.9    5e-17   
ref|WP_035745972.1|  50S ribosomal protein L4                         65.5    6e-17   
ref|XP_002051745.1|  GJ17161                                          59.7    6e-17   Drosophila virilis
ref|WP_028718451.1|  50S ribosomal protein L4                         63.9    6e-17   
ref|WP_011983246.1|  50S ribosomal protein L4                         70.9    6e-17   
ref|WP_038073541.1|  50S ribosomal protein L4                         65.5    6e-17   
ref|WP_011251965.1|  50S ribosomal protein L4                         63.5    6e-17   
ref|WP_018084549.1|  50S ribosomal protein L4                         64.7    7e-17   
ref|WP_019646044.1|  50S ribosomal protein L4                         64.3    7e-17   
ref|WP_036738939.1|  50S ribosomal protein L4                         63.2    7e-17   
ref|WP_026962533.1|  50S ribosomal protein L4                         63.9    7e-17   
ref|WP_005862784.1|  50S ribosomal protein L4                         62.8    7e-17   
gb|EFA80316.1|  hypothetical protein PPL_07147                        59.3    7e-17   Polysphondylium pallidum PN500
ref|WP_035714297.1|  50S ribosomal protein L4                         65.1    7e-17   
ref|WP_028841346.1|  50S ribosomal protein L4                         77.0    7e-17   
ref|WP_018131281.1|  50S ribosomal protein L4                         69.3    8e-17   
ref|XP_004521834.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  58.5    9e-17   
ref|WP_020951882.1|  50S ribosomal protein L4                         62.0    9e-17   
ref|XP_006377175.1|  hypothetical protein POPTR_0011s01580g           89.7    9e-17   
ref|WP_022253576.1|  50S ribosomal protein L4                         74.3    1e-16   
ref|WP_040953123.1|  50S ribosomal protein L4                         67.8    1e-16   
ref|WP_036639444.1|  50S ribosomal protein L4                         64.7    1e-16   
ref|WP_020592345.1|  50S ribosomal protein L4                         66.6    1e-16   
dbj|GAJ29493.1|  50S ribosomal protein L4                             63.2    1e-16   
ref|WP_028713573.1|  50S ribosomal protein L4                         62.8    1e-16   
ref|WP_017999555.1|  50S ribosomal protein L4                         62.8    1e-16   
ref|WP_025899914.1|  50S ribosomal protein L4                         60.5    1e-16   
ref|WP_007424174.1|  MULTISPECIES: 50S ribosomal protein L4           71.2    1e-16   
ref|WP_037997051.1|  50S ribosomal protein L4                         63.5    2e-16   
ref|WP_037526525.1|  50S ribosomal protein L4                         68.2    2e-16   
ref|XP_011210681.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  58.5    2e-16   
ref|WP_038054993.1|  50S ribosomal protein L4                         73.9    2e-16   
ref|WP_036151961.1|  50S ribosomal protein L4                         70.9    2e-16   
ref|WP_010169944.1|  50S ribosomal protein L4                         68.6    2e-16   
ref|WP_025811627.1|  50S ribosomal protein L4                         65.9    2e-16   
ref|XP_008907688.1|  50S ribosomal protein L4                         59.3    2e-16   
ref|WP_039806280.1|  50S ribosomal protein L4                         68.6    2e-16   
ref|WP_041085434.1|  50S ribosomal protein L4                         69.3    2e-16   
ref|XP_001357123.1|  GA19152                                          59.7    2e-16   Drosophila pseudoobscura pseudoobscura
gb|AJE45364.1|  50S ribosomal protein L4                              61.2    3e-16   
gb|EHJ78691.1|  ribosomal protein L4                                  60.5    3e-16   
ref|XP_001420312.1|  Putative mitochondrial ribosomal protein L4      59.7    3e-16   Ostreococcus lucimarinus CCE9901
ref|WP_035839229.1|  50S ribosomal protein L4                         63.9    3e-16   
ref|WP_036735704.1|  50S ribosomal protein L4                         58.2    3e-16   
ref|WP_038062966.1|  50S ribosomal protein L4                         65.1    3e-16   
ref|WP_010400231.1|  50S ribosomal protein L4                         61.6    3e-16   
ref|WP_028717097.1|  50S ribosomal protein L4                         62.8    3e-16   
ref|WP_025885434.1|  50S ribosomal protein L4                         65.1    3e-16   
ref|WP_020062293.1|  50S ribosomal protein L4                         68.6    3e-16   
ref|WP_036754151.1|  50S ribosomal protein L4                         61.6    3e-16   
ref|WP_011747102.1|  50S ribosomal protein L4                         61.6    3e-16   
ref|WP_025822023.1|  50S ribosomal protein L4                         65.1    3e-16   
dbj|GAM14812.1|  LSU ribosomal protein L4p (L1e)                      69.7    4e-16   
ref|WP_030022146.1|  50S ribosomal protein L4                         68.6    4e-16   
ref|WP_028397308.1|  50S ribosomal protein L4                         66.2    4e-16   
ref|WP_006640318.1|  50S ribosomal protein L4                         71.6    4e-16   
ref|WP_028574927.1|  50S ribosomal protein L4                         67.4    4e-16   
gb|ETZ04754.1|  50S ribosomal protein L4                              65.9    4e-16   
gb|EKE09117.1|  hypothetical protein ACD_16C00213G0040                66.2    4e-16   
ref|WP_024844052.1|  50S ribosomal protein L4                         61.2    4e-16   
ref|WP_035433714.1|  50S ribosomal protein L4                         68.2    4e-16   
ref|WP_022708210.1|  50S ribosomal protein L4                         61.6    4e-16   
ref|WP_023979003.1|  MULTISPECIES: 50S ribosomal protein L4           64.7    4e-16   
ref|WP_007662756.1|  50S ribosomal protein L4                         58.2    4e-16   
ref|XP_001640605.1|  predicted protein                                68.9    5e-16   Nematostella vectensis
emb|CEG24421.1|  50S ribosomal protein L4                             67.0    5e-16   
ref|WP_034642618.1|  50S ribosomal protein L4                         68.6    5e-16   
ref|WP_017666960.1|  MULTISPECIES: 50S ribosomal protein L4           62.0    5e-16   
ref|WP_016407829.1|  50S ribosomal protein L4                         72.8    5e-16   
ref|WP_029936461.1|  50S ribosomal protein L4                         69.3    5e-16   
ref|WP_020042727.1|  50S ribosomal protein L4                         61.6    5e-16   
ref|WP_026561221.1|  50S ribosomal protein L4                         69.7    5e-16   
ref|WP_038130256.1|  50S ribosomal protein L4                         63.9    5e-16   
ref|WP_038413160.1|  50S ribosomal protein L4                         68.6    5e-16   
ref|WP_010279595.1|  50S ribosomal protein L4                         67.4    5e-16   
ref|WP_035544091.1|  MULTISPECIES: 50S ribosomal protein L4           65.9    5e-16   
ref|WP_029893979.1|  50S ribosomal protein L4                         70.1    5e-16   
ref|WP_001127258.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    5e-16   
ref|XP_970941.1|  PREDICTED: 39S ribosomal protein L4, mitochondrial  59.3    5e-16   Tribolium castaneum [rust-red flour beetle]
ref|WP_033542798.1|  50S ribosomal protein L4                         66.2    5e-16   
ref|WP_001127261.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    5e-16   
ref|WP_035049348.1|  50S ribosomal protein L4                         58.5    6e-16   
gb|KGT45918.1|  50S ribosomal protein L4                              68.6    6e-16   
ref|WP_016084023.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    6e-16   
ref|WP_036175723.1|  50S ribosomal protein L4                         62.0    6e-16   
ref|WP_017150127.1|  50S ribosomal protein L4                         68.6    7e-16   
ref|XP_011191912.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  58.5    7e-16   
ref|WP_001127260.1|  50S ribosomal protein L4                         68.6    7e-16   
ref|WP_015458358.1|  50S ribosomal protein L4                         70.1    8e-16   
ref|WP_026586067.1|  50S ribosomal protein L4                         71.6    8e-16   
ref|XP_317543.4|  AGAP007937-PA                                       57.4    8e-16   
ref|WP_003178327.1|  MULTISPECIES: 50S ribosomal protein L4           69.3    8e-16   
ref|WP_004616936.1|  50S ribosomal protein L4                         57.8    8e-16   
ref|WP_025840923.1|  50S ribosomal protein L4                         63.5    9e-16   
dbj|GAK32767.1|  50S ribosomal protein L4                             57.0    9e-16   
ref|WP_026593166.1|  50S ribosomal protein L4                         68.6    9e-16   
ref|WP_003194351.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    9e-16   
ref|WP_010506735.1|  MULTISPECIES: 50S ribosomal protein L4           63.9    9e-16   
ref|XP_002588998.1|  hypothetical protein BRAFLDRAFT_124913           58.5    9e-16   
ref|WP_001127259.1|  50S ribosomal protein L4                         68.2    1e-15   
ref|WP_014105029.1|  50S ribosomal protein L4                         63.9    1e-15   
ref|WP_010513084.1|  50S ribosomal protein L4                         63.9    1e-15   
ref|WP_009791327.1|  MULTISPECIES: 50S ribosomal protein L4           69.3    1e-15   
ref|WP_041120836.1|  50S ribosomal protein L4                         66.6    1e-15   
ref|WP_026678041.1|  50S ribosomal protein L4                         68.6    1e-15   
ref|WP_027289402.1|  50S ribosomal protein L4                         58.9    1e-15   
ref|WP_007682169.1|  50S ribosomal protein L4                         69.3    1e-15   
ref|WP_018631573.1|  50S ribosomal protein L4                         61.2    1e-15   
ref|XP_004398915.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  57.8    1e-15   
ref|WP_035189286.1|  50S ribosomal protein L4                         67.4    1e-15   
emb|CCQ74605.1|  50S ribosomal subunit protein L4                     64.3    1e-15   
ref|WP_041054666.1|  50S ribosomal protein L4                         65.1    1e-15   
ref|WP_012521789.1|  50S ribosomal protein L4                         56.6    1e-15   
ref|WP_028543509.1|  50S ribosomal protein L4                         67.8    1e-15   
ref|WP_018663959.1|  50S ribosomal protein L4                         67.0    1e-15   
ref|WP_007164623.1|  50S ribosomal protein L4                         68.6    1e-15   
ref|WP_029006306.1|  50S ribosomal protein L4                         57.0    2e-15   
ref|WP_013658505.1|  50S ribosomal protein L4                         65.5    2e-15   
ref|WP_027285684.1|  50S ribosomal protein L4                         61.2    2e-15   
ref|WP_015087935.1|  50S ribosomal protein L4                         64.3    2e-15   
ref|WP_017928015.1|  50S ribosomal protein L4                         62.0    2e-15   
gb|ERL89826.1|  hypothetical protein D910_07186                       59.7    2e-15   
gb|ETX27456.1|  50S ribosomal protein L4                              57.8    2e-15   
ref|WP_013858080.1|  50S ribosomal protein L4                         67.0    2e-15   
ref|WP_008871705.1|  50S ribosomal protein L4                         71.2    2e-15   
ref|WP_036172437.1|  50S ribosomal protein L4                         69.7    2e-15   
ref|XP_002598388.1|  hypothetical protein BRAFLDRAFT_128122           57.4    2e-15   
ref|WP_011543087.1|  50S ribosomal protein L4                         63.9    2e-15   
ref|XP_002906814.1|  50S ribosomal protein L4                         59.7    2e-15   
ref|WP_019956977.1|  50S ribosomal protein L4                         60.1    2e-15   
ref|WP_029912287.1|  50S ribosomal protein L4                         56.6    2e-15   
ref|WP_008883215.1|  50S ribosomal protein L4                         57.8    2e-15   
ref|WP_011049496.1|  50S ribosomal protein L4                         60.8    2e-15   
ref|WP_029101068.1|  50S ribosomal protein L4                         70.1    2e-15   
ref|WP_010411122.1|  50S ribosomal protein L4                         66.6    2e-15   
gb|AHF05897.1|  50S ribosomal protein L4                              65.1    2e-15   
ref|WP_006445776.1|  50S ribosomal protein L4                         63.5    3e-15   
ref|WP_013066045.1|  50S ribosomal protein L4                         61.6    3e-15   
ref|XP_007441618.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  60.1    3e-15   
ref|WP_002115319.1|  50S ribosomal protein L4                         68.6    3e-15   
ref|WP_013081372.1|  MULTISPECIES: 50S ribosomal protein L4           68.2    3e-15   
ref|WP_009503375.1|  50S ribosomal protein L4                         57.0    3e-15   
ref|WP_013054928.1|  MULTISPECIES: 50S ribosomal protein L4           68.2    3e-15   
ref|WP_028481938.1|  50S ribosomal protein L4                         57.4    3e-15   
ref|WP_036691415.1|  50S ribosomal protein L4                         69.3    3e-15   
ref|WP_037556363.1|  50S ribosomal protein L4                         63.9    3e-15   
ref|WP_013537017.1|  50S ribosomal protein L4                         63.9    3e-15   
dbj|BAN21196.1|  mitochondrial ribosomal protein L4                   56.6    3e-15   
gb|AHI26162.1|  50S ribosomal protein L4                              64.3    3e-15   
ref|WP_010498878.1|  50S ribosomal protein L4                         69.3    3e-15   
ref|XP_005993388.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  58.9    3e-15   
ref|WP_013078647.1|  50S ribosomal protein L4                         56.2    3e-15   
ref|WP_016839369.1|  50S ribosomal protein L4                         71.6    3e-15   
ref|WP_014096499.1|  50S ribosomal protein L4                         67.0    3e-15   
ref|WP_011451664.1|  50S ribosomal protein L4                         65.9    3e-15   
ref|WP_003354781.1|  50S ribosomal protein L4                         69.7    4e-15   
ref|WP_024847016.1|  50S ribosomal protein L4                         63.2    4e-15   
ref|WP_036748405.1|  50S ribosomal protein L4                         57.4    4e-15   
ref|WP_038538454.1|  50S ribosomal protein L4                         70.5    4e-15   
ref|XP_004926561.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  56.6    4e-15   
gb|EWH23376.1|  50S ribosomal protein L4                              69.3    4e-15   
ref|WP_010234667.1|  50S ribosomal protein L4                         69.3    4e-15   
ref|WP_039285531.1|  50S ribosomal protein L4                         67.4    4e-15   
gb|KDR19698.1|  39S ribosomal protein L4, mitochondrial               55.8    4e-15   
gb|ETW11609.1|  50S ribosomal protein L4                              56.6    4e-15   
ref|WP_038008640.1|  MULTISPECIES: 50S ribosomal protein L4           58.2    4e-15   
ref|WP_025909726.1|  50S ribosomal protein L4                         67.8    4e-15   
ref|WP_034161643.1|  50S ribosomal protein L4                         67.4    5e-15   
ref|WP_026964703.1|  50S ribosomal protein L4                         65.5    5e-15   
ref|WP_007399620.1|  MULTISPECIES: 50S ribosomal protein L4           62.0    5e-15   
ref|WP_028041112.1|  50S ribosomal protein L4                         56.6    5e-15   
ref|WP_037263231.1|  50S ribosomal protein L4                         57.0    5e-15   
ref|WP_008236554.1|  50S ribosomal protein L4                         56.2    5e-15   
ref|WP_011240424.1|  50S ribosomal protein L4                         68.9    5e-15   
ref|WP_034905021.1|  50S ribosomal protein L4                         67.8    5e-15   
ref|WP_011255725.1|  50S ribosomal protein L4                         70.1    5e-15   
ref|WP_025851032.1|  50S ribosomal protein L4                         69.7    5e-15   
ref|XP_003486754.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  56.2    5e-15   
gb|EFN63004.1|  39S ribosomal protein L4, mitochondrial               58.2    6e-15   
ref|WP_018302707.1|  50S ribosomal protein L4                         60.5    6e-15   
ref|WP_041051274.1|  50S ribosomal protein L4                         66.2    6e-15   
ref|WP_040963563.1|  50S ribosomal protein L4                         67.0    6e-15   
ref|WP_031537900.1|  50S ribosomal protein L4                         69.3    7e-15   
ref|WP_028031850.1|  50S ribosomal protein L4                         57.4    7e-15   
ref|XP_011064542.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  57.8    7e-15   
ref|WP_003328287.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    7e-15   
ref|WP_012285667.1|  50S ribosomal protein L4                         56.2    8e-15   
ref|WP_003727695.1|  MULTISPECIES: 50S ribosomal protein L4           69.7    8e-15   
ref|WP_010919128.1|  50S ribosomal protein L4                         55.8    8e-15   
ref|WP_022109480.1|  50S ribosomal protein L4                         63.9    8e-15   
ref|WP_008406968.1|  50S ribosomal protein L4                         66.6    8e-15   
ref|WP_014822419.1|  50S ribosomal protein L4                         67.0    8e-15   
ref|XP_010567162.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  55.8    8e-15   
ref|WP_035080027.1|  50S ribosomal protein L4                         56.6    8e-15   
ref|XP_008046081.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  61.2    9e-15   
gb|KGM47515.1|  50S ribosomal protein L4                              62.8    9e-15   
ref|WP_029282830.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    9e-15   
ref|WP_031447986.1|  50S ribosomal protein L4                         56.2    1e-14   
ref|WP_010127201.1|  50S ribosomal protein L4                         65.9    1e-14   
ref|WP_011155288.1|  50S ribosomal protein L4                         68.9    1e-14   
ref|XP_008202484.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  56.2    1e-14   
gb|AHM03939.1|  LSU ribosomal protein L4p (L1e)                       60.5    1e-14   
ref|WP_008331607.1|  50S ribosomal protein L4                         60.8    1e-14   
ref|WP_027716897.1|  50S ribosomal protein L4                         66.6    1e-14   
ref|WP_025054729.1|  50S ribosomal protein L4                         59.3    1e-14   
ref|WP_025826970.1|  50S ribosomal protein L4                         64.7    1e-14   
ref|XP_008545303.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  58.9    1e-14   
ref|WP_007406134.1|  50S ribosomal protein L4                         67.4    1e-14   
ref|WP_034323219.1|  50S ribosomal protein L4                         68.9    1e-14   
ref|WP_022187500.1|  50S ribosomal protein L4                         60.8    1e-14   
ref|WP_004233626.1|  MULTISPECIES: 50S ribosomal protein L4           69.7    1e-14   
ref|WP_020057552.1|  50S ribosomal protein L4                         55.8    1e-14   
ref|WP_008356530.1|  50S ribosomal protein L4                         68.6    1e-14   
ref|WP_036183156.1|  50S ribosomal protein L4                         70.9    1e-14   
ref|WP_008035024.1|  50S ribosomal protein L4                         55.8    1e-14   
dbj|GAK46429.1|  50S ribosomal protein L4                             58.9    1e-14   
ref|WP_031393764.1|  MULTISPECIES: 50S ribosomal protein L4           65.1    1e-14   
ref|XP_005189402.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  56.6    1e-14   
ref|WP_026326660.1|  50S ribosomal protein L4                         69.7    1e-14   
ref|WP_023466630.1|  MULTISPECIES: 50S ribosomal protein L4           66.2    1e-14   
ref|WP_027410236.1|  50S ribosomal protein L4                         68.6    1e-14   
ref|WP_036200755.1|  50S ribosomal protein L4                         68.6    1e-14   
ref|WP_016429883.1|  50S ribosomal protein L4                         68.9    1e-14   
ref|WP_029365709.1|  50S ribosomal protein L4                         57.4    1e-14   
ref|WP_034954472.1|  50S ribosomal protein L4                         65.9    1e-14   
ref|WP_012282472.1|  50S ribosomal protein L4                         63.9    1e-14   
ref|WP_022178366.1|  50S ribosomal protein L4                         67.0    1e-14   
ref|WP_006831879.1|  50S ribosomal protein L4                         67.0    1e-14   
ref|WP_019090047.1|  50S ribosomal protein L4                         64.7    1e-14   
dbj|GAM02859.1|  50S ribosomal protein L4                             68.6    1e-14   
ref|WP_025729833.1|  50S ribosomal protein L4                         66.6    1e-14   
ref|WP_016204559.1|  50S ribosomal protein L4                         69.3    1e-14   
ref|WP_005621925.1|  MULTISPECIES: 50S ribosomal protein L4           62.0    1e-14   
ref|WP_011537608.1|  50S ribosomal protein L4                         61.6    1e-14   
ref|WP_010285046.1|  50S ribosomal protein L4                         70.1    2e-14   
ref|WP_028552015.1|  50S ribosomal protein L4                         66.6    2e-14   
ref|WP_027442295.1|  50S ribosomal protein L4                         65.1    2e-14   
gb|ETE68492.1|  39S ribosomal protein L4, mitochondrial               58.9    2e-14   
ref|WP_012683984.1|  50S ribosomal protein L4                         67.4    2e-14   
ref|WP_033964934.1|  50S ribosomal protein L4                         65.9    2e-14   
ref|WP_022691833.1|  50S ribosomal protein L4                         65.9    2e-14   
gb|ETZ07207.1|  50S ribosomal protein L4                              65.5    2e-14   
ref|WP_022571551.1|  50S ribosomal protein L4                         55.1    2e-14   
ref|WP_024425598.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    2e-14   
ref|WP_007496312.1|  MULTISPECIES: 50S ribosomal protein L4           68.6    2e-14   
ref|XP_002089953.1|  GE19365                                          56.2    2e-14   
ref|WP_040458367.1|  50S ribosomal protein L4                         65.5    2e-14   
ref|WP_015513759.1|  50S ribosomal protein L4                         70.5    2e-14   
ref|WP_015816138.1|  50S ribosomal protein L4                         63.5    2e-14   
emb|CCA14163.1|  50S ribosomal protein L4 putative                    55.1    2e-14   
ref|WP_023463859.1|  50S ribosomal protein L4                         55.8    2e-14   
ref|WP_039388090.1|  50S ribosomal protein L4                         65.9    2e-14   
gb|ETN62234.1|  50S ribosomal protein L4                              56.2    2e-14   
ref|WP_024027906.1|  50S ribosomal protein L4                         68.9    2e-14   
ref|WP_034765984.1|  50S ribosomal protein L4                         67.0    2e-14   
ref|WP_040225853.1|  50S ribosomal protein L4                         65.5    2e-14   
ref|WP_025697580.1|  50S ribosomal protein L4                         67.0    2e-14   
ref|WP_038663400.1|  50S ribosomal protein L4                         64.3    2e-14   
ref|WP_036652495.1|  50S ribosomal protein L4                         68.9    2e-14   
ref|WP_007085289.1|  50S ribosomal protein L4                         68.9    2e-14   
ref|WP_039758109.1|  50S ribosomal protein L4                         65.5    2e-14   
ref|WP_019171226.1|  50S ribosomal protein L4                         60.1    2e-14   
gb|KDO33439.1|  hypothetical protein SPRG_02246                       58.2    2e-14   
ref|WP_021095334.1|  50S ribosomal protein L4                         68.9    2e-14   
ref|WP_019415625.1|  50S ribosomal protein L4                         68.9    2e-14   
ref|WP_018083975.1|  50S ribosomal protein L4                         55.8    2e-14   
ref|WP_008227670.1|  50S ribosomal protein L4                         58.2    2e-14   
emb|CCI43400.1|  unnamed protein product                              56.2    2e-14   
ref|WP_036143386.1|  50S ribosomal protein L4                         70.5    3e-14   
ref|WP_019123538.1|  50S ribosomal protein L4                         70.1    3e-14   
ref|WP_003042204.1|  50S ribosomal protein L4                         61.6    3e-14   
ref|WP_025116440.1|  MULTISPECIES: 50S ribosomal protein L4           70.1    3e-14   
ref|XP_004378419.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  59.3    3e-14   
emb|CCI43401.1|  unnamed protein product                              56.2    3e-14   
ref|WP_025059464.1|  50S ribosomal protein L4                         57.4    3e-14   
ref|WP_038092265.1|  50S ribosomal protein L4                         66.6    3e-14   
ref|WP_006925138.1|  50S ribosomal protein L4                         62.8    3e-14   
ref|WP_023666236.1|  50S ribosomal protein L4                         59.3    3e-14   
emb|CEI85299.1|  50S ribosomal protein L4                             69.3    3e-14   
ref|WP_011703286.1|  50S ribosomal protein L4                         69.7    3e-14   
ref|WP_011304723.1|  50S ribosomal protein L4                         68.9    3e-14   
ref|WP_010137467.1|  50S ribosomal protein L4                         54.3    3e-14   
ref|WP_006322654.1|  50S ribosomal protein L4                         68.6    3e-14   
ref|XP_005818743.1|  hypothetical protein GUITHDRAFT_166830           57.8    3e-14   
ref|WP_026565523.1|  50S ribosomal protein L4                         70.1    3e-14   
ref|WP_017651194.1|  50S ribosomal protein L4                         62.4    3e-14   
ref|WP_020880418.1|  50S ribosomal protein L4                         65.9    3e-14   
ref|XP_005336333.1|  PREDICTED: 39S ribosomal protein L4, mitocho...  61.6    3e-14   
gb|KFB39706.1|  50S ribosomal protein L4                              56.6    3e-14   
ref|WP_034676078.1|  50S ribosomal protein L4                         68.6    3e-14   
ref|WP_027262214.1|  50S ribosomal protein L4                         55.1    3e-14   
gb|EKD61943.1|  hypothetical protein ACD_54C00012G0002                57.8    3e-14   
ref|WP_012296062.1|  50S ribosomal protein L4                         69.7    3e-14   
ref|WP_037529218.1|  50S ribosomal protein L4                         63.5    3e-14   
ref|WP_025693026.1|  50S ribosomal protein L4                         65.9    4e-14   
ref|WP_004888667.1|  50S ribosomal protein L4                         68.2    4e-14   
ref|WP_027091998.1|  50S ribosomal protein L4                         65.1    4e-14   
ref|WP_037534173.1|  50S ribosomal protein L4                         63.9    4e-14   
ref|WP_012369010.1|  MULTISPECIES: 50S ribosomal protein L4           66.6    4e-14   
ref|WP_026974609.1|  50S ribosomal protein L4                         61.2    4e-14   
gb|KFL88405.1|  LSU ribosomal protein L4p (L1e)                       64.3    4e-14   



>ref|XP_001773052.1| predicted protein [Physcomitrella patens]
 gb|EDQ62092.1| predicted protein [Physcomitrella patens]
Length=269

 Score = 97.4 bits (241),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGP-INENLKLATQNIHYVNVL  392
            EGKL VF+ +E P+  K R +  +       KKVL+VD    +NE+L  AT N+HYVNVL
Sbjct  175  EGKLKVFDSVEPPT-LKTREMERLIADIEGCKKVLIVDDAETVNESLCRATGNLHYVNVL  233

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            P+ GLNVYSIL HDTLVMS  A+ RI ER+HTPINR
Sbjct  234  PAKGLNVYSILQHDTLVMSVGAIRRIEERLHTPINR  269


 Score = 88.2 bits (217),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGTGRKP PQKG+GRARHG+LRGPQFRGG   H PKPRSH  I L K+V RLGLK+  
Sbjct  111  EVSGTGRKPGPQKGSGRARHGSLRGPQFRGGATQHGPKPRSH-EIGLQKQVRRLGLKV-A  168

Query  587  FVSSCSRGKAHGF  549
              S  + GK   F
Sbjct  169  LSSRVAEGKLKVF  181



>ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus communis]
 gb|EEF43809.1| 50S ribosomal protein L4, putative [Ricinus communis]
Length=294

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +    ++    KK+LLVDGGPINE LKLA QN+HYVNVLP
Sbjct  201  EGKLLVFEDLEIPTH-KTKNIVNYVKQMEETKKLLLVDGGPINEKLKLAAQNLHYVNVLP  259

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  260  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  294


 Score =   117 bits (292),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK NKKV RLGLK+ 
Sbjct  136  SEVSGTGKKPYRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKCNKKVRRLGLKI-  193

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y ++ME  KK
Sbjct  194  ALTARAAEGKLLVFEDLEIP-THKTKNIVNYVKQMEETKK  232



>ref|XP_010065410.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Eucalyptus 
grandis]
 gb|KCW62860.1| hypothetical protein EUGRSUZ_G00454 [Eucalyptus grandis]
Length=315

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++F+DME+P+H K + +     +    KKVLLVDGGPINE LKLATQN+HYVNVLP
Sbjct  222  EGKLLIFDDMEIPTH-KTKNVVNYVEQMENTKKVLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  281  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  315


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+ RGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  157  SEVSGTGRKPWKQKGTGRARHGSRRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  214

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKN+V+Y ++MEN KK    
Sbjct  215  ALTARAAEGKLLIFDDMEIP-THKTKNVVNYVEQMENTKKVLLV  257



>gb|KDP20700.1| hypothetical protein JCGZ_21171 [Jatropha curcas]
Length=315

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +    ++    KK+L+VDGGPINE LKLATQN+HYVNVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNCVKQMEDTKKLLVVDGGPINEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  281  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  315


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG AMH PKPRSHA IK NKKV RLGLK+ 
Sbjct  157  SEVSGTGRKPYRQKGTGRARHGTLRGPQFRGGAAMHGPKPRSHA-IKCNKKVRRLGLKI-  214

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+  ++ME+ KK
Sbjct  215  ALTARAAEGKLLVFEDLEVP-THKTKNIVNCVKQMEDTKK  253



>ref|XP_011069667.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
 ref|XP_011069668.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
 ref|XP_011069669.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Sesamum indicum]
Length=305

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL VFED+E+PSH K + +     +    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  212  EGKLTVFEDLEVPSH-KTKNIVNYVHQMENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  270

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  271  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  305


 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  147  SEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  204

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV+Y  +MEN KK
Sbjct  205  ALSARAAEGKLTVFEDLEVP-SHKTKNIVNYVHQMENTKK  243



>emb|CDY72492.1| BnaCnng77920D [Brassica napus]
Length=113

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  20   EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  78

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  79   SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  113



>ref|XP_009592582.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009592583.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
 ref|XP_009592584.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=309

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLMVFED+E+ SH K + +     +    KK+LLVDGGPI+E LKLATQN+HYVNVLP
Sbjct  216  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNVHYVNVLP  274

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  275  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  309


 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRG QFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  151  SEVSGTGRKPWRQKGTGRARHGTLRGAQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  208

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     + SHKTKNIV+Y  ++EN KK
Sbjct  209  ALSARAAEGKLMVFEDLEIS-SHKTKNIVNYFNQLENTKK  247



>gb|EYU31362.1| hypothetical protein MIMGU_mgv1a014658mg [Erythranthe guttata]
Length=182

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLM+F+D+E+PSH K + +   A++    KK+LLVDGGP+NE LKLATQN+HYVNVLP
Sbjct  89   EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  147

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AVN IVERMHTPI+R
Sbjct  148  SIGLNVYSILLHDTLVMSRSAVNAIVERMHTPISR  182


 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG  MH P+PRSHA IKLNKKV RLGLK+ 
Sbjct  24   SEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGCTMHGPRPRSHA-IKLNKKVRRLGLKI-  81

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y ++ME+AKK    
Sbjct  82   ALSARAAEGKLMIFDDLEVP-SHKTKNIVNYAKQMEDAKKLLLV  124



>ref|XP_007026181.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 ref|XP_007026182.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 ref|XP_007026183.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28803.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28804.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
 gb|EOY28805.1| Ribosomal protein L4/L1 family isoform 1 [Theobroma cacao]
Length=315

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNYVNQMEKTKKLLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVY ILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  281  SIGLNVYGILLHDTLVMSRDAVNRIVERMHTPINR  315


 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  157  SEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  214

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +S + GK   F       +HKTKNIV+Y  +ME  KK
Sbjct  215  ALSASAAEGKLLVFEDLEVP-THKTKNIVNYVNQMEKTKK  253



>ref|XP_004293324.1| PREDICTED: 50S ribosomal protein L4-like [Fragaria vesca subsp. 
vesca]
Length=307

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +    ++    KKVL+VDGGPI++NLKLATQNIHYVNVLP
Sbjct  214  EGKLLVFEDLEVPTH-KTKNIVNYVKQMENAKKVLVVDGGPISDNLKLATQNIHYVNVLP  272

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVMSRDAVN+IVERMHTPINR
Sbjct  273  SIGLNVYSILQHDTLVMSRDAVNKIVERMHTPINR  307


 Score =   125 bits (313),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  149  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKV-  206

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y ++MENAKK    
Sbjct  207  ALTARAAEGKLLVFEDLEVP-THKTKNIVNYVKQMENAKKVLVV  249



>ref|XP_009758874.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009758875.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Nicotiana 
sylvestris]
Length=309

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLMVFED+E+ SH K + +     +    KK+LLVDGGPI+E LKLATQN+HYVNVLP
Sbjct  216  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNVHYVNVLP  274

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  275  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  309


 Score =   118 bits (296),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRG QFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  151  SEVSGTGRKPWRQKGTGRARHGTLRGAQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  208

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     + SHKTKNIV+Y  ++EN KK
Sbjct  209  ALSARAAEGKLMVFEDLEIS-SHKTKNIVNYFNQLENTKK  247



>ref|XP_009610537.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=306

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLMVFED+E+ SH K + +     +    KK+LLVDGGPI+E LKLATQN+HYVNVLP
Sbjct  213  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNLHYVNVLP  271

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR
Sbjct  272  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  306


 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRG QFRGG  MH PKPRSHA I+LNKKV RLGLK+ 
Sbjct  148  SEVSGTGRKPWRQKGTGRARHGTLRGAQFRGGATMHGPKPRSHA-IQLNKKVRRLGLKI-  205

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     + SHKTKNIV+Y  ++EN KK
Sbjct  206  ALSARAAEGKLMVFEDLEIS-SHKTKNIVNYFNQLENTKK  244



>gb|EYU36343.1| hypothetical protein MIMGU_mgv1a010848mg [Erythranthe guttata]
Length=300

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLM+F+D+E+PSH K + +   A++    KK+LLVDGGP+NE LKLATQN+HYVNVLP
Sbjct  207  EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  265

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AVN IVERMHTPINR
Sbjct  266  SIGLNVYSILLHDTLVMSRSAVNAIVERMHTPINR  300


 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG  MH P+PRSHA IKLNKKV RLGLK+ 
Sbjct  142  SEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGCTMHGPRPRSHA-IKLNKKVRRLGLKI-  199

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV+Y ++ME+AKK
Sbjct  200  ALSARAAEGKLMIFDDLEVP-SHKTKNIVNYAKQMEDAKK  238



>ref|XP_010252520.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252521.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252523.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
 ref|XP_010252524.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Nelumbo nucifera]
Length=314

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  221  EGKLLVFEDLEVPTH-KTKNIVNYVSQIENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  279

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVM+RDAVNRIVERMHTPINR
Sbjct  280  SIGLNVYSILLHDTLVMTRDAVNRIVERMHTPINR  314


 Score =   110 bits (276),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFR G  MH PKPR+HA IKL KKV RLGLK+ 
Sbjct  156  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRHGATMHGPKPRTHA-IKLQKKVRRLGLKI-  213

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +    GK   F       +HKTKNIV+Y  ++EN KK    
Sbjct  214  ALSARIVEGKLLVFEDLEVP-THKTKNIVNYVSQIENTKKLLLV  256



>gb|EYU36344.1| hypothetical protein MIMGU_mgv1a010848mg [Erythranthe guttata]
Length=299

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLM+F+D+E+PSH K + +   A++    KK+LLVDGGP+NE LKLATQN+HYVNVLP
Sbjct  206  EGKLMIFDDLEVPSH-KTKNIVNYAKQMEDAKKLLLVDGGPLNEKLKLATQNVHYVNVLP  264

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AVN IVERMHTPINR
Sbjct  265  SIGLNVYSILLHDTLVMSRSAVNAIVERMHTPINR  299


 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG  MH P+PRSHA IKLNKKV RLGLK+ 
Sbjct  141  SEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGCTMHGPRPRSHA-IKLNKKVRRLGLKI-  198

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV+Y ++ME+AKK
Sbjct  199  ALSARAAEGKLMIFDDLEVP-SHKTKNIVNYAKQMEDAKK  237



>ref|XP_010252525.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X2 
[Nelumbo nucifera]
Length=284

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  191  EGKLLVFEDLEVPTH-KTKNIVNYVSQIENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  249

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVM+RDAVNRIVERMHTPINR
Sbjct  250  SIGLNVYSILLHDTLVMTRDAVNRIVERMHTPINR  284


 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFR G  MH PKPR+HA IKL KKV RLGLK+ 
Sbjct  126  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRHGATMHGPKPRTHA-IKLQKKVRRLGLKI-  183

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +    GK   F       +HKTKNIV+Y  ++EN KK    
Sbjct  184  ALSARIVEGKLLVFEDLEVP-THKTKNIVNYVSQIENTKKLLLV  226



>ref|XP_006342636.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Solanum 
tuberosum]
Length=305

 Score =   143 bits (360),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KK+L+VDGGPI+E LKLATQN+HYVNVLP
Sbjct  212  EGKLLVFEDLEIPSH-KTKNVVNYFNQLENTKKLLVVDGGPISEKLKLATQNVHYVNVLP  270

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  271  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  305


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  147  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  204

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKN+V+Y  ++EN KK    
Sbjct  205  ALSARAAEGKLLVFEDLEIP-SHKTKNVVNYFNQLENTKKLLVV  247



>ref|XP_003634850.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 ref|XP_010645348.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 ref|XP_010645350.1| PREDICTED: 50S ribosomal protein L4, chloroplastic [Vitis vinifera]
 emb|CBI32995.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+E+PSH K + +    ++    KK+LLVDGGPI E LKLATQN+HYVNVLP
Sbjct  222  EGKLLVFDDLEVPSH-KTKNIVNYVKEMENTKKLLLVDGGPITEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  281  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  315


 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  157  SEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGAIMHGPKPRSHA-IKLNKKVRRLGLKI-  214

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV+Y ++MEN KK
Sbjct  215  ALSARTAEGKLLVFDDLEVP-SHKTKNIVNYVKEMENTKK  253



>emb|CAN77922.1| hypothetical protein VITISV_027648 [Vitis vinifera]
Length=278

 Score =   142 bits (357),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+E+PSH K + +    ++    KK+LLVDGGPI E LKLATQN+HYVNVLP
Sbjct  185  EGKLLVFDDLEVPSH-KTKNIVNYVKEMENXKKLLLVDGGPITEKLKLATQNLHYVNVLP  243

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR+AVN+IVERMHTPINR
Sbjct  244  SIGLNVYSILLHDTLVMSRBAVNKIVERMHTPINR  278


 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  120  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRGGAIMHGPKPRSHA-IKLNKKVRRLGLKI-  177

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y ++MEN KK    
Sbjct  178  ALSARTAEGKLLVFDDLEVP-SHKTKNIVNYVKEMENXKKLLLV  220



>gb|KHG30769.1| 50S ribosomal L4 [Gossypium arboreum]
Length=315

 Score =   142 bits (359),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  222  EGKLLVFEDLEVPTH-KTKNIVNYVNQMENTKKLLLVDGGPINEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVMSRDAVNRIVERMHTPI+R
Sbjct  281  SIGLNVYSILQHDTLVMSRDAVNRIVERMHTPISR  315


 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 85/139 (61%), Gaps = 19/139 (14%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKG GRARHG+LRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  157  SEVSGTGRKPWQQKGLGRARHGSLRGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLKIA  215

Query  590  CFVSSC-SRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK-------  435
              +S+C + GK   F       +HKTKNIV+Y  +MEN KK       P   K       
Sbjct  216  --LSACAAEGKLLVFEDLEVP-THKTKNIVNYVNQMENTKKLLLVDGGPINEKLKLATQN  272

Query  434  -------PQVGHSKYTLCQ  399
                   P +G + Y++ Q
Sbjct  273  LHYVNVLPSIGLNVYSILQ  291



>ref|XP_004252759.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Solanum lycopersicum]
Length=305

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+L+VDGGPI+E LK ATQN+HYVNVLP
Sbjct  212  EGKLLVFEDLEIPTH-KTKNIVNYFNQLENTKKLLVVDGGPISEKLKFATQNVHYVNVLP  270

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  271  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  305


 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  147  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  204

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  ++EN KK    
Sbjct  205  ALSARAAEGKLLVFEDLEIP-THKTKNIVNYFNQLENTKKLLVV  247



>emb|CDP01310.1| unnamed protein product [Coffea canephora]
Length=101

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            LMVFED+E+PSH K + + +        KK+LLVDG  INE LKLATQNIHYVNVLPSIG
Sbjct  11   LMVFEDLEIPSH-KTKNVVSYYNLMVDTKKLLLVDGDAINEKLKLATQNIHYVNVLPSIG  69

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            LNVYSILLHDTLVMSRDAVNR+VERMHTPINR
Sbjct  70   LNVYSILLHDTLVMSRDAVNRVVERMHTPINR  101



>gb|EPS72544.1| hypothetical protein M569_02212, partial [Genlisea aurea]
Length=295

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V ED+E+PSH K + +   A +    KK+LLVDGGPI ENLKLATQN+HYVNVLP
Sbjct  202  EGKLLVLEDLEVPSH-KTKNIVNYANQMEGSKKLLLVDGGPIKENLKLATQNLHYVNVLP  260

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMS+DA++RIVERMHTPI+R
Sbjct  261  SIGLNVYSILLHDTLVMSKDAIDRIVERMHTPISR  295


 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG   H PKPRSHA  KLNKKV RLGLK+ 
Sbjct  137  SEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGATKHGPKPRSHA-FKLNKKVRRLGLKI-  194

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK           SHKTKNIV+Y  +ME +KK
Sbjct  195  ALTARAAEGKLLVLEDLEVP-SHKTKNIVNYANQMEGSKK  233



>gb|EYU24034.1| hypothetical protein MIMGU_mgv1a010625mg [Erythranthe guttata]
Length=307

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++F+DME+PSH K + +   A +    KK+LLVDGG INE LKLATQN+HYVNVLP
Sbjct  214  EGKLLIFDDMEVPSH-KTKNIVNYANQMEDAKKLLLVDGGSINEKLKLATQNVHYVNVLP  272

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            +IGLNVYSILLHDTLVMSR+AVNRIVERMHTPI+R
Sbjct  273  AIGLNVYSILLHDTLVMSREAVNRIVERMHTPISR  307


 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG AMH P+PRSHA IKLNKKV RLGLK+ 
Sbjct  149  SEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGCAMHGPRPRSHA-IKLNKKVRRLGLKV-  206

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV+Y  +ME+AKK
Sbjct  207  ALSARAAEGKLLIFDDMEVP-SHKTKNIVNYANQMEDAKK  245



>ref|XP_006836271.1| hypothetical protein AMTR_s00101p00151570 [Amborella trichopoda]
 gb|ERM99124.1| hypothetical protein AMTR_s00101p00151570 [Amborella trichopoda]
Length=279

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + + +   +    KK+LLVDGG INE LKLATQN+HYVNVLP
Sbjct  186  EGKLLVFEDLEVPSH-KTKNVVSYVSQMEGVKKLLLVDGGHINEKLKLATQNLHYVNVLP  244

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRI+ERMHTPINR
Sbjct  245  SIGLNVYSILQHDTLVMTRDAVNRIIERMHTPINR  279


 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+PQKG+GRARHGTLRGPQFR G  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  121  SEVSGTGKKPWPQKGSGRARHGTLRGPQFRHGATMHGPKPRSHA-FKLQKKVRRLGLKI-  178

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKN+VSY  +ME  KK    
Sbjct  179  ALSARVAEGKLLVFEDLEVP-SHKTKNVVSYVSQMEGVKKLLLV  221



>gb|ACN26135.1| unknown [Zea mays]
Length=197

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++FED+E+PSH K + +    R+    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  104  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  162

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  163  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  197


 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPYPQKGTG+ARHGTLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  39   SEVSGTGRKPYPQKGTGKARHGTLRGAQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  96

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y ++M+++KK    
Sbjct  97   ALSARTAEGKLLIFEDLEVP-SHKTKNIVQYIRQMDDSKKVLLV  139



>gb|EEC69298.1| hypothetical protein OsI_38360 [Oryza sativa Indica Group]
Length=197

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + + +   +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  104  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  162

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMH PINR
Sbjct  163  SIGLNVYSILQHDTLVMTRDAVNRIVERMHIPINR  197


 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSH TIKL KKV RLGLK+ 
Sbjct  39   SEVSGTGRKPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSH-TIKLQKKVRRLGLKI-  96

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKN+VSY  +ME+ KK    
Sbjct  97   ALSARTAEGKLLVFEDLEVP-SHKTKNVVSYISQMEDTKKVLLV  139



>ref|XP_004486189.1| PREDICTED: 50S ribosomal protein L4-like [Cicer arietinum]
Length=312

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K +T+     +    KK+L+VDGGPINE LKLATQN+HYVNVLP
Sbjct  219  EGKLLVFEDLEVPTH-KTKTIVNYFNQMEDTKKLLIVDGGPINEKLKLATQNLHYVNVLP  277

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            +IGLNVYSILLHDTLVMS+DAVNRIVERMHTPI +
Sbjct  278  AIGLNVYSILLHDTLVMSKDAVNRIVERMHTPIKQ  312


 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 68/100 (68%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKG GRAR GTLRGP FRGG   H PKPRSHA  KLNKKV RLGLK+ 
Sbjct  154  SEVSGTGRKPWNQKGLGRARQGTLRGPHFRGGATKHGPKPRSHA-FKLNKKVRRLGLKI-  211

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTK IV+Y  +ME+ KK
Sbjct  212  ALSARAAEGKLLVFEDLEVP-THKTKTIVNYFNQMEDTKK  250



>gb|EEE53224.1| hypothetical protein OsJ_36122 [Oryza sativa Japonica Group]
Length=227

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + + +   +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  134  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  192

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  193  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  227


 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = -2

Query  746  KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  567
            +PY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + 
Sbjct  77   QPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAE  134

Query  566  GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
            GK   F       SHKTKN+VSY  +ME+ KK  
Sbjct  135  GKLLVFEDLEVP-SHKTKNVVSYISQMEDTKKVL  167



>emb|CDY05720.1| BnaC07g00830D [Brassica napus]
Length=292

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  199  EGKLLVFDDLALPTH-KTKNIVNYYNQMETTKKVLVVEGGPIDEKLKLATQNLHYVNILP  257

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  258  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  292


 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH P+PRSHA IK+NK+V RLGLK+ 
Sbjct  134  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPRPRSHA-IKMNKQVRRLGLKI-  191

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +ME  KK    
Sbjct  192  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMETTKKVLVV  234



>gb|AFK36510.1| unknown [Lotus japonicus]
Length=305

 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+++ +H K + +    ++    KK+LLVDGGPINE LKLATQN+HYVNVLP
Sbjct  212  EGKLLVFEDLDVLTH-KTKNIVNYFKQMEDSKKLLLVDGGPINEKLKLATQNLHYVNVLP  270

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPI+R
Sbjct  271  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPISR  305


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GTGRK Y QKG G+ARHG+ R   FRGG AMH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  147  SEVRGTGRKMYKQKGLGKARHGSQRVHLFRGGAAMHGPKPRSHA-FKLNKKVRRLGLKI-  204

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y ++ME++KK
Sbjct  205  ALSARAAEGKLLVFEDLD-VLTHKTKNIVNYFKQMEDSKK  243



>ref|XP_011046992.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Populus euphratica]
 ref|XP_011046993.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Populus euphratica]
Length=317

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KK+L+VDGGPINE LKLATQN+HYVN+LP
Sbjct  224  EGKLLVFEDLEVPSH-KTKNIVNYVNEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLP  282

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVMSRDAVN+IVERMHTPI R
Sbjct  283  SIGLNVYSILQHDTLVMSRDAVNKIVERMHTPIKR  317


 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 83/138 (60%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKPYRQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHA-FKLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
               +  + GK   F       SHKTKNIV+Y  +MEN KK       P   K        
Sbjct  217  ALSARAAEGKLLVFEDLEVP-SHKTKNIVNYVNEMENTKKLLVVDGGPINEKLKLATQNL  275

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  276  HYVNLLPSIGLNVYSILQ  293



>ref|XP_006663555.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Oryza 
brachyantha]
Length=318

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +    R+    KKVLLVDGG I+  LKLATQN+HYVNVLP
Sbjct  225  EGKLLVFEDLEVPSH-KTKNIVQYIRQMEDTKKVLLVDGGDIDTKLKLATQNLHYVNVLP  283

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPI+R
Sbjct  284  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPISR  318


 Score =   120 bits (300),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  160  SEVSGTGRKPYNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  217

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
               +  + GK   F       SHKTKNIV Y ++ME+ KK  
Sbjct  218  ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYIRQMEDTKKVL  258



>emb|CDY31994.1| BnaA07g00010D [Brassica napus]
Length=296

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  203  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  261

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  262  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  296


 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH P+PRSHA IK+NK+V RLGLK+ 
Sbjct  138  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPRPRSHA-IKMNKQVRRLGLKI-  195

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  196  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMENTKKVLVV  238



>gb|ABA98275.1| ribosomal protein L4/L1 family protein [Oryza sativa Japonica 
Group]
Length=288

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + + +   +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  195  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  253

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  254  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  288


 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = -2

Query  746  KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  567
            KPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + 
Sbjct  138  KPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAE  195

Query  566  GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
            GK   F       SHKTKN+VSY  +ME+ KK  
Sbjct  196  GKLLVFEDLEVP-SHKTKNVVSYISQMEDTKKVL  228



>ref|XP_006298209.1| hypothetical protein CARUB_v10014259mg [Capsella rubella]
 gb|EOA31107.1| hypothetical protein CARUB_v10014259mg [Capsella rubella]
Length=303

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  210  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  268

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  269  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  303


 Score =   122 bits (306),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  145  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  202

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  203  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMENTKKVLVV  245



>emb|CDY13887.1| BnaA09g43890D [Brassica napus]
Length=288

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+DM LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  195  EGKLVVFDDMALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  253

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+I ERMHTPINR
Sbjct  254  SIGLNVYSILLHDTLVMSRDAVNKITERMHTPINR  288


 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  130  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  187

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  188  ALSARAAEGKLVVFDDMALP-THKTKNIVNYYNQMENTKKVLVV  230



>ref|XP_008778736.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Phoenix 
dactylifera]
Length=197

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ +PSH K + +     +    KKVLLVDGGPI++ LKLAT+N+ YVNVLP
Sbjct  104  EGKLLVFEDLAVPSH-KTKNIVNYVSQLENTKKVLLVDGGPIDDKLKLATRNLRYVNVLP  162

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  163  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  197


 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 82/138 (59%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSG+GRKPY QKGTGRARHGTLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  39   SEVSGSGRKPYKQKGTGRARHGTLRGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKV-  96

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
               +  + GK   F       SHKTKNIV+Y  ++EN KK       P   K        
Sbjct  97   ALSARTAEGKLLVFEDLAVP-SHKTKNIVNYVSQLENTKKVLLVDGGPIDDKLKLATRNL  155

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  156  RYVNVLPSIGLNVYSILQ  173



>ref|XP_006383860.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
 gb|ERP61657.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
Length=317

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+L+VDGGPINE LKLATQN+HYVN+LP
Sbjct  224  EGKLLVFEDLEVPTH-KTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLP  282

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVMSRDAVN+IVERMHTPI R
Sbjct  283  SIGLNVYSILQHDTLVMSRDAVNKIVERMHTPIKR  317


 Score =   122 bits (307),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 83/138 (60%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKPYRQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHA-FKLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
               +  + GK   F       +HKTKNIV+Y  +MEN KK       P   K        
Sbjct  217  ALTARAAEGKLLVFEDLEVP-THKTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNL  275

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  276  HYVNLLPSIGLNVYSILQ  293



>gb|AAM62769.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
Length=300

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  207  EGKLLVFDDLGLPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  265

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  266  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  300


 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  142  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  199

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F   G   +HKTKNIV+Y  +MEN KK    
Sbjct  200  ALTARAAEGKLLVFDDLGLP-THKTKNIVNYYNQMENTKKVLVV  242



>ref|XP_009410210.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   137 bits (344),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ LPSH K + +     +    KKVLLVDGGPI++ LKLAT+N+HYVNVLP
Sbjct  200  EGKLIVFEDLALPSH-KTKNIVNYVTQMENTKKVLLVDGGPIDDKLKLATRNLHYVNVLP  258

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHD LVM++DAVNRIVERMHTPINR
Sbjct  259  SIGLNVYSILLHDVLVMTQDAVNRIVERMHTPINR  293


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  135  SEVSGTGRKPYRQKGTGRARHGTLRGPQFRHGAIMHGPKPRSHA-IKLQKKVRRLGLKI-  192

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y  +MEN KK    
Sbjct  193  ALSARTAEGKLIVFEDLALP-SHKTKNIVNYVTQMENTKKVLLV  235



>ref|XP_009117510.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Brassica 
rapa]
Length=289

 Score =   136 bits (343),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+DM LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  196  EGKLLVFDDMALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  254

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV++I ERMHTPINR
Sbjct  255  SIGLNVYSILLHDTLVMSRDAVDKITERMHTPINR  289


 Score =   120 bits (300),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  131  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKINKQVRRLGLKI-  188

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  189  ALSARAAEGKLLVFDDMALP-THKTKNIVNYYNQMENTKKVLVV  231



>ref|XP_004962972.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Setaria 
italica]
Length=294

 Score =   137 bits (344),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL VFED+E+PSH K + +     +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  201  EGKLFVFEDLEVPSH-KTKNIVNYISQMDNTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  259

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  260  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  294


 Score =   119 bits (298),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  136  SEVSGTGRKPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  193

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y  +M+N KK    
Sbjct  194  TLSARTAEGKLFVFEDLEVP-SHKTKNIVNYISQMDNTKKVLLV  236



>emb|CDX81955.1| BnaC08g36460D [Brassica napus]
Length=297

 Score =   137 bits (344),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF++M LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN+LP
Sbjct  204  EGKLLVFDEMALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNILP  262

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+I+ERMHTPINR
Sbjct  263  SIGLNVYSILLHDTLVMSRDAVNKIIERMHTPINR  297


 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  139  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  196

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  197  ALSARAAEGKLLVFDEMALP-THKTKNIVNYYNQMENTKKVLVV  239



>ref|XP_006408921.1| hypothetical protein EUTSA_v10002043mg [Eutrema salsugineum]
 gb|ESQ50374.1| hypothetical protein EUTSA_v10002043mg [Eutrema salsugineum]
Length=320

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+DM LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  227  EGKLIVFDDMVLPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  285

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERMHTPINR
Sbjct  286  SIGLNVYSILLHDTLVMSRDAVNKIVERMHTPINR  320


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLR  QFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  162  SEVSGTGRKPWNQKGTGRARHGTLRSNQFRGGCIMHGPKPRSHA-IKMNKQVRRLGLKI-  219

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  220  ALTARAAEGKLIVF-DDMVLPTHKTKNIVNYYNQMENTKKVLVV  262



>ref|XP_010502936.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
 ref|XP_010502937.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=301

 Score =   136 bits (343),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  208  EGKLLVFDDLALPTH-KTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  266

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV++IVERMHTPINR
Sbjct  267  SIGLNVYSILLHDTLVMSRDAVDKIVERMHTPINR  301


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  143  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  200

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +ME  KK    
Sbjct  201  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVV  243



>ref|XP_010514578.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
 ref|XP_010514579.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=295

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  202  EGKLLVFDDLALPTH-KTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  260

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV++IVERMHTPINR
Sbjct  261  SIGLNVYSILLHDTLVMSRDAVDKIVERMHTPINR  295


 Score =   119 bits (298),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  137  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  194

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +ME  KK    
Sbjct  195  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVV  237



>ref|NP_565463.1| large subunit ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAL62411.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAD24390.2| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AAN72167.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gb|AEC06960.1| large subunit ribosomal protein L4 [Arabidopsis thaliana]
Length=300

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  207  EGKLLVFDDLGLPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  265

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTL+MSRDAVN+IVERMHTPINR
Sbjct  266  SIGLNVYSILLHDTLLMSRDAVNKIVERMHTPINR  300


 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  142  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  199

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F   G   +HKTKNIV+Y  +MEN KK    
Sbjct  200  ALTARAAEGKLLVFDDLGLP-THKTKNIVNYYNQMENTKKVLVV  242



>ref|XP_002463709.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
 gb|EER90707.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
Length=294

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +    R+    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  201  EGKLLVFEDLEVPSH-KTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  259

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  260  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  294


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  136  SEVSGTGRKPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  193

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y ++M++ KK    
Sbjct  194  ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYIRQMDDTKKVLLV  236



>ref|XP_010456595.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Camelina 
sativa]
Length=299

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  206  EGKLLVFDDLALPTH-KTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  264

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV++IVERMHTPINR
Sbjct  265  SIGLNVYSILLHDTLVMSRDAVDKIVERMHTPINR  299


 Score =   119 bits (298),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  141  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  198

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +ME  KK    
Sbjct  199  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVV  241



>ref|XP_002446335.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
 gb|EES10663.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
Length=333

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +    R+    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  240  EGKLLVFEDLEVPSH-KTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  298

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVMSR A+NRIVERMHTPINR
Sbjct  299  SIGLNVYSILQHDTLVMSRAAINRIVERMHTPINR  333


 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  175  SEVSGTGRKPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  232

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y ++M++ KK    
Sbjct  233  ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYIRQMDDTKKVLLV  275



>ref|XP_010416335.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L4, chloroplastic-like 
[Camelina sativa]
Length=302

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+  P+H K R +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  209  EGKLLVFDDLPFPTH-KTRNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  267

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV++IVERMHTPINR
Sbjct  268  SIGLNVYSILLHDTLVMSRDAVDKIVERMHTPINR  302


 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+  RLGLK+ 
Sbjct  144  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQFRRLGLKI-  201

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKT+NIV+Y  +ME  KK    
Sbjct  202  ALTARAAEGKLLVFDDLPFP-THKTRNIVNYYNQMEKTKKVLVV  244



>ref|NP_001147335.1| LOC100280943 [Zea mays]
 gb|ACG26922.1| 50S ribosomal protein L4 [Zea mays]
Length=293

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++FED+E+PSH K + +    R+    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  200  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  258

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  259  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  293


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPYPQKGTG+ARHGTLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  135  SEVSGTGRKPYPQKGTGKARHGTLRGAQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  192

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y ++M+++KK    
Sbjct  193  ALSARTAEGKLLIFEDLEVP-SHKTKNIVQYIRQMDDSKKVLLV  235



>ref|XP_004134779.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus]
 ref|XP_004172499.1| PREDICTED: 50S ribosomal protein L4-like [Cucumis sativus]
 gb|KGN49080.1| hypothetical protein Csa_6G513440 [Cucumis sativus]
Length=315

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+++++ +H K + +     K    KKVLLVDGGPI+E LKLATQN+HYVNVLP
Sbjct  222  EGKLLVFDNLDVTTH-KTKNMVKYVSKMENTKKVLLVDGGPIDEKLKLATQNLHYVNVLP  280

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV RIV RMHTPINR
Sbjct  281  SIGLNVYSILLHDTLVMSRDAVERIVTRMHTPINR  315


 Score =   119 bits (299),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGL + 
Sbjct  157  SEVSGTGRKPWKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLMI-  214

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     T +HKTKN+V Y  KMEN KK
Sbjct  215  ALSARVAEGKLLVFDNLDVT-THKTKNMVKYVSKMENTKK  253



>tpg|DAA52004.1| TPA: 50S ribosomal protein L4 [Zea mays]
Length=293

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++FED+E+PSH K + +    R+    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  200  EGKLLIFEDLEVPSH-KTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLP  258

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  259  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  293


 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPYPQKGTG+ARHGTLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  135  SEVSGTGRKPYPQKGTGKARHGTLRGAQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  192

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y ++M+++KK    
Sbjct  193  ALSARTAEGKLLIFEDLEVP-SHKTKNIVQYIRQMDDSKKVLLV  235



>ref|XP_008440040.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Cucumis melo]
Length=331

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+++++ +H K + +          KKVLLVDGGPINE LKLATQN+HYVNVLP
Sbjct  238  EGKLLVFDNLDVTTH-KTKNIVKYVNTMENTKKVLLVDGGPINEKLKLATQNLHYVNVLP  296

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAV RIV RMHTPINR
Sbjct  297  SIGLNVYSILLHDTLVMSRDAVERIVTRMHTPINR  331


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGL + 
Sbjct  173  SEVSGTGRKPWKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-FKLNKKVRRLGLMI-  230

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     T +HKTKNIV Y   MEN KK
Sbjct  231  ALSARVAEGKLLVFDNLDVT-THKTKNIVKYVNTMENTKK  269



>gb|EMS66148.1| 50S ribosomal protein L4 [Triticum urartu]
Length=291

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +FED+E+PSH K + +    ++    KK+LLVDGG I++ LKLATQN+HYVNV+P
Sbjct  198  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  256

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPI+R
Sbjct  257  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPISR  291


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 71/120 (59%), Gaps = 23/120 (19%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRG--------------------PQFRGGTAMHVPKP  651
            SEVSGTGRKPY QKGTGRARHGTLRG                     QFRGG  MH PKP
Sbjct  113  SEVSGTGRKPYKQKGTGRARHGTLRGCQALEISYLLWAPTKLRFKLKQFRGGATMHGPKP  172

Query  650  RSHATIKLNKKVCRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
            RSHA  KL KKV RLGLK+    +  + GK   F       SHKTKNIV Y ++M++ KK
Sbjct  173  RSHA-FKLQKKVRRLGLKI-ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKK  229



>gb|EMT16009.1| 50S ribosomal protein L4 [Aegilops tauschii]
Length=276

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +FED+E+PSH K + +    ++    KK+LLVDGG I++ LKLATQN+HYVNV+P
Sbjct  183  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  241

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPI+R
Sbjct  242  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPISR  276


 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  118  SEVSGTGRKPYKQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-  175

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       SHKTKNIV Y ++M++ KK
Sbjct  176  ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKK  214



>gb|KDO78366.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=310

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KKVLL DGG I+E LKLATQN+HYVNVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            S+GLNVYSIL HDTLVMSRDAVN+IV+RMHTPINR
Sbjct  276  SVGLNVYSILQHDTLVMSRDAVNKIVDRMHTPINR  310


 Score =   122 bits (306),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  152  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI-  209

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTK IV+Y  +MEN KK   C
Sbjct  210  ALSARAAEGKLLVFEDLEVP-SHKTKFIVNYYNQMENTKKVLLC  252



>ref|XP_006467374.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Citrus 
sinensis]
Length=310

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KKVLL DGG I+E LKLATQN+HYVNVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            S+GLNVYSIL HDTLVMSRDAVN+IV+RMHTPINR
Sbjct  276  SVGLNVYSILQHDTLVMSRDAVNKIVDRMHTPINR  310


 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  152  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  209

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTK IV+Y  +MEN KK   C
Sbjct  210  ALSARAAEGKLLVFEDLEVP-SHKTKFIVNYYNQMENTKKVLLC  252



>ref|XP_002886003.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62262.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
Length=297

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  204  EGKLLVFDDLALPTH-KTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  262

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVN+IVERM+TPINR
Sbjct  263  SIGLNVYSILLHDTLVMSRDAVNKIVERMNTPINR  297


 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IK+NK+V RLGLK+ 
Sbjct  139  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHA-IKMNKQVRRLGLKI-  196

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       +HKTKNIV+Y  +MEN KK    
Sbjct  197  ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMENTKKVLVV  239



>ref|XP_007134426.1| hypothetical protein PHAVU_010G046600g [Phaseolus vulgaris]
 gb|ESW06420.1| hypothetical protein PHAVU_010G046600g [Phaseolus vulgaris]
Length=313

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDGGPI+E LKL+TQN+HYVN+LP
Sbjct  220  EGKLLVFEDLEVPTH-KTKNMVNYYNQMEKTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AV RIVERM TPINR
Sbjct  279  SIGLNVYSILLHDTLVMSRSAVTRIVERMRTPINR  313


 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTG+ARHGTLRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+ 
Sbjct  155  SEVSGTGRKPWNQKGTGKARHGTLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-  212

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKN+V+Y  +ME  KK
Sbjct  213  ALSARAAEGKLLVFEDLEVP-THKTKNMVNYYNQMEKTKK  251



>gb|AES73712.2| 50S ribosomal protein L4, bacterial/organelle protein [Medicago 
truncatula]
Length=347

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K +       +    KK+L+VD GP+NE LKLATQN+HYVN+LP
Sbjct  249  EGKLLVFEDLEVPTH-KTKNFLNFFNQLEDTKKLLIVDDGPVNEKLKLATQNLHYVNLLP  307

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPIN  287
            SIGLNVYSILLHDTLVMS+DAVNRIVERMHTPI+
Sbjct  308  SIGLNVYSILLHDTLVMSKDAVNRIVERMHTPIS  341


 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG A H PKPRSHA  KLNKKV RLGLK+ 
Sbjct  184  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGEAKHGPKPRSHA-FKLNKKVRRLGLKI-  241

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKN +++  ++E+ KK
Sbjct  242  ALSARAAEGKLLVFEDLEVP-THKTKNFLNFFNQLEDTKK  280



>dbj|BAK00507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +FED+E+PSH K + +    ++    KK+LLVDGG I++ LKLATQN+HYVNV+P
Sbjct  196  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIP  254

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPI+R
Sbjct  255  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPISR  289


 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  131  SEVSGTGRKPYKQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-  188

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
               +  + GK   F       SHKTKNIV Y ++M++ KK  
Sbjct  189  ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKKIL  229



>ref|XP_004979576.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Setaria 
italica]
Length=294

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  201  EGKLLVFEDLEVPSH-KTKNIVQYISQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  259

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  260  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  294


 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  136  SEVSGTGRKPYAQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  193

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y  +M++ KK    
Sbjct  194  ALSARTAEGKLLVFEDLEVP-SHKTKNIVQYISQMDDTKKVLLV  236



>gb|EMS55866.1| 50S ribosomal protein L4 [Triticum urartu]
Length=265

 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +FED+E+PSH K + +    ++    KKVLLVDGG I++ LKLAT+N+HYVNV+P
Sbjct  172  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKVLLVDGGDIDKKLKLATKNLHYVNVIP  230

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPI+R
Sbjct  231  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPISR  265


 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  107  SEVSGTGRKPYKQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-  164

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
               +  + GK   F       SHKTKNIV Y ++M++ KK  
Sbjct  165  ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKKVL  205



>ref|XP_010914093.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X2 
[Elaeis guineensis]
Length=296

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ +PSH K + +     +    KK+LLVDGGP+++ LKLAT+N+ YVNVLP
Sbjct  203  EGKLLVFEDLAIPSH-KTKNIVNYVSQMENTKKILLVDGGPVDDKLKLATRNLRYVNVLP  261

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  262  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  296


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KPY QKGTGRARHGTLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  138  SEVSGTGKKPYRQKGTGRARHGTLRGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKI-  195

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y  +MEN KK    
Sbjct  196  ALSARTAEGKLLVFEDLAIP-SHKTKNIVNYVSQMENTKKILLV  238



>gb|EEC68430.1| hypothetical protein OsI_36619 [Oryza sativa Indica Group]
Length=273

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+E+PSH K + +     +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  180  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  238

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R+A+NRIVERMHTPI+R
Sbjct  239  SIGLNVYSILQHDTLVMTRNAINRIVERMHTPISR  273


 Score =   116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  115  SEVSGTGRKPYNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  172

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y  +ME  KK    
Sbjct  173  ALSARTAEGKLLVFDDLEVP-SHKTKNIVQYIGQMEGTKKVLLV  215



>ref|XP_010914092.1| PREDICTED: 39S ribosomal protein L4, mitochondrial isoform X1 
[Elaeis guineensis]
Length=299

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ +PSH K + +     +    KK+LLVDGGP+++ LKLAT+N+ YVNVLP
Sbjct  206  EGKLLVFEDLAIPSH-KTKNIVNYVSQMENTKKILLVDGGPVDDKLKLATRNLRYVNVLP  264

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDAVNRIVERMHTPINR
Sbjct  265  SIGLNVYSILQHDTLVMTRDAVNRIVERMHTPINR  299


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KPY QKGTGRARHGTLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  141  SEVSGTGKKPYRQKGTGRARHGTLRGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKI-  198

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV+Y  +MEN KK    
Sbjct  199  ALSARTAEGKLLVFEDLAIP-SHKTKNIVNYVSQMENTKKILLV  241



>ref|XP_010553457.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X2 [Tarenaya hassleriana]
Length=298

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ +P+H K + +     +    KK+LLVDG  I+E LKLATQN+HYVN+LP
Sbjct  205  EGKLIVFDDLGVPTH-KTKNIVKYYNQMEKTKKLLLVDGASIDEKLKLATQNLHYVNILP  263

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERM+TPINR
Sbjct  264  SIGLNVYSILLHDTLVMSRDAVNRIVERMNTPINR  298


 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  140  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  197

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F   G   +HKTKNIV Y  +ME  KK    
Sbjct  198  ALTARAAEGKLIVFDDLGVP-THKTKNIVKYYNQMEKTKKLLLV  240



>ref|XP_006383858.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
 gb|ERP61655.1| hypothetical protein POPTR_0004s00660g [Populus trichocarpa]
Length=277

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            +L+VFED+E+P+H K + +     +    KK+L+VDGGPINE LKLATQN+HYVN+LPSI
Sbjct  186  QLLVFEDLEVPTH-KTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLPSI  244

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            GLNVYSIL HDTLVMSRDAVN+IVERMHTPI R
Sbjct  245  GLNVYSILQHDTLVMSRDAVNKIVERMHTPIKR  277


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 56/138 (41%), Gaps = 57/138 (41%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQ      + VP                      
Sbjct  159  SEVSGTGRKPYRQKGTGRARHGTLRGPQLLVFEDLEVP----------------------  196

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
                                 +HKTKNIV+Y  +MEN KK       P   K        
Sbjct  197  ---------------------THKTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNL  235

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  236  HYVNLLPSIGLNVYSILQ  253



>ref|XP_010553456.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X1 [Tarenaya hassleriana]
Length=299

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ +P+H K + +     +    KK+LLVDG  I+E LKLATQN+HYVN+LP
Sbjct  206  EGKLIVFDDLGVPTH-KTKNIVKYYNQMEKTKKLLLVDGASIDEKLKLATQNLHYVNILP  264

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSRDAVNRIVERM+TPINR
Sbjct  265  SIGLNVYSILLHDTLVMSRDAVNRIVERMNTPINR  299


 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  141  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  198

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F   G   +HKTKNIV Y  +ME  KK    
Sbjct  199  ALTARAAEGKLIVFDDLGVP-THKTKNIVKYYNQMEKTKKLLLV  241



>ref|XP_003577421.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Brachypodium 
distachyon]
Length=289

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +F+D++LPSH K + +    ++    KKVLLVDGG I++ LKLATQN+HYVNV+P
Sbjct  196  EGKLCIFDDLDLPSH-KTKNIVQYIKQMDETKKVLLVDGGDIDKKLKLATQNLHYVNVIP  254

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R A+NRIVERMHTPINR
Sbjct  255  SIGLNVYSILQHDTLVMTRAAINRIVERMHTPINR  289


 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  131  SEVSGTGRKPYAQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-  188

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
               +  + GK   F       SHKTKNIV Y ++M+  KK  
Sbjct  189  ALSARTAEGKLCIFDDLDLP-SHKTKNIVQYIKQMDETKKVL  229



>ref|XP_008787312.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Phoenix 
dactylifera]
Length=332

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ +PSH K + +     +    KKVLLVDGGPI++ LKLAT+N+ YVNVLP
Sbjct  239  EGKLLVFEDLAVPSH-KTKNIVNYVSQLENTKKVLLVDGGPIDDKLKLATRNLRYVNVLP  297

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+RDA+NRIVERMHTPINR
Sbjct  298  SIGLNVYSILQHDTLVMTRDAINRIVERMHTPINR  332


 Score =   117 bits (292),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 83/138 (60%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSG+GRKPY QKGTGRARHGTLRGPQFR G AMH PKPRSHA IKL KKV RLGLK+ 
Sbjct  174  SEVSGSGRKPYRQKGTGRARHGTLRGPQFRHGAAMHGPKPRSHA-IKLQKKVRRLGLKV-  231

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
               +  + GK   F       SHKTKNIV+Y  ++EN KK       P   K        
Sbjct  232  ALSARTAEGKLLVFEDLAVP-SHKTKNIVNYVSQLENTKKVLLVDGGPIDDKLKLATRNL  290

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  291  RYVNVLPSIGLNVYSILQ  308



>ref|XP_007147686.1| hypothetical protein PHAVU_006G146000g [Phaseolus vulgaris]
 gb|ESW19680.1| hypothetical protein PHAVU_006G146000g [Phaseolus vulgaris]
Length=313

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++FED+E+P+H K + +     +    KK+LLVDGGPI+E LKL+TQN+HYVN+LP
Sbjct  220  EGKLLIFEDLEVPTH-KTKNIVNYYNQMENTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            +IGLNVYSILLHDTLVMSR AV RIVERM TPINR
Sbjct  279  AIGLNVYSILLHDTLVMSRAAVTRIVERMRTPINR  313


 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTG+ARHGTLRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+ 
Sbjct  155  SEVSGTGRKPWNQKGTGKARHGTLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-  212

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y  +MEN KK
Sbjct  213  ALSARAAEGKLLIFEDLEVP-THKTKNIVNYYNQMENTKK  251



>ref|NP_001068165.1| Os11g0585700 [Oryza sativa Japonica Group]
 gb|ABA94446.1| ribosomal protein L4/L1 family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28528.1| Os11g0585700 [Oryza sativa Japonica Group]
Length=286

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+E+PSH K + +     +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  193  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  251

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R+A+NRIVERMHTPI+R
Sbjct  252  SIGLNVYSILQHDTLVMTRNAINRIVERMHTPISR  286


 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  128  SEVSGTGRKPYNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  185

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y  +ME  KK    
Sbjct  186  ALSARTAEGKLLVFDDLEVP-SHKTKNIVQYIGQMEGTKKVLLV  228



>ref|XP_010099157.1| 50S ribosomal protein L4 [Morus notabilis]
 gb|EXB77029.1| 50S ribosomal protein L4 [Morus notabilis]
Length=297

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            KL+VFED+E+P+H K + +     +    KK+LLVDG PI E LKLATQN+HYVNVLPSI
Sbjct  206  KLLVFEDLEVPTH-KTKNIVNYVSQMENTKKLLLVDGSPIGEKLKLATQNLHYVNVLPSI  264

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            GLNVYSILLHDTLVMSRDAVN IVER+HTPINR
Sbjct  265  GLNVYSILLHDTLVMSRDAVNGIVERVHTPINR  297


 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 66/100 (66%), Gaps = 21/100 (21%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKK+       D
Sbjct  157  SEVSGTGRKPWPQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKLLVFE---D  212

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
              V                  +HKTKNIV+Y  +MEN KK
Sbjct  213  LEVP-----------------THKTKNIVNYVSQMENTKK  235



>ref|XP_010685040.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=280

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ +P+H K + +     +    KK+LLVD GPI+E LKLATQN+HYVNVLP
Sbjct  187  EGKLLVFDDLTVPTH-KTKNIVNWVDEMEDSKKLLLVDDGPISEKLKLATQNLHYVNVLP  245

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            S+GLNVYSILLHDTLVMSR AVNRIVERMHTPI+R
Sbjct  246  SVGLNVYSILLHDTLVMSRGAVNRIVERMHTPISR  280


 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KPYPQKGTGRAR G+ R  Q RGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  122  SEVSGTGKKPYPQKGTGRARLGSRRSNQQRGGATMHGPKPRSHAH-KLNKKVRRLGLKI-  179

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F    T  +HKTKNIV++  +ME++KK
Sbjct  180  ALSARAAEGKLLVFDDL-TVPTHKTKNIVNWVDEMEDSKK  218



>ref|XP_006383859.1| ribosomal protein L4 [Populus trichocarpa]
 gb|ERP61656.1| ribosomal protein L4 [Populus trichocarpa]
Length=285

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            +L+VFED+E+P+H K + +     +    KK+L+VDGGPINE LKLATQN+HYVN+LPSI
Sbjct  194  QLLVFEDLEVPTH-KTKNIVNYVIEMENTKKLLVVDGGPINEKLKLATQNLHYVNLLPSI  252

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            GLNVYSIL HDTLVMSRDAVN+IVERMHTPI R
Sbjct  253  GLNVYSILQHDTLVMSRDAVNKIVERMHTPIKR  285


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 81/142 (57%), Gaps = 20/142 (14%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  122  SEVSGTGRKPYRQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHA-FKLNKKVRRLGLKIA  180

Query  590  ----CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK----  435
                  +      +   F       +HKTKNIV+Y  +MEN KK       P   K    
Sbjct  181  LTAPIILIEFLNAQLLVFEDLEVP-THKTKNIVNYVIEMENTKKLLVVDGGPINEKLKLA  239

Query  434  ----------PQVGHSKYTLCQ  399
                      P +G + Y++ Q
Sbjct  240  TQNLHYVNLLPSIGLNVYSILQ  261



>gb|EMT27905.1| 50S ribosomal protein L4 [Aegilops tauschii]
Length=265

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL +FED+E+PSH K + +    ++    KKVLLVDGG I++ LKLAT+N+HYVNV+P
Sbjct  172  EGKLCIFEDLEVPSH-KTKNIVQYIKQMDDTKKVLLVDGGDIDKKLKLATKNLHYVNVIP  230

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R+A+NRIVERMHTPI+R
Sbjct  231  SIGLNVYSILQHDTLVMTREAINRIVERMHTPISR  265


 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRG QFRGG  MH PKPRSHA  KL KKV RLGLK+ 
Sbjct  107  SEVSGTGRKPYKQKGTGRARHGTLRGCQFRGGATMHGPKPRSHA-FKLQKKVRRLGLKI-  164

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
               +  + GK   F       SHKTKNIV Y ++M++ KK  
Sbjct  165  ALSARTAEGKLCIFEDLEVP-SHKTKNIVQYIKQMDDTKKVL  205



>gb|AHA84219.1| 50S ribosomal protein L4 [Phaseolus vulgaris]
Length=313

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++FED+E+P+H K + +     +    KK+LLVDGGPI+E LKL+TQN+HYVN+LP
Sbjct  220  EGKLLIFEDLEVPTH-KTKNIVNYYNQMENTKKLLLVDGGPIDEKLKLSTQNLHYVNILP  278

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            +IGLNVYSILLHDTLVMSR AV RIVERM TPINR
Sbjct  279  AIGLNVYSILLHDTLVMSRAAVTRIVERMPTPINR  313


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTG+ARHGTLRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+ 
Sbjct  155  SEVSGTGRKPWNQKGTGKARHGTLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-  212

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y  +MEN KK
Sbjct  213  ALSARAAEGKLLIFEDLEVP-THKTKNIVNYYNQMENTKK  251



>gb|EEE52352.1| hypothetical protein OsJ_34399 [Oryza sativa Japonica Group]
Length=353

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+E+PSH K + +     +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  260  EGKLLVFDDLEVPSH-KTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  318

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+R+A+NRIVERMHTPI+R
Sbjct  319  SIGLNVYSILQHDTLVMTRNAINRIVERMHTPISR  353


 Score =   117 bits (293),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  195  SEVSGTGRKPYNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-  252

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTKNIV Y  +ME  KK    
Sbjct  253  ALSARTAEGKLLVFDDLEVP-SHKTKNIVQYIGQMEGTKKVLLV  295



>ref|XP_010533789.1| PREDICTED: 50S ribosomal protein L4, chloroplastic-like [Tarenaya 
hassleriana]
Length=303

 Score =   131 bits (329),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+EL +H K + +     +    KK+LLVDG  I+E LKL+TQN+HYV+VLP
Sbjct  210  EGKLIVFDDLELQTH-KTKNIVKFYNQMENTKKLLLVDGASIDEKLKLSTQNLHYVDVLP  268

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AVNRIVERMHTPINR
Sbjct  269  SIGLNVYSILLHDTLVMSRGAVNRIVERMHTPINR  303


 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  145  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI-  202

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV +  +MEN KK
Sbjct  203  ALTARAAEGKLIVFDDLELQ-THKTKNIVKFYNQMENTKK  241



>ref|XP_002969851.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
 gb|EFJ28975.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
Length=215

 Score = 84.0 bits (206),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDG-GPINENLKLATQNIHYVNVL  392
            E KLM+F++++LP+H K R L  +       ++VL+VDG   +   + LA +N+  VNV+
Sbjct  122  ERKLMLFDNVDLPTH-KTRQLMKLVPNLGC-RRVLIVDGVEKMGREITLACRNVKEVNVI  179

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            P+ GLNVYSILLHDTLVMS  AV  I +R+HTPINR
Sbjct  180  PAKGLNVYSILLHDTLVMSVAAVREIEDRLHTPINR  215


 Score = 72.4 bits (176),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            EV+G+ RK + QKGTG+ARHG+ R PQFRGG   H PKPRS+   KLNKKV RLGLK+
Sbjct  58   EVAGSTRKIHKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYE-YKLNKKVRRLGLKI  114



>gb|ADE77062.1| unknown [Picea sitchensis]
Length=323

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLMVF+  +L +H K + +     +    KK+LLV+GGP+N+ L LATQN+HY NVLP
Sbjct  230  EGKLMVFDTFDLTTH-KTKEVAKYVSQLENCKKILLVEGGPVNKKLGLATQNLHYANVLP  288

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSIL HDTLVM+ DAVNRIVERMHTPINR
Sbjct  289  SIGLNVYSILQHDTLVMTADAVNRIVERMHTPINR  323


 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 83/138 (60%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+PQKGTG+ARHGTLRGPQFR G  MH PKPRSHA IKL KKV RLGLK+ 
Sbjct  165  SEVSGTGRKPWPQKGTGKARHGTLRGPQFRHGATMHGPKPRSHA-IKLQKKVRRLGLKI-  222

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC*WWPHQRK--------  435
               +  + GK   F  +  T +HKTK +  Y  ++EN KK       P  +K        
Sbjct  223  ALSARAAEGKLMVFDTFDLT-THKTKEVAKYVSQLENCKKILLVEGGPVNKKLGLATQNL  281

Query  434  ------PQVGHSKYTLCQ  399
                  P +G + Y++ Q
Sbjct  282  HYANVLPSIGLNVYSILQ  299



>ref|XP_002985293.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
 gb|EFJ13787.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
Length=215

 Score = 84.0 bits (206),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDG-GPINENLKLATQNIHYVNVL  392
            E KLM+F++++LP+H K R L  +       ++VL+VDG   +   + LA +N+  VNV+
Sbjct  122  ERKLMLFDNVDLPTH-KTRQLMKLVPNLGC-RRVLIVDGVEKMGREITLACRNVKEVNVI  179

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            P+ GLNVYSILLHDTLVMS  AV  I +R+HTPINR
Sbjct  180  PAKGLNVYSILLHDTLVMSVAAVREIEDRLHTPINR  215


 Score = 71.2 bits (173),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            EV+G+ RK   QKGTG+ARHG+ R PQFRGG   H PKPRS+   KLNKKV RLGLK+
Sbjct  58   EVAGSTRKINKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYE-YKLNKKVRRLGLKI  114



>ref|NP_001242456.1| uncharacterized protein LOC100804238 [Glycine max]
 gb|ACU18017.1| unknown [Glycine max]
Length=312

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDG  I+E LKL+TQN+HYVNVLP
Sbjct  220  EGKLLVFEDLEVPTH-KTKNIVNYYNQMEDTKKLLLVDG-TIDEKLKLSTQNLHYVNVLP  277

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AV +IVERMHTPINR
Sbjct  278  SIGLNVYSILLHDTLVMSRAAVTKIVERMHTPINR  312


 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG  MH PKPRSHA  K+NKKV  LGLK+ 
Sbjct  155  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGATMHGPKPRSHA-FKVNKKVRCLGLKI-  212

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y  +ME+ KK
Sbjct  213  ALSARAAEGKLLVFEDLEVP-THKTKNIVNYYNQMEDTKK  251



>ref|XP_006597049.1| PREDICTED: uncharacterized protein LOC100804238 isoform X1 [Glycine 
max]
Length=317

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K + +     +    KK+LLVDG  I+E LKL+TQN+HYVNVLP
Sbjct  225  EGKLLVFEDLEVPTH-KTKNIVNYYNQMEDTKKLLLVDG-TIDEKLKLSTQNLHYVNVLP  282

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AV +IVERMHTPINR
Sbjct  283  SIGLNVYSILLHDTLVMSRAAVTKIVERMHTPINR  317


 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+ 
Sbjct  160  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-  217

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y  +ME+ KK
Sbjct  218  ALSARAAEGKLLVFEDLEVP-THKTKNIVNYYNQMEDTKK  256



>ref|XP_003534682.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Glycine max]
 gb|KHN40857.1| 50S ribosomal protein L4 [Glycine soja]
Length=310

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 78/95 (82%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+ +P+H K + +     +    KK+LLVDG  I+E LKL+TQN+HYVNVLP
Sbjct  218  EGKLLVFEDLAVPTH-KTKNIVNYYNQMEDTKKLLLVDGA-IDEKLKLSTQNLHYVNVLP  275

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            SIGLNVYSILLHDTLVMSR AV++IVERMHTPINR
Sbjct  276  SIGLNVYSILLHDTLVMSRAAVSKIVERMHTPINR  310


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+ 
Sbjct  153  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI-  210

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKNIV+Y  +ME+ KK
Sbjct  211  ALSARAAEGKLLVFEDLAVP-THKTKNIVNYYNQMEDTKK  249



>gb|KDO78367.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=299

 Score =   122 bits (305),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+ 
Sbjct  152  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI-  209

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
               +  + GK   F       SHKTK IV+Y  +MEN KK   C
Sbjct  210  ALSARAAEGKLLVFEDLEVP-SHKTKFIVNYYNQMENTKKVLLC  252


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + +     +    KKVLL DGG I+E LKLATQN+HYVNVLP
Sbjct  217  EGKLLVFEDLEVPSH-KTKFIVNYYNQMENTKKVLLCDGGCIHEKLKLATQNLHYVNVLP  275

Query  388  SI  383
            S+
Sbjct  276  SV  277



>ref|XP_008224759.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L4, mitochondrial-like 
[Prunus mume]
Length=275

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D E+P+H K + +    ++    KK+LLVDG  + E LKLATQN+HYVNVLP
Sbjct  183  EGKLLVFDDFEVPTH-KTKNIVNYVQQMGNSKKLLLVDG-MLPEKLKLATQNLHYVNVLP  240

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            ++GLNVYSIL HDTLVMSR AVN IVERMHTPI R
Sbjct  241  AVGLNVYSILQHDTLVMSRAAVNEIVERMHTPIKR  275


 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  118  SEVSGTGRKPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKI-  175

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTKNIV+Y Q+M N+KK
Sbjct  176  ALTAXAAEGKLLVFDDFEVP-THKTKNIVNYVQQMGNSKK  214



>ref|XP_008231665.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Prunus 
mume]
Length=307

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++F+D E+P+H K + +    ++    KK+LLVDG  + E LKLATQN+HYVNVLP
Sbjct  215  EGKLLIFDDFEVPTH-KTKNIANYVQQMEDSKKLLLVDGF-LPEKLKLATQNLHYVNVLP  272

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            ++GLNVYSIL HDTLVMSR AVN IVERMHTPI R
Sbjct  273  AVGLNVYSILQHDTLVMSRTAVNEIVERMHTPIKR  307


 Score =   116 bits (290),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 86/137 (63%), Gaps = 16/137 (12%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  150  SEVSGTGRKPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKI-  207

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC-*WWPHQRK-------  435
               +  + GK   F  +    +HKTKNI +Y Q+ME++KK      + P + K       
Sbjct  208  ALTARAAEGKLLIFDDFEVP-THKTKNIANYVQQMEDSKKLLLVDGFLPEKLKLATQNLH  266

Query  434  -----PQVGHSKYTLCQ  399
                 P VG + Y++ Q
Sbjct  267  YVNVLPAVGLNVYSILQ  283



>ref|XP_007220702.1| hypothetical protein PRUPE_ppa021068mg [Prunus persica]
 gb|EMJ21901.1| hypothetical protein PRUPE_ppa021068mg [Prunus persica]
Length=318

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++F+D E+P+H K + +    ++    KK+LLVDG  + E LKLATQN+HYVNVLP
Sbjct  226  EGKLLIFDDFEVPTH-KTKNIANYVQQMEDSKKLLLVDG-ILPEKLKLATQNLHYVNVLP  283

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            ++GLNVYSIL HDTLVMSR AVN IVERMHTPI R
Sbjct  284  AVGLNVYSILQHDTLVMSRTAVNEIVERMHTPIKR  318


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  161  SEVSGTGRKPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKI-  218

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTKNI +Y Q+ME++KK
Sbjct  219  ALTARAAEGKLLIFDDFEVP-THKTKNIANYVQQMEDSKK  257



>ref|XP_008384099.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Malus 
domestica]
Length=324

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSH   KLNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTKNIV+Y Q+ME +KK
Sbjct  217  ALTARAAEGKLLVFEDFEVP-THKTKNIVNYVQQMEGSKK  255


 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 8/102 (8%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPIN-------ENLKLATQNI  410
            EGKL+VFED E+P+H K + +    ++    KK LLVDG           E LKLATQN+
Sbjct  224  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  282

Query  409  HYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            HYVNVLP++GLNVYSIL HDTLVM++ AVN IVERMHTPINR
Sbjct  283  HYVNVLPAVGLNVYSILQHDTLVMTQAAVNEIVERMHTPINR  324



>ref|XP_009357493.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X2 [Pyrus x bretschneideri]
Length=324

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSH   KLNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTKNIV+Y Q+ME +KK
Sbjct  217  ALTARAAEGKLLVFEDFEVP-THKTKNIVNYVQQMEGSKK  255


 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 8/102 (8%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPIN-------ENLKLATQNI  410
            EGKL+VFED E+P+H K + +    ++    KK LLVDG           E LKLATQN+
Sbjct  224  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  282

Query  409  HYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            HYVNVLP++GLNVYSIL HDTLVM++ AVN IVERMHTPINR
Sbjct  283  HYVNVLPAVGLNVYSILQHDTLVMTQAAVNEIVERMHTPINR  324



>ref|XP_009357492.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like isoform 
X1 [Pyrus x bretschneideri]
Length=328

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 8/102 (8%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPIN-------ENLKLATQNI  410
            EGKL+VFED E+P+H K + +    ++    KK LLVDG           E LKLATQN+
Sbjct  228  EGKLLVFEDFEVPTH-KTKNIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  286

Query  409  HYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            HYVNVLP++GLNVYSIL HDTLVM++ AVN IVERMHTPINR
Sbjct  287  HYVNVLPAVGLNVYSILQHDTLVMTQAAVNEIVERMHTPINR  328


 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSH   KLNKKV RLGLK+ 
Sbjct  163  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCTMHGPKPRSHE-FKLNKKVRRLGLKI-  220

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTKNIV+Y Q+ME +KK
Sbjct  221  ALTARAAEGKLLVFEDFEVP-THKTKNIVNYVQQMEGSKK  259



>ref|XP_009356763.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009356834.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009356895.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pyrus 
x bretschneideri]
Length=324

 Score =   117 bits (293),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSH  IKLNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCTMHGPKPRSHE-IKLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F  +    +HKTK IV+Y Q+ME +KK
Sbjct  217  ALTARAAEGKLLVFEDFEVP-THKTKKIVNYVQQMEGSKK  255


 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 8/102 (8%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPIN-------ENLKLATQNI  410
            EGKL+VFED E+P+H K + +    ++    KK LLVDG           E LKLATQN+
Sbjct  224  EGKLLVFEDFEVPTH-KTKKIVNYVQQMEGSKKFLLVDGTKTEDGKQMLPEKLKLATQNL  282

Query  409  HYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            HYVNVL +IGLNVYSIL HDTLVM+R AVN IV+RMHTPINR
Sbjct  283  HYVNVLLAIGLNVYSILQHDTLVMTRAAVNEIVKRMHTPINR  324



>ref|XP_010490301.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like, partial 
[Camelina sativa]
Length=269

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VF+D+ LP+H K + +     +    KKVL+V+GGPI+E LKLATQN+HYVN++P
Sbjct  179  EGKLLVFDDLALPTH-KTKNIVNYYNQMEKTKKVLVVEGGPIDEKLKLATQNLHYVNIIP  237

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIV  311
            SIGLNVYSILLHDTLV+SRDAV++IV
Sbjct  238  SIGLNVYSILLHDTLVISRDAVDKIV  263


 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 72/112 (64%), Gaps = 11/112 (10%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQ--------FRGGTAMHVPKPRSHATIKLNKKV  615
            SEVSGTGRKP+ QKGTGRARHGTLRGPQ        FRGG  MH P PRSHA IK+NK+V
Sbjct  106  SEVSGTGRKPWNQKGTGRARHGTLRGPQINQFFDFKFRGGCVMHGPIPRSHA-IKMNKQV  164

Query  614  CRLGLKLDCFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSFAC  459
             RLGLK+    +  + GK   F       +HKTKNIV+Y  +ME  KK    
Sbjct  165  RRLGLKI-ALTARAAEGKLLVFDDLALP-THKTKNIVNYYNQMEKTKKVLVV  214



>ref|WP_038461578.1| 50S ribosomal protein L4 [Candidatus Caedibacter acanthamoebae]
 gb|AIL12571.1| 50S ribosomal protein L4 [Candidatus Caedibacter acanthamoebae]
Length=206

 Score = 71.6 bits (174),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            S++SGT RKP+ QKGTGRAR G+LR PQFRGG  +  P  R H    L KKV RLGL + 
Sbjct  54   SDISGTTRKPWKQKGTGRARQGSLRSPQFRGGAVIFGPVVRDHGY-SLQKKVRRLGL-MT  111

Query  590  CFVSSCSRGK  561
               S  S GK
Sbjct  112  ALSSKLSEGK  121


 Score = 68.9 bits (167),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVL  392
            EGKL + + +E  S   P+T  A+    ++  K  L VDG  +N+N  LA +NI Y++VL
Sbjct  119  EGKLFIVDSLEQQS---PKTQDAIKNLEKLGLKNALFVDGAEVNKNFSLAIRNIPYIDVL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            P  GLNVY IL  +TLV+++ AV  I +R+ 
Sbjct  176  PQQGLNVYDILRRETLVLTKAAVESIEQRLR  206



>ref|XP_007212503.1| hypothetical protein PRUPE_ppa017710mg [Prunus persica]
 gb|EMJ13702.1| hypothetical protein PRUPE_ppa017710mg [Prunus persica]
Length=271

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRAR G+LR PQFRGG+ MH PKPRSHA  KLNKKV RLGLK+ 
Sbjct  118  SEVSGTGRKPWNQKGTGRARQGSLRSPQFRGGSTMHGPKPRSHA-FKLNKKVRRLGLKIA  176

Query  590  CFV-----SSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
                     +C + +   F  +    +HKTKNIV+Y Q+M+N+KK
Sbjct  177  LTAREQRERNCMKLQLLVFDDFEVP-THKTKNIVNYVQQMDNSKK  220


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 12/93 (13%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            +L+VF+D E+P+H K + +    ++    KK+LL           LATQN+HYVNVLP++
Sbjct  191  QLLVFDDFEVPTH-KTKNIVNYVQQMDNSKKLLL-----------LATQNLHYVNVLPAV  238

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            GLNV SIL HDTLVMSR AVN IVERMHTPI R
Sbjct  239  GLNVNSILQHDTLVMSRAAVNEIVERMHTPIKR  271



>ref|XP_003603461.1| 50S ribosomal protein L4 [Medicago truncatula]
Length=366

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG A H PKPRSHA  KLNKKV RLGLK+ 
Sbjct  184  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGEAKHGPKPRSHA-FKLNKKVRRLGLKI-  241

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F       +HKTKN +++  ++E+ KK
Sbjct  242  ALSARAAEGKLLVFEDLEVP-THKTKNFLNFFNQLEDTKK  280


 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+P+H K +       +    KK+L+VD GP+NE LKLATQN+HYVN+LP
Sbjct  249  EGKLLVFEDLEVPTH-KTKNFLNFFNQLEDTKKLLIVDDGPVNEKLKLATQNLHYVNLLP  307

Query  388  SI  383
            SI
Sbjct  308  SI  309



>ref|WP_002725426.1| MULTISPECIES: 50S ribosomal protein L4 [Phaeospirillum]
 emb|CCG39741.1| 50S ribosomal subunit protein L4 [Phaeospirillum molischianum 
DSM 120]
 gb|EPY01581.1| 50S ribosomal protein L4 [Phaeospirillum fulvum MGU-K5]
Length=206

 Score = 68.9 bits (167),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMAR----KWRMPKKVLLVDGGPINENLKLATQNIHYV  401
            +GKL V +   + +   P+T    AR     W     VL++DG  +++N  LA++NI YV
Sbjct  119  DGKLFVLDAANVAT---PKTRELAARLNALGW---SSVLVIDGAAVDDNFALASRNIPYV  172

Query  400  NVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +VLP  G NVY IL HDTLV+++DAV  +  R+
Sbjct  173  DVLPQAGANVYDILRHDTLVLTKDAVEALEARL  205


 Score = 64.7 bits (156),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            E+SGT +KP+ QKG GRAR G+LR PQFRGG  +  P  RSHA   L KKV +L LK
Sbjct  55   EISGTTKKPFAQKGGGRARQGSLRSPQFRGGATIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_014246890.1| 50S ribosomal protein L4 [Azospirillum lipoferum]
 ref|YP_005038088.1| 50S ribosomal protein L4 [Azospirillum lipoferum 4B]
 emb|CBS85835.1| 50S ribosomal subunit protein L4 [Azospirillum lipoferum 4B]
Length=209

 Score = 71.6 bits (174),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KPY QKGTGRAR G++R PQFRGG  +  P  RSHA   L KKV +L LK
Sbjct  57   SEISGTTKKPYSQKGTGRARQGSIRSPQFRGGATIFGPVVRSHAH-DLTKKVRKLALK  113


 Score = 60.5 bits (145),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V E     +H K + L A      +    L++DG  ++EN   A++NI  ++VLP
Sbjct  122  EGKLIVLEAAAAETH-KTKELAARLATLGLTS-ALIIDGSNLDENFAKASRNIPLIDVLP  179

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  DTLV++R+AV ++  R+
Sbjct  180  EQGANVYDILRRDTLVLTRNAVEQLEARL  208



>ref|XP_009610538.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L4, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=290

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGTGRK    KGTGRARHGTLRG QF GG  MH PKPRSHA I+LNKKV RLGLK+ 
Sbjct  159  SEVSGTGRKSXRXKGTGRARHGTLRGAQFLGGATMHGPKPRSHA-IQLNKKVRRLGLKI-  216

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKMENAKK  471
               +  + GK   F     + SHKTKNIV+Y  ++EN KK
Sbjct  217  ALSARAAEGKLMVFEDLEIS-SHKTKNIVNYFNQLENTKK  255


 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKLMVFED+E+ SH K + +     +    KK+LLVDGGPI+E LKLATQN+HYVNVLP
Sbjct  224  EGKLMVFEDLEISSH-KTKNIVNYFNQLENTKKLLLVDGGPISEKLKLATQNLHYVNVLP  282

Query  388  SI  383
            SI
Sbjct  283  SI  284



>ref|WP_012973206.1| 50S ribosomal protein L4 [Azospirillum lipoferum]
 ref|YP_003447764.1| 50S ribosomal protein L4 [Azospirillum sp. B510]
 dbj|BAI71220.1| large subunit ribosomal protein L4 [Azospirillum sp. B510]
Length=206

 Score = 70.5 bits (171),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KPY QKGTGRAR G++R PQFRGG  +  P  RSHA  +L KKV +L LK
Sbjct  54   SEISGTTKKPYGQKGTGRARQGSIRSPQFRGGATIFGPVVRSHAH-ELTKKVRKLALK  110


 Score = 60.8 bits (146),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V E     +H K + L A      +    L++DG  ++EN   A++NI  ++VLP
Sbjct  119  EGKLIVLEAAAAETH-KTKELAARLATLGLTS-ALIIDGANLDENFAKASRNIPLIDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  DTLV++R+AV ++  R+
Sbjct  177  EQGANVYDILRRDTLVLTRNAVEQLEARL  205



>ref|WP_011385498.1| 50S ribosomal protein L4 [Magnetospirillum magneticum]
 ref|YP_422492.1| 50S ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
 sp|Q2W2J2.1|RL4_MAGSA RecName: Full=50S ribosomal protein L4 [Magnetospirillum magneticum 
AMB-1]
 dbj|BAE51933.1| Ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
Length=206

 Score = 67.4 bits (163),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVL  392
            +GKL+V   ++  S   P+T    AR  ++    VL +DG  ++ N  LA++NI YV+VL
Sbjct  119  DGKLIV---VDAASAGSPKTKDLAARLGKLGLSSVLFIDGAAVDGNFALASRNIPYVDVL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P+ G NVY IL  DTLV+++DAV  +  R+
Sbjct  176  PTQGANVYDILRRDTLVLTKDAVAALEARL  205


 Score = 63.9 bits (154),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKG GRAR G+LR  QFRGG+ +  P  RSHA   L KKV +L LK
Sbjct  54   SEISGTTKKPFAQKGGGRARQGSLRSAQFRGGSTIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_007004403.1| 50S ribosomal protein L4 [Roseomonas cervicalis]
 gb|EFH11763.1| 50S ribosomal protein L4 [Roseomonas cervicalis ATCC 49957]
Length=206

 Score = 72.0 bits (175),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G A+H P  R H    LNKKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YSLNKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAAEG  120


 Score = 58.9 bits (141),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 12/94 (13%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARK-----WRMPKKVLLVDGGPINENLKLATQNIHY  404
            EGKL+V +   L +  K     AMA K     W   K  L+VD   + +    A +N+  
Sbjct  119  EGKLVVLDTAALGADAKTS---AMASKVKALGW---KSALVVDA-QVEDGFGRAVRNLKN  171

Query  403  VNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            VNVLPS+G NVY IL HD L ++R AV+ + ER+
Sbjct  172  VNVLPSMGANVYDILKHDVLAVTRQAVDALKERL  205



>ref|WP_011477720.1| 50S ribosomal protein L4 [Rickettsia bellii]
 ref|YP_538231.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 ref|YP_001495829.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
 sp|Q1RHM2.1|RL4_RICBR RecName: Full=50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 sp|A8GVB5.1|RL4_RICB8 RecName: Full=50S ribosomal protein L4 [Rickettsia bellii OSU 
85-389]
 gb|ABE05142.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 gb|ABV78792.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG  +H P  RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVIHGPVVRSHAT-KLPKKVRKLGL  110


 Score = 60.8 bits (146),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V + ++L +  K   L  +  K++  K   ++DG  ++ N  LA QNI+   V+P
Sbjct  120  EGKLLVIDSLKLET-PKTSNLVNILNKFQ-GKSFFVIDGNEVDVNFSLAAQNIYNTVVVP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
             IG NVY I+ H+ +++S++AVN + ER+
Sbjct  178  QIGANVYDIIRHEYVLLSQEAVNVLEERL  206



>ref|WP_040289942.1| 50S ribosomal protein L4 [Acetobacteraceae bacterium AT-5844]
Length=206

 Score = 69.7 bits (169),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    LNKKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGVVHGPVVRDHG-YSLNKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAAEG  120


 Score = 59.7 bits (143),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARK--WRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + +EL +  K   L A  +   W   K  L+VD   + E    A +N+ +VNV
Sbjct  119  EGKLIVLDTVELGADAKTSALAAKVKALGW---KSALVVDA-AVEEGFGRAVRNLPHVNV  174

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            LPS G NVY IL HD L ++R  V  + ER+
Sbjct  175  LPSPGANVYDILNHDVLAVTRAGVEALKERL  205



>ref|WP_040848409.1| 50S ribosomal protein L4 [Nitrospirillum amazonense]
Length=206

 Score = 68.6 bits (166),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKGTGRAR G+LR PQFRGG  +  P  RSH    L KKV +L LK
Sbjct  54   SEISGTTKKPWKQKGTGRARQGSLRSPQFRGGAVIFGPVVRSHEH-DLTKKVRKLALK  110


 Score = 60.8 bits (146),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++ +D    +H K + L        +   VL++DG  ++EN   A  NI +V+VLP
Sbjct  119  EGKLVILDDARAETH-KTKALVEQFGALGL-NSVLIIDGANLDENFVRAAGNIPHVDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  DTLV++R+AV ++  R+
Sbjct  177  EQGANVYDILRRDTLVLTRNAVEQLEARL  205



>gb|EHM03061.1| 50S ribosomal protein L4 [Acetobacteraceae bacterium AT-5844]
Length=222

 Score = 69.3 bits (168),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    LNKKV RLGL    
Sbjct  71   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGVVHGPVVRDHG-YSLNKKVRRLGL----  125

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  126  -ISALSQKAAEG  136


 Score = 59.7 bits (143),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARK--WRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + +EL +  K   L A  +   W   K  L+VD   + E    A +N+ +VNV
Sbjct  135  EGKLIVLDTVELGADAKTSALAAKVKALGW---KSALVVDAA-VEEGFGRAVRNLPHVNV  190

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            LPS G NVY IL HD L ++R  V  + ER+
Sbjct  191  LPSPGANVYDILNHDVLAVTRAGVEALKERL  221



>ref|WP_009868565.1| 50S ribosomal protein L4 [Magnetospirillum magnetotacticum]
 gb|KIM00031.1| LSU ribosomal protein L4p (L1e) [Magnetospirillum magnetotacticum 
MS-1]
Length=206

 Score = 64.3 bits (155),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVL  392
            +GKL+V ++    S   P+T    AR  ++    VL +DG  ++ N  LA++NI YV+VL
Sbjct  119  DGKLIVVDNATAGS---PKTKDLAARLGKLGLSSVLFIDGAAVDGNFALASRNIPYVDVL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P  G NVY IL  +TLV+++DAV  +  R+
Sbjct  176  PQQGANVYDILRRETLVLTKDAVAALEARL  205


 Score = 63.9 bits (154),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKG GRAR G+LR  QFRGG+ +  P  RSHA   L KKV +L LK
Sbjct  54   SEISGTTKKPFAQKGGGRARQGSLRSAQFRGGSTIFGPVVRSHAH-DLPKKVRKLALK  110



>emb|CDP01309.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVSGTGRKP+ QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKLNKKV RLGLK+
Sbjct  148  SEVSGTGRKPWRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLNKKVRRLGLKI  205



>ref|WP_011390437.1| 50S ribosomal protein L4 [Rhodospirillum rubrum]
 ref|YP_427771.1| 50S ribosomal protein L4 [Rhodospirillum rubrum ATCC 11170]
 ref|YP_006049019.1| 50S ribosomal protein L4 [Rhodospirillum rubrum F11]
 sp|Q2RQW1.1|RL4_RHORT RecName: Full=50S ribosomal protein L4 [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC23484.1| LSU ribosomal protein L4P [Rhodospirillum rubrum ATCC 11170]
 gb|AEO49222.1| 50S ribosomal protein L4 [Rhodospirillum rubrum F11]
Length=206

 Score = 67.4 bits (163),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT  KP+ QKGTG AR G+ R PQFRGG  +  P  RSHA   LNKKV +LGLK
Sbjct  54   SEISGTTAKPFKQKGTGHARQGSKRSPQFRGGATIFGPVVRSHAH-DLNKKVRKLGLK  110


 Score = 60.5 bits (145),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G+L+V  D  +    K + L A  +   + +KVL +DG  +NE   LA +NI  ++VLP 
Sbjct  120  GQLIVL-DQAISESGKTKDLLAQLKVLGL-EKVLFIDGPEVNEKFALAARNIIGLDVLPQ  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERMH  299
             G NVY IL  DTLV++++AV  + ER+ 
Sbjct  178  QGANVYDILRRDTLVLTKEAVKHLEERLQ  206



>ref|WP_011191090.1| 50S ribosomal protein L4 [Rickettsia typhi]
 ref|YP_067595.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
 ref|YP_005427714.1| 50S ribosomal protein L4 [Rickettsia typhi str. TH1527]
 ref|YP_005423953.1| 50S ribosomal protein L4 [Rickettsia typhi str. B9991CWPP]
 sp|Q68W79.1|RL4_RICTY RecName: Full=50S ribosomal protein L4 [Rickettsia typhi str. 
Wilmington]
 gb|AAU04113.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
 gb|AFE54492.1| 50S ribosomal protein L4 [Rickettsia typhi str. TH1527]
 gb|AFE55331.1| 50S ribosomal protein L4 [Rickettsia typhi str. B9991CWPP]
Length=207

 Score = 71.6 bits (174),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H PK RSHA IKL KKV +LGL + 
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSIQMRGGGISHGPKVRSHA-IKLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAAGK  122


 Score = 56.2 bits (134),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 57/90 (63%), Gaps = 6/90 (7%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVL  392
            GKL++   ++L    KP+T  L  +  K++  +   ++DG  ++ N  LAT+NI+   ++
Sbjct  121  GKLLIINSLKLE---KPKTSVLVNLLNKFQ-GQSFFIIDGNKVDTNFSLATKNIYNTLIV  176

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  177  PQIGANVYDIIRHEYVLLSQEAVSFLEERL  206



>ref|WP_008615456.1| 50S ribosomal protein L4 [Magnetospirillum sp. SO-1]
 gb|EME70956.1| 50S ribosomal protein L4 [Magnetospirillum sp. SO-1]
Length=206

 Score = 63.9 bits (154),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVL  392
            +GKL+V +     S   P+T    AR  ++    VL +DG  ++ N  LA++NI YV+VL
Sbjct  119  DGKLIVVDSAAAGS---PKTKDLAARLGKLGLSSVLFIDGSAVDGNFALASRNIPYVDVL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P  G NVY IL  +TLV+++DAV  +  R+
Sbjct  176  PQQGANVYDILRRETLVLTKDAVAALEARL  205


 Score = 63.5 bits (153),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKG GRAR G+LR  QFRGG  +  P  RSHA   L KKV +L LK
Sbjct  54   SEISGTTKKPFAQKGGGRARQGSLRSAQFRGGATIFGPVVRSHAH-DLPKKVRKLALK  110



>ref|WP_040256138.1| 50S ribosomal protein L4 [Rickettsia hoogstraalii]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 58.2 bits (139),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILSKFQ-GKSFFVIDGNEVDTNFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|NP_001066789.2| Os12g0488600 [Oryza sativa Japonica Group]
 dbj|BAF29808.2| Os12g0488600 [Oryza sativa Japonica Group]
Length=346

 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = -2

Query  746  KPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDCFVSSCSR  567
            KPY QKGTGRARHGTLRGPQFRGG  MH PKPRSHA IKL KKV RLGLK+    +  + 
Sbjct  173  KPYKQKGTGRARHGTLRGPQFRGGATMHGPKPRSHA-IKLQKKVRRLGLKI-ALSARTAE  230

Query  566  GKAHGF*GYGTTFSHKTKNIVSYGQKMENAKKSF  465
            GK   F       SHKTKN+VSY  +ME+ KK  
Sbjct  231  GKLLVFEDLEVP-SHKTKNVVSYISQMEDTKKVL  263


 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+VFED+E+PSH K + + +   +    KKVLLVDGG I++ LKLATQN+HYVNVLP
Sbjct  230  EGKLLVFEDLEVPSH-KTKNVVSYISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLP  288

Query  388  SIGLNVYSILLHDTL  344
            SIGLNVYSIL HDTL
Sbjct  289  SIGLNVYSILQHDTL  303



>ref|WP_011270631.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|YP_246295.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 sp|Q4UMS8.1|RL4_RICFE RecName: Full=50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 gb|AAY61130.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 gb|KHO03330.1| 50S ribosomal protein L4 [Rickettsia felis str. LSU]
 gb|KIJ88960.1| 50S ribosomal protein L4 [Candidatus Rickettsia asemboensis]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 58.2 bits (139),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSVLVNILNKFQ-GKSFFVIDGNEVDTNFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_014364921.1| 50S ribosomal protein L4 [Rickettsia philipii]
 ref|YP_005301088.1| 50S ribosomal protein L4 [Rickettsia philipii str. 364D]
 gb|AFB26631.1| 50S ribosomal protein L4 [Rickettsia philipii str. 364D]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.8 bits (138),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSALEERL  206



>gb|KDO78369.1| hypothetical protein CISIN_1g021591mg [Citrus sinensis]
Length=251

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVSGTG+KP+ QKGTGRARHGTLRGPQFRGGT MH PKPRSHA IKLNKKV RLGLK+
Sbjct  152  SEVSGTGKKPWRQKGTGRARHGTLRGPQFRGGTTMHGPKPRSHA-IKLNKKVRRLGLKI  209



>ref|WP_012151151.1| 50S ribosomal protein L4 [Rickettsia rickettsii]
 ref|YP_001495101.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila 
Smith']
 ref|YP_001650375.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Iowa]
 ref|YP_005286569.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Colombia]
 ref|YP_005287915.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Arizona]
 ref|YP_005289267.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hauke]
 ref|YP_005292306.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Brazil]
 ref|YP_005294403.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hino]
 sp|A8GT68.1|RL4_RICRS RecName: Full=50S ribosomal protein L4 [Rickettsia rickettsii 
str. 'Sheila Smith']
 sp|B0BUQ9.1|RL4_RICRO RecName: Full=50S ribosomal protein L4 [Rickettsia rickettsii 
str. Iowa]
 gb|ABV76593.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila 
Smith']
 gb|ABY72969.1| LSU ribosomal protein L1E (= L4P) [Rickettsia rickettsii str. 
Iowa]
 gb|AFB21835.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Brazil]
 gb|AFB23945.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Colombia]
 gb|AFB25291.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Arizona]
 gb|AFB27970.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hino]
 gb|AFB30631.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hauke]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.4 bits (137),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   V
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVV  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_014014636.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|YP_004764684.1| 50S ribosomal protein L4 [Rickettsia heilongjiangensis 054]
 ref|YP_004885099.1| 50S ribosomal protein L4 [Rickettsia japonica YH]
 gb|AEK75006.1| 50S ribosomal protein L4 [Rickettsia heilongjiangensis 054]
 dbj|BAK96960.1| 50S ribosomal protein L4 [Rickettsia japonica YH]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.4 bits (137),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDVNFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_004997785.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|NP_360642.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 ref|YP_005066101.1| 50S ribosomal protein L4 [Rickettsia slovaca 13-B]
 ref|YP_005393247.1| 50S ribosomal protein L4 [Rickettsia parkeri str. Portsmouth]
 ref|YP_005426745.1| 50S ribosomal protein L4 [Rickettsia slovaca str. D-CWPP]
 sp|Q92GW7.1|RL4_RICCN RecName: Full=50S ribosomal protein L4 [Rickettsia conorii str. 
Malish 7]
 gb|AAL03543.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 gb|EAA26259.1| 50S ribosomal protein L4 [Rickettsia sibirica 246]
 gb|AEV92533.1| 50S ribosomal protein L4 [Rickettsia slovaca 13-B]
 gb|AFC75188.1| 50S ribosomal protein L4 [Rickettsia parkeri str. Portsmouth]
 gb|AFD20014.1| 50S ribosomal protein L4 [Rickettsia slovaca str. D-CWPP]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_012736946.1| MULTISPECIES: 50S ribosomal protein L4 [spotted fever group]
 ref|YP_002916827.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
 ref|YP_005295716.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hlp#2]
 sp|C4K2H8.1|RL4_RICPU RecName: Full=50S ribosomal protein L4 [Rickettsia peacockii 
str. Rustic]
 gb|ACR47775.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
 gb|AFB29296.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Hlp#2]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSVLVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_012719919.1| 50S ribosomal protein L4 [Rickettsia africae]
 ref|YP_002845509.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
 sp|C3PPA6.1|RL4_RICAE RecName: Full=50S ribosomal protein L4 [Rickettsia africae ESF-5]
 gb|ACP53766.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_023507969.1| 50S ribosomal protein L4 [Rickettsia monacensis]
 emb|CDI29733.1| 50S ribosomal protein L4 [Rickettsia monacensis IrR/Munich]
 emb|CEO17992.1| 50S ribosomal protein L4 [Rickettsia monacensis]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_008494543.1| MULTISPECIES: 50S ribosomal protein L4 [Acidocella]
 gb|EKM99183.1| 50S ribosomal protein L4 [Acidocella sp. MX-AZ02]
Length=204

 Score = 73.6 bits (179),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT RKPY QKGTG AR G+LR PQFR G A+H P  R H    LNKKV RLGL    
Sbjct  55   EVSGTTRKPYKQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHGY-SLNKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S   A G
Sbjct  110  -ISALSAKAAEG  120


 Score = 52.8 bits (125),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V + +     TK          W   K  L+VD   + E    A++N+  ++VLP
Sbjct  119  EGKLVVLDGVAALDKTKDVAAKVANFGW---KSALIVDA-AVEEKFGRASRNVKGLDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
             +G NVY I+ HD LV+++ AV  + ER+
Sbjct  175  VVGANVYDIMQHDVLVVTKAAVEGLKERL  203



>ref|WP_010421659.1| 50S ribosomal protein L4 [Rickettsia helvetica]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.0 bits (136),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALINILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>gb|KIE05824.1| 50S ribosomal protein L4 [endosymbiont of Acanthamoeba sp. UWC36]
Length=208

 Score = 66.6 bits (161),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            +V G+ RK Y QKGTG+ARHG +RG QFRGG  +  P  RSH   K+NKKV +LGLK 
Sbjct  58   DVRGSTRKIYKQKGTGKARHGAIRGAQFRGGGIIFGPHFRSHEY-KINKKVRKLGLKF  114


 Score = 59.3 bits (142),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L + ++  L SH   +T     +      K +L+    INEN+K +  NIH +NVLP  G
Sbjct  125  LTIMDEFNLSSH---KTADLKQKLGNFNAKSILIIDNNINENVKKSCANIHTINVLPVAG  181

Query  379  LNVYSILLHDTLVMSRDAVNRIVERM  302
            +NVY I+ H+ L+++ DA+N I ER+
Sbjct  182  INVYDIIRHEKLIITVDALNAIKERL  207



>ref|WP_012153048.1| 50S ribosomal protein L4 [Rickettsia massiliae]
 ref|YP_001499629.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
 gb|ABV85082.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
Length=209

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  57   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  114

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  115  ALSEKCAEGK  124


 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  122  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFCVIDGNEVDINFSLAAKNIYNTVI  177

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  178  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  208



>ref|WP_014365540.1| 50S ribosomal protein L4 [Rickettsia massiliae]
 ref|YP_005301887.1| 50S ribosomal protein L4 [Rickettsia massiliae str. AZT80]
 gb|AFB31427.1| 50S ribosomal protein L4 [Rickettsia massiliae str. AZT80]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCAEGK  122


 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFCVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_039455032.1| 50S ribosomal protein L4 [endosymbiont of Acanthamoeba sp. UWC36]
Length=205

 Score = 66.6 bits (161),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            +V G+ RK Y QKGTG+ARHG +RG QFRGG  +  P  RSH   K+NKKV +LGLK 
Sbjct  55   DVRGSTRKIYKQKGTGKARHGAIRGAQFRGGGIIFGPHFRSHEY-KINKKVRKLGLKF  111


 Score = 59.3 bits (142),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L + ++  L SH   +T     +      K +L+    INEN+K +  NIH +NVLP  G
Sbjct  122  LTIMDEFNLSSH---KTADLKQKLGNFNAKSILIIDNNINENVKKSCANIHTINVLPVAG  178

Query  379  LNVYSILLHDTLVMSRDAVNRIVERM  302
            +NVY I+ H+ L+++ DA+N I ER+
Sbjct  179  INVYDIIRHEKLIITVDALNAIKERL  204



>gb|KFM28200.1| 50S ribosomal protein L4 [Auxenochlorella protothecoides]
Length=282

 Score = 63.9 bits (154),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 50/80 (63%), Gaps = 9/80 (11%)
 Frame = -2

Query  815  ILHR--KASLKAQQT------LESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHV  660
            ILHR  +  L A+Q         +EV G GRKP PQKG G +R G++R PQ+RGG   H 
Sbjct  97   ILHRVVRWQLAARQQGTHKTKTRTEVRGGGRKPRPQKGGGVSRQGSIRAPQWRGGGVAHG  156

Query  659  PKPRSHATIKLNKKVCRLGL  600
            P  RSHA IKL K++ RLGL
Sbjct  157  PVTRSHA-IKLLKRIRRLGL  175


 Score = 62.0 bits (149),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 12/99 (12%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT-L*AMARKWRMPKKVLLVD----GGPINENLKLATQNIHY  404
            EG+L+V + + LP   +P+T L A A +    + VLL D    G    E L+ A  N+ +
Sbjct  185  EGRLLVVDTLRLP---QPKTGLLAGAPR----RSVLLSDLSAEGPDGGEGLRRACANLPW  237

Query  403  VNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPIN  287
            V++LPSIGLNVYSIL  D LV++  +V  + ER+  PI 
Sbjct  238  VDLLPSIGLNVYSILRRDYLVLTCQSVEAVQERLRKPIR  276



>ref|WP_014412448.1| 50S ribosomal protein L4 [Rickettsia australis]
 ref|YP_005414760.1| 50S ribosomal protein L4 [Rickettsia australis str. Cutlack]
 gb|AFC70917.1| 50S ribosomal protein L4 [Rickettsia australis str. Cutlack]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 56.2 bits (134),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V + ++L    K   L  +  K++  K   ++DG  ++ N  LA +NI+ + ++P
Sbjct  120  EGKLLVIDSLKL-DQPKTSALVNILSKFQ-GKSFFVIDGNEVDTNFSLAAKNIYNIVIVP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
             +G NVY I+ ++ +++S++AV+ + ER+
Sbjct  178  QVGANVYDIIRYEYVILSQEAVSVLEERL  206



>ref|WP_014103663.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus]
 ref|YP_004866442.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus ARL-13]
 gb|AEP10440.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus ARL-13]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            EVSGTG+KP+ QKGTG  R G+LR PQ RGG  +  P PRSHAT  L KKV  L LK
Sbjct  55   EVSGTGKKPFKQKGTGNGRQGSLRSPQMRGGAVIFGPTPRSHAT-DLPKKVRALALK  110


 Score = 56.2 bits (134),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -3

Query  565  GKLMVFEDMELPSH-TKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            GKL+V +     +H TKP    A A K       ++V G  ++ N   AT N+  ++VLP
Sbjct  120  GKLIVLDQAVADTHKTKPM---AEAMKALGLTSAVIVCGDEVDANFSRATDNLPRIDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            S G NVY IL  DTLV+++DAV  +  R+
Sbjct  177  SQGANVYDILRRDTLVLTKDAVANLTARL  205



>ref|WP_008945160.1| 50S ribosomal protein L4 [Oceanibaculum indicum]
 gb|EKE73565.1| 50S ribosomal protein L4 [Oceanibaculum indicum P24]
Length=205

 Score = 66.6 bits (161),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE++GT +KPY QKGTGRAR G+ R PQFRGG  +  P  R H    L KKV +LGLK
Sbjct  54   SEIAGTTKKPYKQKGTGRARQGSTRSPQFRGGATIFGPVVRDHGY-DLPKKVRKLGLK  110


 Score = 58.9 bits (141),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            KL+V +D +L S  K + L A   K  +    L+VDG  ++ENLK A  N+  ++VLP I
Sbjct  121  KLIVLDDAKL-SEPKTKELKAQLEKLGITS-ALIVDG-AVDENLKKAASNLIGIDVLPQI  177

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERM  302
            G NVY IL  DTLV++++A+  +  R+
Sbjct  178  GANVYDILRRDTLVLTKNAIEALEARL  204



>ref|WP_032138905.1| 50S ribosomal protein L4 [Rickettsia tamurae]
Length=207

 Score = 68.6 bits (166),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G++R  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSIRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.0 bits (136),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTMI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_015468375.1| 50S ribosomal protein L4 [Micavibrio aeruginosavorus]
 ref|YP_007643476.1| LSU ribosomal protein L4p (L1e) [Micavibrio aeruginosavorus EPB]
 gb|AGH98856.1| LSU ribosomal protein L4p (L1e) [Micavibrio aeruginosavorus EPB]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            EVSGTG+KP+ QKGTG  R G+LR PQ RGG  +  P PRSHAT  L KKV  L LK
Sbjct  55   EVSGTGKKPFKQKGTGNGRQGSLRSPQMRGGAVIFGPTPRSHAT-DLPKKVRALALK  110


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -3

Query  565  GKLMVFEDMELPSH-TKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            GKL+V +     +H TKP    A A K       ++V G  ++ N   AT N+  ++VLP
Sbjct  120  GKLIVLDQAIADTHKTKPM---AEAMKALGLTSAVIVCGDEVDANFSRATDNLPRIDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            S G NVY IL  DTLV+++DAV  +  R+
Sbjct  177  SQGANVYDILRRDTLVLTKDAVANLTARL  205



>ref|WP_038540054.1| 50S ribosomal protein L4 [endosymbiont of Acanthamoeba sp. UWC8]
 gb|AIF81732.1| 50S ribosomal protein L4 [endosymbiont of Acanthamoeba sp. UWC8]
Length=205

 Score = 66.6 bits (161),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            +V G+ RK Y QKGTG+ARHG +RG QFRGG  +  P  RSH   K+NKKV +LGLK 
Sbjct  55   DVRGSTRKIYKQKGTGKARHGAIRGAQFRGGGIIFGPHFRSHEY-KINKKVRKLGLKF  111


 Score = 58.5 bits (140),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L + ++  L SH   +T     +      K +L+    +NEN+K +  NIH +NVLP  G
Sbjct  122  LTIMDEFNLSSH---KTADLKQKLGNFNAKSILIIDNNVNENVKKSCANIHTINVLPVAG  178

Query  379  LNVYSILLHDTLVMSRDAVNRIVERM  302
            +NVY I+ H+ L+++ DA+N I ER+
Sbjct  179  INVYDIIRHEKLIITVDALNAIKERL  204



>ref|WP_036704919.1| MULTISPECIES: 50S ribosomal protein L4 [Paracoccus]
 gb|KGJ14902.1| 50S ribosomal protein L4 [Paracoccus sp. 4681]
 gb|KGJ16811.1| 50S ribosomal protein L4 [Paracoccus sp. 10990]
 gb|KGJ18434.1| 50S ribosomal protein L4 [Paracoccus sp. 39524]
 gb|KGJ23162.1| 50S ribosomal protein L4 [Paracoccus sp. 5503]
Length=206

 Score = 66.6 bits (161),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARK-WRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            GKL++ E+++L          A+A   W   K+VL++DG  +NEN   A +N+  ++VLP
Sbjct  120  GKLVILENLDLAEAKTSAVAKALAENGW---KRVLVIDGAEVNENFARAARNLDGIDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            S+G NVY IL  DTLV++R  V  +  R+
Sbjct  177  SMGANVYDILKRDTLVITRAGVEALEARL  205


 Score = 58.5 bits (140),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 53/93 (57%), Gaps = 10/93 (11%)
 Frame = -2

Query  815  ILHRKASL---KAQQ----TL-ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHV  660
            ILHR       KAQQ    TL +S+VS + +K Y QKGTG ARHG+ + P FR G     
Sbjct  31   ILHRVVRWQRAKAQQGTHATLGKSDVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGVYKG  90

Query  659  PKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  561
            P PRSHA   L KKV  LGLK     +  SRGK
Sbjct  91   PVPRSHA-FDLPKKVRALGLK-HALSAKASRGK  121



>ref|WP_014408922.1| 50S ribosomal protein L4 [Rickettsia rhipicephali]
 ref|YP_005390810.1| 50S ribosomal protein L4 [Rickettsia rhipicephali str. 3-7-female6-CWPP]
 gb|AFC72737.1| 50S ribosomal protein L4 [Rickettsia rhipicephali str. 3-7-female6-CWPP]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL + 
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL-IH  112

Query  590  CFVSSCSRGK  561
                 C+ GK
Sbjct  113  ALSEKCTEGK  122


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  +   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GESFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_026397249.1| 50S ribosomal protein L4 [Acetobacter nitrogenifigens]
Length=205

 Score = 66.2 bits (160),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            EVSGT +KPY QKGTG AR G+LR PQFR G A+H P  R H    L KKV RLGL
Sbjct  55   EVSGTTKKPYKQKGTGSARQGSLRAPQFRTGGAVHGPVVRDHG-YDLPKKVRRLGL  109


 Score = 58.5 bits (140),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +  +  S T           W      L+VDG  INE    A +N+  ++VLP
Sbjct  119  DGKLIVLDSTDGVSKTAELAAKLKVLGW---SSALIVDGASINEAFGRAARNLPKIDVLP  175

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD L ++R  V  + ER+
Sbjct  176  TIGANVYDILNHDVLAITRAGVEGLKERL  204



>ref|WP_028795257.1| 50S ribosomal protein L4 [Thalassobaculum salexigens]
Length=206

 Score = 65.5 bits (158),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKGTGRAR G+LR  Q+RGG  +H P  R HA   L KK  +LGLK
Sbjct  54   SEISGTTKKPFRQKGTGRARAGSLRATQYRGGQTVHGPVVRDHAH-DLTKKFRKLGLK  110


 Score = 58.5 bits (140),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMP--KKVLLVDGGPINENLKLATQNIHYVNVL  392
            G+L++ ++    +  +P+T  A+A K++      VL++DG  +NEN   A +NI  V++L
Sbjct  120  GQLIIIDE---AAAAEPKTK-ALAEKFKKLGWSSVLVIDGDAVNENFARAARNIPLVDLL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P  G NVY IL  DTLV+++ AV ++  R+
Sbjct  176  PQQGANVYDILRRDTLVLTKGAVEQLEARL  205



>ref|WP_011952195.1| MULTISPECIES: 50S ribosomal protein L4 [Sphingomonas]
 ref|YP_001261855.1| 50S ribosomal protein L4 [Sphingomonas wittichii RW1]
 sp|A5V601.1|RL4_SPHWW RecName: Full=50S ribosomal protein L4 [Sphingomonas wittichii 
RW1]
 gb|ABQ67717.1| LSU ribosomal protein L4P [Sphingomonas wittichii RW1]
Length=208

 Score = 73.6 bits (179),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V + +EL    K + L A   K       L++DG  ++   +LA+ NIH +NVLP
Sbjct  119  DGKLVVVDTLELKD-AKTKALIAKIGKLGFGATALVIDGEAVDNGFQLASSNIHTINVLP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            +IG NVY IL H+TLV++R AV ++  R +
Sbjct  178  AIGANVYDILKHETLVLTRAAVEKLEARFN  207


 Score = 50.4 bits (119),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = -2

Query  812  LHRKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATI  633
            LH + +        S+V+ TG+K   QKG G ARHG  R P F GG   H P+ R   + 
Sbjct  40   LHNRRAPARAARERSDVARTGKKFGRQKGGGTARHGDRRAPVFIGGGKAHGPRARVFES-  98

Query  632  KLNKKVCRLGLKL  594
             LNKKV  LGLK+
Sbjct  99   SLNKKVRALGLKM  111



>ref|WP_027302615.1| 50S ribosomal protein L4 [Rhodospirillales bacterium URHD0088]
Length=206

 Score = 66.2 bits (160),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S++ GT +KP+ QKG GRAR G+LR PQFRGG  +  P  RSHA   L KKV RL LK
Sbjct  54   SDIQGTTKKPFKQKGGGRARQGSLRSPQFRGGAVIFGPVVRSHA-FGLQKKVRRLALK  110


 Score = 57.8 bits (138),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V E   +    K + L A   K+     VL++DG  ++EN   A +N+  V+VLP
Sbjct  119  EGKLIVLETAHV-DEAKTKLLGARLAKFGWDS-VLIIDGPVVDENFARAARNLPKVDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  D LV++RDAV  +  R+
Sbjct  177  QQGANVYDILRRDMLVLTRDAVQHLEARL  205



>ref|WP_032073486.1| 50S ribosomal protein L4 [Rickettsia aeschlimannii]
Length=207

 Score = 66.6 bits (161),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.4 bits (137),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDVNFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_004596200.1| 50S ribosomal protein L4 [Rickettsia prowazekii]
 ref|NP_221022.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Madrid E]
 ref|YP_005404329.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvV257]
 ref|YP_005405736.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Chernikova]
 ref|YP_005406580.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Katsinyian]
 ref|YP_005407419.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Dachau]
 ref|YP_005413243.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. BuV67-CWPP]
 ref|YP_005414079.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. RpGvF24]
 ref|YP_005999099.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Rp22]
 ref|YP_007749736.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. NMRC Madrid 
E]
 ref|YP_007751151.1| 50S ribosomal protein L3 [Rickettsia prowazekii str. Breinl]
 sp|Q9ZCQ6.1|RL4_RICPR RecName: Full=50S ribosomal protein L4 [Rickettsia prowazekii 
str. Madrid E]
 emb|CAA15098.1| 50S RIBOSOMAL PROTEIN L4 (rplD) [Rickettsia prowazekii str. Madrid 
E]
 gb|ADE30201.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Rp22]
 gb|AFE52251.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvV257]
 gb|AFE53652.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. RpGvF24]
 gb|AFE49458.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Chernikova]
 gb|AFE50302.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Katsinyian]
 gb|AFE51148.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. BuV67-CWPP]
 gb|AFE51984.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Dachau]
 gb|AGJ01682.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. NMRC Madrid 
E]
 gb|AGJ03097.1| 50S ribosomal protein L3 [Rickettsia prowazekii str. Breinl]
 gb|EOB10614.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. GvF12]
 gb|EOB10842.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Cairo 3]
Length=207

 Score = 69.7 bits (169),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H PK RSHA IKL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGISHGPKVRSHA-IKLPKKVRKLGL  110


 Score = 53.9 bits (128),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            E KL++ + ++L    KP+T  L  +  K++  +   ++DG  ++ N  LAT+NI+   +
Sbjct  120  EEKLLIIDSLKLD---KPKTSILVNLLSKFQ-GQSFFVIDGNKVDINFSLATKNIYNTLI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSFLEERL  206



>ref|WP_012148993.1| 50S ribosomal protein L4 [Rickettsia canadensis]
 ref|YP_001492583.1| 50S ribosomal protein L4 [Rickettsia canadensis str. McKiel]
 ref|YP_005299842.1| 50S ribosomal protein L4 [Rickettsia canadensis str. CA410]
 sp|A8EZL5.1|RL4_RICCK RecName: Full=50S ribosomal protein L4 [Rickettsia canadensis 
str. McKiel]
 gb|ABV73798.1| 50S ribosomal protein L4 [Rickettsia canadensis str. McKiel]
 gb|AFB21360.1| 50S ribosomal protein L4 [Rickettsia canadensis str. CA410]
Length=207

 Score = 65.9 bits (159),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P  RSHAT +L KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGLAHGPIVRSHAT-QLPKKVRKLGL  110


 Score = 57.8 bits (138),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  +   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSFLVNILNKFQ-GQSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AVN + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVNVLEERL  206



>ref|WP_017442487.1| 50S ribosomal protein L4 [Candidatus Rickettsia gravesii]
Length=207

 Score = 66.6 bits (161),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.0 bits (136),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_014409476.1| 50S ribosomal protein L4 [Rickettsia montanensis]
 ref|YP_005391432.1| 50S ribosomal protein L4 [Rickettsia montanensis str. OSU 85-930]
 gb|AFC73373.1| 50S ribosomal protein L4 [Rickettsia montanensis str. OSU 85-930]
Length=207

 Score = 66.6 bits (161),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 57.0 bits (136),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_022675062.1| 50S ribosomal protein L4 [Novosphingobium sp. B-7]
Length=207

 Score = 73.2 bits (178),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L+V + +EL +  K + L     K    KKVL+VDG  +NE    A +NI  VNVLP+IG
Sbjct  121  LVVIDSLEL-TDAKTKALAGTLAKAGFGKKVLVVDGEQVNEGFARAARNIVGVNVLPAIG  179

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  180  ANVYDILKHDTLVLTRAAVEKLEARFN  206


 Score = 50.4 bits (119),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  + P F GG   H P+ R   ++ LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRKAPIFIGGGKAHGPRVRDF-SVSLNKKVRALGLKM  111



>ref|WP_027134785.1| 50S ribosomal protein L4 [Geminicoccus roseus]
Length=206

 Score = 62.0 bits (149),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVLP  389
            GKL+V + +EL    +PRT   +AR  ++   KVL V    +  N  LA++N+ +V+VLP
Sbjct  120  GKLVVVDKLEL---DQPRTKELIARLGKLGLDKVLFVGPAELQLNFALASRNLTHVDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            S+G NVY IL  D LV+S+ A   + ER+
Sbjct  177  SVGANVYDILRSDQLVISKAAAQELQERL  205


 Score = 61.2 bits (147),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            EV+G+  K Y QKGTGRARHG  R P FR G   H P PR HA I L KKV  LGL++
Sbjct  55   EVAGSTAKIYKQKGTGRARHGNKRAPIFRTGGRAHGPTPRDHA-IDLPKKVRALGLRM  111



>ref|WP_038603371.1| 50S ribosomal protein L4 [Rickettsiales bacterium Ac37b]
 gb|AIL65576.1| Ribosomal protein L4 [Rickettsiales bacterium Ac37b]
Length=206

 Score = 66.2 bits (160),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            EVSGT +KPY QKGTG AR G+LR  QFRGG  +  P  RSHA   L KKV +LGLK
Sbjct  55   EVSGTTKKPYKQKGTGHARQGSLRSGQFRGGATIFGPNVRSHAY-DLPKKVRKLGLK  110


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL++ ++ +L +  K + +  + + + +   VL++DG  ++ N   +  N++ V++LP 
Sbjct  120  GKLLIIDEAKLAA-PKTKIVKDLLKNFGLSS-VLIIDGANVDSNFLQSINNLNAVDILPH  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL HDTL+++++ V ++ ER+
Sbjct  178  IGANVYDILRHDTLLITKEGVKQLEERL  205



>ref|WP_007678342.1| 50S ribosomal protein L4 [alpha proteobacterium BAL199]
 gb|EDP62456.1| 50S ribosomal protein L2 [alpha proteobacterium BAL199]
Length=206

 Score = 69.3 bits (168),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SE+SGT +KP+ QKGTGRAR G++R  QFRGG  +H P  RSHA   L KKV +LGLK  
Sbjct  54   SEISGTTKKPFRQKGTGRARQGSIRATQFRGGQTVHGPVVRSHAH-DLPKKVRKLGLK--  110

Query  590  CFVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKM  486
            C +S+  +          +T   KTK + +  +K+
Sbjct  111  CALSAKLKSGQLIVLDAASTDEAKTKLLAAKFEKL  145


 Score = 53.5 bits (127),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            + VL++DG  +NE    A +NI  V+VLP  G NVY IL  +TLV++R AV  +  R+
Sbjct  148  QSVLVIDGPELNEGFARAARNIPRVDVLPQQGANVYDILRRETLVLTRGAVEHLEARL  205



>ref|WP_012149904.1| 50S ribosomal protein L4 [Rickettsia akari]
 ref|YP_001493782.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
 sp|A8GPE9.1|RL4_RICAH RecName: Full=50S ribosomal protein L4 [Rickettsia akari str. 
Hartford]
 gb|ABV75274.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
Length=207

 Score = 67.8 bits (164),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSH T KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHVT-KLPKKVRKLGL  110


 Score = 54.7 bits (130),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EG+L+V + ++L    K   L  +  K++  K   ++DG  ++ N  LA +NI+   ++P
Sbjct  120  EGRLLVIDSLKL-DQPKTSALVNILSKFQ-GKSFFVIDGNEVDTNFSLAAKNIYNTAIVP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
             IG NVY I+ ++ +++S++AV+ + ER+
Sbjct  178  QIGANVYDIIRYEYVLLSQEAVSVLEERL  206



>gb|ACU18021.1| unknown [Glycine max]
Length=224

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVSGTGRKP+ QKGTGRARHG+LRGPQFRGG  MH PKPRSHA  K+NKKV RLGLK+
Sbjct  153  SEVSGTGRKPWNQKGTGRARHGSLRGPQFRGGATMHGPKPRSHA-FKVNKKVRRLGLKI  210



>ref|WP_008580969.1| MULTISPECIES: 50S ribosomal protein L4 [Rickettsia]
 ref|XP_002401694.1| ribosomal protein L4, putative [Ixodes scapularis]
 gb|EEC11380.1| ribosomal protein L4, putative [Ixodes scapularis]
 gb|EER22618.1| ribosomal protein L4/L1 family protein [Rickettsia endosymbiont 
of Ixodes scapularis]
 gb|KDO03530.1| ribosomal protein L4 [Rickettsia sp. ISO7]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEVSGT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT KL KKV +LGL
Sbjct  55   SEVSGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-KLPKKVRKLGL  110


 Score = 53.1 bits (126),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++D   ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTSALVNILNKFQ-GKSFFVIDRNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S++AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYVLLSQEAVSVLEERL  206



>ref|WP_011631262.1| 50S ribosomal protein L4 [Granulibacter bethesdensis]
 ref|YP_744376.1| 50S ribosomal protein L4 [Granulibacter bethesdensis CGDNIH1]
 sp|Q0BUP9.1|RL4_GRABC RecName: Full=50S ribosomal protein L4 [Granulibacter bethesdensis 
CGDNIH1]
 gb|ABI61453.1| LSU ribosomal protein L1E (= L4P) [Granulibacter bethesdensis 
CGDNIH1]
 gb|AHJ62332.1| LSU ribosomal protein L1E ( L4P) [Granulibacter bethesdensis 
CGDNIH3]
 gb|AHJ67583.1| LSU ribosomal protein L1E ( L4P) [Granulibacter bethesdensis 
CGDNIH2]
Length=215

 Score = 68.6 bits (166),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G A+H P  R H    L KKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+ +A G
Sbjct  110  -ISALSQKQAEG  120


 Score = 53.5 bits (127),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +       T+       A  WR     L+VDG  ++E    A++++  V+VLP
Sbjct  119  EGKLVVIDTAAGMEKTRDLAAKLRALGWR---SALIVDGASVDEGFARASRSLLAVDVLP  175

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD L ++   V  +  R+
Sbjct  176  TIGANVYDILNHDVLAITVAGVEALKARL  204



>ref|WP_025319712.1| 50S ribosomal protein L4 [Granulibacter bethesdensis]
 gb|AHJ64961.1| LSU ribosomal protein L1E ( L4P) [Granulibacter bethesdensis 
CGDNIH4]
Length=215

 Score = 68.6 bits (166),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G A+H P  R H    L KKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+ +A G
Sbjct  110  -ISALSQKQAEG  120


 Score = 53.5 bits (127),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +       T+       A  WR     L+VDG  ++E    A++++  V+VLP
Sbjct  119  EGKLVVIDTAAGMEKTRDLAAKLRALGWR---SALIVDGASVDEGFARASRSLLAVDVLP  175

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD L ++   V  +  R+
Sbjct  176  TIGANVYDILNHDVLAITVAGVEALKARL  204



>ref|WP_028639308.1| 50S ribosomal protein L4 [Novosphingobium acidiphilum]
Length=207

 Score = 72.0 bits (175),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V +++++ +  K + L     +    KKVL+VDG  +NE    A +N+  +NVLP+
Sbjct  119  GGLVVVDNLDM-TDAKTKVLAGTLAERGFGKKVLVVDGDAVNEGFARAARNLIGINVLPA  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            IG NVY IL HDTLV++R AV ++  R H
Sbjct  178  IGANVYDILKHDTLVLTRAAVEKLEARFH  206


 Score = 50.1 bits (118),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  + P F GG   H P+ R    I LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRKAPIFIGGGKAHGPRVREF-NISLNKKVRALGLKM  111



>ref|WP_036717362.1| 50S ribosomal protein L4 [Paracoccus sphaerophysae]
 gb|KGJ08525.1| 50S ribosomal protein L4 [Paracoccus sphaerophysae]
Length=209

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL++ + ++L +  K   + A A K    K+VL++DG  +NEN   A +N+  V+VLPS
Sbjct  120  GKLVILDSLDL-AEAKTSAV-AKAVKENGWKRVLVIDGAEVNENFARAARNLDGVDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV++R  V  +  R+
Sbjct  178  MGANVYDILKRDTLVITRAGVEALEARL  205


 Score = 57.4 bits (137),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 53/93 (57%), Gaps = 10/93 (11%)
 Frame = -2

Query  815  ILHRKASL---KAQQ----TL-ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHV  660
            ILHR       KAQQ    TL +S+VS + +K Y QKGTG ARHG+ + P FR G     
Sbjct  31   ILHRVVRWQRAKAQQGTHATLGKSDVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGVYKG  90

Query  659  PKPRSHATIKLNKKVCRLGLKLDCFVSSCSRGK  561
            P PRSHA   L KKV  LGL+     +  SRGK
Sbjct  91   PTPRSHA-FDLPKKVRALGLR-HALSAKASRGK  121



>ref|WP_023837788.1| 50S ribosomal protein L4 [Blastomonas sp. CACIA14H2]
 gb|ESZ87373.1| 50S ribosomal protein L4 [Blastomonas sp. CACIA14H2]
Length=208

 Score = 73.2 bits (178),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L+V E ++L    K + L A   K  + KK L +DG  +N+N K A+ N+  +NVLP++G
Sbjct  122  LIVVESLDL-GEAKTKALAAQLGKLGLGKKALFIDGDAVNDNFKKASANLIGLNVLPAVG  180

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  181  ANVYDILKHDTLVLTRAAVEKLEARFN  207


 Score = 48.1 bits (113),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  R P F GG   H P+ R      LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRRAPIFVGGGKAHGPRVRDF-NPSLNKKVRALGLKM  111



>ref|WP_008067248.1| 50S ribosomal protein L4 [Novosphingobium nitrogenifigens]
 gb|EGD58178.1| 50S ribosomal protein L4 [Novosphingobium nitrogenifigens DSM 
19370]
Length=207

 Score = 71.2 bits (173),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L+V + ++L +  K + L     K    KKVL+VDG  +NE    A +NI  VNVLP+IG
Sbjct  121  LVVVDTLDL-ADAKTKVLVGKFAKAGFGKKVLVVDGEAVNEGFARAARNIVGVNVLPAIG  179

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  180  ANVYDILKHDTLVLTRAAVEKLEARFN  206


 Score = 50.1 bits (118),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  + P F GG   H P+ R    I LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRKAPVFIGGGKAHGPRVREF-NISLNKKVRALGLKM  111



>ref|WP_008852406.1| 50S ribosomal protein L4 [Gluconobacter morbifer]
 gb|EHH67268.1| 50S ribosomal protein L4 [Gluconobacter morbifer G707]
Length=204

 Score = 63.9 bits (154),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            E+SGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL +  
Sbjct  55   EISGTTKKPYRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL-ISA  112

Query  587  FVSSCSRGK  561
                 + GK
Sbjct  113  LSQKATEGK  121


 Score = 57.4 bits (137),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V E     + T+       A  W      L+VDG  ++E    A  N+  ++VLP
Sbjct  119  EGKLIVLETASGVTKTREAAAKLKALGW---SSALIVDG-AVDEQFARAVANLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  I ER+
Sbjct  175  TIGANVYDILNHDVLVITRAGLEGIKERL  203



>ref|WP_011444908.1| 50S ribosomal protein L4 [Novosphingobium aromaticivorans]
 ref|YP_496528.1| 50S ribosomal protein L4 [Novosphingobium aromaticivorans DSM 
12444]
 sp|Q2G8X9.1|RL4_NOVAD RecName: Full=50S ribosomal protein L4 [Novosphingobium aromaticivorans 
DSM 12444]
 gb|ABD25694.1| LSU ribosomal protein L4P [Novosphingobium aromaticivorans DSM 
12444]
Length=207

 Score = 70.9 bits (172),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L+V +++++ + TK   L     K    KKVL++DG  +N+N   A +NI  VNVLP+IG
Sbjct  122  LVVVDNLDVDAKTK--ALVGQLAKANWGKKVLVIDGEGVNDNFAKAARNIVGVNVLPAIG  179

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  180  ANVYDILKHDTLVLTRAAVEKLEARFN  206


 Score = 50.1 bits (118),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  + P F GG   H P+ R    I LNKKV  LGLK+
Sbjct  55   SDVARTGKKFGRQKGGGTARHGDRKAPIFIGGGKAHGPRVREF-NISLNKKVRALGLKM  112



>ref|WP_012565934.1| 50S ribosomal protein L4 [Rhodospirillum centenum]
 ref|YP_002296956.1| 50S ribosomal protein L4 [Rhodospirillum centenum SW]
 sp|B6IRQ7.1|RL4_RHOCS RecName: Full=50S ribosomal protein L4 [Rhodospirillum centenum 
SW]
 gb|ACI98143.1| ribosomal protein L4 [Rhodospirillum centenum SW]
Length=206

 Score = 63.2 bits (152),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE++GT +KP+ QKGTGRAR G+ R PQFRGG  +  P  RSH    L KKV +L LK
Sbjct  54   SEIAGTTKKPWRQKGTGRARQGSTRSPQFRGGARIFGPVVRSHEH-DLTKKVRKLALK  110


 Score = 57.8 bits (138),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL V E  +  +H K + L A  +   +    L++DG  ++E    A +NI +++VLP
Sbjct  119  EGKLFVLEAAKADTH-KTKALAAQLKTLGLTS-ALIIDGANLDETFVRAARNIPHLDVLP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  D LV++R+AV ++  R+
Sbjct  177  EQGANVYDILRRDVLVLTRNAVEQLEARL  205



>ref|WP_020695007.1| 50S ribosomal protein L4 [Reyranella massiliensis]
Length=206

 Score = 62.0 bits (149),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMP-KKVLLVDGGPINENLKLATQNIHYVNVL  392
            EGKL+V +   LP   +P+T        ++    VL++ G  ++ N   A  NI +V+VL
Sbjct  119  EGKLIVVDAATLP---EPKTAKLKGHFGKLGISSVLVIAGAEVDTNFARAAANIAHVDVL  175

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            P  G NVY IL  DTLV+++DAV  + ER+ 
Sbjct  176  PQQGANVYDILRRDTLVLTKDAVKHLEERLQ  206


 Score = 58.9 bits (141),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE++ T +K Y QKGTGRARHG    PQFRGG     P  RSHA+  L KKV +L L+
Sbjct  54   SEITATAKKMYAQKGTGRARHGNEAAPQFRGGGKAFGPVVRSHAS-DLPKKVRQLALR  110



>ref|WP_012227956.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus]
 ref|YP_001603634.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 ref|YP_002277312.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 sp|A9H3R2.1|RL4_GLUDA RecName: Full=50S ribosomal protein L4 [Gluconacetobacter diazotrophicus 
PA1 5]
 emb|CAP57346.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PA1 
5]
 gb|ACI52697.1| ribosomal protein L4/L1e [Gluconacetobacter diazotrophicus PA1 
5]
Length=204

 Score = 66.2 bits (160),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQ+R G A+H P  R H    L KKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGSARQGSLRAPQYRTGGAVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAAEG  120


 Score = 54.7 bits (130),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 45/89 (51%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +       T        A  W   K  L+VD   + EN   A +N+  ++ LP
Sbjct  119  EGKLVVLDAATASGRTSELAAKVKALGW---KSALIVDA-TVEENFGRAARNLPKIDALP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD L ++R  V  + ER+
Sbjct  175  TIGANVYDILNHDVLAITRAGVEGLKERL  203



>ref|WP_014392635.1| 50S ribosomal protein L4 [Candidatus Rickettsia amblyommii]
 ref|YP_005365762.1| 50S ribosomal protein L4 [Candidatus Rickettsia amblyommii str. 
GAT-30V]
 gb|AFC70130.1| 50S ribosomal protein L4 [Candidatus Rickettsia amblyommii str. 
GAT-30V]
Length=207

 Score = 64.7 bits (156),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            SEV GT +KP+ QKGTG AR G+LR  Q RGG   H P+ RSHAT  L KKV +LGL
Sbjct  55   SEVLGTTKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHAT-TLPKKVRKLGL  110


 Score = 55.8 bits (133),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRT--L*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V + ++L    KP+T  L  +  K++  K   ++DG  ++ N  LA +NI+   +
Sbjct  120  EGKLLVIDSLKLD---KPKTAALVNILNKFQ-GKSFFVIDGNEVDINFSLAAKNIYNTVI  175

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +P IG NVY I+ H+ +++S+ AV+ + ER+
Sbjct  176  VPQIGANVYDIIRHEYILLSQAAVSVLEERL  206



>ref|WP_028466778.1| 50S ribosomal protein L4 [Nisaea denitrificans]
Length=205

 Score = 62.4 bits (150),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = -2

Query  806  RKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKL  627
            R+A   A +T+ S+VSGT +KP+ QKGTGRAR G+LR  Q+RGG   H P  R H    L
Sbjct  43   RRAGTHATKTV-SQVSGTTKKPFKQKGTGRARAGSLRATQYRGGGISHGPMSRDHG-FAL  100

Query  626  NKKVCRLGLKLDCFVSSCSRGKAHG  552
             KKV +LG++     S+ S  +A G
Sbjct  101  PKKVRKLGMR-----SALSAKQAEG  120


 Score = 57.8 bits (138),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +D    + TK       A  W     VL + G  ++E    A +NI  V+VLP
Sbjct  119  EGKLIVIDDAAGETKTKELAKKLTALGW---NSVLFIGGSALDEGFARAARNIPNVDVLP  175

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              G NVY IL  DTLV+++ AV  +  R+
Sbjct  176  EQGANVYDILRRDTLVLTKAAVESLEARL  204



>ref|WP_017670445.1| MULTISPECIES: 50S ribosomal protein L4 [Sphingomonadaceae]
Length=208

 Score = 72.0 bits (175),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L+V +  ++ +  K +TL A   K  + KK L +DG  +N+N K A+ N+  +NVLP++G
Sbjct  122  LIVVDTFDI-TEAKTKTLLAQLGKLGLGKKALFIDGDAVNDNFKKASANLIGLNVLPAVG  180

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  181  ANVYDILKHDTLVLTRAAVEKLEARFN  207


 Score = 47.8 bits (112),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  R P F GG   H P+ R      LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRRAPIFIGGGKAHGPRVRDF-NPSLNKKVRALGLKM  111



>ref|WP_011909486.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides]
 ref|YP_001168726.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides ATCC 17025]
 sp|A4WVK7.1|RL4_RHOS5 RecName: Full=50S ribosomal protein L4 [Rhodobacter sphaeroides 
ATCC 17025]
 gb|ABP71421.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides ATCC 17025]
Length=206

 Score = 65.1 bits (157),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V ED+ + S  K   L A A K    K+VL++DG  INEN   A +N+  ++VLPS
Sbjct  120  GNLIVIEDIAM-SEAKTALL-AKAVKELGWKRVLVIDGADINENFAKAARNLEGIDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV+++  V  +  R+
Sbjct  178  IGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 54.7 bits (130),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   LNKK   LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAH-DLNKKFRALGLK  110



>ref|WP_037499788.1| 50S ribosomal protein L4 [Sphingomonas jaspsi]
Length=209

 Score = 70.1 bits (170),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V ED+++    K + L A   K    K  L++DG  +N     A+ N+  +N+LP+
Sbjct  120  GNLIVLEDLDMGKEAKTKALQAKLGKLGFGKTALVIDGDALNVGFARASSNLEGLNLLPA  179

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            IG NVY I+ H+TLV++R AV ++  R +
Sbjct  180  IGANVYDIMRHETLVLTRAAVEKLEARFN  208


 Score = 50.1 bits (118),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  R P F GG   H P+ R   T  LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRRAPIFIGGGKAHGPRARVF-TSSLNKKVRALGLKM  111



>ref|WP_014746146.1| 50S ribosomal protein L4 [Tistrella mobilis]
 ref|YP_006372053.1| 50S ribosomal protein L4P [Tistrella mobilis KA081020-065]
 gb|AFK54469.1| 50S ribosomal protein L4P [Tistrella mobilis KA081020-065]
Length=207

 Score = 60.1 bits (144),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE++G+  K Y QKGTGRARHG  R   FRGG  +H P  RSHA   L KKV RL LK
Sbjct  54   SEIAGSTAKIYRQKGTGRARHGAKRANIFRGGATVHGPVVRSHAH-DLPKKVRRLALK  110


 Score = 59.7 bits (143),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL+V ++++     K + L A   K  +    L + G  +++  +LA +N+  ++VLPS
Sbjct  120  GKLVVVDELK-ADDAKTKALVARLEKAGLGSSTLFIGGTEVDQGFRLAARNLIGIDVLPS  178

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
             G NVY IL  DTLV+SR AV  +  R+
Sbjct  179  QGANVYDILRRDTLVLSRAAVESLEARL  206



>ref|WP_002722493.1| MULTISPECIES: 50S ribosomal protein L4 [Rhodobacter]
 ref|YP_351764.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides 2.4.1]
 ref|YP_001042250.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides ATCC 17029]
 ref|YP_002524376.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides KD131]
 sp|Q3J5S1.1|RL4_RHOS4 RecName: Full=50S ribosomal protein L4 [Rhodobacter sphaeroides 
2.4.1]
 sp|A3PGL2.1|RL4_RHOS1 RecName: Full=50S ribosomal protein L4 [Rhodobacter sphaeroides 
ATCC 17029]
 sp|B9KL92.1|RL4_RHOSK RecName: Full=50S ribosomal protein L4 [Rhodobacter sphaeroides 
KD131]
 gb|ABA77863.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides 2.4.1]
 gb|ABN75478.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides ATCC 17029]
 gb|ACL99874.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides KD131]
 gb|EGJ23168.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides WS8N]
 gb|EKX57642.1| LSU ribosomal protein L4p (L1e) [Rhodobacter sp. AKP1]
Length=206

 Score = 65.1 bits (157),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V ED+ L +  K   L A A K    K+VL++DG  INEN   A +N+  V+VLPS
Sbjct  120  GNLIVLEDIAL-AEGKTAML-AKAVKELGWKRVLVIDGADINENFAKAARNLEGVDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV+++  V  +  R+
Sbjct  178  IGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 54.7 bits (130),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   LNKK   LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAH-DLNKKFRALGLK  110



>ref|WP_008853156.1| 50S ribosomal protein L4 [Commensalibacter intestini]
 gb|EHD14234.1| 50S ribosomal protein L4 [Commensalibacter intestini A911]
Length=204

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KP+ QKGTG AR G+LRGP FR G  +H P  R H    L K++ RLGL +  
Sbjct  55   EVSGTTKKPFRQKGTGNARQGSLRGPHFRTGGVVHGPVVRDHGY-SLPKQIRRLGL-ISA  112

Query  587  FVSSCSRGK  561
                 S GK
Sbjct  113  LSQKLSEGK  121


 Score = 57.0 bits (136),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +     + T           W   K  L+VD   ++EN   A +NIH V++LP
Sbjct  119  EGKLVVIDQANGVAKTAELAAKLKVLGW---KSALIVDT-AVDENFGHAVRNIHSVDILP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL H+ L ++R AV+ + ER+
Sbjct  175  TIGANVYDILNHEVLAITRAAVDGLKERL  203



>ref|WP_033921122.1| 50S ribosomal protein L4 [Sphingomonas sp. 37zxx]
Length=208

 Score = 72.4 bits (176),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (62%), Gaps = 1/89 (1%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V +D+++ +  K + L          K  L++DG  + +   LAT+N+ Y+NV+P+
Sbjct  120  GTLVVLDDLKV-AEAKTKVLQGAWAAMGFGKTALVIDGDAVEDGFALATRNLSYINVMPA  178

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            +G NVY IL HDTLV++R AV ++  R H
Sbjct  179  MGANVYDILKHDTLVLTRAAVEKLEARFH  207


 Score = 47.0 bits (110),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 44/82 (54%), Gaps = 9/82 (11%)
 Frame = -2

Query  815  ILHRKASLK-------AQQTLE-SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHV  660
            ILHR  + +       A+ T E SEV+ TG+K   QKG G ARHG  R P F GG   H 
Sbjct  31   ILHRVVTWQLHNRRGTARPTRERSEVARTGKKFGRQKGGGTARHGDRRAPIFIGGGKAHG  90

Query  659  PKPRSHATIKLNKKVCRLGLKL  594
             + R      LNKKV  LGLK+
Sbjct  91   ARLRDFDN-SLNKKVRALGLKM  111



>ref|WP_008828237.1| MULTISPECIES: 50S ribosomal protein L4 [Sphingomonadaceae]
 gb|EJU14458.1| 50S ribosomal protein L4 [Sphingomonas sp. LH128]
 gb|EZP80385.1| 50S ribosomal protein L4 [Novosphingobium resinovorum]
Length=208

 Score = 70.9 bits (172),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L++ + +++ +  K + L     K    KKVL++DG  +NE   LA +NI  VNVLP++G
Sbjct  122  LVIVDSLDV-ADAKTKALAGQLAKANFGKKVLVMDGDQVNEGFALAARNIVGVNVLPAVG  180

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  181  ANVYDILKHDTLVLTRAAVEKLEARFN  207


 Score = 48.1 bits (113),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  818  TILHRKASLK-------AQQTLE-SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMH  663
             ILHR  + +       A+ T E SEV+ TG+K   QKG G ARHG    P F GG   H
Sbjct  31   DILHRVVTWQLENRRGIARATRERSEVARTGKKFGNQKGGGTARHGDRAAPVFIGGGKAH  90

Query  662  VPKPRSHATIKLNKKVCRLGLKL  594
              + R    I LNKK+  LGLK+
Sbjct  91   GARRREF-NISLNKKIRALGLKM  112



>ref|WP_035406792.1| 50S ribosomal protein L4 [Bacillus sp. SJS]
 gb|KEZ57059.1| 50S ribosomal protein L4 [Bacillus sp. SJS]
Length=207

 Score = 70.9 bits (172),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -2

Query  815  ILHRKASLK---AQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRS  645
            ++ ++ASL+   A+    SEV G GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS
Sbjct  37   VIMQRASLRQGNAKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRS  96

Query  644  HATIKLNKKVCRLGLK  597
            +A  KL KKV RL +K
Sbjct  97   YAY-KLPKKVRRLAIK  111


 Score = 47.8 bits (112),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            + K++V ED+ L +  K + + ++ +   + KK L+V    +NE + L+ +NI  + V+ 
Sbjct  120  DSKIVVLEDLTLDA-VKTKEMASILKAISVEKKALIVTA-DVNEKVSLSARNIQGITVVA  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NV  +L H+ L+M++ AV ++ E
Sbjct  178  ADGINVLDVLNHEKLIMTKAAVQKVEE  204



>ref|WP_029421879.1| 50S ribosomal protein L4 [Alicyclobacillus macrosporangiidus]
Length=206

 Score = 63.9 bits (154),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV G GRKP+ QKGTGRAR G++R PQ++GG  +  PKPRS+A  ++ KKV R  L   
Sbjct  55   SEVRGGGRKPWRQKGTGRARQGSIRAPQWKGGGVVFGPKPRSYA-FRVPKKVRRQAL-YS  112

Query  590  CFVSSCSRGK  561
               S    GK
Sbjct  113  ALTSKVDGGK  122


 Score = 54.7 bits (130),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = -3

Query  565  GKLMVFEDMELPS-HTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            GKL+V +++ +P   TKP  + AM R+  + +K L+VD     +N +L+ +NI  V  +P
Sbjct  121  GKLIVLDELRVPEIKTKP--MVAMLRRLNL-EKALIVDA-EKQQNAELSLRNIPGVTYVP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            +  +NVY IL HD LV++RDAV ++ E
Sbjct  177  ANAVNVYEILRHDHLVLTRDAVAKVQE  203



>ref|WP_031934484.1| 50S ribosomal protein L4 [Candidatus Hepatobacter penaei]
Length=205

 Score = 69.3 bits (168),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S VSGT RKPY QKGTGRAR G+LR PQFRGG  +  P+ RSHA   L K+V RLGL +
Sbjct  54   SNVSGTTRKPYKQKGTGRARQGSLRSPQFRGGGIIFGPQVRSHAH-ALPKRVRRLGLSV  111


 Score = 49.3 bits (116),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            E KL+V + +   SH K + +      W+   ++L V  G  +     A +N+  VN+LP
Sbjct  119  EQKLVVVDALTFASH-KTQKIDQCLSSWQ--GRLLFVAAGEPDAQFVRAVRNLWRVNILP  175

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              GLNVY IL HD +++ + A+  + ER+
Sbjct  176  EKGLNVYDILRHDYIMVEKPAIKSLEERL  204



>gb|AHC73384.1| 50S ribosomal protein L4 [Candidatus Endolissoclinum faulkneri 
L5]
Length=206

 Score = 64.3 bits (155),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SE+SGT +KP+ QKGTGRAR G++R   FRGG  +H P  RSH   +L KK  +LGLK+
Sbjct  54   SEISGTTKKPFRQKGTGRARQGSMRTTHFRGGQTVHGPVVRSHK-YQLTKKFRKLGLKI  111


 Score = 54.3 bits (129),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 10/94 (11%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMAR----KWRMPKKVLLVDGGPINENLKLATQNIHYV  401
            +GKL+V ++    S  +P+T    AR     W     VL++DGG +N+N   A +NI  V
Sbjct  119  DGKLVVIDE---ASADRPKTKPLAARFKLLGWL---SVLVIDGGVLNKNFAYAVRNIPLV  172

Query  400  NVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            ++LP  G NVY IL  +TLV+++ AV ++  R+ 
Sbjct  173  DLLPQQGANVYDILRRETLVLTKVAVEQLEIRLR  206



>gb|AIH04237.1| 50S ribosomal protein L4 [Thermodesulfobacterium commune DSM 
2178]
Length=210

 Score = 78.6 bits (192),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV G GRKP+PQK TGRAR G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+  
Sbjct  58   EVRGGGRKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-A  115

Query  587  FVSSCSRGKAHGF*GYGTTFSHKTKNIVSY  498
              S     K     G+      KTK + SY
Sbjct  116  LSSRALTNKLFVAEGFPVVEKPKTKLLKSY  145


 Score = 39.7 bits (91),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  433  LKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            L+ +  N+  V VL   GLNVY IL H+ L++S++A+++I ER+ 
Sbjct  165  LEKSASNLPKVKVLAVEGLNVYDILNHENLIISKEALDKIEERLR  209



>ref|WP_034335761.1| 50S ribosomal protein L4 [Commensalibacter sp. MX01]
 gb|EUK18170.1| 50S ribosomal protein L4 [Commensalibacter sp. MX01]
Length=204

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            +EVSGT +KP+ QKGTG AR G+LRGP FR G  +H P  R H    L KKV  LGL + 
Sbjct  54   AEVSGTKKKPFRQKGTGNARQGSLRGPHFRTGGVVHGPVVRDHGY-DLPKKVRTLGL-IS  111

Query  590  CFVSSCSRGK  561
                  S GK
Sbjct  112  ALSQKLSEGK  121


 Score = 56.2 bits (134),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL++ +     + T           W      L+VD   ++EN   A +NIH V++LP
Sbjct  119  EGKLVILDQASGVAKTSELAAKLKVLGW---TSALIVDT-TVDENFGHAIRNIHSVDILP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD L ++R AV+ + ER+
Sbjct  175  TIGANVYDILNHDVLAITRAAVDGLKERL  203



>ref|WP_022734147.1| 50S ribosomal protein L4 [Thalassospira lucentensis]
Length=206

 Score = 64.3 bits (155),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARK--WRMPKKVLLVDGGPINENLKLATQNIHYVNV  395
            +GKL+V ++ E  S  K ++L A+  K  W   K  L++DG  +NE    A +NI  ++V
Sbjct  119  DGKLIVLDNAEF-SDAKTKSLVAVFNKLGW---KSALIIDGTQVNEGFARAARNIPQIDV  174

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            LP IG NVY IL  DTLV+++ AV  +  R+
Sbjct  175  LPEIGANVYDILRRDTLVLTKGAVEALEARL  205


 Score = 53.9 bits (128),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+S T +K   QKG+G ARHG+ +  QFRGG  +H P+ R HA   L KK  +L LK
Sbjct  54   SEISATTKKFVRQKGSGGARHGSRKAAQFRGGGVVHGPRVRDHAH-DLTKKFRKLALK  110



>ref|WP_021233445.1| 50S ribosomal protein L4 [Novosphingobium lindaniclasticum]
 gb|EQB17697.1| 50S ribosomal protein L4 [Novosphingobium lindaniclasticum LE124]
Length=208

 Score = 71.6 bits (174),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -3

Query  559  LMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIG  380
            L++ + +++ S  K + L     K    KKVL++DG  +NE   LA +NI  VNVLP++G
Sbjct  122  LVIVDSLDV-SDAKTKALAGQLAKANFGKKVLVMDGEQVNEGFALAARNIVGVNVLPAVG  180

Query  379  LNVYSILLHDTLVMSRDAVNRIVERMH  299
             NVY IL HDTLV++R AV ++  R +
Sbjct  181  ANVYDILKHDTLVLTRAAVEKLEARFN  207


 Score = 46.6 bits (109),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  818  TILHRKASLK-------AQQTLE-SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMH  663
             ILHR  + +       A+ T E S+V+ TG+K   QKG G ARHG    P F GG   H
Sbjct  31   DILHRVVTWQLENRRGIARATRERSDVARTGKKFGRQKGGGTARHGDRAAPVFIGGGKAH  90

Query  662  VPKPRSHATIKLNKKVCRLGLKL  594
              + R    I LNKK+  LGLK+
Sbjct  91   GARRREF-NISLNKKIRALGLKM  112



>ref|XP_009515921.1| hypothetical protein PHYSODRAFT_552366 [Phytophthora sojae]
 gb|EGZ28646.1| hypothetical protein PHYSODRAFT_552366 [Phytophthora sojae]
Length=277

 Score = 59.7 bits (143),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVSG+ RKP+ QKG+GRAR G +R PQ+RGG  +H P  R   +  L KKV  +GL++
Sbjct  123  SEVSGSTRKPWKQKGSGRARVGDIRAPQWRGGYRVHGPVLRDF-SYNLPKKVRAMGLRV  180


 Score = 58.5 bits (140),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELP-SHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVL  392
            EGKL V + +++  + TK        R W      L V G  +  +  LAT+NI YV+ L
Sbjct  188  EGKLAVVDSLDVDVTKTKDMKKLLGGRGW---DHALFVGGEEVESSFVLATRNIPYVDTL  244

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            P   +NVYSIL  D L++++DAV  + ER+H
Sbjct  245  PQNKINVYSILQKDLLIITKDAVKYLEERLH  275



>ref|WP_009574005.1| 50S ribosomal protein L4 [Celeribacter baekdonensis]
 gb|EKE67645.1| 50S ribosomal protein L4 [Celeribacter baekdonensis B30]
Length=206

 Score = 65.9 bits (159),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L++ ED +L +  K   L A A K +  K+VL++DG  I+ N K A  NI  V++LP+
Sbjct  120  GNLVILEDAKL-AEAKTAFL-AKAIKEQGWKRVLIIDGAEIDANFKAAAANIAGVDILPT  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV++R AV  +  R+
Sbjct  178  MGANVYDILKRDTLVLTRSAVEALEARL  205


 Score = 52.4 bits (124),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSH   +L KK  +LGLK
Sbjct  54   SEVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHGH-ELTKKFRKLGLK  110



>ref|WP_023943129.1| 50S ribosomal protein L4 [Gluconobacter frateurii]
 dbj|GAD09794.1| 50S ribosomal protein L4 [Gluconobacter frateurii NBRC 103465]
Length=204

 Score = 63.9 bits (154),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            E+SGT +KP+ QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL    
Sbjct  55   EISGTTKKPFRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAADG  120


 Score = 53.9 bits (128),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +     S T+       A  W      L+VDG  ++E    A  N+  ++VLP
Sbjct  119  DGKLVVLDTANGVSKTREAAAKLKALGW---SSALIVDG-AVDEQFARAVANLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  + ER+
Sbjct  175  TIGANVYDILNHDVLVITRAGLEGLKERL  203



>ref|WP_007282722.1| MULTISPECIES: 50S ribosomal protein L4 [Gluconobacter]
 ref|YP_006984502.1| protein RplD [Gluconobacter oxydans H24]
 gb|AFW01571.1| RplD [Gluconobacter oxydans H24]
 dbj|GAC87544.1| 50S ribosomal protein L4 [Gluconobacter thailandicus NBRC 3255]
 dbj|GAD25496.1| 50S ribosomal protein L4 [Gluconobacter thailandicus NBRC 3257]
Length=204

 Score = 64.3 bits (155),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            E+SGT +KP+ QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL    
Sbjct  55   EISGTTKKPFRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAADG  120


 Score = 53.9 bits (128),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +     S T+       A  W      L+VDG  ++E    A  N+  ++VLP
Sbjct  119  DGKLIVLDTANGVSKTREAAAKLKALGW---SSALIVDG-AVDEQFARAIANLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  + ER+
Sbjct  175  TIGANVYDILNHDVLVITRAGLEGLKERL  203



>ref|WP_038062588.1| 50S ribosomal protein L4 [Thermodesulfobacterium commune]
Length=202

 Score = 78.2 bits (191),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV G GRKP+PQK TGRAR G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+  
Sbjct  50   EVRGGGRKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-A  107

Query  587  FVSSCSRGKAHGF*GYGTTFSHKTKNIVSY  498
              S     K     G+      KTK + SY
Sbjct  108  LSSRALTNKLFVAEGFPVVEKPKTKLLKSY  137


 Score = 39.7 bits (91),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  433  LKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            L+ +  N+  V VL   GLNVY IL H+ L++S++A+++I ER+ 
Sbjct  157  LEKSASNLPKVKVLAVEGLNVYDILNHENLIISKEALDKIEERLR  201



>ref|XP_002066858.1| GK24328 [Drosophila willistoni]
 gb|EDW77844.1| GK24328 [Drosophila willistoni]
Length=296

 Score = 59.7 bits (143),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVNVL  392
            +  L + E  ++P+ T+P+ +  +  + +    VL+VD   I  EN+  AT  + +VN++
Sbjct  187  QDDLHIIESTDIPT-TEPQFIKDLIDERQWGPSVLIVDKADIFPENICYATDELGFVNLM  245

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            P+ GLNVYS+L HDTLV++ DAV  + +R+   ++R
Sbjct  246  PTFGLNVYSMLKHDTLVLTVDAVKHLEQRLLYQLHR  281


 Score = 58.2 bits (139),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  809  HRKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +R  S+   +T  +EV G GRKP+PQKG GRARHG++R P F+GG  +H P+ P +H
Sbjct  109  YRYVSMAHAKT-RAEVRGGGRKPWPQKGQGRARHGSIRSPLFKGGGVIHGPRSPTTH  164



>ref|WP_028843121.1| 50S ribosomal protein L4 [Thermodesulfobacterium thermophilum]
Length=202

 Score = 78.6 bits (192),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV G GRKP+PQK TGRAR G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+  
Sbjct  50   EVRGGGRKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRSY-EFKLNKKVRRLGLKM-A  107

Query  587  FVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKM  486
              S     K     G+      KTK + SY + +
Sbjct  108  LSSRALTNKIFVAEGFPVAEQPKTKLLKSYLETL  141


 Score = 39.3 bits (90),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = -3

Query  442  NENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            N  L+ +  N+  V VL   GLNVY IL H+ L++S++A+ +I ER+ 
Sbjct  154  NLTLEKSASNLPKVKVLAVEGLNVYDILNHENLIVSKEALEKIEERLR  201



>ref|XP_002001866.1| GI14673 [Drosophila mojavensis]
 gb|EDW11308.1| GI14673 [Drosophila mojavensis]
Length=911

 Score = 59.7 bits (143),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKP--RTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVN  398
            +  L + ED+E+P+      R L    R W     VL+VD   +  EN+  AT +I YVN
Sbjct  802  QDDLHIIEDVEIPTKDAQFIRDL-IQERNWG--PSVLIVDKHDVFPENICYATDSIGYVN  858

Query  397  VLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            ++P+ GLNVYS+L HDTLV++ +AV  + ER+
Sbjct  859  LMPAYGLNVYSMLKHDTLVLTVEAVKHLEERL  890


 Score = 58.2 bits (139),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +EV G GRKP+PQKG GRARHG++R P F+GG  +H P+ P +H
Sbjct  736  AEVRGGGRKPWPQKGMGRARHGSIRSPLFKGGGVIHGPRSPTTH  779



>ref|WP_010502124.1| 50S ribosomal protein L4 [Gluconobacter frateurii]
Length=204

 Score = 64.3 bits (155),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            E+SGT +KP+ QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL    
Sbjct  55   EISGTTKKPFRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAADG  120


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +     S T+       A  W      L+VDG  ++E    A  N+  ++VLP
Sbjct  119  DGKLVVLDTANGVSKTREAVAKLKALGW---SSALIVDG-AVDEQFARAVANLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  + ER+
Sbjct  175  TIGANVYDILNHDVLVITRAGLEGLKERL  203



>ref|WP_029604136.1| 50S ribosomal protein L4 [Kozakia baliensis]
Length=204

 Score = 65.1 bits (157),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            E+SGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL    
Sbjct  55   EISGTTKKPYRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YNLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAADG  120


 Score = 52.8 bits (125),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +     + T+       A  W      L+VD   ++EN   A +N+  ++VLP
Sbjct  119  DGKLVVLDTASGVTKTREAVAKLRALGW---SSALIVDA-TVDENFGRAVRNLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  + ER+
Sbjct  175  TIGANVYDILNHDVLVLTRAGLEGLKERL  203



>ref|WP_007011871.1| MULTISPECIES: 50S ribosomal protein L4 [Novosphingobium]
 ref|YP_004534390.1| 50S ribosomal protein L4 [Novosphingobium sp. PP1Y]
 emb|CCA92572.1| large subunit ribosomal protein L4 [Novosphingobium sp. PP1Y]
 gb|EHJ62359.1| large subunit ribosomal protein L4 [Novosphingobium pentaromativorans 
US6-1]
 gb|AIT81055.1| 50S ribosomal protein L4 [Novosphingobium pentaromativorans US6-1]
Length=207

 Score = 70.9 bits (172),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -3

Query  535  LPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILL  356
            L    K + L     K    KKVL++DG  +N+N   A +NI  VNVLP++G NVY IL 
Sbjct  128  LDGEAKTKALAGQLAKAGFGKKVLVIDGEAVNDNFARAARNIVGVNVLPAVGANVYDILK  187

Query  355  HDTLVMSRDAVNRIVERMH  299
            HDTLV++R AV ++  R +
Sbjct  188  HDTLVLTRAAVEKLEARFN  206


 Score = 47.0 bits (110),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  818  TILHRKASLK-------AQQTLE-SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMH  663
             ILHR  + +       A+ T E S+V+ TG+K   QKG G ARHG    P F GG   H
Sbjct  31   DILHRVVTWQLENRRGIARATRERSDVARTGKKWGRQKGGGTARHGDRAAPVFIGGGKAH  90

Query  662  VPKPRSHATIKLNKKVCRLGLKL  594
              + R    I LNKK+  LGLK+
Sbjct  91   GARRREF-NISLNKKIRALGLKM  112



>ref|XP_001988917.1| GH11428 [Drosophila grimshawi]
 gb|EDW03784.1| GH11428 [Drosophila grimshawi]
Length=923

 Score = 58.9 bits (141),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = -3

Query  559  LMVFEDMELPSHTKP--RTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVNVLP  389
            L + E++ELP+      R L A  R W     VL++D   +  EN+  AT +I YVN++P
Sbjct  817  LHIIENVELPTRDAQFIRDLIA-ERNWG--PSVLIIDKQEMFPENICYATDSIGYVNLMP  873

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            S GLNVYS+L HDTLV++ +AV  + +R+
Sbjct  874  SFGLNVYSMLKHDTLVLTVEAVKHLEQRL  902


 Score = 58.5 bits (140),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +EV G GRKP+PQKG GRARHG++R P F+GG  +H P+ P SH
Sbjct  748  AEVRGGGRKPWPQKGMGRARHGSIRSPLFKGGGIVHGPRSPTSH  791



>ref|WP_038144446.1| 50S ribosomal protein L4 [Thioclava sp. 13D2W-2]
 gb|KFE36159.1| 50S ribosomal protein L4 [Thioclava sp. 13D2W-2]
Length=206

 Score = 65.9 bits (159),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V +D  L +  K + L A A K    KKVL++DG  +NEN   A +NI  ++VLPS
Sbjct  120  GNLVVLDDATL-AEAKTKLL-AKAAKELGWKKVLVIDGAEVNENFAQAARNIEGIDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV+++  V  +  R+
Sbjct  178  MGANVYDILKRDTLVLTKAGVEALEARL  205


 Score = 52.0 bits (123),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  53   KSEVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGVYKGPTPRSHAH-DLPKKFRALGLK  110



>ref|WP_035745972.1| 50S ribosomal protein L4 [Haematobacter missouriensis]
 gb|KFI27625.1| 50S ribosomal protein L4 [Haematobacter missouriensis]
Length=206

 Score = 65.5 bits (158),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V +  EL +  K   L A A K    K+VL++DG  +NEN   A +NI  +++LP
Sbjct  119  DGKLVVIDSAEL-AEAKTAQL-AKAAKDLGWKRVLIIDGAEVNENFAKAARNIEGIDILP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL  DTLV+++  V  +  R+
Sbjct  177  TIGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 52.0 bits (123),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKFRALGLK  110



>ref|XP_002051745.1| GJ17161 [Drosophila virilis]
 gb|EDW63900.1| GJ17161 [Drosophila virilis]
Length=298

 Score = 59.7 bits (143),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  809  HRKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +R  S+   +T  +EV G GRKP+PQKG GRARHG++R P F+GG  +H P+ P SH
Sbjct  111  YRYVSMAHTKT-RAEVRGGGRKPWPQKGMGRARHGSIRSPLFKGGGVVHGPRSPTSH  166


 Score = 57.8 bits (138),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPIN-ENLKLATQNIHYVNVL  392
            +  L + E++E+P+    + +  + ++      VL++D   I  EN+  AT  + YVN++
Sbjct  189  QDDLHIIENVEIPTRDA-QFIKDLIQERNWGPSVLIIDKQDIFPENICYATDTLGYVNLM  247

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            P+ GLNVYS+L HDTLV++ DAV  + ER+   ++R
Sbjct  248  PAFGLNVYSMLKHDTLVLTVDAVKHLEERLLFQLHR  283



>ref|WP_028718451.1| 50S ribosomal protein L4 [Paracoccus yeei]
Length=206

 Score = 63.9 bits (154),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +NI  V+VLPSIG NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNIEGVDVLPSIGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPTFRHGGTYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_011983246.1| 50S ribosomal protein L4 [Bacillus cytotoxicus]
 ref|YP_001373474.1| 50S ribosomal protein L4 [Bacillus cytotoxicus NVH 391-98]
 sp|A7GK21.1|RL4_BACCN RecName: Full=50S ribosomal protein L4 [Bacillus cytotoxicus 
NVH 391-98]
 gb|ABS20479.1| ribosomal protein L4/L1e [Bacillus cytotoxicus NVH 391-98]
Length=207

 Score = 70.9 bits (172),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEVSG GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS+A  KL KKV RL +K
Sbjct  55   SEVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAY-KLPKKVRRLAIK  111


 Score = 46.6 bits (109),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            E  ++V ED+ L +  K + + A+ +   + KK L+V    +NE ++L+ +NI  V V+ 
Sbjct  120  ENNIVVLEDLVL-NAPKTKDMVAVLKGLAVEKKALIVTA-DVNEAVELSARNIPGVTVIT  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NV  +L HD L+M++ AV ++ E
Sbjct  178  ADGVNVLDVLHHDKLIMTKAAVEKVEE  204



>ref|WP_038073541.1| 50S ribosomal protein L4 [Thioclava pacifica]
 gb|KEO55373.1| 50S ribosomal protein L4 [Thioclava pacifica DSM 10166]
Length=206

 Score = 65.5 bits (158),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL+V +D  + +  K + L A A K    KKVL++DG  +NEN   A +NI  ++VLPS
Sbjct  120  GKLVVLDDAVM-AEAKTQLL-AKAAKELGWKKVLVIDGAEVNENFAKAARNIEGIDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV+++  V  +  R+
Sbjct  178  MGANVYDILKRDTLVLTKAGVEALEARL  205


 Score = 52.0 bits (123),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  53   KSEVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGVYKGPTPRSHAH-DLPKKFRALGLK  110



>ref|WP_011251965.1| 50S ribosomal protein L4 [Gluconobacter oxydans]
 ref|YP_190818.1| 50S ribosomal protein L4 [Gluconobacter oxydans 621H]
 sp|Q5FTY4.1|RL4_GLUOX RecName: Full=50S ribosomal protein L4 [Gluconobacter oxydans 
621H]
 gb|AAW60162.1| LSU ribosomal protein L4P [Gluconobacter oxydans 621H]
 gb|AHK70316.1| 50S ribosomal protein L4 [Gluconobacter oxydans DSM 3504]
Length=204

 Score = 63.5 bits (153),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            E+SGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL
Sbjct  55   EISGTTKKPYRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL  109


 Score = 53.9 bits (128),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +     + T+       A  W      L+VDG  ++E    A  N+  ++VLP
Sbjct  119  EGKLIVLDAANGVTKTREAAAKIKALGW---TSALIVDG-AVDEQFARAIANLPKIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL HD LV++R  +  + ER+
Sbjct  175  TIGANVYDILNHDVLVITRAGLEGLKERL  203



>ref|WP_018084549.1| 50S ribosomal protein L4 [Desulfurispora thermophila]
Length=210

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV G GRKP+ QKGTGRARHG++R P +RGG  +  P PRS+  IK+NKK  RL ++  C
Sbjct  56   EVRGGGRKPWRQKGTGRARHGSIRSPIWRGGGTVFGPHPRSY-RIKINKKERRLAIR--C  112

Query  587  FVSS  576
             +S 
Sbjct  113  ALSD  116


 Score = 52.4 bits (124),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  481  MPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVE  308
            M +K L+V  GP +EN+  + +NI  V  +P+  +NVY IL H TLVM+RDAV R+ E
Sbjct  150  MAQKALVVTAGP-DENVFKSARNIPGVKPIPTDNINVYDILKHGTLVMTRDAVARVEE  206



>ref|WP_019646044.1| 50S ribosomal protein L4 [Novispirillum itersonii]
Length=205

 Score = 64.3 bits (155),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SE+SGT +KP+ QKGTGRAR G+ R  QFRGG+ +  P  RSHA   L KK   LGLK
Sbjct  54   SEISGTTKKPFKQKGTGRARQGSTRSAQFRGGSTIFGPVVRSHAH-DLTKKFRALGLK  110


 Score = 52.8 bits (125),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL+V +       TK   +      W      L++DG  +N     A  NI  V+VLP+
Sbjct  120  GKLVVVDLESASGKTKDLAVQLKGLGW---GSALVIDGAEVNTLFARAAANIPGVDVLPT  176

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
             G NVY IL  DTLV+++ A+ ++ ER+
Sbjct  177  QGANVYDILRRDTLVLTKAAIEKLEERL  204



>ref|WP_036738939.1| 50S ribosomal protein L4 [Paracoccus halophilus]
 gb|KGJ05891.1| 50S ribosomal protein L4 [Paracoccus halophilus]
Length=206

 Score = 63.2 bits (152),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G+L+V E++++ +  K   + A A +    K+VL++DG  +NEN   A +N+  V+VLPS
Sbjct  120  GELVVVENLDI-AEAKTSAV-AKAVRENGWKRVLVIDGAEVNENFARAARNLEGVDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV++R  V  +  R+
Sbjct  178  MGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.9 bits (128),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSRKAPTFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_026962533.1| 50S ribosomal protein L4 [Alicyclobacillus herbarius]
Length=206

 Score = 63.9 bits (154),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLD  591
            SEV G GRKP+ QKGTGRAR G++R PQ++GG  +  PKPR +  +K+ KKV R  L   
Sbjct  55   SEVRGGGRKPWRQKGTGRARQGSIRAPQWKGGGVVFGPKPREY-KMKVPKKVRRAAL-YS  112

Query  590  CFVSSCSRGK  561
               S    GK
Sbjct  113  ALTSKVDEGK  122


 Score = 53.1 bits (126),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +++ELP   K + + A+ R+  + +K L+VD   +NE   L+ +N+  V  + 
Sbjct  120  EGKLIVLDNLELP-EIKTKHVVALLRQLNL-QKPLIVDA-EVNEKALLSARNLPDVKYVS  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NVY +L H  LV++RDAV ++ E
Sbjct  177  AGGVNVYDVLRHGHLVLTRDAVEKVQE  203



>ref|WP_005862784.1| 50S ribosomal protein L4 [Sagittula stellata]
 gb|EBA06208.1| 50S ribosomal protein L4 [Sagittula stellata E-37]
Length=205

 Score = 62.8 bits (151),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V + ++  S TK          W   K+ L++DG  +NEN   A +NI  ++VLP+
Sbjct  120  GALIVIDSIDGASKTKALAAQVSKLGW---KRALIIDGAEVNENFAKAARNIEGLDVLPT  176

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV+++  V  +  R+
Sbjct  177  IGANVYDILKRDTLVITKAGVEALEARL  204


 Score = 54.3 bits (129),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSHA  +L KKV  LGLK+
Sbjct  54   SEVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHAH-ELPKKVRALGLKM  111



>gb|EFA80316.1| hypothetical protein PPL_07147 [Polysphondylium pallidum PN500]
Length=318

 Score = 59.3 bits (142),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            + KL++ E++EL SH        +  +W    + LLVD   I+ NL LA  NI  +++LP
Sbjct  228  QNKLVIVENLELESHKTKDLDTLLPEQW---GRSLLVDK-EISSNLSLAGFNIKRIDLLP  283

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              GLNVYSIL  DTLV++R +++ I +R+
Sbjct  284  ERGLNVYSILQKDTLVLTRASLDEIQKRL  312


 Score = 57.8 bits (138),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            ++  T +KP+ QKGTGRAR GT    Q +GG     PKPR H+   L KKV RLGLK+
Sbjct  164  DIDRTNKKPFSQKGTGRARQGTNHAIQMKGGARAFPPKPRDHS-FSLPKKVRRLGLKV  220



>ref|WP_035714297.1| 50S ribosomal protein L4 [Haematobacter massiliensis]
 gb|KFI26275.1| 50S ribosomal protein L4 [Haematobacter massiliensis]
Length=206

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +GKL+V E  EL      +   A A K    K+VL++DG  +NEN   A +NI  +++LP
Sbjct  119  DGKLVVIESAELVEAKTAQL--AKAAKDLGWKRVLIIDGAEVNENFAKAARNIEGIDILP  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +IG NVY IL  DTLV+++  V  +  R+
Sbjct  177  TIGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 52.0 bits (123),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKFRALGLK  110



>ref|WP_028841346.1| 50S ribosomal protein L4 [Thermodesulfobacterium hveragerdense]
Length=202

 Score = 77.0 bits (188),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV G GRKP+PQK TGRAR G++R PQ+ GG  +H PKPRS+   KLNKKV RLGLK+  
Sbjct  50   EVRGGGRKPWPQKHTGRARQGSIRAPQWVGGGIVHGPKPRSY-EFKLNKKVRRLGLKM-A  107

Query  587  FVSSCSRGKAHGF*GYGTTFSHKTKNIVSYGQKM  486
              S     +     G+      KTK + SY + +
Sbjct  108  LSSRALTNRIFVAEGFPVAEQPKTKLLKSYLETL  141


 Score = 40.0 bits (92),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  442  NENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            N  L+ +  N+  V VL   GLNVY IL H+ L++S++A+++I ER+ 
Sbjct  154  NLTLEKSASNLPKVKVLAVEGLNVYDILNHENLIVSKEALDKIEERLR  201



>ref|WP_018131281.1| 50S ribosomal protein L4 [Effusibacillus pohliae]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEV G GRKP+ QKGTGRARHG++R PQ+ GG  +  P PRS+A  KL KKV RL LK
Sbjct  55   SEVRGGGRKPWRQKGTGRARHGSIRAPQWVGGGVVFGPTPRSYAY-KLPKKVRRLALK  111


 Score = 47.4 bits (111),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -3

Query  484  RMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVE  308
            +  KK LLVD G  N N +L+ +NI  V  + + G+NVY +L HD+LV+++DAV ++ E
Sbjct  147  KAAKKALLVDMGN-NVNAQLSARNIPGVKFVTATGINVYDLLNHDSLVITKDAVAKVEE  204



>ref|XP_004521834.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Ceratitis 
capitata]
Length=293

 Score = 58.5 bits (140),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +EV G GRKP+PQKG GRARHG++R P FRGG   H P+ P +H
Sbjct  118  AEVRGGGRKPWPQKGMGRARHGSIRSPLFRGGGVAHGPRSPTTH  161


 Score = 58.5 bits (140),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVNVL  392
            +  L + + +++P+   P     + ++      VL+VD   I  EN+  AT  + YVN++
Sbjct  184  QDDLHIIDSVDVPTR-DPEFFKELIKERNWGPSVLIVDKDDIFPENICYATDALGYVNLM  242

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            PS GLN+YS+L HDTLV++ +AV  I ER+   +NR
Sbjct  243  PSYGLNIYSMLKHDTLVLTVNAVKHIEERLLYQMNR  278



>ref|WP_020951882.1| 50S ribosomal protein L4 [Paracoccus aminophilus]
 ref|YP_008406077.1| 50S ribosomal protein L4 [Paracoccus aminophilus JCM 7686]
 gb|AGT10245.1| 50S ribosomal protein L4 [Paracoccus aminophilus JCM 7686]
Length=206

 Score = 62.0 bits (149),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPSIG NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLIIDGADVNENFARAARNLEGVDVLPSIGANVYDILRRDTLVITRAGVEALEARL  205


 Score = 54.7 bits (130),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 46/82 (56%), Gaps = 9/82 (11%)
 Frame = -2

Query  818  TILHRKASL---KAQQTL-----ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMH  663
             +LHR       KAQQ       +S+VS + +K Y QKGTG ARHG+ + P FR G    
Sbjct  30   DLLHRVVRWQRAKAQQGTHSVLGKSDVSYSTKKIYRQKGTGGARHGSRKAPIFRSGGVYK  89

Query  662  VPKPRSHATIKLNKKVCRLGLK  597
             P PRSHA   L KKV  LGLK
Sbjct  90   GPTPRSHA-FDLPKKVRALGLK  110



>ref|XP_006377175.1| hypothetical protein POPTR_0011s01580g, partial [Populus trichocarpa]
 gb|ERP54972.1| hypothetical protein POPTR_0011s01580g, partial [Populus trichocarpa]
Length=170

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -2

Query  815  ILHRKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHAT  636
            I+HR  +   +    SEVSGTGRKPY QK TGRAR+GTL  PQFRGG  MH PKP+SHA 
Sbjct  56   IIHRVGAHSTKTI--SEVSGTGRKPYRQKSTGRARYGTLCWPQFRGGAVMHGPKPQSHA-  112

Query  635  IKLNKKVCRLGLKLDCFVSSCSRGKA  558
            I+LNKKV RLGLK+    +  + GKA
Sbjct  113  IELNKKVRRLGLKI-ALSARAAEGKA  137



>ref|WP_022253576.1| 50S ribosomal protein L4 [Clostridium sp. CAG:505]
 emb|CDC27387.1| 50S ribosomal protein L4 [Firmicutes bacterium CAG:466]
 emb|CDD61626.1| 50S ribosomal protein L4 [Clostridium sp. CAG:505]
Length=206

 Score = 74.3 bits (181),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +EV G GRKP+ QKGTGRARHG++R PQ+ GG  +  PKPR + + KLNKKV RL L+
Sbjct  55   AEVRGGGRKPWRQKGTGRARHGSIRSPQWVGGGVVFAPKPRDY-SFKLNKKVKRLALQ  111


 Score = 42.4 bits (98),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGK++V +++ L +  K + +  +       K ++++DG   N N+ L+ +NI  V    
Sbjct  120  EGKIIVLDELNL-AEVKTKDMAKVLANINCGKALIVMDG--TNTNVMLSARNIPDVKTAS  176

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
               +NVY +L ++TLV+++DAV +I E
Sbjct  177  VSTINVYDLLKYNTLVVTKDAVAKIEE  203



>ref|WP_040953123.1| 50S ribosomal protein L4 [Paenibacillaceae bacterium G5]
Length=207

 Score = 67.8 bits (164),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = -2

Query  818  TILHRKASLKA---QQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPR  648
             ++ ++ASL+A   +    SEV G GRKP+ QKGTGRAR G++R PQ++GG  +  P PR
Sbjct  36   AVVMQQASLRAGTHKTKGRSEVRGGGRKPWKQKGTGRARQGSIRAPQWKGGGIVFGPTPR  95

Query  647  SHATIKLNKKVCRLGLK  597
            S+A  KL KKV RL +K
Sbjct  96   SYAY-KLPKKVRRLAIK  111


 Score = 48.1 bits (113),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -3

Query  520  KPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLV  341
            K + + A+ +  ++  + LLV G   NEN+ L+ +N+  V  + + GLNV  +LLHD L+
Sbjct  135  KTKDVVALLKNLKVESRALLVTG-EYNENVALSARNLPGVKFVSAEGLNVLDVLLHDKLI  193

Query  340  MSRDAVNRIVE  308
            +++DAV+++ E
Sbjct  194  ITKDAVSKVEE  204



>ref|WP_036639444.1| 50S ribosomal protein L4 [Paenirhodobacter enshiensis]
 gb|KFI24728.1| 50S ribosomal protein L4 [Paenirhodobacter enshiensis]
Length=206

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V E  +L +  K + L A A K    KKVL++DG  +NEN  +A++N+  +++LPS
Sbjct  120  GNLVVLESADL-AEAKTKLL-AKAAKELGWKKVLVIDGAEVNENFLVASRNLEGLDILPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV+++  V  +  R+
Sbjct  178  IGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 51.6 bits (122),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAH-DLTKKFRVLGLK  110



>ref|WP_020592345.1| 50S ribosomal protein L4 [Kiloniella laminariae]
Length=205

 Score = 66.6 bits (161),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 12/94 (13%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARK-----WRMPKKVLLVDGGPINENLKLATQNIHY  404
            EGKLMV E+ E+     P+T  A+A++     W     VL++DG  +NE+  LA +NI  
Sbjct  118  EGKLMVLENTEVKG---PKTS-ALAKQLTALGW---SSVLVIDGATVNESFALAARNIPC  170

Query  403  VNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            V+VLP  G NVY IL  DTLV+++DA+  +  R+
Sbjct  171  VDVLPEQGANVYDILRRDTLVLTKDALVALEARL  204


 Score = 49.7 bits (117),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            EVSG+ RK   QKG G ARHG++R   FRGG  +H P+ R HA   L KKV  L LK
Sbjct  55   EVSGSTRKIKKQKGGG-ARHGSIRANIFRGGGIVHGPRVRDHAH-DLTKKVRLLALK  109



>dbj|GAJ29493.1| 50S ribosomal protein L4 [Acidomonas methanolica NBRC 104435]
Length=204

 Score = 63.2 bits (152),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGL  600
            +VSGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL
Sbjct  55   QVSGTTKKPYKQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL  109


 Score = 52.8 bits (125),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL+V E     S T+       A  W      L+VDG  ++     A +NI  ++VLP+
Sbjct  120  GKLVVIETAAGVSRTRDAAAKLRALGW---SSALIVDG-QVDVAFGRAVRNIAKIDVLPT  175

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL HD LV++R  +  + ER+
Sbjct  176  IGANVYDILNHDVLVLTRAGLEGLKERL  203



>ref|WP_028713573.1| 50S ribosomal protein L4 [Paracoccus sp. J55]
Length=206

 Score = 62.8 bits (151),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPSIG NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNLEGVDVLPSIGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_017999555.1| 50S ribosomal protein L4 [Paracoccus sp. N5]
Length=206

 Score = 62.8 bits (151),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPSIG NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNLEGVDVLPSIGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_025899914.1| 50S ribosomal protein L4 [Sneathiella glossodoripedis]
Length=206

 Score = 60.5 bits (145),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEVSGTG KP+ QKGTGRAR G  R P  RGG   H P  RSHA   L KKV +L LK
Sbjct  54   SEVSGTGAKPFNQKGTGRARQGQKRAPHQRGGGVAHGPVLRSHAH-ALPKKVRKLALK  110


 Score = 55.5 bits (132),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 8/92 (9%)
 Frame = -3

Query  568  EGKLMVFEDMELP-SHTKPRTL*AMARKWRMP--KKVLLVDGGPINENLKLATQNIHYVN  398
            EGKL+V ++++   + TK     AMA K+     K  L++D    + N  L+T+N+  V+
Sbjct  119  EGKLIVVDELKAAEAKTK-----AMAGKFDTLGWKSALIIDASEPDTNFALSTRNLPNVD  173

Query  397  VLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            VLP  G NVY IL  DTLV+++ AV  +  R+
Sbjct  174  VLPETGANVYDILRRDTLVLTKSAVESLEARL  205



>ref|WP_007424174.1| MULTISPECIES: 50S ribosomal protein L4 [Acidiphilium]
 ref|YP_001235065.1| 50S ribosomal protein L4 [Acidiphilium cryptum JF-5]
 ref|YP_004284418.1| 50S ribosomal protein L4 [Acidiphilium multivorum AIU301]
 sp|A5FZW4.1|RL4_ACICJ RecName: Full=50S ribosomal protein L4 [Acidiphilium cryptum 
JF-5]
 gb|ABQ31146.1| LSU ribosomal protein L4P [Acidiphilium cryptum JF-5]
 dbj|BAJ81536.1| 50S ribosomal protein L4 [Acidiphilium multivorum AIU301]
 gb|EGO94138.1| RplD [Acidiphilium sp. PM]
 gb|KDM68129.1| 50S ribosomal protein L4 [Acidiphilium sp. JA12-A1]
Length=216

 Score = 71.2 bits (173),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G A+H P  R H    LNKKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHG-YSLNKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKLAEG  120


 Score = 44.7 bits (104),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V + +   S T    +      W    + L+VD   ++E    A++N+  ++VLP
Sbjct  119  EGKLVVLDTVAGVSKTSELNVKLKKLGW---GRTLVVDA-VVDEGFARASRNLIGIDVLP  174

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
             +G NVY IL HDTL ++   +  +  R+
Sbjct  175  VVGANVYDILQHDTLAITAAGLEGLKRRL  203



>ref|WP_037997051.1| 50S ribosomal protein L4 [Thermoactinomyces sp. Gus2-1]
 gb|KFZ39853.1| 50S ribosomal protein L4 [Thermoactinomyces sp. Gus2-1]
Length=208

 Score = 63.5 bits (153),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -2

Query  764  VSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            VSG G+KP+ QKGTGRARHG++R P + GG  +  P+PRS+A  KL KKV RL +K
Sbjct  57   VSGGGKKPWRQKGTGRARHGSIRSPLWVGGGTVFGPQPRSYAY-KLPKKVRRLAIK  111


 Score = 52.8 bits (125),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            + +L+V +++++    K R +  + +   + +K L+V    + EN +L+ +NI  V V+P
Sbjct  120  DSELIVLDELKM-EQPKTREMVQVLKNLGVDRKALIV-ADQVEENAELSARNIPGVKVIP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + GLNV  +L HD L+++R AVNRI E
Sbjct  178  AEGLNVLDVLYHDKLILTRGAVNRIEE  204



>ref|WP_037526525.1| 50S ribosomal protein L4 [Sphingomonas wittichii]
Length=208

 Score = 68.2 bits (165),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +G L++ + +EL    K + L A   K       L++DG  +N    LA+ NI  VNVLP
Sbjct  119  DGTLIIVDTLELKD-AKTKALIAQIAKLGFGNTALVIDGDEVNAGFALASSNIPKVNVLP  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            +IG NVY IL H+TLV++R AV ++  R +
Sbjct  178  AIGANVYDILKHETLVLTRAAVEKLEARFN  207


 Score = 47.8 bits (112),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            S+V+ TG+K   QKG G ARHG  R P F GG   H P+ R      LNKKV  LGLK+
Sbjct  54   SDVARTGKKFGRQKGGGTARHGDRRAPIFIGGGKAHGPRVRDF-NPSLNKKVRALGLKM  111



>ref|XP_011210681.1| PREDICTED: 39S ribosomal protein L4, mitochondrial [Bactrocera 
dorsalis]
Length=294

 Score = 58.5 bits (140),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +EV G GRKP+PQKG GRARHG++R P FRGG   H P+ P +H
Sbjct  119  AEVRGGGRKPWPQKGMGRARHGSIRSPLFRGGGVAHGPRSPTTH  162


 Score = 57.8 bits (138),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVNVL  392
            +  L V + +++P+   P+ +  + ++      VL+VD   I  EN+  AT  + YVN++
Sbjct  185  QDDLHVIDTVDVPTQ-DPQFIKELIKERNWGPSVLIVDRDDIFPENISYATDALSYVNLM  243

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
            PS GLN YS+L HDTLV++ +AV  I ER+   ++R
Sbjct  244  PSYGLNTYSMLKHDTLVLTVNAVKHIEERLLYQLHR  279



>ref|WP_038054993.1| 50S ribosomal protein L4 [Thermodesulfobacterium hydrogeniphilum]
Length=210

 Score = 73.9 bits (180),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            EV G GRKP+PQK TGRAR G++R PQ+ GG  +H PKPR +   KLNKKV RLGLK+
Sbjct  58   EVRGGGRKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRCY-EFKLNKKVRRLGLKM  114


 Score = 42.0 bits (97),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -3

Query  562  KLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSI  383
            KL V ED  +    K + L        + + +++V     N  L+ +  N+  V VL   
Sbjct  124  KLFVAEDFPVKDQPKTKILKGFLDNLGLKEALIIVP--ERNLVLEKSATNLPKVKVLAVE  181

Query  382  GLNVYSILLHDTLVMSRDAVNRIVERMH  299
            GLNVY IL H+ L++++DA+++I ER+ 
Sbjct  182  GLNVYDILNHENLILAKDALSKIEERLR  209



>ref|WP_036151961.1| 50S ribosomal protein L4 [Lysinibacillus odysseyi]
 gb|KGR86706.1| 50S ribosomal protein L4 [Lysinibacillus odysseyi 34hs-1 = NBRC 
100172]
Length=207

 Score = 70.9 bits (172),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEV+G GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS+A  KL KKV RL LK
Sbjct  55   SEVAGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAY-KLPKKVRRLALK  111


 Score = 45.1 bits (105),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -3

Query  520  KPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLV  341
            K +   A+ +   + KK L V    +NEN  L+ +NI  V VL + G+NV  +L HD +V
Sbjct  135  KTKDFAAILKALEINKKALFVTA-ELNENAALSARNIPGVTVLTANGINVLDLLGHDKVV  193

Query  340  MSRDAVNRIVE  308
             ++DAV ++ E
Sbjct  194  FTQDAVKKVEE  204



>ref|WP_010169944.1| 50S ribosomal protein L4 [Bacillus coahuilensis]
Length=207

 Score = 68.6 bits (166),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEV+G GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS+ + KL KKV RL +K
Sbjct  55   SEVAGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSY-SYKLPKKVRRLAIK  111


 Score = 47.4 bits (111),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  520  KPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLV  341
            K +   A+ +   +  KVL+V  G ++EN+ L+ +NI  V V+PS G++V  +L HD LV
Sbjct  135  KTKEFVAVLKNLSLDNKVLVVTDG-LDENVALSARNIPGVTVVPSNGISVLDVLGHDKLV  193

Query  340  MSRDAVNRIVE  308
            M++ AV ++ E
Sbjct  194  MTKAAVEKVEE  204



>ref|WP_025811627.1| 50S ribosomal protein L4 [Komagataeibacter kakiaceti]
Length=204

 Score = 65.9 bits (159),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQ+R G A+H P  R H    L KKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGSARQGSLRSPQYRTGGAVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAAEG  120


 Score = 49.7 bits (117),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 8/91 (9%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPK--KVLLVDGGPINENLKLATQNIHYVNV  395
            EGKL+V E       +       +ARK ++      L+VD   + EN   A +N+  +++
Sbjct  119  EGKLVVLEAATASGKSAE-----LARKLKVLGWTSALIVDA-AVEENFGRAARNLPKIDI  172

Query  394  LPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            LP++G NVY IL H+ L ++R  V  + ER+
Sbjct  173  LPTVGANVYDILNHEVLAITRAGVEGLKERL  203



>ref|XP_008907688.1| 50S ribosomal protein L4 [Phytophthora parasitica INRA-310]
 gb|ETI43455.1| 50S ribosomal protein L4 [Phytophthora parasitica P1569]
 gb|ETK83539.1| 50S ribosomal protein L4 [Phytophthora parasitica]
 gb|ETL36953.1| 50S ribosomal protein L4 [Phytophthora parasitica]
 gb|ETL90125.1| 50S ribosomal protein L4 [Phytophthora parasitica]
 gb|ETM43413.1| 50S ribosomal protein L4 [Phytophthora parasitica]
 gb|ETN07312.1| 50S ribosomal protein L4 [Phytophthora parasitica INRA-310]
 gb|ETO72125.1| 50S ribosomal protein L4 [Phytophthora parasitica P1976]
 gb|ETP13281.1| 50S ribosomal protein L4 [Phytophthora parasitica CJ01A1]
 gb|ETP41353.1| 50S ribosomal protein L4 [Phytophthora parasitica P10297]
Length=277

 Score = 59.3 bits (142),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKL  594
            SEVSG+ RKP+ QKG+GRAR G +R PQ+RGG  +H P  R   +  L KKV  +GL++
Sbjct  123  SEVSGSTRKPWKQKGSGRARVGDIRAPQWRGGYRVHGPVLRDF-SYSLPKKVRAMGLRV  180


 Score = 56.2 bits (134),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = -3

Query  568  EGKLMVFEDMELP-SHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVL  392
            EGKL V + +++  + TK        R W      L V G  +  +  LAT+NI +V+ L
Sbjct  188  EGKLAVVDSLDVDITKTKDMKKLLGGRGW---DHALFVGGEEVESSFVLATRNIPHVDTL  244

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERMH  299
            P   +NVYSIL  D L++++DAV  + ER+H
Sbjct  245  PQNKINVYSILQKDLLIITKDAVKYLEERLH  275



>ref|WP_039806280.1| 50S ribosomal protein L4 [Jeotgalibacillus sp. D5]
 gb|AJD89453.1| 50S ribosomal protein L4 [Jeotgalibacillus sp. D5]
Length=207

 Score = 68.6 bits (166),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEV+G GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS+ + KL KKV RL +K
Sbjct  55   SEVAGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSY-SYKLPKKVRRLAIK  111


 Score = 46.6 bits (109),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            E  ++V E +   S  K +   ++     + KKVL+V  G ++EN+ L+ +NI  V V+ 
Sbjct  120  EENILVLEALSFES-PKTKEFASVLSSLSLDKKVLVVTEG-LDENVALSGRNIPGVTVIS  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NV  +L HD +VM++ AV ++ E
Sbjct  178  ATGVNVLDVLGHDKVVMTKGAVQKVEE  204



>ref|WP_041085434.1| 50S ribosomal protein L4 [Jeotgalibacillus soli Cunha et al. 
2012]
 gb|KIL52341.1| 50S ribosomal protein L4 [Jeotgalibacillus soli Cunha et al. 
2012]
Length=207

 Score = 69.3 bits (168),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEV G GRKP+ QKGTGRAR G++R PQ+RGG A+  P PRS+ + KL KKV RL +K
Sbjct  55   SEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGAVFGPTPRSY-SYKLPKKVRRLAIK  111


 Score = 46.2 bits (108),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            E  ++V E +   +  K +   A+ +   + KKVL+V  G ++EN+ L+ +NI  V ++ 
Sbjct  120  EENILVLEALSFET-PKTKEFAAVLKNLSVDKKVLVVTDG-LDENIALSGRNIPGVTIVS  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NV  +L HD L+M++ AV ++ E
Sbjct  178  ANGVNVLDVLGHDKLIMTKAAVQKVEE  204



>ref|XP_001357123.1| GA19152 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002020915.1| GL14082 [Drosophila persimilis]
 gb|EAL34189.1| GA19152 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW39908.1| GL14082 [Drosophila persimilis]
Length=293

 Score = 59.7 bits (143),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  809  HRKASLKAQQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK-PRSH  642
            +R  SL   +T  +EV G GRKP+PQKG GRARHG++R P F+GG  +H P+ P +H
Sbjct  106  YRYVSLAHAKT-RAEVRGGGRKPWPQKGMGRARHGSIRSPLFKGGGVIHGPRSPTTH  161


 Score = 55.5 bits (132),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPI-NENLKLATQNIHYVNVL  392
            +  L V E++++P+         +A +   P  VL+VD   +  EN+  AT ++ YVN++
Sbjct  184  QDDLHVIENVDIPTRDAQFIKDLIAERNWGPS-VLIVDKEYMFPENICYATDDLGYVNLM  242

Query  391  PSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            P+ GLNVYS+L HDTLV++ DAV  + +R+
Sbjct  243  PAFGLNVYSMLKHDTLVLTVDAVKHLEQRL  272



>gb|AJE45364.1| 50S ribosomal protein L4 [Celeribacter indicus]
Length=206

 Score = 61.2 bits (147),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V ++ +L        L A A K +  K+VL++DG  ++ N K A  NI  V+VLP+
Sbjct  120  GNLVVLDEAKLAE--AKTALLAKAVKEQGWKRVLVIDGSDVDANFKAAAANIAGVDVLPT  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV+++  V  +  R+
Sbjct  178  IGANVYDILKRDTLVITKAGVEALEARL  205


 Score = 54.3 bits (129),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSHA  +L KK  +LGLK
Sbjct  54   SEVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHAH-ELTKKFRKLGLK  110



>gb|EHJ78691.1| ribosomal protein L4 [Danaus plexippus]
Length=285

 Score = 60.5 bits (145),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            +  L V  D+ELP+      +  + ++   P  +L+ D      N+ +AT ++ YVN++P
Sbjct  179  QDDLHVVRDLELPTDESEYLIELIEKRNWGPSVLLVDDTDYAPRNITVATDSLQYVNIMP  238

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERM  302
              GLNVYS+L HDTLV+++ A  +I ER+
Sbjct  239  VYGLNVYSMLKHDTLVLTQAAAEKIEERI  267


 Score = 54.7 bits (130),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPK  654
            +EV G G+KP+PQKG GRARHG++R P +RGG   H P+
Sbjct  113  AEVRGGGKKPWPQKGLGRARHGSIRSPLWRGGGIAHGPR  151



>ref|XP_001420312.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO98605.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus lucimarinus 
CCE9901]
Length=224

 Score = 59.7 bits (143),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EV+G+ RK  PQKG+GRAR G L+ PQ RGG   H P  RSHA   L KKV R+GLK+  
Sbjct  71   EVAGSTRKVRPQKGSGRARVGNLKAPQMRGGGTAHGPVVRSHAH-ALPKKVRRMGLKV-A  128

Query  587  FVSSCSRGK  561
              +  + GK
Sbjct  129  LSAKAAEGK  137


 Score = 55.5 bits (132),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            EGKL+V +     +  +P+T    A   R+   + L  GG  +E ++++ +N+ +V VLP
Sbjct  135  EGKLIVVDSF---AGMEPKTRAMKATLERLTGDLGLAAGG--DELVRMSARNLPHVEVLP  189

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVERMHTPINR  284
             IG NVYSIL   TL++++  + +++ R+  PI R
Sbjct  190  QIGANVYSILRRRTLIVTKSGLEQLIARLDAPIKR  224



>ref|WP_035839229.1| 50S ribosomal protein L4 [Defluviimonas sp. 20V17]
 gb|KDB04841.1| 50S ribosomal protein L4 [Defluviimonas sp. 20V17]
Length=206

 Score = 63.9 bits (154),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G+L+V +  E+ +  K   L A A K    K+VL++DG  +NEN   A QN+  V+VLPS
Sbjct  120  GELVVLDAAEM-AEAKTAIL-AKAAKELGWKRVLVIDGAEVNENFARAAQNLEGVDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV+++  V  +  R+
Sbjct  178  MGANVYDILKRDTLVLTKAGVEALEARL  205


 Score = 51.2 bits (121),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            SEVS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KK   LGLK
Sbjct  54   SEVSYSTKKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAH-DLPKKFRVLGLK  110



>ref|WP_036735704.1| 50S ribosomal protein L4 [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFD41245.1| 50S ribosomal protein L4 [Peptococcaceae bacterium SCADC1_2_3]
 gb|KFI35020.1| 50S ribosomal protein L4 [Peptococcaceae bacterium SCADC1_2_3]
Length=208

 Score = 58.2 bits (139),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +EV G GRKP+ QKGTGRARHG++R P +R G  +  P PR + +  + KK+ RL LK
Sbjct  55   AEVRGGGRKPWRQKGTGRARHGSIRSPIWRKGGIIFGPHPRDY-SYNMPKKMRRLALK  111


 Score = 57.0 bits (136),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L + ED++L S  K + +  +  K ++ ++ LLV  GP +EN+  +T+NI  V  LP 
Sbjct  121  GNLFILEDLKL-SRPKTKDILMLLDKMKIKERTLLVTAGP-DENVLKSTRNISGVKFLPL  178

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVE  308
             G+NVY IL +  L+M+R+A+++  E
Sbjct  179  TGMNVYDILAYQKLIMTREALDKCEE  204



>ref|WP_038062966.1| 50S ribosomal protein L4 [Thioclava dalianensis]
 gb|KEP70721.1| 50S ribosomal protein L4 [Thioclava dalianensis]
Length=206

 Score = 65.1 bits (157),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G L+V E++E+    K + L A A K    K+VL++DG  +NEN   A +NI  ++VLPS
Sbjct  120  GNLIVLENIEMAG-AKTKDL-AKAAKELGWKRVLVIDGAEVNENFAKAARNIEGIDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            +G NVY IL  DTLV+++  +  +  R+
Sbjct  178  MGANVYDILRRDTLVITKAGIEALEARL  205


 Score = 50.1 bits (118),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 44/82 (54%), Gaps = 9/82 (11%)
 Frame = -2

Query  818  TILHR-------KASLKAQQTL-ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMH  663
             ILHR       KA      TL  ++VS + +K Y QKGTG ARHG+ + P FR G    
Sbjct  30   DILHRVVRWQRAKAQAGTHSTLGRADVSYSTKKIYRQKGTGGARHGSRKAPIFRKGGVYK  89

Query  662  VPKPRSHATIKLNKKVCRLGLK  597
             P PRSHA   L KK   LGLK
Sbjct  90   GPVPRSHAH-DLPKKFRALGLK  110



>ref|WP_010400231.1| 50S ribosomal protein L4 [Paracoccus sp. TRP]
Length=206

 Score = 61.6 bits (148),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            G+L++ E++ + +  K   + A A K    K+VL++DG  +NE    A +N+  V+VLPS
Sbjct  120  GELVIVENLNI-AEAKTGAV-AKAVKENGWKRVLVIDGAEVNETFARAARNLEGVDVLPS  177

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL  DTLV++R  V  +  R+
Sbjct  178  IGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_028717097.1| 50S ribosomal protein L4 [Paracoccus sp. J39]
Length=206

 Score = 62.8 bits (151),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPSIG NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNLEGVDVLPSIGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 52.4 bits (124),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FGLPKKVRALGLK  110



>ref|WP_025885434.1| 50S ribosomal protein L4 [Asaia prunellae]
Length=204

 Score = 65.1 bits (157),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  767  EVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLKLDC  588
            EVSGT +KPY QKGTG AR G+LR PQFR G  +H P  R H    L KKV RLGL    
Sbjct  55   EVSGTTKKPYRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHG-YDLPKKVRRLGL----  109

Query  587  FVSSCSRGKAHG  552
             +S+ S+  A G
Sbjct  110  -ISALSQKAAAG  120


 Score = 49.7 bits (117),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = -3

Query  565  GKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLPS  386
            GKL+V +     + T+       A  W      L+VDG  ++     A +N+  ++VLP+
Sbjct  120  GKLIVIDQAAGVTKTREAAAKLAALGW---SSALIVDG-AVDVAFGRAVRNLPKIDVLPT  175

Query  385  IGLNVYSILLHDTLVMSRDAVNRIVERM  302
            IG NVY IL HD LV++R  +  + ER+
Sbjct  176  IGANVYDILNHDVLVLTRAGLEGLKERL  203



>ref|WP_020062293.1| 50S ribosomal protein L4 [Bacillus sp. 123MFChir2]
Length=207

 Score = 68.6 bits (166),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = -2

Query  815  ILHRKASLKA---QQTLESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRS  645
            +L ++ASL+    +    SEV G GRKP+ QKGTGRAR G++R PQ+RGG  +  P PRS
Sbjct  37   VLMQRASLRQGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRS  96

Query  644  HATIKLNKKVCRLGLK  597
            +A  KL KKV RL +K
Sbjct  97   YA-YKLPKKVRRLAIK  111


 Score = 46.2 bits (108),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -3

Query  568  EGKLMVFEDMELPSHTKPRTL*AMARKWRMPKKVLLVDGGPINENLKLATQNIHYVNVLP  389
            E  ++V ED+ L +  K + + A+ +   + KK L+V    +NE ++L+ +NI  V V+ 
Sbjct  120  ENNIVVLEDLVL-NAPKTKDMVAVLKGLTVEKKALIVTA-DVNEAVELSARNIPGVTVIT  177

Query  388  SIGLNVYSILLHDTLVMSRDAVNRIVE  308
            + G+NV  +L HD L+M++ AV ++ E
Sbjct  178  ADGVNVLDVLHHDKLIMTKAAVEKVEE  204



>ref|WP_036754151.1| 50S ribosomal protein L4 [Paracoccus versutus]
 gb|KGJ10671.1| 50S ribosomal protein L4 [Paracoccus versutus]
Length=206

 Score = 61.6 bits (148),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPS+G NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNLEGVDVLPSMGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -2

Query  770  SEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  54   SDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



>ref|WP_011747102.1| 50S ribosomal protein L4 [Paracoccus denitrificans]
 ref|YP_914568.1| 50S ribosomal protein L4 [Paracoccus denitrificans PD1222]
 sp|A1B028.1|RL4_PARDP RecName: Full=50S ribosomal protein L4 [Paracoccus denitrificans 
PD1222]
 gb|ABL68872.1| LSU ribosomal protein L4P [Paracoccus denitrificans PD1222]
Length=206

 Score = 61.6 bits (148),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  475  KKVLLVDGGPINENLKLATQNIHYVNVLPSIGLNVYSILLHDTLVMSRDAVNRIVERM  302
            K+VL++DG  +NEN   A +N+  V+VLPS+G NVY IL  DTLV++R  V  +  R+
Sbjct  148  KRVLVIDGAEVNENFARAARNLEGVDVLPSMGANVYDILRRDTLVLTRAGVEALEARL  205


 Score = 53.5 bits (127),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  773  ESEVSGTGRKPYPQKGTGRARHGTLRGPQFRGGTAMHVPKPRSHATIKLNKKVCRLGLK  597
            +S+VS + +K Y QKGTG ARHG+ + P FR G     P PRSHA   L KKV  LGLK
Sbjct  53   KSDVSYSTKKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHA-FDLPKKVRALGLK  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7431070434544