BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24766_g2_i2 len=1278 path=[1244:0-206 1451:207-227 1472:228-262
2691:263-411 1644:412-441 4590:442-565 1798:566-636 1869:637-814
2047:815-858 2091:859-882 2115:883-1046 2279:1047-1056
9424:1057-1070 2303:1071-1075 2308:1076-1099 2332:1100-1277]

Length=1278
                                                                      Score     E

ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    449   8e-153   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    446   2e-151   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    427   4e-144   
emb|CDP15888.1|  unnamed protein product                                425   3e-143   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    418   1e-140   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     417   5e-140   Vitis vinifera
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    416   2e-139   
emb|CDP21787.1|  unnamed protein product                                414   1e-138   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    413   1e-138   Vitis vinifera
emb|CDP21836.1|  unnamed protein product                                413   2e-138   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    411   7e-138   
emb|CDP19840.1|  unnamed protein product                                410   2e-137   
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    408   1e-136   Vitis vinifera
emb|CDP17644.1|  unnamed protein product                                407   2e-136   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             407   4e-136   Populus trichocarpa [western balsam poplar]
emb|CDP21661.1|  unnamed protein product                                407   4e-136   
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   406   6e-136   Rosa hugonis
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                406   8e-136   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    405   1e-135   Vitis vinifera
emb|CAN78992.1|  hypothetical protein VITISV_005827                     405   1e-135   Vitis vinifera
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    405   1e-135   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    405   2e-135   
gb|AEF97347.1|  O-methyltransferase                                     404   3e-135   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   4e-135   Vitis vinifera
emb|CAQ76879.1|  resveratrol O-methyltransferase                        404   4e-135   Vitis vinifera
emb|CAN79968.1|  hypothetical protein VITISV_043678                     404   4e-135   Vitis vinifera
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   6e-135   
gb|AFX68805.1|  O-metyltransferase                                      404   7e-135   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    403   1e-134   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    403   1e-134   
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   402   2e-134   Rosa hugonis
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    402   2e-134   Vitis vinifera
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    402   2e-134   Vitis vinifera
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    401   5e-134   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           401   5e-134   
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   401   7e-134   Rosa hybrid cultivar
gb|ABQ02270.2|  O-methyltransferase                                     401   8e-134   Vitis vinifera
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    400   1e-133   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    403   2e-133   
emb|CAH05083.1|  putative orcinol O-methyltransferase                   399   3e-133   Rosa hybrid cultivar
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    399   3e-133   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    399   3e-133   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    399   4e-133   
ref|NP_001267963.1|  O-methyltransferase                                399   5e-133   
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   397   2e-132   Rosa beggeriana
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   2e-132   
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   397   2e-132   Rosa odorata var. gigantea
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   397   2e-132   Rosa woodsii var. ultramontana
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   4e-132   
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   396   4e-132   Rosa odorata var. gigantea
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   396   5e-132   Rosa bracteata [Macartny rose]
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   396   5e-132   Rosa chinensis [China rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   396   5e-132   Rosa majalis [cinnamon rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   396   5e-132   Rosa marretii
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   395   6e-132   Rosa odorata var. gigantea
gb|AAB71213.1|  methyltransferase                                       396   6e-132   Prunus armeniaca
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   395   7e-132   Rosa beggeriana
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   395   8e-132   Rosa gallica [apothecary rose]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   395   9e-132   Rosa hybrid cultivar
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   395   9e-132   Rosa odorata [tea rose]
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   395   1e-131   Rosa gallica [apothecary rose]
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   395   1e-131   Rosa chinensis var. spontanea
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   395   1e-131   Rosa gallica [apothecary rose]
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   395   1e-131   Rosa chinensis var. spontanea
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    395   1e-131   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    395   1e-131   
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   395   2e-131   Rosa odorata [tea rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa chinensis [China rose]
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa gallica [apothecary rose]
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa chinensis var. spontanea
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa banksiae
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa beggeriana
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   394   2e-131   Rosa canina [dog briar]
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   394   3e-131   Rosa rugosa [Japanese rose]
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   395   3e-131   Rosa hybrid cultivar
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   394   3e-131   Rosa chinensis var. spontanea
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   394   3e-131   Rosa gallica [apothecary rose]
emb|CAH05084.1|  orcinol O-methyltransferase 3                          394   4e-131   Rosa hybrid cultivar
emb|CAH05089.1|  putative orcinol O-methyltransferase                   394   4e-131   Rosa odorata var. gigantea
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   394   4e-131   Rosa chinensis [China rose]
emb|CAH05082.1|  putative orcinol O-methyltransferase                   393   8e-131   Rosa hybrid cultivar
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   393   8e-131   Rosa bracteata [Macartny rose]
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   393   9e-131   Rosa chinensis [China rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   393   9e-131   Rosa roxburghii [chestnut rose]
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   393   9e-131   Rosa canina [dog briar]
emb|CDP19709.1|  unnamed protein product                                393   9e-131   
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa beggeriana
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa lucieae [memorial rose]
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa rugosa [Japanese rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa odorata [tea rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa chinensis var. spontanea
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa gallica [apothecary rose]
emb|CAH05079.1|  putative orcinol O-methyltransferase                   392   1e-130   Rosa gallica [apothecary rose]
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    392   2e-130   Vitis vinifera
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   392   2e-130   Rosa odorata var. gigantea
emb|CAH05085.1|  orcinol O-methyltransferase 3                          392   2e-130   Rosa hybrid cultivar
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   392   3e-130   Rosa marretii
emb|CAH05087.1|  orcinol O-methyltransferase 4                          391   3e-130   Rosa hybrid cultivar
emb|CDP15886.1|  unnamed protein product                                391   3e-130   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   391   4e-130   Rosa canina [dog briar]
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   390   6e-130   Rosa odorata [tea rose]
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    391   6e-130   Vitis vinifera
emb|CAH05080.1|  putative orcinol O-methyltransferase                   390   8e-130   Rosa gallica [apothecary rose]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   390   8e-130   Rosa banksiae
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   390   9e-130   Rosa chinensis var. spontanea
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   390   1e-129   Rosa odorata [tea rose]
emb|CAH05086.1|  orcinol O-methyltransferase 4                          390   1e-129   Rosa hybrid cultivar
emb|CAH05088.1|  putative orcinol O-methyltransferase                   389   2e-129   Rosa odorata var. gigantea
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   389   2e-129   Rosa chinensis [China rose]
emb|CAD29556.1|  orcinol O-methyltransferase                            389   2e-129   Rosa hybrid cultivar
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   389   3e-129   Rosa odorata var. gigantea
emb|CAH05090.1|  putative orcinol O-methyltransferase                   389   3e-129   Rosa odorata var. gigantea
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             389   3e-129   
emb|CAD29555.1|  orcinol O-methyltransferase                            389   3e-129   Rosa hybrid cultivar
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   389   4e-129   Rosa marretii
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   389   4e-129   Rosa woodsii var. ultramontana
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   388   4e-129   Rosa odorata var. gigantea
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         389   5e-129   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   388   5e-129   Rosa odorata [tea rose]
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    389   5e-129   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     388   6e-129   Vitis vinifera
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   388   7e-129   Rosa odorata var. gigantea
emb|CAN83014.1|  hypothetical protein VITISV_029725                     388   9e-129   Vitis vinifera
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    388   1e-128   Vitis vinifera
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   387   1e-128   Rosa odorata var. gigantea
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   387   2e-128   Rosa odorata [tea rose]
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   3e-128   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    389   3e-128   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   386   3e-128   Rosa odorata [tea rose]
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   386   3e-128   Rosa odorata var. gigantea
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   386   5e-128   Rosa odorata var. gigantea
ref|XP_002517827.1|  o-methyltransferase, putative                      385   7e-128   Ricinus communis
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    385   1e-127   
emb|CAH05091.1|  putative orcinol O-methyltransferase                   384   1e-127   Rosa odorata var. gigantea
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             384   2e-127   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   382   9e-127   Rosa odorata [tea rose]
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   382   1e-126   Rosa odorata [tea rose]
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   382   1e-126   Rosa chinensis [China rose]
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             382   2e-126   
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    382   3e-126   Vitis vinifera
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             381   4e-126   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    381   7e-126   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   1e-125   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             380   1e-125   
ref|XP_002525159.1|  o-methyltransferase, putative                      379   2e-125   Ricinus communis
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    379   2e-125   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              379   4e-125   
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   377   9e-125   Rosa chinensis var. spontanea
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             378   1e-124   
ref|XP_002525160.1|  o-methyltransferase, putative                      377   1e-124   Ricinus communis
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   1e-124   
emb|CDP19839.1|  unnamed protein product                                376   2e-124   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   375   7e-124   Rosa odorata var. gigantea
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             375   1e-123   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    374   2e-123   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         374   2e-123   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    374   2e-123   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    373   5e-123   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           374   9e-123   
gb|AFK40900.1|  unknown                                                 372   2e-122   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           372   2e-122   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    371   3e-122   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    371   3e-122   Vitis vinifera
gb|ABZ89567.1|  O-methyltransferase 3                                   371   5e-122   Humulus lupulus [common hop]
emb|CAN73269.1|  hypothetical protein VITISV_021917                     370   6e-122   Vitis vinifera
emb|CAA11131.1|  O-methyltransferase                                    370   7e-122   Prunus dulcis [sweet almond]
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   2e-121   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             369   2e-121   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             369   2e-121   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   3e-121   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     367   4e-121   Vitis vinifera
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    368   5e-121   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           369   5e-121   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    369   6e-121   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   6e-121   
emb|CDP19713.1|  unnamed protein product                                367   1e-120   
gb|ABK96707.1|  unknown                                                 367   1e-120   Populus trichocarpa x Populus deltoides
ref|XP_003615966.1|  O-methyltransferase                                366   3e-120   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           367   4e-120   
ref|XP_002517832.1|  o-methyltransferase, putative                      365   7e-120   Ricinus communis
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    364   2e-119   
ref|XP_002517833.1|  o-methyltransferase, putative                      365   2e-119   Ricinus communis
gb|AES89720.2|  orcinol O-methyltransferase                             364   2e-119   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             363   3e-119   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    363   6e-119   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    362   1e-118   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    362   1e-118   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    362   1e-118   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     362   1e-118   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    361   3e-118   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             361   4e-118   
emb|CDP19711.1|  unnamed protein product                                360   5e-118   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    360   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   8e-118   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   1e-117   
ref|XP_003607523.1|  O-methyltransferase                                360   1e-117   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   2e-117   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     358   3e-117   Vitis vinifera
ref|XP_003615967.1|  O-methyltransferase                                358   6e-117   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    358   7e-117   
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 357   1e-116   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         357   2e-116   
ref|XP_003615973.1|  O-methyltransferase                                356   3e-116   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   3e-116   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         356   4e-116   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   5e-116   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   6e-116   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   355   9e-116   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   1e-115   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   1e-115   Vitis vinifera
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   1e-115   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     354   1e-115   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    354   1e-115   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    354   2e-115   
emb|CBI22005.3|  unnamed protein product                                352   2e-115   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   3e-115   Vitis vinifera
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    353   3e-115   Mentha x piperita
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         353   5e-115   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     351   7e-115   Vitis vinifera
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   7e-115   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             352   1e-114   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                350   2e-114   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           351   2e-114   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      349   5e-114   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       350   8e-114   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    349   2e-113   Vitis vinifera
ref|XP_002522501.1|  o-methyltransferase, putative                      348   3e-113   Ricinus communis
ref|XP_002522500.1|  o-methyltransferase, putative                      348   4e-113   Ricinus communis
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    348   4e-113   Catharanthus roseus [chatas]
ref|XP_002517834.1|  o-methyltransferase, putative                      348   4e-113   Ricinus communis
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    348   6e-113   Vitis vinifera
ref|XP_002517835.1|  o-methyltransferase, putative                      346   2e-112   Ricinus communis
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    346   2e-112   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     346   2e-112   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     346   2e-112   Vitis vinifera
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   3e-112   
gb|AAR02421.1|  putative O-methyltransferase                            345   4e-112   Catharanthus roseus [chatas]
emb|CDP21583.1|  unnamed protein product                                343   5e-112   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   5e-112   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   7e-112   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       345   8e-112   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         344   8e-112   
gb|AAR09603.1|  O-methyltransferase                                     343   2e-111   Mentha x piperita
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   6e-111   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   1e-110   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     342   1e-110   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   1e-110   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   1e-110   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    341   1e-110   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    341   1e-110   
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   339   2e-110   
emb|CDP21582.1|  unnamed protein product                                340   2e-110   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    342   3e-110   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   4e-110   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   7e-110   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   1e-109   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   1e-109   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   1e-109   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   339   1e-109   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   2e-109   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   2e-109   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   3e-109   
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   3e-109   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   3e-109   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   4e-109   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   5e-109   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                336   5e-109   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    337   6e-109   Catharanthus roseus [chatas]
ref|XP_003615962.1|  O-methyltransferase                                337   7e-109   
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   8e-109   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   8e-109   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    337   8e-109   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             337   9e-109   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      337   1e-108   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   1e-108   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   1e-108   
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    336   1e-108   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   2e-108   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   2e-108   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                335   4e-108   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   5e-108   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   335   6e-108   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   7e-108   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    334   7e-108   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    334   9e-108   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    334   9e-108   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       334   1e-107   
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    333   3e-107   
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   4e-107   
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            334   4e-107   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   4e-107   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             332   6e-107   
emb|CDP21212.1|  unnamed protein product                                330   8e-107   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   9e-107   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   1e-106   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         331   2e-106   
ref|XP_003615968.1|  O-methyltransferase                                329   3e-106   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   3e-106   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   3e-106   
ref|NP_001267964.1|  O-methyltransferase                                330   5e-106   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   6e-106   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                330   6e-106   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       330   6e-106   
ref|XP_002522586.1|  o-methyltransferase, putative                      329   1e-105   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      329   1e-105   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 329   1e-105   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    329   1e-105   
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   327   1e-105   
emb|CAN75971.1|  hypothetical protein VITISV_009882                     327   2e-105   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                328   3e-105   
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   6e-105   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   1e-104   
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   1e-104   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             325   2e-104   
dbj|BAI79244.1|  O-methyltransferase                                    325   2e-104   
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     325   2e-104   
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              325   3e-104   
dbj|BAJ05387.1|  O-methyltransferase                                    325   4e-104   
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    324   7e-104   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             322   7e-104   
emb|CDP20220.1|  unnamed protein product                                321   9e-104   
gb|ADO16249.1|  chavicol O-methyltransferase                            324   1e-103   
dbj|BAJ05384.1|  O-methyltransferase                                    323   1e-103   
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   1e-103   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    323   2e-103   
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   5e-103   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   5e-103   
dbj|BAI77794.1|  chavicol O-methyltransferase                           322   6e-103   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   7e-103   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   8e-103   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   8e-103   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    322   1e-102   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   1e-102   
dbj|BAA86059.1|  O-methyltransferase                                    322   1e-102   
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   2e-102   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        320   2e-102   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     320   3e-102   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   4e-102   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   5e-102   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   7e-102   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   7e-102   
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   8e-102   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   1e-101   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   1e-101   
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    332   1e-101   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    318   2e-101   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   2e-101   
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         316   2e-101   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 318   3e-101   
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   3e-101   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      317   4e-101   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   4e-101   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   4e-101   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   5e-101   
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   7e-101   
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   7e-101   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   2e-100   
emb|CBI21931.3|  unnamed protein product                                312   3e-100   
dbj|BAJ05383.1|  O-methyltransferase                                    315   3e-100   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   3e-100   
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   4e-100   
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   4e-100   
ref|XP_002525163.1|  o-methyltransferase, putative                      313   4e-100   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   5e-100   
dbj|BAI79243.1|  O-methyltransferase                                    314   6e-100   
gb|AAM97498.1|  O-methyltransferase                                     313   8e-100   
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   9e-100   
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   9e-100   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 313   1e-99    
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    313   1e-99    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   1e-99    
dbj|BAJ05388.1|  O-methyltransferase                                    313   2e-99    
dbj|BAI79245.1|  O-methyltransferase                                    312   3e-99    
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    312   5e-99    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   6e-99    
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         311   8e-99    
emb|CBI21929.3|  unnamed protein product                                309   8e-99    
emb|CBI21927.3|  unnamed protein product                                308   9e-99    
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   1e-98    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   1e-98    
emb|CBI21921.3|  unnamed protein product                                308   2e-98    
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 310   2e-98    
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    310   3e-98    
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   1e-97    
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      308   1e-97    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 309   1e-97    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    308   2e-97    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   4e-97    
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    306   5e-97    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    306   5e-97    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               306   6e-97    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     305   1e-96    
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   2e-96    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    305   2e-96    
emb|CBI21932.3|  unnamed protein product                                307   3e-96    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   5e-96    
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   6e-96    
gb|AAR02417.1|  putative O-methyltransferase                            303   8e-96    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      303   2e-95    
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   2e-95    
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    302   2e-95    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        301   3e-95    
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   6e-95    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     301   6e-95    
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             301   7e-95    
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   1e-94    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       300   2e-94    
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    300   2e-94    
gb|AEF14418.1|  isoflavone O-methyltranferase                           300   3e-94    
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   3e-94    
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                     299   4e-94    
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   5e-94    
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   5e-94    
gb|ACU19152.1|  unknown                                                 296   6e-94    
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   6e-94    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   6e-94    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             298   7e-94    
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   8e-94    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             298   1e-93    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             298   1e-93    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        304   2e-93    
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                        296   2e-93    
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   2e-93    
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   3e-93    
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   3e-93    
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   3e-93    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    296   4e-93    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             296   5e-93    
gb|ACU20151.1|  unknown                                                 296   5e-93    
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   5e-93    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    295   1e-92    
ref|XP_006467716.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    295   1e-92    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    294   3e-92    
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                290   7e-92    
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase                289   9e-92    
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    293   1e-91    
gb|KHN14033.1|  Isoflavone 7-O-methyltransferase                        292   2e-91    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    292   2e-91    
dbj|BAF36052.1|  O-methyltransferase                                    292   2e-91    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    293   3e-91    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   4e-91    
sp|Q84KK4.1|I4OMT_LOTJA  RecName: Full=Isoflavone 4'-O-methyltran...    291   5e-91    
sp|C6TAY1.1|SOMT2_SOYBN  RecName: Full=Flavonoid 4'-O-methyltrans...    291   7e-91    
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                        291   8e-91    
ref|NP_001241162.1|  uncharacterized protein LOC100813225               290   1e-90    
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          290   1e-90    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    289   1e-90    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    290   1e-90    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    290   2e-90    
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    290   2e-90    
gb|KHN13532.1|  Isoflavone 7-O-methyltransferase                        289   2e-90    
ref|XP_003552589.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    289   4e-90    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   289   5e-90    
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    289   5e-90    
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   8e-90    
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     287   1e-89    
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        288   1e-89    
emb|CBI21925.3|  unnamed protein product                                285   1e-89    
sp|Q84KK5.1|D7OMT_GLYEC  RecName: Full=Isoflavone 7-O-methyltrans...    287   2e-89    
gb|ABD83944.1|  IOMT 4                                                  287   2e-89    
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    287   3e-89    
ref|XP_010231162.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    287   4e-89    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 286   4e-89    
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    286   7e-89    
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    286   7e-89    
ref|XP_007153628.1|  hypothetical protein PHAVU_003G051600g             285   9e-89    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   285   1e-88    
gb|ACY41220.1|  O-methyltransferase-like protein                        285   1e-88    
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    285   1e-88    
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        284   2e-88    
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    285   2e-88    
gb|ABD83946.1|  IOMT 7                                                  284   3e-88    
emb|CAN77288.1|  hypothetical protein VITISV_004161                     282   3e-88    
ref|XP_003552574.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    284   3e-88    
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    285   4e-88    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        283   4e-88    
gb|EMT07987.1|  O-methyltransferase ZRP4                                284   4e-88    
gb|KEH29290.1|  isoflavone-7-O-methyltransferase                        284   4e-88    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    283   5e-88    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    283   5e-88    
ref|XP_007148101.1|  hypothetical protein PHAVU_006G180900g             283   6e-88    
emb|CBI21926.3|  unnamed protein product                                281   6e-88    
dbj|BAK04190.1|  predicted protein                                      284   6e-88    
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like           283   7e-88    
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     283   1e-87    
gb|EMT10452.1|  O-methyltransferase ZRP4                                283   1e-87    
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   1e-87    
gb|KDP35402.1|  hypothetical protein JCGZ_10386                         280   2e-87    
gb|KEH30981.1|  isoflavone-7-O-methyltransferase                        281   3e-87    
ref|XP_006586449.1|  PREDICTED: flavonoid 4'-O-methyltransferase-...    281   3e-87    
gb|ABD83945.1|  IOMT 6                                                  281   4e-87    
ref|NP_001061464.1|  Os08g0290700                                       281   8e-87    
gb|EAZ42206.1|  hypothetical protein OsJ_26771                          280   1e-86    
gb|AFK42082.1|  unknown                                                 280   1e-86    
gb|EMS57233.1|  putative O-methyltransferase 2                          280   1e-86    



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   449 bits (1156),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 268/356 (75%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL++L + L+INKAK  HL
Sbjct  12    EILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKTTHL  71

Query  237   GRLMRVLTRSGFFLDAKIKD--------GDGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
              RLMR+L  SGFF+ ++I++        G+GYAL PPS LL+KD P ++ PF+L     I
Sbjct  72    RRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSVTPFLLAMLDPI  131

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
                PWH VSEWF ND PTP+ TA+G+TFWD A  +  LNH+FN AMA D  L+M +V KY
Sbjct  132   LVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKY  191

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
              ++VFEGL+S+VDVGGGTG VA++IA+ FPD +CTV DLPHVV GLE  KNL YV GD F
Sbjct  192   SKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEGNKNLNYVGGDFF  251

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
              +IPPA A+ LKW+LHDW+D + VKILKKCKEAIP RE GGKVII+DM+V    +  + D
Sbjct  252   VSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMV----DNKIGD  307

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DE I++QIF D+ MMV   GRER+ K W K+F+DAGF  YK T  LG RSLI+++P
Sbjct  308   DESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILGLRSLIEVYP  363



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   446 bits (1147),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 269/355 (76%), Gaps = 11/355 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
              EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL++L + L+INKAK  H
Sbjct  11    TEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKTTH  70

Query  234   LGRLMRVLTRSGFFLDAKIKDGDG------YALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             L RLMR+L RSGFF+ ++I++ +G      Y+L PPS LL+KD P ++ PF+L     I 
Sbjct  71    LRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPFLLAMLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PWH VSEWF ND PTP+ TA+G+TFWD A  +  LNH+FN AMA D  L+M +V KY 
Sbjct  131   VKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVIKYS  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             ++VFEGL+S+VDVGGGTG VA++IA+ FPD +CTV DLPHVV GLEE+KNL YV GD F 
Sbjct  191   KDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESKNLNYVGGDFFV  250

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             +IPPA A+ LKW+LHDW+D + VKILKKCKEAIP RE GGKVII+DM+V    +  + DD
Sbjct  251   SIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMV----DNKIGDD  306

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             E I++QIF D+ MMV   GRER+ K W K+F DAGF  YK T  LG RSLI+++P
Sbjct  307   ESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILGLRSLIEVYP  361



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   427 bits (1099),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 204/359 (57%), Positives = 265/359 (74%), Gaps = 15/359 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL EL + L+INK+K  H
Sbjct  11    SEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALSINKSKITH  70

Query  234   LGRLMRVLTRSGFFLDAKI----------KDGDGYALGPPSCLLIKDHPFNLAPFVLGAS  383
             L RLMR+L  SGFFL   +           +G+GY L PP+ LL+KD P  + PF+L   
Sbjct  71    LRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTVTPFLLAML  130

Query  384   STIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALV  563
               I   PWH V+EWF +D+PTP++ A+G+TFWD A  +Q LNH+FN AMA D  L+M++V
Sbjct  131   DPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVMSVV  190

Query  564   KKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAG  743
              KY ++VFEGL+S+VDVGGGTG VA+ IA +FP+ +CTV DLPHVV GLE + NL+YV G
Sbjct  191   MKYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGSDNLSYVGG  250

Query  744   DMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGD  923
             D F ++PPA A+ LKW+LHDW+D + VKILKKCKEAIP +E GGKVII+DM+V    +  
Sbjct  251   DFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMMV----DNK  306

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             + DDE I++QIF D+ MMV   GRER+ + W KIF +AGF  YK T  LG RSLI+++P
Sbjct  307   IGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILGLRSLIEVYP  365



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 201/350 (57%), Positives = 260/350 (74%), Gaps = 5/350 (1%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ HIWNHIFNFINS SLKCA+QLGIPD+IH+HGQP+ L +L+D L IN AKA  +
Sbjct  12    ELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAPFV  71

Query  237   GRLMRVLTRSGFFLDAKIKDGDG---YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF+ AKI D +G   YAL   S LL+ + PF++ PF+L     I T PW
Sbjct  72    YRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLAMLDPILTDPW  131

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H  S+WF N + TP+ T +G + W+ A +  +LN +FN+ MA D  L+  +V + C++VF
Sbjct  132   HHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVSTMVIENCKDVF  191

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SL+DVGGGTG VA+AIAD FP  +C+VLDLPHVV G E +KNLAYV GDMF+AIPP
Sbjct  192   MGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAYVGGDMFEAIPP  251

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A A+ LKW+LHDW+D +CV+IL+KCKEAIP  E GGKVII+DM++ S QNGD DD E I+
Sbjct  252   ADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKSQQNGD-DDAEAIE  310

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             +Q+F D+ MMV+  GRER  K+W K+F +AGF  YK T  LG RS+I+++
Sbjct  311   TQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIEVY  360



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 264/357 (74%), Gaps = 8/357 (2%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+TL ELV  L I+ 
Sbjct  5     SVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHP  64

Query  219   AKAHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASST  389
              K   + RLMR+L +SGFF   K+++ +   GY L   S LL++D P ++ PF+L     
Sbjct  65    KKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDP  124

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
             I T PWH VS WF NDDPTP+ TA+G+TFWD    + ++N++FN+AMA D  L+ +++ K
Sbjct  125   ILTKPWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIK  184

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+ VFEGL+SLVDVGGGTG VA+AIA+ FP   CTV DLPHVVAGLE +KNL Y+ GDM
Sbjct  185   DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
             FK IPPA AI LKW+LHDWND +CVKIL++C++AIP +E GGKVII+DM++   Q G   
Sbjct  245   FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMM-ENQKG---  300

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DDE +++Q+F D+ MM+   G+ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  301   DDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 261/357 (73%), Gaps = 8/357 (2%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+TL ELV  L I+ 
Sbjct  5     SVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHP  64

Query  219   AKAHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASST  389
              K   + RLMR+L +SGFF   K+++ +   GY L   S LL++D P ++ PF+L     
Sbjct  65    KKVWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDP  124

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
             I T PWH VS WF NDDPTP+ TA+G TFWD    + + N++FN+AMA D  L+ + + K
Sbjct  125   ILTKPWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIK  184

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+ VFEGL+SLVDVGGGTG VA+AIA+ FP   CTV DLPHVVAGLE +KNL Y+ GDM
Sbjct  185   DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDM  244

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
             FK IPPA AI LKW+LHDWND +CVKIL++C++AIP +E GGKVII+DM++   Q G   
Sbjct  245   FKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMM-ENQKG---  300

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DDE +++Q+F D+ MM+   G+ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  301   DDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 253/354 (71%), Gaps = 7/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG+P+TL EL   L IN  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPINPTK  77

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP ++ PF+      + T
Sbjct  78    SHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLDPVLT  137

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH  S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   CR
Sbjct  138   KPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIVDECR  197

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGLDSLVDVGGGTG VA+AIAD FP  KCTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  198   GVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA A+ LKW+LHDWND +CVKIL++ KEAI G++  GKVII+DM++   Q G   D+E
Sbjct  258   VPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKVIIIDMMM-ENQKG---DEE  313

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  314   SMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 257/352 (73%), Gaps = 7/352 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ HIWNHIFNFINS S+KCA QLGIPDVIH+HGQP+TL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRSGFFLDAKIKDGD-----GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
              RLM++L  SGFF++AKI   +     GY L   S LL+K +PF++ PF+L       T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PW  +S+WF N D TP+ T +G++ +  AS +  LN +FN+AMA DT L+ ++V K C+ 
Sbjct  133   PWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKH  192

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFE L+SLVDVGGGTG  A+AIAD FP  KCTVLDLPHVV GLE +KNLAYV G+MF+AI
Sbjct  193   VFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAI  252

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PPA A+ +KW+L DW+D +CV+ILKKCKEA P +E GGKVIIVDM   S Q GD DD E 
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVIIVDMFCKSLQKGD-DDHET  311

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             I++Q+F D+++MV   GR+R  K+W K+F +AGF  YK T  LG RS+I+++
Sbjct  312   IETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 259/351 (74%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ A  H+WNHIFNFINS SLKCA++LGIPD+IH HG+P+TL ELV  L +N  K   +
Sbjct  11    ELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEKTKCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L +SGFF   ++++    +GY L   S LL+KD P +  PF+L     +   PW
Sbjct  71    YRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDPVLITPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
               VS WF NDDPTP+ TA+G+TFWD A  + +LN++FN+AMA D  L+ +++ K C+ +F
Sbjct  131   QYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLIKDCKGIF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VARAIA+ FP   CTVLDLPHVVAGLE +KNL Y+AGDMF+AIPP
Sbjct  191   VGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDWN  +CVKILK+C++AIP +E GGKVII+DM++ + +     DDE I+
Sbjct  251   ADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKA----DDESIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             +Q+F D+ MM+   G+ER +K+W K+F DAGF  YK T  LG RSLI+++P
Sbjct  307   TQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  357



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   413 bits (1061),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/352 (57%), Positives = 257/352 (73%), Gaps = 7/352 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ HIWNHIFNFINS S+KCA+QLGIPDVIH+HGQPITL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRSGFFLDAKIKDGD-----GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
              RLM++L  SGFF++AKI   +     GY L   S LL+K +PF++ PF+L       T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PWH +S+WF N D TP+ T +G++ +  AS +  LN +FN+AMA DT L+ ++V K C+ 
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVVTKDCKH  192

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFE L+SLVDVGGGTG  A+AIAD FP  KCTVLDLPHVV GLE +KNL YV G+MF+AI
Sbjct  193   VFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLGYVGGNMFEAI  252

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PPA A+ +KW+L DW+D +CV+ILKKCKEAIP +E GGKVIIVDM   S Q GD DD E 
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDMFCKSLQKGD-DDHEA  311

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             I++Q+F D+ +MV    R+R  K+W K+F +AGF  YK T  LG RS+I+++
Sbjct  312   IETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   411 bits (1056),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 254/358 (71%), Gaps = 6/358 (2%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ HIWNHIF+FINS SLKCAVQLGIPDVI +HGQP+TL ELV  L 
Sbjct  1     MGSEVRASHELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALP  60

Query  210   INKAKAHHLGRLMRVLTRSGFFLDAKIKDGD-GYALGPPSCLLIKDHPFNLAPFVLGASS  386
             I+  KAH + RLMR+L  S FF    +  G+ GY L   S LL++D+P +  PF+L   +
Sbjct  61    ISPTKAHFIPRLMRILVHSSFFARESLSGGEQGYVLTDASTLLLEDNPMSARPFLLAVLN  120

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              I T PW  ++ WF ND+PTP+   +G TFWD  +QD  + H+FN AMA D  L+ +LV 
Sbjct  121   PILTDPWQYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLVI  180

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               C+ VF+G+DSLVDVGGGTG VA++IAD FP  KCTVLDLPHVVA L+ +KNL YVAGD
Sbjct  181   DECKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGD  240

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF A+P A AIFLKW+LHDW+D +CVKIL++CKEAI      GKVIIVDM V        
Sbjct  241   MFDAVPAADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVEDKNT---  297

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
              D E  ++Q+F D++MMV   G+ER  KEW K+F+DAGF +YK T  LG RSLI+++P
Sbjct  298   -DKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEVYP  354



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   410 bits (1054),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 257/352 (73%), Gaps = 7/352 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ HIWNHIFNFINS S+KCA+QLGIPDVIH+HGQP+TL++L+D L I  AKA  +
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  237   GRLMRVLTRSGFFLDAKIKDGD-----GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
              RLM++L  SGFF++AKI   +     GY L   S LL+K +PF++ PF+L       T 
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALTD  132

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PWH +S+WF N D TP+ T +G++ +  AS +  LN +FN+AMA D  ++ ++V K C+ 
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVSSVVTKDCKH  192

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFEGL+SLVD+GGGTG  A+AIAD FP  KCTVLDLPHVV GLE +KNLAYV G+MF+AI
Sbjct  193   VFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAI  252

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PPA A+ +KW+L DW+D +CV+ILKKCKEAIP +E GGKVIIVD    S Q GD DD E 
Sbjct  253   PPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSQQKGD-DDHEA  311

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             I++Q+F D+  MV   GR+R   +W K+F++AGF  YK T  LG RS+I+++
Sbjct  312   IETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 258/351 (74%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+T  ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ PF+L     + T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPVLTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ + FWD A  + +LN++FN+AMA D+ L+++++ K  + +F
Sbjct  131   HYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+E+KNL Y AGDMF+AIPP
Sbjct  191   EGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQESKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + ++
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSVE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q++ D+ MM+   GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 252/348 (72%), Gaps = 16/348 (5%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ HIWNH+FNFINS SLKCA+QLGIPD+IH+HGQP+ L +L+D L IN AKAH +
Sbjct  12    ELFQAQAHIWNHLFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAHFV  71

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMR+L  SGFF+ AK+ D +G+                + PF+L     I T PWH  
Sbjct  72    YRLMRILIHSGFFIKAKMPDNEGHE--------------GVTPFLLAMLDPILTDPWHHF  117

Query  417   SEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGL  596
             S+WF +++ TP+ + +G + W+ A +   LN +FN+ MA D  L+  +V K C++VF GL
Sbjct  118   SQWFQDNEETPFHSCHGTSMWELAGRQPRLNQFFNEGMASDARLVCTMVIKNCKDVFMGL  177

Query  597   DSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQA  776
             +SL+DVGGGTG VA+AIAD FP  KC+VLDLPHVV G E +KNLAYV GDMF+AIPP+ A
Sbjct  178   NSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSESSKNLAYVGGDMFEAIPPSDA  237

Query  777   IFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD-ELIQSQ  953
             + LKW+LHDW+D +CV+IL+KCKEAIP +E GGKVII+DM++ S QNGD DD+ E I++Q
Sbjct  238   VLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVIIIDMLLKSRQNGDDDDNAEAIETQ  297

Query  954   IFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             +F D+ MMV   GRER  K+W K+F +AGF  YK T  LG RS+I+++
Sbjct  298   LFFDMLMMVLVKGRERNEKDWAKLFFEAGFNGYKITPVLGLRSIIEVY  345



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   407 bits (1045),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 256/351 (73%), Gaps = 9/351 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNF+NS SLKCA+QLGIPDVIH HG+P+TL ELV  L I+ +KA  +
Sbjct  12    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPGI  71

Query  237   GRLMRVLTRSGFFL---DAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF    ++   +G+GY L   S LLIKD+PF++ PF+L     I T PW
Sbjct  72    YRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLDPILTQPW  131

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H VS WF ND P+ + TA+ +T W+ A  + ELNH+FN+AMA D  L+ +++   C+ VF
Sbjct  132   HYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVNECKGVF  191

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIA EF    CTV DLPHVVAGLE ++NL Y++GDMF+AIP 
Sbjct  192   EGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGSENLKYLSGDMFEAIPQ  251

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDWND +CVKILK+CKEAI GRE GGK+II+DM+V    N +V+     +
Sbjct  252   ADAILLKWILHDWNDEECVKILKQCKEAIKGRE-GGKLIIIDMVV--ENNKEVEGS--TE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM+   G+ER  KEW K+F DAGF  YK    LG RSLI+++P
Sbjct  307   TQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   407 bits (1046),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 256/353 (73%), Gaps = 7/353 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E+  AQ HIWNHIFNFINS SLKCA+QL IPDVIH+HG+P+TL++L+D L I   KA  
Sbjct  12    DELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDALPIKNEKAPF  71

Query  234   LGRLMRVLTRSGFFLDAKIKDGD-----GYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             + RLM++L  SGFF++AKI   +     GY L   S LL+K +PF++ PF+L       T
Sbjct  72    VYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALT  131

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH +S+WF N   +P+ T +G++ +D AS + +LN +FN+AMA D  ++ ++V K C+
Sbjct  132   DPWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVSSVVTKDCK  191

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFE L+SLVDVGGGTG  A+AIAD FP  KCTVLDLPHVV GLE TKNL YV G+MF+A
Sbjct  192   HVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESTKNLGYVGGNMFEA  251

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA A+ +KW+L DW+D +CV+ILKKCKEAIP +E GGKVIIVD    S Q GD DD E
Sbjct  252   IPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSLQKGD-DDHE  310

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
              I++Q+F D+  MV   GR+R  K+W K+F++AGF  YK T  LG RS+I+++
Sbjct  311   AIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  363



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   406 bits (1043),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 245/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMACD  L+ +++   C+
Sbjct  127   KPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+CKEAI  ++  GKVII+DMI+   +N  V D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIM---ENQKV-DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   406 bits (1044),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 193/354 (55%), Positives = 251/354 (71%), Gaps = 7/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  77

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  78    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  137

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  138   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  197

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  198   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  258   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMM-ENQKG---DEE  313

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  314   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY + FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q GD    E   
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 257/351 (73%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH HG+P+T  ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ PF+L     + T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLDPVLTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ + FWD A  + +LN++FN+AMA D+ L+++++ K  + +F
Sbjct  131   HYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLLKEGKGLF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIA+ FP   CTVLD PHVVAGL+E+KNL Y AGDMF+AIPP
Sbjct  191   EGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQESKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + ++
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSVE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q++ D+ MM+   GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 258/356 (72%), Gaps = 12/356 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
              EI+ AQTHIWNHIF+FINS SLK A+QL IPD+IH+HG+P+TL+EL + L+IN +K  H
Sbjct  11    TEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALSINHSKITH  70

Query  234   LGRLMRVLTRSGFFLDAKIKDGDG-------YALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             L RLMR+L  SGFFL +    G         Y L PP+ LL+KD P  + PF+L     I
Sbjct  71    LRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVTPFLLAMLDPI  130

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
                PWH VSEWF +D+PT ++ A+G+TFWD A  +  LNH+FN AMA D  L+M++V KY
Sbjct  131   LVKPWHHVSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMSVVMKY  190

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
              ++VFEGL+S+VDVGGGTG VA+ IA  FP+ +CTV DLPHVV GLE + NL YV GD F
Sbjct  191   SKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGSDNLTYVGGDFF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
              +IP A+A+ LKW+LHDW+D + VKILKKCKEAIP +E GGKVII+DM+V    +  + D
Sbjct  251   VSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMMV----DNKIGD  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DE I++QIF D+ MMV   GRER+ + W KIF++AGF  YK T  LG RSLI+++P
Sbjct  307   DESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILGLRSLIEVYP  362



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   405 bits (1040),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 253/351 (72%), Gaps = 9/351 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ HIWNHIF+FINS SLKCA+ LGIPD+I++H +P+TL EL+ TL ++ +KA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPSKARCV  71

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF   K+ + D   GY L   S LL+KD+PF++APF+      I T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H VS W  NDDPTP+ TA+G+TFWD    +   NH FN AMA D  L+  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL SLVDVGGGTG VA +IA  FP   CTV DLPHVVA L+ ++NL YV GDMF+AIPP
Sbjct  192   EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A  I LKW+LHDWND +CVKILKKCKEAI  RE GGKV+I++M++   Q G   +DE I+
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMM-ENQKG---EDESIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +QIF D+ MM+ + G+ER  KEW K+F+DAGF  YK T  LG RS+I++FP
Sbjct  307   TQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 252/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q GD    E   
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 253/352 (72%), Gaps = 6/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L  SGFF   +++   D +GYAL   S LL+KDHP +  PF+L       T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYALANASRLLLKDHPLSATPFLLAMLDPDLTEP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+G+T WD    +   N++FN+AMA D  L+ +++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGA  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+S VDVGGGTG VA+ I D FP    TVLDLPHVVA L+ +KNL Y+AGDMF+AIP
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGSKNLTYLAGDMFEAIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +C+KIL++C+ AIP +E GGKV+I+DM +   + GD +D+  +
Sbjct  250   PADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKVMIIDMAI-LNKKGD-EDESKV  307

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+F D+ MMV Y GRER  KEW K+F D+GF  YK T  LG RSLI+++P
Sbjct  308   ETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   404 bits (1038),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 253/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q GD    E   
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   404 bits (1038),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 248/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY   FWD A  + +LN+ FN+AMA D  LL  ++ K    VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLLKEGXGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA  FP   CTVLDL HVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     DD+ I+
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DDKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW KIF DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   404 bits (1037),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 254/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ P +L     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ + FWD A  + +LN++FN+AMA D  L+ +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGD+F+AIPP
Sbjct  191   EGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + I+
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   404 bits (1037),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G+   GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY + FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLIKEGKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + I+
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ M ++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 252/351 (72%), Gaps = 9/351 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ HIWNHIF+FINS SLKCA+ LGIPD+I++H +P+TL EL+  L ++ +KA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPSKARCV  71

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF   K+ + D   GY L   S LL+KD+PF++APF+      I T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H VS W  NDDPTP+ TA+G+TFWD    +   NH FN AMA D  L+  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL SLVDVGGGTG VA +IA  FP   CTV DLPHVVA L+ ++NL YV GDMF+AIPP
Sbjct  192   EGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A  I LKW+LHDWND +CVKILKKCKEAI  RE GGKV+I++M++   Q G   +DE I+
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMM-ENQKG---EDESIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +QIF D+ MM+ + G+ER  KEW K+F+DAGF  YK T  LG RS+I++FP
Sbjct  307   TQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 253/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF     ++ G+   GY L   S LL+ D   ++ P +L     I T PW
Sbjct  71    YRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TA+ + FWD A  + +LN++FN+AMA D  L+ +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGD+F+AIPP
Sbjct  191   EGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + I+
Sbjct  251   ADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 244/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+F+NS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S  L+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMACD  L+ +++   C+
Sbjct  127   KPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+CKEAI  ++  GKVII+DMI+   +N  V D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIM---ENQKV-DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 252/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDL HVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW++ +CVKILK+C+EAIP +ENGGKVII+DMI+   Q GD    E   
Sbjct  251   ADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 252/353 (71%), Gaps = 8/353 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L  SGFF   +++   D +GY L   S LL+KDHP ++ PF+L       T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYVLANASRLLLKDHPLSVTPFLLAMLDPDLTEP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+G+T WD    +   N++FN+AMA D  L+ +++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLVKECKGA  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+S VDVGGGTG VA+ I + FP    TVLDLPHVVA L+  K+L Y+AGDMF+AIP
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGGKSLTYLAGDMFEAIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL-  941
             PA AI LKW+LHDW+D +C+KILK+C+EAIP +E GGKV+I+DM +   QN   DDDE  
Sbjct  250   PADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAI---QNKKGDDDESN  306

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q+F D+ MMV   GRER  KEW K+F D+GF  YK T  LG RSLI+++P
Sbjct  307   VETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 252/359 (70%), Gaps = 7/359 (2%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ HIWNHIF+F+NS SLKCAVQL I DVI +HGQP+ L ELV  L 
Sbjct  1     MGSEVRASHELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALP  60

Query  210   INKAKAHHLGRLMRVLTRSGFFLDAKIKDG--DGYALGPPSCLLIKDHPFNLAPFVLGAS  383
             I+  KAH + RLMR+L  SGFF    +  G   GY L   S LL+KD+P +  PF+L   
Sbjct  61    ISPTKAHFIPRLMRILVHSGFFARESLSGGGEQGYVLTDASALLLKDNPMSARPFLLAML  120

Query  384   STIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALV  563
             + + T PW  ++ WF ND+PTP+   +G TFWD  +QD  L H+FN AMA D  L+ +L+
Sbjct  121   NPMLTDPWQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLM  180

Query  564   KKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAG  743
                C+ VF+G+DSLVDVGGGTG VA++IAD FP  KCTVLDLPHVVA L+ +KNL YVAG
Sbjct  181   IDDCKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAG  240

Query  744   DMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGD  923
             DMF+A+P A AIFLKW+LHDW+D +CVKIL++CKEAI      GKVIIVDM V +     
Sbjct  241   DMFEAVPEADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVENKNT--  298

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
               D E  ++Q+F D+ MMV   G+ER  KEW K+F+DAGF +YK T  LG RSLI+++P
Sbjct  299   --DKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEVYP  355



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 194/351 (55%), Positives = 250/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ T Y ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + I+
Sbjct  251   ADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F  AGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPILGLRSLIEVYP  357



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   401 bits (1031),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 251/354 (71%), Gaps = 7/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  77

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  78    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  137

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  138   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  197

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  198   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  257

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDW+D +C+KIL++ + AI G+E  GKVII+DM++   Q G   D+E
Sbjct  258   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMM-ENQKG---DEE  313

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T + G RSLI+++P
Sbjct  314   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVYP  367



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   401 bits (1030),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDL HVVAGL+ +KNL Y AGDMF AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFGAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW++ +CVKILK+C+EAIP +ENGGKVII+DMI+   Q GD    E   
Sbjct  251   ADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 253/358 (71%), Gaps = 6/358 (2%)
 Frame = +3

Query  30    IGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             +G  ++  +E++ AQ  IWNH F+FINS SLKCAVQL IPDVI +HGQP+TL ELV  L 
Sbjct  1     MGSDVRASHELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALP  60

Query  210   INKAKAHHLGRLMRVLTRSGFFLDAKIKDGD-GYALGPPSCLLIKDHPFNLAPFVLGASS  386
             I+  KAH + RL+R+L  SGFF    +  G+ GY L   S LL+KD+P +  PF+L   +
Sbjct  61    ISPTKAHFIPRLIRILVHSGFFASESLNGGEQGYVLTDASALLLKDNPMSARPFLLAMLN  120

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              I T PW  ++ WF ND+PTP+  A+G TFWD  +QD  L H+FN+AMA D  L+ +L+ 
Sbjct  121   PILTDPWQYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLMI  180

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               C+ VF+G+DSLVDVGGGTG VA++IA  FP  KCTVLDLPHVVA L+ + NL YVAGD
Sbjct  181   DDCKGVFQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSNNLEYVAGD  240

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+AIP A AIFLKW+LHDW+D +CVKIL++CKEAI      GKVIIVDM V +      
Sbjct  241   MFEAIPGADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKVIIVDMTVENKNT---  297

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              D E  ++Q+F D++MMV   G+ER  KEW  +F+DAGF +YK T  LG RSLI+++P
Sbjct  298   -DKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVYP  354



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 257/352 (73%), Gaps = 10/352 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE++ AQ HI NH+FN+INS SLKCA+QLGIPD+IH HG+ +T  +LV+ L INK+K 
Sbjct  102   ETNEVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSDLVNALPINKSKG  161

Query  228   HH-LGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             H  + RLMR+L  +GFF   +    +GY L P S LL+K+ P +LAPFV      +   P
Sbjct  162   HDCIYRLMRILIHAGFFTQGE----EGYLLTPTSRLLLKNEPLSLAPFVQAQLDPVLMDP  217

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH + EWF N+D TP+ TA+GK  ++ A  +Q LN+ FN+AM CD  L+M+++ K  + V
Sbjct  218   WHSLGEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLIMSVLIKNGKGV  277

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL SLVDVGGG G VA+AI++ FP+ KC+V DLPHVV GLE  KNL Y+AGDMFK +P
Sbjct  278   FEGLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGKNLTYIAGDMFKFVP  337

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
              A AI LKW+LHDW+D DCVKILKKCKEAIP +ENGGKVI++D+++ + +     D++  
Sbjct  338   SADAILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVIVIDIVIDNQKR----DNKSF  393

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+F+DV MMV+  G+ER  +EW K+F++AGF  YK +  LG RS+I+++P
Sbjct  394   ETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILGLRSVIEVYP  445



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   399 bits (1025),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++ NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EDSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD--GYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H L RLMR+L  SGFF   K+ + D  GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH +S WF NDD TP+ TA+G T WD  +     +H+FN AMA D  L+ +++   C+
Sbjct  127   KPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVIINECK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKIL++ KEAI  ++  GKVII+DMI+G+ Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKVIIIDMIMGN-QKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I+ Q+F D+ MMV   G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 250/351 (71%), Gaps = 9/351 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ HIWNHIFNFINS SLKCA+ LGIPD+I++H +P+TL EL+  L ++  KA  +
Sbjct  12    ELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPGKARCV  71

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF   K+ + D   GY L   S LL+KD+PF++APF+      I T PW
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H VS W  NDDPTP+ TA+G+TFWD    +   NH FN AMA D  L+  ++   C+EVF
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLINECKEVF  191

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL SLVDVGGGTG VA++IA  FP   CTV DLPHVVA L+ ++NL YV GDMF+AIPP
Sbjct  192   EGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDMFEAIPP  251

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A  I LKW+LHDWND +CVKILKKCKEAI  RE GGKV+I++M++   Q G   +D+ I+
Sbjct  252   ADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKVMIIEMMM-ENQKG---EDDSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +QIF D+ MM+   G+ER  KEW K+F+DA F  YK T  LG RS+I++FP
Sbjct  307   TQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 254/359 (71%), Gaps = 13/359 (4%)
 Frame = +3

Query  27    KIGMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL  206
             KIG    E NE++ AQ HI NH+ N++NS SLKCA+QLGIPD+IH HG+ +T  +LV+ L
Sbjct  6     KIG---DETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNAL  62

Query  207   AINKAKAHH-LGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGAS  383
              INK+K H  + RLMR+L  +GFF++ +    +GY L P S LL+K+ P NLAPFV    
Sbjct  63    PINKSKGHECIYRLMRILIHTGFFIEGE----EGYLLTPTSRLLLKNEPLNLAPFVQAHL  118

Query  384   STIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALV  563
               I   PWH + EWF N D TP+ TA+GK  +D A  D  LN  FN+AM  D  L+M+++
Sbjct  119   DPILMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVL  178

Query  564   KKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAG  743
              K  + VFEGL SLVDVGGG G VA+AI++ FP+ KC+V DLPHVV GLE   NL+Y+ G
Sbjct  179   IKNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITG  238

Query  744   DMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGD  923
             DMFK++P A AI LKW+LHDW+D DC KILKKCKEAIP +ENGGKVI++D ++   Q G 
Sbjct  239   DMFKSVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVI-DNQKG-  296

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
               DD+  ++Q+F DV MMV+  G+ER  +EW K+F+DAGF  YK +  LG RS+I+++P
Sbjct  297   --DDKSFETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 257/355 (72%), Gaps = 9/355 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E  EI+ AQ HI NH+FN++NS SLKCA+QL IPD+IH HG+P+TL  LV+ L INKAK 
Sbjct  10    ETREILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKG  69

Query  228   HH-LGRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
                + RLMR+L  SGFF+  KI   ++ +GY L P S LL+K+ P +L PFVL     I 
Sbjct  70    QDCIYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPFVLAQLDPIL  129

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               P+  +S+W  NDD TP+ TA+GK  ++ A ++  LN+ FN+AMA D  L++++V K  
Sbjct  130   MDPFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVIKTG  189

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
               +F+GL SLVDVGGG G VA+AI++ FP+ KCTV DLPHVV GLE +KNL+YV GDMFK
Sbjct  190   SGIFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSKNLSYVGGDMFK  249

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             ++P A AI LKW+LHDW+D DCVKILKKCKEAIP +EN GKVII+D++V S Q G   D+
Sbjct  250   SVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVVDS-QKG---DN  305

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +  ++Q+F+D+ MMV+  G+ER  +EW K+F DAGF  YK    LG RS+I+++P
Sbjct  306   KSFETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFI S SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  237   GRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGF    +++ G   +GY L   S LL+ D   ++ P VL     I T PW
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDDPTP+ TAY ++FWD A  + +LN+ FN+AMA D  LL +++ K  + VF
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG VA+AIA+ FP   CTVLDL HVVAGL+ +KNL Y AGDMF+AIPP
Sbjct  191   AGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILK+C+ AIP +E GGKVII+DMI+   Q     D + I+
Sbjct  251   AVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKVIIIDMIMMKNQG----DYKSIE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   TQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  R+  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 249/352 (71%), Gaps = 10/352 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE++ AQ HI NH+ N++NS SLKCA+QLGIPD+IH HG+ +T  +LV+ L INK+K 
Sbjct  10    ETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKG  69

Query  228   HH-LGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             H  + RLMR+L  + FF++ +    DGY L P S LL+K+ P +LAPFV      I   P
Sbjct  70    HECIYRLMRILIHASFFIEGE----DGYLLTPTSRLLLKNEPLSLAPFVQAQLDPILMDP  125

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH + EWF N D TP+ TA+GK  +D A  D  LN  FN+AM  D  L+M+ + K  + V
Sbjct  126   WHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALIKNGKRV  185

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL SLVDVGGG G VA+AI++ FP+ KC+V DLPHVV GLE   NL+Y+ GDMFK++P
Sbjct  186   FEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDMFKSVP  245

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
              A AI LKW+LHDW+D DC KILKKCKEAIP +ENGGKVI++D ++   Q G   DD+  
Sbjct  246   SADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVI-DNQKG---DDKSF  301

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +SQ+F DV MMV+  G+ER  +EW K+F+DAGF  YK +  LG RS+I+++P
Sbjct  302   ESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ+HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  N+++ AQ HIWNHIF+FINS+SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    GRER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/351 (55%), Positives = 252/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH-  233
             EI+ AQ HI NH+FN+IN  SLKCA+QL IPD+IH HG+P+TL  LV+ L INKAK    
Sbjct  13    EILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  234   LGRLMRVLTRSGFFLDAKIKDGD--GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
             + RLMR+L  SGFF+  KI + +  GY L P S LL+K+ P +LAPFVL     I   P+
Sbjct  73    IYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFVLAQLDPILMDPF  132

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
               +S+W  N D TP+ TA+GK  ++ A  +  LN+ FN+AMA D  L++++V K  R +F
Sbjct  133   QSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMISVVIKNGRGIF  192

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL SL DVGGG G VA+AI++ FP+ KCTV DLPHVV GLE +  L+YV GDMFK++P 
Sbjct  193   EGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNKLSYVGGDMFKSVPS  252

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D DCVKILKKCKEAIP +ENGGKVII+D++V S Q G   D++  +
Sbjct  253   ADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVVDS-QKG---DNKSFE  308

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F+D  MMV+  G+ER  +EWVK+F DAGF  YK    LG RSLI+++P
Sbjct  309   TQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVYP  359



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   396 bits (1017),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP ++ PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA A+ LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS+SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM+    Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMM-RENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   395 bits (1016),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ+HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ ++NL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 195/356 (55%), Positives = 249/356 (70%), Gaps = 7/356 (2%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
             +++  +E++ AQ HIWNHIF+FINS SLKCAVQL IPDVI +HGQP+TL ELV  L I+ 
Sbjct  3     SVRASHELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISP  62

Query  219   AKAHHLGRLMRVLTRSGFFLDAKIKD--GDGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
              KAH + RLMR+L  SGFF    +      GY L   S LL+KD+P +  PF+L   S I
Sbjct  63    TKAHFIPRLMRILVHSGFFAKESLSGCGEQGYILTDASALLLKDNPMSARPFLLAMLSPI  122

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
              T P+  ++ WF ND+PTP+    G T WD  +QD  L H+FN AMA D  L+ +LV   
Sbjct  123   LTDPYQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVIDD  182

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
             C+EVF+G+DSLVDVGGGTG VA++IAD FP  KCTVLDLPHVVA L+ +KNL YVAGDMF
Sbjct  183   CKEVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGDMF  242

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +A+P A AIFLKW+LHDW+D +CVKIL++CK A+      GKVIIV+M V +       D
Sbjct  243   EAVPAADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKVIIVEMTVENKNT----D  298

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
              E  ++Q+F D+ MMV   G+ER  KEW K+F+DAGF  YK T L G +SLI+++P
Sbjct  299   KESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   395 bits (1016),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   395 bits (1015),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  +   GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   395 bits (1015),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   395 bits (1015),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/343 (55%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI   +  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 243/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y+ GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KIL++ + AI G+E  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLG  1070
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T + 
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/340 (55%), Positives = 241/340 (71%), Gaps = 6/340 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K+H 
Sbjct  10    NELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKSHS  69

Query  234   LGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
             + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T PW
Sbjct  70    VYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLTKPW  129

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             + +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+ VF
Sbjct  130   NYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCKGVF  189

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A+PP
Sbjct  190   EGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEAVPP  249

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E I+
Sbjct  250   ADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEESIE  305

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
             +Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  306   TQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 243/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   ++E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---EEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLG  1070
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T + 
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 257/360 (71%), Gaps = 10/360 (3%)
 Frame = +3

Query  33    GMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI  212
             G  +Q   E++ AQ+H+WNH+FNFINS SLKC +QLGIPD+I +HG+P+TL EL  +L +
Sbjct  5     GNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHL  64

Query  213   NKAKAHHLGRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPFNLAPFVLGAS  383
             N AK+  L RLMR++  S FF++ KI   ++ DGY L P S LL++D P ++ PF L   
Sbjct  65    NDAKSPSLERLMRIMIHSKFFINVKISQVEETDGYWLTPASHLLLRDEPSSMRPFALVLL  124

Query  384   STIFTGPWHRVSEWFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMAL  560
               I   PWH VS+WF +D D TP+ T +G+TFW+ A+QD  LN +FN+AMACDT+L+ ++
Sbjct  125   DPILIDPWHHVSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASV  184

Query  561   VKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVA  740
             +   CR VFEGL S+VDVGGGTG VA+A+AD F    C VLDLPHVVAG E T+NL +VA
Sbjct  185   ITGDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTENLVFVA  244

Query  741   GDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNG  920
             GDMF+ IP A A+F+KW+LHDW D  C+KIL+KCK+A+  ++  GKVIIVD++V   +  
Sbjct  245   GDMFEYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKVIIVDIVVDFQK--  302

Query  921   DVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
                + + I++Q+F D+ MM    GRERT K+W ++F  AGF  YK T  LG RSLI+LFP
Sbjct  303   ---EHKAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIELFP  359



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 251/358 (70%), Gaps = 10/358 (3%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
              +Q   E++ AQ+H+WNH+FNF+NS SLKC +QLGIPD+I +HG+P+TL EL  +L +N 
Sbjct  7     GIQSTQELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLND  66

Query  219   AKAHHLGRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPFNLAPFVLGASST  389
             AK+  L RLMR++  S FF++ KI   ++ +GY L P S LL++D P ++ PF LG    
Sbjct  67    AKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHLLLRDEPLSVRPFALGMLDP  126

Query  390   IFTGPWHRVSEWFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
             I T PWH +SEWF  D D TP+ T +G+T W+ A QD  LN  FN+ MA D+ L+  ++ 
Sbjct  127   ILTDPWHHLSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSELVATVIT  186

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             K CR VFEGL S+VDVGGGTG VA+AIAD F    C VLDLPHVVAG E T++L +VAGD
Sbjct  187   KDCRNVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEGTESLTFVAGD  246

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF  IPPA A+F+KW+LHDW D  C+KILKKCK+AI  ++ GGKVIIVDM+V   +    
Sbjct  247   MFDYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKVIIVDMVVDFKK----  302

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
              + + I++Q+F D+ M+    G ERT K+W K+F+ AGF  YK T   G RSLI+LFP
Sbjct  303   -EHKAIETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAFGLRSLIELFP  359



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ ++NL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 243/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y+ GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KIL++ + AI G+E  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDP P+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA A+ LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C 
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCN  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWN+ +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 249/354 (70%), Gaps = 8/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  18    EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  76

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  77    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  136

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF N+DPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  137   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  196

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  197   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  256

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  257   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  312

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  313   SIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   394 bits (1012),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   394 bits (1011),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ + NL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSTNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ ++AI  ++  GKVII+DM++ + +     D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKR----DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   394 bits (1011),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   393 bits (1009),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM +   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMTM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   393 bits (1009),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE + AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP ++ PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
              PPA A+ LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   APPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 242/344 (70%), Gaps = 6/344 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDW+D +C+KIL++ + AI G+E  GKVIIVDM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIVDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLG  1070
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T + 
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKIL++  EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+ 
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFET  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   393 bits (1009),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 249/353 (71%), Gaps = 9/353 (3%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQ H+ N + NF  S+SLKCA++LGIPD I++HG+PITL ELV  L IN +
Sbjct  4     VENLTELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPS  63

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             KA+H+ RLMR L+ +GFF    +    GYAL     LL+K+ PFNL  F+   S  +   
Sbjct  64    KANHIYRLMRFLSNAGFF----VLQDQGYALTAAGRLLLKEEPFNLRAFIFYTSDPVLVK  119

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PW+ ++EWF NDDP+P+ TA+GK FW  A+++    + FN+AMA D+ L + ++   C+ 
Sbjct  120   PWNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMTQCKF  179

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VF+GL SLVDVGGGTG VARAIA  FP+ +C V DLPHV+AG E T+NL +VAGDM + +
Sbjct  180   VFDGLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEGTENLDFVAGDMLEKV  239

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P A AI LKW+LHDW+D DCVKILK CKEAIPGR+ GGKVII+DMI+ S     + DDE 
Sbjct  240   PAADAILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKVIIIDMILES----HMKDDES  295

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q   D+QM+  YG +ERT KEW K+F DAGF  YK    LG R LI+++P
Sbjct  296   VETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVLGVRCLIEVYP  348



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   ++   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CV+ILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFGDYKITPI  345



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF + K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S  F NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++  Q HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ ++NL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSRNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+ HDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   392 bits (1007),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAG   YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGLSDYKITPI  345



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 257/352 (73%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL +LV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMRVL +S FF   + +   + +GY L   S LL+KD   ++ PF+L       T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+ +T WD A  + +LN++FN+AMA D  L+ +++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGV  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+SLVDVGGGTG VA+AIA+ FP  KCTVLDLPHVVAGL+ +KNL Y AGDMF+AIP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +CVKILK+C+EAIP +E GGKVII+DM+V   Q GD    E  
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMV-KNQKGDCKSRE--  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +Q+F D+ MMV   G+ER  KEW K+F +AGF +YK T  LG RSLI+++P
Sbjct  307   -TQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   392 bits (1006),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  N+++ AQ H WNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ H+WNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   391 bits (1005),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 252/353 (71%), Gaps = 9/353 (3%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQ H+ N + NF  S+SLKCA++LGIPD I++HG+PITL ELV  L IN +
Sbjct  4     VENLTELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPS  63

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             KA+H+ RLMR L+ +GFF+   ++D  GYAL     LL+K+ PFNL  F+   S  +   
Sbjct  64    KANHIYRLMRFLSNAGFFV---LQD-QGYALTAAGRLLLKEEPFNLRAFIFYMSDPVLVK  119

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PW+ ++EWF NDDP+P+ TA+GK FW  A+++    + FN+AMA D+ L++ ++   C+ 
Sbjct  120   PWNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMTQCKF  179

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VF+GL SL DVGGGTG VARAIA  FP+ KC V DLPHV+AG E T+NL +VAGDM + +
Sbjct  180   VFDGLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEGTENLDFVAGDMLEKV  239

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P A AI LKW+LHDW+D DCVKILK CKEAIPGR+ GGKVII+DMI+ S     V DD+ 
Sbjct  240   PAADAILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKVIIIDMILES----QVKDDDS  295

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKT-TQLGSRSLIQLFP  1097
             +++Q+  D+QM++ YG +ERT KEW K+F DAGF  YK    LG   LI ++P
Sbjct  296   VETQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPALGVCCLIAVYP  348



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 239/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EA   +   GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   390 bits (1003),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     QHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   391 bits (1004),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 256/352 (73%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMRVL +S FF   + +   + +GY L   S LL+KD   ++ PF+L       T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+ +T WD A  + +LN++FN+AMA D  L+ +++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVKEGKGV  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +CVKILK+C+EAIP +E GGKVII+DM+V   Q GD    E  
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMV-KNQKGDCKSRE--  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +Q+F D+ MMV   G+ER  KEW K+F +AGF +YK T  LG RSLI+++P
Sbjct  307   -TQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   390 bits (1002),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HI NHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   390 bits (1002),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G T WD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD F   +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA A+ LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   390 bits (1002),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 242/344 (70%), Gaps = 6/344 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y+ GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYIGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHD ND +C+KIL++ + AI G+E  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLG  1070
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T + 
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 239/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ T +G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVV  L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/343 (54%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI D+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +      H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 241/344 (70%), Gaps = 6/344 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKI--KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDW+D +C+KIL++ + AI G+E  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLG  1070
              I++Q+F D+ MM   GG+ER  KEW K+F DAG   YK T + 
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGLSDYKITPIS  346



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 239/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  8     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  68    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  127

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ T +G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  128   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCK  187

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVV  L+ +KNL Y  GDMF+A
Sbjct  188   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  247

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  248   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  303

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  304   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI DVI++HG  +TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   IPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/356 (54%), Positives = 251/356 (71%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+LGIPD+I++HG+P+TL ELV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPSKTRCV  70

Query  237   GRLMRVLTRSGFF----LDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  SGFF    L++   + D   GY L   S LL+KD+P ++ PF+      I 
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++S WF NDDPTP+ TA+GK+FW+ A  + ++N++FN+AMA D  L  ++V   C
Sbjct  131   LSPWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATSVVIHKC  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             ++VFEGL+SLVDVGGGTG VA+AIA  FP+ +CT  DLPHVV GLE +  NL YV GD+F
Sbjct  191   KDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDVF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+  KW+LHDWND +CVKIL+KCKEAI      GKVII+DM+  + +     D
Sbjct  251   EAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKVIIIDMMRENKKG----D  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              E I++Q+F D+ MMV   G ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  307   SESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  8     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  68    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  127

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  128   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  187

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  188   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  247

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  248   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  303

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  304   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLP VVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  G+VII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL  TL I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +LAPF+        T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLDPALT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +P A  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DMI+   Q G   D+E
Sbjct  247   VPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMIM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++++F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 237/343 (69%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++  Q HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP  L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ T +G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVV  L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 255/366 (70%), Gaps = 16/366 (4%)
 Frame = +3

Query  33    GMALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAI  212
             G   Q+ N+++ AQ HIWNHIFNFINS SLKCA+QLGIPD I++HG+P+TL +L+  L+I
Sbjct  7     GTRSQDHNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSI  66

Query  213   NKAKAHHLGRLMRVLTRSGFFLDAKIKDG----DGYALGPPSCLLIKDHPFNLAPFVLGA  380
             + AK H + RL+R+L  SGF    K ++     +GY L   S LL+K+HPF+L  F+L  
Sbjct  67    HPAKTHAIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAM  126

Query  381   SSTIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMAL  560
                + TGPW  ++ WF NDDPTP+QT +G+  W  A  + ELN  FN+AMACD  ++ ++
Sbjct  127   LDPVLTGPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASI  186

Query  561   VKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVA  740
             + K C  VF+GL SLVDVGGGTG VA+A+AD FP   C V DLPHVVAGL++  NL +V 
Sbjct  187   LIKECEGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDGDNLKFVG  246

Query  741   GDMFKAIPPAQAIFLK------WVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIV  902
             GDMF+ IPPA AI LK      W++HDW+D  C+KILK CKEAI GR+ GGK+II+DM++
Sbjct  247   GDMFEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGRK-GGKLIIIDMVM  305

Query  903   GSTQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRS  1079
               TQ  D D  E   +++F D+ M+V Y G+ER  KEW K+F DAGF  +K T  LG RS
Sbjct  306   -ETQKEDKDATE---TELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLGLRS  361

Query  1080  LIQLFP  1097
             +++++P
Sbjct  362   VVEVYP  367



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 238/343 (69%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIFNFINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+K HP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ T +G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVV  L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+K+LK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 252/366 (69%), Gaps = 18/366 (5%)
 Frame = +3

Query  39    ALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINK  218
              +Q   E++ AQ+H+WNH+FNFINS SLKC +QLGIPD+I +HG+P+TL EL  +L +N+
Sbjct  7     GIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNE  66

Query  219   AKAHHLGRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPFNLAPFVLGASST  389
             AK+  L RLMR++  S FF++ KI   ++ +GY L P S LL++D P ++ PF L     
Sbjct  67    AKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHLLLRDEPLSVRPFALSMLDP  126

Query  390   IFTGPWHRVSEWFHND---------DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDT  542
             I T PWH VSEWF  D         D TP+ T +G+T W+ A QD  LN  FN+ MA D+
Sbjct  127   ILTDPWHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNEGMASDS  186

Query  543   LLLMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETK  722
              L+  ++ K CR VFEGL S+VDVGGGTG VA+A+AD F    C VLDLPHVVAG E T 
Sbjct  187   KLVATVITKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGTA  246

Query  723   NLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIV  902
             NL +VAGDMF+ IPPA A+F+KW+LHDW D  C+KIL+KCK+AI  ++  GKVIIVDM+V
Sbjct  247   NLVFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGKVIIVDMVV  306

Query  903   GSTQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRS  1079
                +     + + I++Q+F D+ +M    GR+RT K+W ++F+ AGF  YK T  LG RS
Sbjct  307   DFQK-----EHKAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLGLRS  361

Query  1080  LIQLFP  1097
             LI+LFP
Sbjct  362   LIELFP  367



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   388 bits (997),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 255/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL +LV  L ++  K  +
Sbjct  3     SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  62

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMRVL +S FF   + +   + +GY L   S LL+KD   ++ PF+L       T P
Sbjct  63    VYRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKP  122

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+ +T WD A  + +LN+ FN+AMA D  L+ +++ K  + V
Sbjct  123   WHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVKEGKGV  182

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+AIP
Sbjct  183   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEAIP  242

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +CVKILK+C+EAIP +E GGKVII+DM+V   Q GD    E  
Sbjct  243   PADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMV-KNQKGDCKSRE--  299

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +Q+F D+ MMV   G+ER  KEW K+F +AGF +YK T  LG RSLI+++P
Sbjct  300   -TQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  350



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 238/343 (69%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ T +G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVV  L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   388 bits (996),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 254/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMRVL +S FF   + +   + +GY L   S LL+KD   ++ PF+L       T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASXLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+ +T WD A  + +LN++ N+AMA D  L+ +++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGV  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+ IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEXIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +CVKILK+C+EAIP +E GGKVII+DM++   Q GD    E  
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMM-KNQKGDXKSRE--  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +Q+F D+ MMV   G+ER  KEW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   -TQLFFDMLMMVXVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 254/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WNHIFNF+NS SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  K  +
Sbjct  10    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMRVL +S FF   + +   + +GY L   S LL+KD   ++ PF+L       T P
Sbjct  70    VYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQLLLKDDSLSVRPFLLAMLDPTLTKP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+ +T WD A  + +LN++ N+AMA D  L+ +++ K  + V
Sbjct  130   WHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVKEGKGV  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL+SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGDMF+ IP
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDMFEPIP  249

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDW+D +CVKILK+C+EAIP +E GGKVII+DM++   Q GD    E  
Sbjct  250   PADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMM-KNQKGDCKSRE--  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +Q+F D+ MMV   G+ER  KEW K+F DAGF +YK T  LG RSLI+++P
Sbjct  307   -TQLFFDMLMMVLVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SL DVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  S FF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + L+W+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GGRER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 248/352 (70%), Gaps = 9/352 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRSGFFL----DAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
              RLMR++  SGFF     D + +    Y L   S LL+K+HP ++ PF+      + T P
Sbjct  71    HRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNP  130

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             W++ S WF N DPTP++TA+GK FWD A  D +LNH FN AMA D   + +LV + C+ V
Sbjct  131   WNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGV  190

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F GL+SLVDVGGGTG +A+AIA  FP  +C V DLPHVV+GL+ ++NL YVAGDMF+AIP
Sbjct  191   FMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIP  250

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDWND +CV ILKKCKEAI  +   GKVII+DM+V + +     DDE +
Sbjct  251   PADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKR----DDESV  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+F D+ MMV   G+ER+ KEW K+ + AG+  YK T  LG RSLI+++P
Sbjct  307   ETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/356 (54%), Positives = 249/356 (70%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+LGIPD+I++HG+P+TL ELV  L IN +K   +
Sbjct  51    ELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCV  110

Query  237   GRLMRVLTRSGFF----LDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  SGFF    L++   + D   GY L   S LL+KD+P ++ PF+      I 
Sbjct  111   YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  170

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++S WF NDDPTP+ TA+GK+ W+ A  + ++N++FN+AMA D  L   +V   C
Sbjct  171   LSPWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  230

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             ++VFEGL+SLVDVGGGTG VA+AIA  FP+ +CT  DLPHVV GLE +  NL Y+ GDMF
Sbjct  231   KDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYIGGDMF  290

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+  KW+LHDWND +CVKILKKCKEAI      GKVII+DM+  + +     D
Sbjct  291   EAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENKKG----D  346

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              E I++Q+F D+ MMV   G ER  KEW K+F DAGF  YK T  LG RSLI+++P
Sbjct  347   SESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  402



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  S FF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSGYKITPI  345



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDW+D +C+KIL++ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 240/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +P A  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM   GG+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   385 bits (990),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 248/350 (71%), Gaps = 8/350 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ HIWNHIFNFINS SLK A+QLGIPD IH HG+PI+L +L+  L +  AKA  +
Sbjct  10    ELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARCI  69

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF +AKIK  D   G+ L   S LL+KD+P ++ PF+L     I T PW
Sbjct  70    PRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLDPILTEPW  129

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H VS WF NDD TP+ T +G  FW+ A  + + N++FN+AMA D  L+M ++    + VF
Sbjct  130   HYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLIDEYKGVF  189

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+SLVDVGGGTG +A AIA  FP   C V DLPHVVAGL+ + NL YV G+MF+ +PP
Sbjct  190   EGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNMFEGVPP  249

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW++HDW+D +C+KIL++ KEAI G++ GGK+II+DM+   ++N  V DD+ ++
Sbjct  250   ADAILLKWIIHDWSDEECLKILQRSKEAIKGKK-GGKLIIIDMV---SENQQVIDDQYVE  305

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             +Q+F D+ MM    G+ER  KEW K+F DAGF  YK T  LG RS+I+++
Sbjct  306   TQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/355 (53%), Positives = 251/355 (71%), Gaps = 13/355 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + +++++GAQTH+WNHIF+FINS SLKCA++L IPD+IH++GQP+ L +L  +L+I+ +K
Sbjct  7     ERVSKLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A+ + RLMR+LT SGFF   K+ + +   GY L   S LL+KD+P ++ PF+        
Sbjct  67    ANCIYRLMRILTHSGFFSQHKVNENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW ++  WF NDDP+P+QTA+G   WD A ++  LN  FN AMA DT L+  +V + C
Sbjct  127   TQPWLQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIERC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + VF GL+SLVDVGGGTG +A AIA  FP  +CTV DLPHVVA L+ ++NL YV GDMF+
Sbjct  187   KGVFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             +IP A AI LKW+LHDWND  CVKILKKCKEAI       KVII+DM+V + +     DD
Sbjct  247   SIPSADAILLKWILHDWNDEQCVKILKKCKEAI-----KSKVIIIDMVVENEKG----DD  297

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             E I++Q+F D+ +MV Y G+ERT KEW K+    GF  YK T  LG RSLI+++P
Sbjct  298   ESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   384 bits (987),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 239/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I+++G P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G  FWD  +    + H FN AMA D  L+ +++   C+
Sbjct  127   KPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG +A+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  187   GVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +P A  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  247   VPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMM-ENQKG---DEE  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  303   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 245/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTH+WNHI +FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K H +
Sbjct  11    KLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR++ +SGFF      + +    YAL   S LL+K H  ++ P++       FT PW
Sbjct  71    HRLMRIMVQSGFFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDPAFTNPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             ++ S WF ND PT ++ A+GK FW+ A  D   N  FN AMA D  L+ ++V + C+ VF
Sbjct  131   NQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIEKCKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG + +AI+  FP  +CTV DLPHVV+GL+ ++NL YV GDMF+AIPP
Sbjct  191   MGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CVKILKKCKEAI  +   GKVII+DM+V    + ++ DDE  +
Sbjct  251   ADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKVIIIDMVV----DKEMKDDESFE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MMV + G+ER  KEWVK+ + AGF  YK T  +G RSLI+++P
Sbjct  307   TQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   382 bits (982),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 239/343 (70%), Gaps = 7/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FIN  SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  125

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF N+DPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  126   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  185

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  186   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  245

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  301

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  302   SIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 239/343 (70%), Gaps = 7/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDPVLT  125

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF N+DPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  126   TPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIDDCK  185

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD  P  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  186   GVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQGSKNLKYTGGDMFEA  245

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  301

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  302   SIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 238/343 (69%), Gaps = 7/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L P++      + T
Sbjct  66    SHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDPVLT  125

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  126   NPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  185

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SL DVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  186   GVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGSKNLKYTGGDMFEA  245

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +C+KILK+ + AI  ++  GKVII+DM++   Q G   D+E
Sbjct  246   VPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMM-ENQKG---DEE  301

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  302   SIETQPFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 245/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTH+WNHIF+FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K H +
Sbjct  11    KLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR++  SGFF      + +    YAL   S LL+K +  ++ PF+      + T PW
Sbjct  71    HRLMRIMVHSGFFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLDPVMTNPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             ++ S WF N +PT ++   GK FW+ AS D   N  FN AMA D  L+ +LV + C+ VF
Sbjct  131   NQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTSLVTEKCKGVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG++ +AIA  FP  +CTV DLPHVV+GL+ ++NL YV GDMF+AIPP
Sbjct  191   MGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +CV ILKKCKEA+  +   GKVII+DM+V    + ++ DDE  +
Sbjct  251   ADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKVIIIDMVV----DKEMKDDESFE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MMV   G+ER  KEWVK+F+ AGF  YK T  +GSRSLI+++P
Sbjct  307   TQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   382 bits (980),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 246/356 (69%), Gaps = 9/356 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQ H+WNHIFNFINS SLKCA+QLGIPD+IH H +P+TL ELV  L +   K
Sbjct  7     ERSSELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRPNK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
                + RLMR+L  SGFF   +++   D +GY L   S LL+KDHP ++    L       
Sbjct  67    TLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASRLLLKDHPLSIT-PFLLLLDPDL  125

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW   S WF NDDPTP+ TA+G+T WD    +   N++FN+ MA D  L+ +++ K C
Sbjct  126   TEPWDYASAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLVKEC  185

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             +  FEGL+S VDVGGGTG VA+ I + FP    TVLDLPHVVA L  +KNL Y+AGD+F+
Sbjct  186   KGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGSKNLTYLAGDLFE  245

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             AIPPA AI LKW+LHDW+D +C+KILK+C+EAIP +E GGKV+I+DM +   QN   DDD
Sbjct  246   AIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAI---QNKKGDDD  302

Query  936   EL-IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             E  +++Q+F D+ MMV   GRER  KEW K+F D+GF  YK T  LG RSLI+++P
Sbjct  303   ESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  358



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/356 (53%), Positives = 244/356 (69%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQTH+WNHIFNFINS +LKCA+QLGIPD+I +HG+P+TL ELV  L IN +K+  +
Sbjct  11    ELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCV  70

Query  237   GRLMRVLTRSGFFLDAKI-------KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  +GFF   K+        +  GY L   S LL+KD+P ++ PF+      I 
Sbjct  71    YRLMRILIHTGFFAQQKLISSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++  WF NDDPTP+ TA+GKT W+ A  + +LN++FN+AMA D  L  +++   C
Sbjct  131   LSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIHKC  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             ++VFEGL+SLVDVGGG G  A+AIA  FP  +CT  DLPHVV GL+ +  NL YV GDMF
Sbjct  191   KDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKYVGGDMF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AI PA A+ LKW+LHDWND +CVKILKKCKEAI      GKVII+DMI  + +     D
Sbjct  251   EAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKG----D  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+ I++Q+F D+ MMV   G ER  KEW K+F  AGF  YK    LG RSLI+++P
Sbjct  307   DKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   381 bits (978),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 245/356 (69%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQTH+WNHIFNFINS +LKCA+QLGIPD+I +HG+P+TL ELV  L IN +K+  +
Sbjct  11    ELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRCV  70

Query  237   GRLMRVLTRSGFFLDAKI----KDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  +GFF   K+     + D   GY L   S LL+KD+P ++ PF+      I 
Sbjct  71    YRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQAMLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++  WF NDDPTP+ TA+GKT W+ A  + +LN++FN+AMA D  L  +++   C
Sbjct  131   LSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIHKC  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             ++VFEGL+SLVDVGGG G  A+AIA  FP  +CT  DLPHVV GL+ +  NL YV GDMF
Sbjct  191   KDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKYVGGDMF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AI PA A+ LKW+LHDWND +CVKILKKCKEAI      GKVII+DMI  + +     D
Sbjct  251   EAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKG----D  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+ I++Q+F D+ MMV   G ER  KEW K+F  AGF  YK    LG RSLI+++P
Sbjct  307   DKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 249/355 (70%), Gaps = 7/355 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
              + + ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+P++L +L+  L I+ +K
Sbjct  8     HDASNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
                + RLMR++T SGFF    I + +    Y L   S LL+KD+P N+  FV      + 
Sbjct  68    TFFIYRLMRIMTHSGFFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFVHLVFDPVL  127

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PWH++S W  NDDPT ++T +G  FWD A ++ ++N+ FN AMA D  L+ ++V + C
Sbjct  128   TKPWHQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVIEKC  187

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             +EVF GL+SLVDVGGGTG +A+A+A  FP  +CTV DLPHVV GL+ T NL YV GDMFK
Sbjct  188   KEVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGTDNLKYVGGDMFK  247

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
              IPPA AI LKW+LHDWND +CVKILKKCKE++  + N GKVII+DM++  T+ GD+++ 
Sbjct  248   EIPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKVIIIDMVL-DTKKGDINES  306

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
                ++Q+F D+ M V   G+ER  KEW+K+ + AGF  YK    LG RSLI+++P
Sbjct  307   G--KTQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPILGLRSLIEVYP  359



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 247/356 (69%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+L IPD+I++HG+P+TL +LV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPSKTRCV  70

Query  237   GRLMRVLTRSGFF----LDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  SGFF    L++   + D   GY L   S LL+KD P ++ PF+      I 
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQAMLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++S WF +DDP P+ TA+GK+FW+ A  + ++N++FN+AMA D  L   +V   C
Sbjct  131   LSPWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             ++VF+GL+SLVDVGGGTG VA+AIA  FP+ +CT  DLPHVV GLE +  NL YV GDMF
Sbjct  191   KDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+ LKW+LHDWND +CVKILKKCKEAI      GKVII+DM+  + +     +
Sbjct  251   EAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENKKG----N  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DE  ++Q+F D+ MMV   G ER  KEW K+F DAGF  YK T  LG RSLI++ P
Sbjct  307   DESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVCP  362



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/355 (53%), Positives = 248/355 (70%), Gaps = 8/355 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
              +  E++ AQ +IWNHIFNFINS SLK A+QLGIPD IH HG+PI+L  L+  L I+ AK
Sbjct  6     HDAQELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIHPAK  65

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A  + RLMR+L  SGFF  AK+K+ D   GY L   S LL+KD+PF++ PF+L     I 
Sbjct  66    ARCIPRLMRILIHSGFFAKAKLKENDEAEGYVLTKASKLLLKDNPFSVTPFLLAMLDRIL  125

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PWH +S WF NDD T + TA+G  FW+ A  + +LN++FN+AMA D  L+M ++    
Sbjct  126   TEPWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLIDEY  185

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + VFEGL SLVDVGGGTG +A+AIA  FP   C V DLPHVVAGL  ++NL YVAGDMF+
Sbjct  186   KGVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGLAGSENLKYVAGDMFE  245

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
              +PPA AI LKW++H W+D +C+K+LK  KEAI G +  GK+II+DM++   +N  V D 
Sbjct  246   GVPPADAILLKWIMHVWSDEECLKLLKLSKEAIKGNKE-GKLIIIDMVL---ENRQVTDH  301

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             + I+SQ+F D+ MM    G++R  KEW K+F DAGF  YK T  LG RS+I+++P
Sbjct  302   QSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVYP  356



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 249/356 (70%), Gaps = 10/356 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + + E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  13    ESVGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  72

Query  225   AHHLGRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF       + + + Y+L   + LL+KD+P+N+ P +L    ++ 
Sbjct  73    AQYVHRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTRLLLKDNPWNMRPLLLFELDSVL  132

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF ND+ T +  A+  TFW+ A QD  + + FN+AMA D++L   LV   C
Sbjct  133   TKPWDCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSILASKLVVSKC  192

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +FEGL SLVDVGGG G +A+ IA+ FP   CTV DLPHVV+ L+  KNL YV GDMF+
Sbjct  193   KGIFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGCKNLKYVGGDMFQ  252

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA+AI LKW+LHDW+D DCVKIL++C++AI   G++  GKVII+DM V    NG   
Sbjct  253   AVPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKVIIIDM-VRENLNG---  308

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             D+  I++Q+F D+ MMV   G ER  KEW K+F DAGF  YK    LG+R+LI+L+
Sbjct  309   DEGSIETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELY  364



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 243/352 (69%), Gaps = 6/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ H+WN++FNFINS SLKCA+ LGIPDVI  HG+P+T+ ELV  L IN  KA  
Sbjct  15    HELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAALPINATKASS  74

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L  SGFF   K+ + D   GY L   S LL+   P ++ PF+      I T P
Sbjct  75    IYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASRLLLNGDPLSVTPFLKAMLDPILTKP  134

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH +  WF NDDPTP+ TA+G+TFWD    D  L+H+FN+ MA D  L+ +++   C  V
Sbjct  135   WHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVSSILIHKCEGV  194

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F+GL+S+VDVGGG G VA+AI+D FP  +CTV DLP VVAGL++  NL YV GDMF+A+P
Sbjct  195   FQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRGNLKYVGGDMFEAVP  254

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
              A A+ LKW+LHDWND +CVKILK+CKEAI     GGK II+DM++ + +N  V+D   I
Sbjct  255   AADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKAIIIDMVL-TEKNHKVNDAS-I  312

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+F D+ MMV   G+ER  +EW  +F  AGF  YK T  +G RSLI+++P
Sbjct  313   ETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLRSLIEVYP  364



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   377 bits (969),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 238/343 (69%), Gaps = 7/343 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGIPD+I++HG P+TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSELTSALPIHPTK  65

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +  + RLMR+L  SGFF   K+   D +GY L   S LL+KDHP +L PF+      + T
Sbjct  66    SPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLDPVLT  125

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF NDDPTP+ TA+G TFWD  +    + H FN AMA D  L+ +++   C+
Sbjct  126   TPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIINDCK  185

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SL+DVGGG G VA+AIAD FP  +CTVLDLP+VVA L+ +KNL Y  GDMF+A
Sbjct  186   GVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQGSKNLKYTGGDMFEA  245

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ +EAI  ++  GKVII+DM++   Q G   D+E
Sbjct  246   VPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMM-ENQKG---DEE  301

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAG   YK T +
Sbjct  302   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGISDYKITPI  344



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 244/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTH+WNHI +FINS SLKC V LGIPD+IH HGQP++L  L+ +L I+ +K H +
Sbjct  11    KLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR++  SGFF      + +    YAL   S LL+K +  ++ PF+      + T PW
Sbjct  71    HRLMRIMVHSGFFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQAMLDPVLTTPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             ++ + WF N +PT ++ A GK FW+ A  D  +N  FN AMA D  L+ ++V + C+ VF
Sbjct  131   NQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVIEKCKRVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG + +AIA  FP  +CTV DLPHVV+GL+ ++NL YV GDMF+AIPP
Sbjct  191   MGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDMFEAIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D D V ILKKCKEA+  +   GKVII+DM+V    + ++ DDE  +
Sbjct  251   ADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKVIIIDMVV----DKEMKDDESFE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+F D+ MMV++ G+ER  KEWVK+F+ AGF  YK T  +G RSLI+++P
Sbjct  307   TQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/354 (53%), Positives = 247/354 (70%), Gaps = 8/354 (2%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             + NE++ AQ HIWNHIF+FINS SLK AVQLGIPD IH HG+PI+L +L+  L I+ AKA
Sbjct  7     DANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIHPAKA  66

Query  228   HHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
               + RLMR+L  SGFF  AKI++ D   GY L   S LL+KD+P ++APF+L     I  
Sbjct  67    RGIPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLAMLDPILI  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PWH +S WF NDD T + TA+G  FW+  + D  LN++FN+AMA D  L+M ++    +
Sbjct  127   KPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLIDEHK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              +FEGL SLVDVGGGTG +A AIA  FP  +CTV DLPHVV GL+ T+NL YVAGDMF+A
Sbjct  187   GLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKYVAGDMFEA  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IPPA A+ LKW++H W    CVK+LK CKEAI G++ GGK+IIVD+++ S     V D +
Sbjct  247   IPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGKK-GGKLIIVDLVLESQH---VTDHQ  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +++Q F D+ +M    G+E+  K+W K+F DAGF  YK    LG RS+I+++P
Sbjct  303   DVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVYP  356



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 246/352 (70%), Gaps = 9/352 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRSGFFL----DAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
              RLMR++  SGFF     D + +    Y L   S LL+K+HP ++ PF+      + T P
Sbjct  71    HRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNP  130

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             W++ S WF N DPTP++TA+G   WD A  D +LN+ FN AMA D   + +LV + C+ V
Sbjct  131   WNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIEKCKGV  190

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F GL+SLVDVGGGTG +A+AIA  FP  +C V DLPHVV+GL+ ++NL YV+GDMF+AIP
Sbjct  191   FMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVSGDMFEAIP  250

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA AI LKW+LHDWND +CV ILKKCKEAI  +   GKVII+DM+V + +     DDE +
Sbjct  251   PADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKR----DDESV  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             ++Q+F D+ MMV   G+ER+ KEW K+ + AG+  YK T + G RSLI+++P
Sbjct  307   ETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  358



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 242/332 (73%), Gaps = 7/332 (2%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLMRVLTRSGFFLDAKIKD  296
             S+KCA+QLGIPDVIH+HGQP+TL++L+D L I  AKA  + RLM++L  SGFF++AKI  
Sbjct  2     SVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFVYRLMQILIHSGFFIEAKIPG  61

Query  297   GD-----GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSEWFHNDDPTPYQTA  461
              +     GY L   S LL+K +PF++ PF+L       T PWH +S+WF N D TP+ T 
Sbjct  62    NENDNQKGYLLTSASELLLKSNPFSMTPFLLAILDPTLTDPWHHLSQWFQNSDETPFYTC  121

Query  462   YGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLDSLVDVGGGTGMVAR  641
             +G++ +  AS +  LN +FN+AMA DT L+  +V K C+ VFEGL+SLVDVGGGTG  A+
Sbjct  122   HGRSIYAFASHEPWLNQFFNEAMASDTRLVSRVVTKDCKHVFEGLNSLVDVGGGTGTFAK  181

Query  642   AIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDC  821
             AIAD FP  KCTVLDLPHVV GLE +KNLAYV G+MF+AIPPA A+ +KW+L DW+D +C
Sbjct  182   AIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDDEC  241

Query  822   VKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQIFADVQMMVYYGGRER  1001
             V+ILKKCKEAIP +E GGKVIIV+M   S Q GD DD E I++Q+  D+++M    GR+ 
Sbjct  242   VQILKKCKEAIPSKEKGGKVIIVEMFCKSQQKGD-DDHEAIETQLCYDMEVMALGKGRQI  300

Query  1002  TLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
               K+W K+F++AGF  YK T  LG RS+I+++
Sbjct  301   NEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  332



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   375 bits (962),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 238/343 (69%), Gaps = 11/343 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ AQ HIWNHIF+FINS SLK A+QLGI DVI++HG  +TL EL   L I+  K
Sbjct  7     EHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
             +H + RLMR+L  SGFF   K+   D +GY L   S LL+KD P +L PF+     T   
Sbjct  67    SHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFL-----TAMN  121

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW+ +S WF N+DPTP+ TA+G TFWD  +    + H+FN AMA D  L+ +++   C+
Sbjct  122   KPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAMASDARLVTSVIIDDCK  181

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VFEGL+SLVDVGGGTG VA+AIAD FP  +CTVLDLPHVVA L+ +KNL Y  GDMF+A
Sbjct  182   GVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTRGDMFEA  241

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA  + LKW+LHDWND +CVKILK+ ++AI  ++  GKVII+DM++ + +     D+E
Sbjct  242   VPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKR----DEE  297

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL  1067
              I++Q+F D+ MM    G+ER  KEW K+F DAGF  YK T +
Sbjct  298   SIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  340



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 250/357 (70%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKD---GDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF    + D    D Y+L   + LL+KD+P+++ P +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD   +  A+  TFW+ A QD  +N+ FN AMA D++L+  +V   C
Sbjct  127   TKPWDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVVCKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +F+G++SLVDVGGG G +A+ IA+ FP   CTV DLPHVV+ L+ +KNL YV GDMF+
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA AI LKW+LHDW+D DCVKIL++CK+AI   G++  GKVII+DM V    NG   
Sbjct  247   AVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAGKVIIIDM-VRENLNG---  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+  I++Q+  D+Q+MV + G ER  KEW K+F DAGF  YK    LG+R+LI+L+P
Sbjct  303   DEGSIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 245/358 (68%), Gaps = 21/358 (6%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTHIWNHIF+FINS SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   +
Sbjct  11    KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  237   GRLMRVLTRSGFF----------LDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASS  386
              RLMR++  SGFF          LDAK      Y L   S LL+K+HP ++ PF+     
Sbjct  71    HRLMRIMIHSGFFSQQNHDMENQLDAK------YVLTDASVLLLKNHPMSVTPFLHAMLD  124

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              I T PW++ S WF N D TP++TA+G   WD A  D + N+ FN AMA D   + +LV 
Sbjct  125   PILTNPWNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVI  184

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + C+ +F GL+SLVDVGGGTG +A+AIA  FP  +C V DLPHVV+GL+ ++NL YVAGD
Sbjct  185   EKCKGMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGD  244

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+AIPPA AI LKW+LHDWND +CV ILKKCKEAI  +   GKVII+DM+V + +    
Sbjct  245   MFEAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKVIIIDMVVENEKR---  301

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              DDE +++Q+F D+ MMV   G+ER+ KEW K+ + AG+  YK T  LG RSLI+++P
Sbjct  302   -DDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 243/356 (68%), Gaps = 9/356 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  NE++ A  HIWNH FNF+ S SLKCA++LGIPD+IH HGQP+TL +LV  L I ++K
Sbjct  7     ESTNELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             +HH+ RLM+VL +SGFF   K+ D +GY L   S LL+K+HP    P+VL     I T P
Sbjct  67    SHHIHRLMQVLVQSGFFSLQKVSDENGYLLTQSSLLLVKEHPVTARPYVLAVLDPILTKP  126

Query  405   WHRVSEWFHNDD---PTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             WH +S WF N D    TP+  A+ + FWD AS +   N +FN+AMA D+ ++  +V   C
Sbjct  127   WHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVVISNC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             +EVF+GL SLVDVGG TG + +AIA+ FP+ KCTVLDLPHVVAGL+ TKNL Y+ G+MF+
Sbjct  187   KEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGTKNLNYIGGNMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG-GKVIIVDMIVGSTQNGDVDD  932
              IPPA AI LK + H  +D DC+K+LKKCKEA+   E G GKVII+D+++ S    D   
Sbjct  247   FIPPADAILLKMICHILDDEDCLKLLKKCKEAVMNNEEGSGKVIIIDIVMESPNWVD-KA  305

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              E IQ     D++M+V   G+ER  K+W K+F DAGF  YK    LG RS+I++FP
Sbjct  306   TETIQ---LYDLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEVFP  358



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 247/353 (70%), Gaps = 10/353 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ+H+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +KA ++
Sbjct  11    EMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  237   GRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMR+L  SGFF       I + + Y+L   + LL+KD+P+++ P +L     + T PW
Sbjct  71    HRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLLLDPVLTKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
               +S WF NDD   +  A+ KTFW+ A QD  LN+ FN+AMA D++L   LV   C+ +F
Sbjct  131   DCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSILASKLVVSKCKGIF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             +G++SLVDVGGG G + + IA+ FP   CTV DLPHVV+ L+  KNL YV GDMF+A+PP
Sbjct  191   DGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFEAVPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIP--GRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             A A+ LKW+LHDW+D DCVKILK+CK+AI   G++  GKVII+DM V   QN    D+  
Sbjct  251   ADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKVIIIDM-VRENQN---RDEGS  306

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             I++Q+  D++MMV   G ER  KEW K+F DAGF  YK    LG+R+LI+L+P
Sbjct  307   IETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 242/356 (68%), Gaps = 11/356 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQ H W H  NF+NS  LKCA+QLGIPDVIH HGQP+ L +L+  L++   K
Sbjct  8     ERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKI----KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             A  L RLMRVL  SGFF   K+    ++ +GY+L   S  L+KD P +  PF+L     I
Sbjct  68    APCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDPI  127

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
              T PWH + +WF N+DPTP+ TA+ K+FWD A  + +LN  FN+ M  D+ L+  ++ + 
Sbjct  128   LTAPWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVRQ  187

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
              +EVFEGL SLVDVGGGTG + +AIA  FP  KC V D PHVVA LE  +NL  V G++F
Sbjct  188   YKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGENLEIVGGNIF  247

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA AI LKW+LHDW+D +CVKILKKCK AIP +  GGKVII+DM+V S +     D
Sbjct  248   EAIPPADAILLKWILHDWSDEECVKILKKCKGAIPNK--GGKVIIIDMVVESNKG----D  301

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             ++ +++Q+F D+ MMV   G+ER  KEW K+F  AGF +YK T  LG RSLI+++P
Sbjct  302   NKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   374 bits (959),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 243/362 (67%), Gaps = 14/362 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK---  224
              E + AQ HIWN IFNFINS SLKCA+QLGIPD IH HG+P+TL +L+  L I++ K   
Sbjct  16    TEQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLD  75

Query  225   AHHLGRLMRVLTRSGFFLDAKI-----KDGDGYALGPPSCLLIKDHPFNLAPFVLGASST  389
             +H + RLMR+L  S FF   ++     +  DGY L   S LL++D+PF+L P +L     
Sbjct  76    SHLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTPILLTVLDP  135

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
             I T PWH +S W  +DDPTP+ T +G  FWD   +D    + FN+AMA D  L+++++  
Sbjct  136   IMTKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVLFD  195

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
                 VFEGL+SLVD+ GGTG V +AIAD FP  +CTV DLPHV+A L+ + NL +V GDM
Sbjct  196   KRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGSTNLKFVGGDM  255

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGREN-GGKVIIVDMIVGSTQN---  917
             F  IPPA AIF+KW+LHDW+D DCVK+LK+CK AI  + N  GKVI+VDM++   QN   
Sbjct  256   FDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGKVILVDMVIVEKQNNKD  315

Query  918   -GDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQL  1091
              G   D +L ++QI  D+ MMV + GRER   EW K+F+DAGF  YK T  LG RSLI++
Sbjct  316   IGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKITPILGVRSLIEV  375

Query  1092  FP  1097
             FP
Sbjct  376   FP  377



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 248/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQ+HIWNHI ++INS SLKC V LGIPD+IH +G+P+ L +L+ +L I+ +KA ++
Sbjct  11    KLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIHSSKAGNI  70

Query  237   GRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
              RLMRV+  SGFF    I + +    Y L   S LL+K HPF++ PF+L ++  I   PW
Sbjct  71    PRLMRVMIHSGFFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLLCSNDPILKKPW  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H +S WF NDD TP++TA+G   WD A++D ++N+  N++MACD  L+  +  + C+++ 
Sbjct  131   HHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVFIEKCKDML  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
              GL+SLVDVGGGTG +ARAIA  FP  KCTV DLPHVVA L+ ++NL Y+ GDMFK IPP
Sbjct  191   NGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGSENLEYIGGDMFKEIPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
             A AI LKW+LHDW+D +C+KILK CKEAI  +   GKVII+DM++      D  DD+ ++
Sbjct  251   ADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKVIIIDMVIEE----DKGDDKSVE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+  D+ MMV   G+ER++KEW  + + AGF  YK +  LG RS+++++P
Sbjct  307   TQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 248/358 (69%), Gaps = 11/358 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++  E++GAQ HIWN+IFNFINS SLKCAVQLGIPD IH+HG+P+TL +L+  L +++ K
Sbjct  20    EKATELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQNK  79

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD-----GYALGPPSCLLIKDHPFNLAPFVLGASST  389
             A ++ RLMR+L  SGFF    I + D     GY L   S LL+ D+P ++APF+L     
Sbjct  80    APYVYRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLLAMLDP  139

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
             + T PW  +S WF NDDPT + T  G  FW    Q+ ++ ++FN AMA D  L++++V +
Sbjct  140   VLTKPWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVIE  199

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+ VF+ L+S VDVGGGTG VA+AIA  FP  +CTV DLPHVV  L+   NL +V GDM
Sbjct  200   NCKWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGKDNLKFVGGDM  259

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGR-ENGGKVIIVDMIVGSTQNGDV  926
             F+ +PPA AI LKW+LHDW+D +CVKILKKCKEAI  +    GKVII+D+++   +N D 
Sbjct  260   FQQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVIIIDIMI---ENKD-  315

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +DD+  ++Q+F D+ MMV   G+ER  KEW K+F D+GF  YK    LG RSLI+++P
Sbjct  316   EDDKSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVYP  373



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 239/356 (67%), Gaps = 13/356 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHIFNFINS SLKCAV+L IPD+I++HG+P TL +LV  L IN +K   +
Sbjct  11    ELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTRCV  70

Query  237   GRLMRVLTRSGFF----LDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              RLMR+L  SGFF    L++   + D   GY L   S LL+KD P ++ P +      I 
Sbjct  71    YRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAVLDPIL  130

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW ++S WF +DDP P+   +GK+FW+ A  + ++N++FN+AMA D  L   +V   C
Sbjct  131   LSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIHKC  190

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMF  752
             + VFEGL+SLVDVGG TG VA+AIA  FP+ +CT  DLPHVV GLE +  NL YV GDMF
Sbjct  191   KNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMF  250

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+ LKW+LHDWND +CVKILKKCKEAI      GKVII+DM+  + +     D
Sbjct  251   EAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMRENKKG----D  306

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DE  ++Q+F  + MMV   G ER  KEW K+  D GF  YK T  LG RSLI+++P
Sbjct  307   DESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVYP  362



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 244/351 (70%), Gaps = 10/351 (3%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLG  239
             ++ AQ H+WNH  NF+NS +LKCAV+LGIPD I+ HGQPITL ELV  L+IN  KA  L 
Sbjct  12    LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  240   RLMRVLTRSGFFLDAKIKDGDG---YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWH  410
             RLMRVL  SGFF   +    +    Y+L   S  L+KD P + AP +L       T P H
Sbjct  72    RLMRVLVHSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPHLTNPCH  131

Query  411   RVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFE  590
              +S+WF N DPTP+ TAYGK FWD A+ + + N++FN+AMA D+ L+ ++V   C+EVF 
Sbjct  132   FLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFR  191

Query  591   GLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPA  770
             GL SL+DVGGGTG +A+ IA  FP  KCTV D PHVVA L+  +NL +V GD+F+AIPPA
Sbjct  192   GLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIFEAIPPA  251

Query  771   QAIFLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
              AI LK +LH+W+D +CVKILKKCKEAI P ++ GGKVII+D+++ + +      DE ++
Sbjct  252   DAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDIVMENNKG-----DEAVE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYK-TTQLGSRSLIQLFP  1097
             +Q+F D+ MMV   G+ER  +EW  +F  AGF +YK T+ LG RSLI+++P
Sbjct  307   AQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   371 bits (953),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 190/367 (52%), Positives = 246/367 (67%), Gaps = 14/367 (4%)
 Frame = +3

Query  30    IGMALQEMN--EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDT  203
             I + L E N  EI+GAQ HIWN IFNFINS SLKCA+QLGIPD+I+ HG+P+T+ +L   
Sbjct  14    IDLILNEENSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLA  73

Query  204   LAINKAKAHHLGRLMRVLTRSGFFLDAKIK-------DGDGYALGPPSCLLIKDHPFNLA  362
             L IN+ K+  + RLMR+L  SGFF   K +       + +GY +   S LL+KD+P ++ 
Sbjct  74    LPINRKKSPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVT  133

Query  363   PFVLGASSTIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDT  542
             PF+L     + T PW  +S WF N DPTP+ TA G  FWD  S + +L  +FN AMA D 
Sbjct  134   PFLLAMLDPVMTKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDA  193

Query  543   LLLMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETK  722
              L+ ++V + C+ VFEG++SLVDVGGGTG VA +IA  FP  +CTV DLPHVVA L+   
Sbjct  194   RLVTSVVIEKCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGN  253

Query  723   NLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIP-GRENGGKVIIVDMI  899
             NL +V GDMF  +P  + + LKW+LHDWND + VKILKKCKEAI    + GGKVII+DM 
Sbjct  254   NLNFVGGDMFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGKVIIIDMK  313

Query  900   VGSTQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSR  1076
             V   +N   +DDE  ++Q+F D+ MM    GRER  KEW K+F DAGF  YK T  LG R
Sbjct  314   V---ENEKDEDDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPILGLR  370

Query  1077  SLIQLFP  1097
             SLI+++P
Sbjct  371   SLIEVYP  377



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   370 bits (951),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 244/351 (70%), Gaps = 10/351 (3%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLG  239
             ++ AQ H+WNH  NF+NS +LKCAV+LGIPD I+ HGQPITL ELV  L+IN  KA  L 
Sbjct  12    LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  240   RLMRVLTRSGFFLDAKIKDGDG---YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWH  410
             RLMRVL  SGFF   +    +    Y+L   S  L+KD P + AP +L       T P H
Sbjct  72    RLMRVLVXSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVDPHLTNPCH  131

Query  411   RVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFE  590
              +S+WF N DPTP+ TAYGK FWD A+ + + N++FN+AMA D+ L+ ++V   C+EVF 
Sbjct  132   FLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVVGECKEVFR  191

Query  591   GLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPA  770
             GL SL+DVGGGTG +A+ IA  FP  KCTV D PHVVA L+  +NL +V GD+F+AIPPA
Sbjct  192   GLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIFEAIPPA  251

Query  771   QAIFLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
              AI LK +LH+W+D +CVKILKKCKEAI P ++ GGKVII+D+++ + +      DE ++
Sbjct  252   DAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDVVMENNKG-----DEAVE  306

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYK-TTQLGSRSLIQLFP  1097
             +Q+F D+ MMV   G+ER  +EW  +F  AGF +YK T+ LG RSLI+++P
Sbjct  307   AQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   370 bits (951),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 241/350 (69%), Gaps = 9/350 (3%)
 Frame = +3

Query  60    IVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLG  239
             ++ AQ HIWN IF+FIN  SLKCAVQLGIPD+I +HG P++L +L+  L I+  K++ + 
Sbjct  12    LLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNCVY  71

Query  240   RLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWH  410
             RLMR+L  SGFF   K+ + D   GY L   S LL+KD P +  PF+LGA     T PWH
Sbjct  72    RLMRILVHSGFFCRQKLSELDEEEGYVLTDASRLLLKDDPLSARPFLLGALDPFMTKPWH  131

Query  411   RVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFE  590
               S WF NDDPT   TA+G TFWD    +  L+H FN AMA D  L+  +V    + VFE
Sbjct  132   YFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVVSNEYKGVFE  191

Query  591   GLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPA  770
             GL+SLVDVGGG G + +AIAD FP  +C V DLPHVVA L+ ++NL +  GDMF+AIPP 
Sbjct  192   GLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGSENLKFFGGDMFEAIPPT  251

Query  771   QAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQS  950
              AI +KW+LHDW+D +C+KIL++ KEAI  +E  GKVIIVDM++   Q G   DD+ I++
Sbjct  252   DAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKVIIVDMVM--KQKG---DDQSIET  306

Query  951   QIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             Q+F D+ MMV + G+ERT KEW K+F+DAGF  YK T + G R LI+++P
Sbjct  307   QLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPICGLRYLIEVYP  356



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 248/361 (69%), Gaps = 18/361 (5%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN----  215
             E  +++ AQ HIWNHIFN+INS SLKCA+QL IPD+IH HG+P+ L +L + L IN    
Sbjct  11    ETRQVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINNNHD  70

Query  216   KAKAHH-LGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             KAK H  + RLMR+L  +GFF+    +  +GY L P S LL+KD P ++ PF+       
Sbjct  71    KAKTHDCVYRLMRILVHAGFFIQ---EAEEGYLLTPTSRLLLKDEPMSMIPFLNFQLDPN  127

Query  393   FTGPWHRVSEWFHN----DDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMA-  557
                PWH +S+WF+N     + TPY TA+G  F+  A  +  LNH FN+AMA DT L+M  
Sbjct  128   LMDPWHSLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVMTV  187

Query  558   LVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYV  737
             L++     +FEGL SLVDVGGGTG +A+AIAD FP   CTV +LPHV+ GL+ +KNL++V
Sbjct  188   LIQNGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKGSKNLSFV  247

Query  738   AGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQN  917
              GDMF +IP A AI LKW+LHDW+D DC+KILKKCKEAIP +ENGGKVI++++++   + 
Sbjct  248   GGDMFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVILIEIVMDQNK-  306

Query  918   GDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
                DDD+  ++Q+  D+ MM+   G+ER+ +EW K+F DAG+  YK    LG R +I+++
Sbjct  307   ---DDDKSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILGLRCVIEVY  363

Query  1095  P  1097
             P
Sbjct  364   P  364



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 244/355 (69%), Gaps = 13/355 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + +++++ AQTH+WNHIF+F+NS SLKCA+ L IPD+IH++G+ +   +L  +L++N +K
Sbjct  7     ERVSKLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A+ + RLMR+LT SGFF   ++ + D   GY L   S LL+KD+P ++ PF       I 
Sbjct  67    ANCIYRLMRILTHSGFFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLDPIL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PWH++  WF NDDPTP+ TA+    WD A +D +LN  FN AMA D  L+  +V + C
Sbjct  127   TKPWHQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVIERC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
               VF+GL+SLVDVGGGTG++A+AIA  FP   CTV DLPHVVA L+  +NL YV GDMF+
Sbjct  187   SGVFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGCENLKYVGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             ++PPA A+ LKW+LHDWND  CVKILKKCKE I       KVI++DM+V S +    +D 
Sbjct  247   SVPPADAVLLKWILHDWNDEQCVKILKKCKEGI-----KRKVIVIDMVVESEE----EDF  297

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             E  ++++  D+ +MV Y G+ERT KEW KI   AGF  YK T  +G RS I+++P
Sbjct  298   ESTETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSFIEIYP  352



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 247/357 (69%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF    +    + + Y+L   + LL+KD+P+++   +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD T +  A+ K  W+   QD  +N+  N+ MA D++L   LV   C
Sbjct  127   TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +FEG+ SLVDVGGG G +A+ I + FP   CTVLDLPHVV+ L+  KNL YVAGDMF+
Sbjct  187   KGIFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKYVAGDMFQ  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA+AI LKW+LH+W+D DCVKILK+CK+AI   G++  GKVII+DM V    NG   
Sbjct  247   AVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDM-VRENLNG---  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+  I++Q+F D+QMMV  GG ER  KEW K+F DAGF  YK    LG+R+LI+L+P
Sbjct  303   DEGSIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 243/358 (68%), Gaps = 13/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  AQTH++  +FN++NS SL CA QLGIPD+IH HG PITL ELV  L I   K
Sbjct  22    QKETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHIPPNK  81

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDG------YALGPPSCLLIKDHPFNLAPFVLGASS  386
                + RLMR+L  SGFF   +  +G G      Y L PPS LL+KD+   L+PF +   +
Sbjct  82    TSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  140

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
               F  PWH + +WF   +PT +Q AYG  FW+  +Q+ ELN  FN AMACD+ + M LV 
Sbjct  141   PAFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQM-MNLVI  199

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + C+ +FEGLDS+VDVGGGTG +AR I++ FP  KCTVL+ P V+A LE T+NL YV GD
Sbjct  200   RDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGTENLKYVGGD  259

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IP A A+ LK + H W+D DCVKILKKCKEAI  +E GGKVIIVD+++    N   
Sbjct  260   MFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVI----NKKK  315

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             D+ EL ++++  D+ MMV   G+ER+++EW ++F +AGF +YK T L G RSLI+++P
Sbjct  316   DEHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVYP  373



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 237/348 (68%), Gaps = 36/348 (10%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHI NFI S SLKCA+QLGIPD+IH HG+P+TL E               
Sbjct  11    ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPE---------------  55

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
                      +G       ++ +GY L   S LL+ D   ++ P +L     I T PWH +
Sbjct  56    ---------AG-------EEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPILTKPWHYL  99

Query  417   SEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGL  596
             S WF NDDPTP+ TA+ + FWD A  + +LN++FN+AMA D  L+ +++ K  + VFEGL
Sbjct  100   SAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLKEGKGVFEGL  159

Query  597   DSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQA  776
             +SLVDVGGGTG VA+AIA+ FP   CTVLDLPHVVAGL+ +KNL Y AGD+F+AIPPA A
Sbjct  160   NSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDIFEAIPPADA  219

Query  777   IFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
             I LKW+LHDW+D +CVKILK+C+EAIP +ENGGKVII+DMI+   Q     D + I++Q+
Sbjct  220   ILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG----DYKSIETQL  275

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM++  GRER   EW K+F DAGF +YK T  LG RSLI+++P
Sbjct  276   FFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  323



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 247/352 (70%), Gaps = 8/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             + ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+PI+L +L+  L I+ +K   
Sbjct  11    SNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPIHPSKTIF  70

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR++T SGFF    I + +    Y L   S LL+ D+P ++APFV      + T P
Sbjct  71    IYRLMRIMTHSGFFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHAMLDPVLTNP  130

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH++S W  N DPT ++T +G  FWD A ++ + N+ FN AMA D  L+ ++V + C+EV
Sbjct  131   WHQLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVVIEKCKEV  190

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F GL+S+VDVGGG G +A+A+A  FP  +CTVLDLPHVVAGL+ET+NL YV GDMFK IP
Sbjct  191   FNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQETENLKYVGGDMFKEIP  250

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
              A AI LKW+LHDWND +CVKILK CK+AI  +   GKVII+DM++ + +      +E +
Sbjct  251   SADAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKVIIIDMVMENEKG----KNESL  306

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             Q+Q+F D+ MMV   G+ERT KEWV + + +GF  YK T  LG RS+I+++P
Sbjct  307   QTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIYP  358



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   369 bits (947),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 244/368 (66%), Gaps = 20/368 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK---  224
              E+V +Q HIWN IFNFINS SLKCA+QLGIPD I+ HG+P+ L +L+ +L I++ K   
Sbjct  17    TELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKRPD  76

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD------GYALGPPSCLLIKDHPFNLAPFVLGASS  386
             +  + RLMR+L  SGFF   ++  G+      GY L   S LL++D+P ++ PF+L    
Sbjct  77    SRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVTPFLLSMLD  136

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              I T PWH +S W  +DDPTP+ T +GK FWD    D  L + FN+AMA D  L+ ++V 
Sbjct  137   PIMTKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTSVVI  196

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + C+ +FEGL+SLVD+ GGTG VA+AIA  FP   CTV DLPHV+A L+ +KNL +V GD
Sbjct  197   EKCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGGD  256

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGREN-GGKVIIVDMIVGSTQNGD  923
             MF  IPPA AIF+KW+LHDW+D DCVK+L++CK AI  + N  GKVI+VDM++   QN  
Sbjct  257   MFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQNNK  316

Query  924   ---------VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGS  1073
                        D +  ++Q+F D+ MMV   GRER   EW K+F DAGF  YK T  LG 
Sbjct  317   DIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGFSTYKITPILGV  376

Query  1074  RSLIQLFP  1097
             RSLI++FP
Sbjct  377   RSLIEVFP  384



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   369 bits (946),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 244/357 (68%), Gaps = 12/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  AQTH++  +FN++NS SL CA QLGIPD+IH HG+PITL ELV  L I   K
Sbjct  22    QKATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELVSALHIPPNK  81

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDG-----YALGPPSCLLIKDHPFNLAPFVLGASST  389
             +  + RLMR+L  SGFF   K   G G     Y L PPS LL+KD+   L+PF +   + 
Sbjct  82    SSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPPSQLLVKDNTNCLSPF-MSLINP  140

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
              F  PWH + +WF   +PT +Q AYG  FW+  +Q+ ELN  FN AMACD+ + M LV +
Sbjct  141   AFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDSQM-MNLVIR  199

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+ +FEGLDS+VDVGGGTG +AR I++ FP   CTVL++P V+A LE T+NL YV GDM
Sbjct  200   DCKPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGTENLKYVGGDM  259

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
             F+ IP A A+ LK + H W+D DCVKILKKCKEAI  +E GGKVIIVD+++    N   D
Sbjct  260   FQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVI----NEKKD  315

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             + EL ++++  D+ MMV   G+ER+++EW ++F +AGF +YK T L G RSLI+++P
Sbjct  316   EHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVYP  372



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 244/349 (70%), Gaps = 6/349 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQT ++N IF+FINS SLKCA++L IPD+IH +GQPI L +L+ +L I+ +K+  +
Sbjct  45    KLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQLISSLPIHPSKSGDI  104

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMRVLT S FF+  K +    Y L   S LL+KDHPF++   +      I + PWH++
Sbjct  105   DRLMRVLTHSNFFIVTKNELEVMYELTDASRLLLKDHPFSMTSMLHVILGPIMSKPWHQL  164

Query  417   SEWFHNDDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEG  593
             S W+ N+DP+P+ T   G  FWD A  D E NH FN+AMAC+T +   +V   C+ VF+G
Sbjct  165   SNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMASTVVMGKCKGVFQG  224

Query  594   LDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQ  773
             L+SLVDVGGG G +++AIA  FP+ +C V DLPHVV GL+ ++N  YVAGDMF++IPP Q
Sbjct  225   LESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGSENFKYVAGDMFESIPPTQ  284

Query  774   AIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQ  953
             +I LK VLHDWND +C+KILKKCKEAI  +   GKVII+D ++G+ +     D+E  ++Q
Sbjct  285   SILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVIIIDAVMGNEK----ADNESFEAQ  340

Query  954   IFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +F D++MMV   G+ER  KEW K+F  AGF  YK T  LG +SLI++FP
Sbjct  341   LFYDLEMMVLVNGKERNEKEWSKLFFSAGFNNYKITHGLGFKSLIEVFP  389



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 242/353 (69%), Gaps = 11/353 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + + E++ AQ H+ N + NF  S+SLKCA++LGIP+ I++HG+PITL ELV  L +N +K
Sbjct  5     ENLTELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSK  64

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             A H+ RLMR L+++GFF    +     YAL     LL+KD PFNL   +   S  +   P
Sbjct  65    ASHIYRLMRFLSKAGFF----VLQDQCYALTAAGRLLLKDDPFNLRALIFFMSDPVLVKP  120

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             W+ ++EWF NDDP P+ TA+GK FW  A+++    + FN+AMA D+  ++ ++   C+ V
Sbjct  121   WNSLTEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMTRCKFV  180

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F+GL SLVDVGGGTG VARAIA  FP+ +C V DLPHV+A  E T+NL +VAGDM + +P
Sbjct  181   FDGLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEGTENLDFVAGDMLEKVP  240

Query  765   PAQAIFLKW--VLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
              A AI LK    +HDW+D DCVKILK CKEAIPGR  GG+VII+DMI+ S     + DDE
Sbjct  241   TADAILLKKPDSIHDWSDEDCVKILKNCKEAIPGRNKGGRVIIIDMILES----QIKDDE  296

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLF  1094
              +++Q+  D+QM++ +  +ERT KEW K+F DAGF YYK   + G R LI+++
Sbjct  297   SVETQVGMDMQMLMCHAAKERTEKEWAKLFRDAGFSYYKILPVFGVRCLIEVY  349



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 246/357 (69%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF       + + + Y+L   + LL+KD+P+++   +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD T +  A+ K  W+   QD  +N+  N+ MA D++L   LV   C
Sbjct  127   TKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVNKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +FEG+ SLVDVGGG G +A+ I + FP   CTVLDLPHVV+ L+  KNL +VAGDMF+
Sbjct  187   KGIFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCKNLKFVAGDMFQ  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA+AI LKW+LH+W+D DCVKILK+CK+AI   G++  GKVII+DM V    NG   
Sbjct  247   AVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDM-VRENLNG---  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+  I++Q+F D+QMMV  GG ER  KEW K+F DAGF  YK    LG R+LI+L+P
Sbjct  303   DEGSIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 240/352 (68%), Gaps = 7/352 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             + ++ AQ+HIWNHIFNFINS SLKC V LGIPD+IH +G+PI+L +L+  L I+ +K   
Sbjct  12    SNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCF  71

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR++T S FF    + + +    Y L   S LL+KD+P ++ PFV      + T P
Sbjct  72    IHRLMRIMTHSSFFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAMLDPVLTNP  131

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH+ S W  NDDPT ++T +    W+  + D + ++ FN++MA DT L+  L+ + CR V
Sbjct  132   WHQFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLIEKCRGV  191

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F GL+SLVDVGGGTG +A+A+A  FP  + +V DLPHVV GL+ ++NL YV GDMFK IP
Sbjct  192   FNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGSENLNYVGGDMFKEIP  251

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             P  AI LKW+LHDWND +CVKILK CK+AI  +   GKVI++DM++ S +      +E +
Sbjct  252   PTDAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVIVIDMVLESEKES---INESV  308

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+F D+ MMV   G+ER  KEW+K+ + AGF  YK T  LG RSLI+++P
Sbjct  309   ETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILGLRSLIEIYP  360



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 242/368 (66%), Gaps = 20/368 (5%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN---KAK  224
              E+V AQ HIWN+IFNFINS SLKCAVQLGIPD IH HG+P+TL +L+  L I+   K+ 
Sbjct  17    TELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSD  76

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD------GYALGPPSCLLIKDHPFNLAPFVLGASS  386
             +  + RLMR+L  SGFF+  ++  G+      GY L   S LL++D+P ++ P +L    
Sbjct  77    SRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVTPLLLSMLD  136

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              I T PWH +S W  +DDPTP+   +G   WD    D  L + FN+AMA D  L+ +++ 
Sbjct  137   PIMTKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVLI  196

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               C+ V EGL+SLVD+ GGTG VA+AIA  FP   CTV DLPHV+A L+ +KNL +V GD
Sbjct  197   DKCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFVGGD  256

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGREN-GGKVIIVDMIVGSTQNGD  923
             MF  IPPA AIF+KW+LHDW+D DCVK+L++CK AI  + N  GKVI+VDM++   QN  
Sbjct  257   MFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQNNK  316

Query  924   ---------VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGS  1073
                        D +  ++Q+F D+ MMV Y GRER   EW K+F+DAGF  YK T  LG 
Sbjct  317   DIGHDHHAHDHDHQSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGFNTYKITPILGV  376

Query  1074  RSLIQLFP  1097
             RSLI++FP
Sbjct  377   RSLIEVFP  384



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 245/355 (69%), Gaps = 8/355 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             ++++E++ AQTHIWNH F+FI S SLKCAVQLGIPD+I+ HGQP+TL ELV TL ++  K
Sbjct  7     EKIDELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
               HL RLMRVL  SGFF      D    +GY L P S LL+KD  F+  PF+  A   + 
Sbjct  67    TDHLYRLMRVLVHSGFFNLQNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALDPVA  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T P++ +  +  NDDPT + TA+G+T +  A  +  +NH FN+ MA D+ ++   V   C
Sbjct  127   TEPYNYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVIIKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             ++VFEG++SLVDVGGGTG +A+AI   FP+ KCTVLDLPHVV  L+ + NL+++ GDMF+
Sbjct  187   KKVFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGDMFQ  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             A+PPA AI LKW+LHDW D +C+KILK CKEA+  +  GGKV+I+DM++G+       DD
Sbjct  247   AVPPADAILLKWILHDWPDEECIKILKNCKEAVSEKGTGGKVMIIDMVMGNQSW----DD  302

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              L+++Q+  D+QMM    G+ER  +EW K+F DAGF  YK    LG R+LI+  P
Sbjct  303   SLMEAQLCFDMQMMALLMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEFLP  357



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 247/353 (70%), Gaps = 9/353 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKAH  230
             +E++ A+  IWN +F++INS SLKC  +LGIP +I++HG+P+TL EL++ L  +++AKA 
Sbjct  10    SELLEAEARIWNQVFSYINSMSLKCVTELGIPGIINKHGRPMTLTELMEALPGVDRAKAD  69

Query  231   HLGRLMRVLTRSGFFLDAKIKDGD--GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             H+ RLMR +  SGFF+  K+   D  GY L P S LL++DHP ++  F+L    ++   P
Sbjct  70    HVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFLLSQLDSVLCEP  129

Query  405   WHRVSEWFHN-DDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             W  +S WF N +D T + T +G + W++  Q+    H F+Q M  DT ++  ++ + CR+
Sbjct  130   WQHLSGWFRNIEDRTAFHTTHGMSLWEQKEQNPRFGHLFDQGMGNDTPMVADVIARDCRQ  189

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFEGL SLVDVGGGTG +A+AIA+ FP+  CTVLDL  +VAGLE T+NL YV GDMF+ I
Sbjct  190   VFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLEGTRNLKYVEGDMFEYI  249

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PPA A+ LKW+LHDW+D +CV+ILK+CKEAI   E GGKV+I++M+V   QN    D + 
Sbjct  250   PPADAVLLKWILHDWSDEECVEILKRCKEAIKSNEKGGKVVIIEMVV-DDQNS---DHKS  305

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q+  D+ MM   GG+ER  KEW K+F+DAGF  YK +  LG RS+I+++P
Sbjct  306   VETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYKISPLLGIRSIIEVYP  358



>ref|XP_002517833.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44351.1| o-methyltransferase, putative [Ricinus communis]
Length=372

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 239/355 (67%), Gaps = 8/355 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + ++E++ AQTHIWN  F+FI S SLKCAVQLGIPD+I+ HGQP+TL ELV  L +   K
Sbjct  22    ENIDELIKAQTHIWNETFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLALQVRPTK  81

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              HHL RLMRVL RSGFF      D    +GY L P S LL+++  F+  PF+      I 
Sbjct  82    THHLYRLMRVLVRSGFFNLQNASDNYSQEGYILTPASRLLLQNSSFDTRPFISLVLDPII  141

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T P++ ++ +  NDD TP+ TA+  T W  A  +  +NH  N  MA D+ ++   V   C
Sbjct  142   TEPYNSLTSFLRNDDLTPFVTAFKDTLWGCAGNEARINHLVNDCMASDSSVIGRAVIIKC  201

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             +EVFEGL+SLVDVGGGTG +A+AIA  FP+ KCTVLDLPHVV  L+   NL+++ GDMF+
Sbjct  202   KEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLGGDMFQ  261

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
             A+PPA AI LKW+LHDW D +C+KILK CKEAI  +   GKV+I+D+++G        DD
Sbjct  262   AVPPADAILLKWILHDWPDEECIKILKNCKEAISRKGKEGKVMIIDIVMGY----QTWDD  317

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              L ++Q+  D++MMV   G+ER  KEW K+F DAGF  YK    LG R+LI+++P
Sbjct  318   SLTEAQLLFDMKMMVAVMGKERNEKEWTKLFFDAGFTNYKIYPVLGPRALIEVYP  372



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 241/349 (69%), Gaps = 6/349 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQT ++NHIF+FINS SLKCA++L IPDVIH +GQPI L +L+  L I+ +K   +
Sbjct  11    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  70

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMRVLT SGFF  +K      Y L   S LL+KDHPF++   +      I + PW+++
Sbjct  71    HRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPWYQL  130

Query  417   SEWFHNDDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEG  593
             S W+ NDDP+P+ T   G  FWD A  D   N+ FN+AMAC+T L  ++V   C+ VFEG
Sbjct  131   SNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFEG  190

Query  594   LDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQ  773
             L+SLVDVGGG G + + IA  FP+ +C V DLPHVV GL+ ++NL YV GDMF+AIPP  
Sbjct  191   LESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEAIPPTH  250

Query  774   AIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQ  953
             +I LK VLHDWND +C+KILKKCKEAI  +   GKVII+D ++G+ +    +D+E I++Q
Sbjct  251   SILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEK----EDNESIEAQ  306

Query  954   IFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +F D++MMV   G+ER  KEW  +F  AGF  YK T  LG +SLI++FP
Sbjct  307   LFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  355



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 242/354 (68%), Gaps = 8/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             A ++ RLMR+L  SGFF    + + + Y+L   + LL+KD+P ++   +L     + T P
Sbjct  67    AQYVHRLMRILVHSGFFSQQNL-NQEAYSLTQSTRLLLKDNPLSMRTLLLFVLDPVLTKP  125

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
                +S WF ND+ T +  A+   FW+ A QD  +N+ FN AMA D++L+  +V   C+ +
Sbjct  126   HDCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVSKCKGI  185

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEG++SLVDVGGG G +A+ IA+ FP   CTV DLP VV+ L+ +KNL YV GDMF+A+P
Sbjct  186   FEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGSKNLKYVGGDMFEAVP  245

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             PA  I LKW+LH W+D DCVKILK+CK+AI   G++  GKVII+DM V    NGD     
Sbjct  246   PADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDM-VRENLNGDGGS--  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              I++Q+F D+QMMV   G ER  KEW K+F DAGF  YK    LG+R+LI+L+P
Sbjct  303   -IETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  355



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 237/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++AH + RLM
Sbjct  13    AQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  72

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  73    RILVHSGFFEQKKLAPDGQGAYVLNHVSKLLLTDNPSNVAPFALSMLDPILINPWHGLSA  132

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G +FW  A Q+   N  FN  MA D  L+ ++V    + VFEG+ 
Sbjct  133   WFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMASDARLVASMVVNEHKGVFEGIT  192

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG  A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF+AIPPA AI
Sbjct  193   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  252

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VK+LK+C+EA+  G     KVII+DM++ +T++    D E++++Q+
Sbjct  253   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIDMVMDNTKS----DKEMVETQL  308

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  309   FYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  356



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 246/357 (69%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF       I + + Y+L   + LL+KD+P+++ P +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD   +  A+ KT W+ A QD   N+ FN+AMA D++L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +F+G++SLVDVGGG G +A+ IA+ FP   CTV DLPHVV+ L+  KNL YV GDMF+
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA A+ LKWVLHDW+D  CVKILK+CK+A+   G++  GKVII+DM+  +       
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSG----  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKT-TQLGSRSLIQLFP  1097
             D+  I++Q+  D+++MV   G ER  KEW K+F DAGF  YK  + LG+R+LI+L+P
Sbjct  303   DEGSIETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_010058047.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 239/348 (69%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFI+S  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++AH + RLM
Sbjct  15    AQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G +FW  A Q+  LN  FN  MA D  L+ ++V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG +A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF+AIPPA AI
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VK+LK+C+EA+  G     KVII++M++ +T++    D E++++Q+
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS----DKEMVETQL  310

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  311   FYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 245/354 (69%), Gaps = 8/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNH+FNFINS +LKCAV+LGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             A ++ RLMR+L  SGFF    +K  + Y+L   + LL+KD+P+++   +L     + T P
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLKQ-EAYSLTQSTRLLLKDNPWSMRTLLLFVLDPVLTKP  125

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
                +S WF ND+ + +  A+  TFW+ A QD  +N+ FN AMA D++L   +V   C+ +
Sbjct  126   HDCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVSKCKGI  185

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEG++SLVDVGGG G +A+ I + FP   CTV DLPHVV+ L+ +KNL YV GDMF+A+P
Sbjct  186   FEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGSKNLKYVGGDMFQAVP  245

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             PA AI LK +LH W D DCVKIL++CK+AI   G++  GKVII+DM V    NG   D+ 
Sbjct  246   PADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKVIIIDM-VRENLNG---DEG  301

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKT-TQLGSRSLIQLFP  1097
              I++Q+F D+Q+MV   G ER  KEW K+F DAGF  YK  + LG+R+LI+L+P
Sbjct  302   SIETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  355



>gb|KCW75545.1| hypothetical protein EUGRSUZ_E04305 [Eucalyptus grandis]
Length=359

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 239/348 (69%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFI+S  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++AH + RLM
Sbjct  15    AQAHIWNHIFNFISSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G +FW  A Q+  LN  FN  MA D  L+ ++V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG +A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF+AIPPA AI
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VK+LK+C+EA+  G     KVII++M++ +T++    D E++++Q+
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS----DKEMVETQL  310

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  311   FYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 246/357 (69%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF       I + + Y+L   + LL+KD+P+++ P +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD   +  A+ KT W+ A QD   N+ FN+AMA D++L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVSKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +F+G++SLVDVGGG G +A+ IA+ FP   CTV DLPHVV+ L+  KNL YV GDMF+
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYVGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PPA A+ LKWVLHDW+D  CVKILK+CK+A+   G++  GKVII+DM+  +       
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSG----  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKT-TQLGSRSLIQLFP  1097
             D+  I++Q+  D+++MV   G ER  +EW K+F DAGF  YK  + LG+R+LI+L+P
Sbjct  303   DEGSIETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 243/357 (68%), Gaps = 10/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +   E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +K
Sbjct  7     ESAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAK---IKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             A ++ RLMR+L  SGFF       I +   Y+L   + LL+KD+P+++ P +L     + 
Sbjct  67    AQYVHRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVL  126

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             T PW  +S WF NDD   +  A+ KT W+ A QD  LN+ FN AMA D++L   LV   C
Sbjct  127   TKPWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSILASKLVVSKC  186

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + +F+G++SLVDVGGG G +A+ IA+ FP   CTV DLPHVV+ L+  KNL Y  GDMF+
Sbjct  187   KGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGKNLKYAGGDMFE  246

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVD  929
             A+PP  A+ LKW+LHDW+D DCVKILK+CK+AI   G++  GKVII+DM V   +NG   
Sbjct  247   AVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKVIIIDM-VRDNRNG---  302

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+  I +Q+  D++MMV   G ER  KEW K+F DAGF  YK    LG+R+L +L+P
Sbjct  303   DEGSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALFELYP  359



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 240/354 (68%), Gaps = 10/354 (3%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++ + E++ AQTH+WN +F+F  S+ LKCAV+LGIPDVI  HG+PITL +L+  L I+ +
Sbjct  4     VENLGELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHPS  63

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             K+ H+ RLMR L  SGFF    +++  GYAL     LL+KD PFN+   +  +       
Sbjct  64    KSAHIFRLMRFLANSGFF----VENPQGYALTSAGRLLLKDEPFNVRAHIFLSCDPAMLK  119

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PW+ +++WF NDDP+P+ TAYG  FW   +Q+      FN+AMA D  L + ++   C+ 
Sbjct  120   PWNFLTKWFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVEVLMTKCKF  179

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFEGL +L DVGGGTG V RAIA  FP+ KCTV DLPHVVA  E  +NL ++AGDMF+++
Sbjct  180   VFEGLTTLADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGAENLEFLAGDMFQSV  239

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P A AI LK +LHDW+D DC+KILK CK+AIP ++NGGKVII+D ++GS     + D   
Sbjct  240   PRANAILLKRILHDWSDEDCLKILKNCKKAIPEKDNGGKVIIIDGVMGS----QIQDKTS  295

Query  942   IQSQIFADVQMMVYYG-GRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +++   D+QM+V  G  +ERT KEW K+F+DAGF  YK    LG R LI+++P
Sbjct  296   FETEFSMDMQMLVMLGPAKERTEKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  349



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   360 bits (925),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 242/358 (68%), Gaps = 13/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  A TH+ + +FN+INS SL CA QLGIPD+IH HG+PITL  LV  L I   K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDG------YALGPPSCLLIKDHPFNLAPFVLGASS  386
                + RLMR+L  SGFF   K  +G G      Y L PPS LL+KD+   L+PF +   +
Sbjct  68    TSIIYRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
               F  PW  + +WF  ++PT ++ AYG  FW+  +Q+ ELN  FN+AMACD+ + M LV 
Sbjct  127   PAFVTPWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQM-MNLVI  185

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + C+ +FEGL+S+VDVGGGTG ++R I++ FP   CTVL+LP V+  LE TKNL YV GD
Sbjct  186   RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGD  245

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IP A A+ LK + H W+D DC+KILKKCKEAI  +E GGKVIIVD+++   +    
Sbjct  246   MFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKVIIVDVVIDEKK----  301

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             D+ EL ++++  D+ MMV   G+ER++KEW K+F +AGF +YK T L G RSLI+++P
Sbjct  302   DEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLFGLRSLIEVYP  359



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   360 bits (924),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 245/358 (68%), Gaps = 11/358 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKA  221
             ++ +E + AQ HIWNH+ ++ NS SLKCA +LGIPD IH+HG P++L ELVD L  ++K 
Sbjct  7     EQSSEKLEAQAHIWNHVLSYTNSMSLKCATELGIPDAIHQHGGPMSLTELVDALPGVDKT  66

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             KA  + RLMR+L  SGFF+  KI      +GY+L   S LL+ DHPF++ P V+   + I
Sbjct  67    KADCVYRLMRILVHSGFFVLEKIDSSNYEEGYSLTSTSRLLVGDHPFSMKPLVICGLNPI  126

Query  393   FTGPWHRVSEWFHN-DDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              T PW ++  W  N +D TP+  A  G +FW+   ++   +H  +Q MA DT L+  ++ 
Sbjct  127   LTEPWRQLGRWLQNTEDHTPFHIANNGMSFWEYKERNPRFSHLLDQVMASDTPLVAGVIT  186

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + CR+VFEGLDSLVDVGGGTG +A+ IA+ FP   CTVLDL  VVAGLE T+NL YV GD
Sbjct  187   RDCRQVFEGLDSLVDVGGGTGTLAKVIAEGFPQIHCTVLDLAPVVAGLEGTRNLKYVEGD  246

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IPP+ A+  KW+LHDW+D  CV+ILKKCKEA+   E  GKVII+DM++   +    
Sbjct  247   MFEFIPPSDAVLCKWILHDWSDEKCVQILKKCKEAVTRDEKKGKVIIIDMVIDDQKC---  303

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYK-TTQLGSRSLIQLFP  1097
              D + +++++F D+ MM   GGRER  KEW K+F+DAGF  Y+ ++ LG RS+I+++P
Sbjct  304   -DHKSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYRISSLLGLRSIIEVYP  360



>ref|XP_010052409.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89598.1| hypothetical protein EUGRSUZ_A01881 [Eucalyptus grandis]
Length=358

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 236/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QLGIPD IH HGQP+ L+ LV  L I+ ++AH + RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMNLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L         PWH +S 
Sbjct  75    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPCNVAPFALSMLDPTLINPWHGLSA  134

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G +FW  A Q+  LN  FN  MA D  L+ ++V    + VFEG+ 
Sbjct  135   WFHNRVDPTPFEMVQGMSFWRYAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG  A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF++IPPA AI
Sbjct  195   SLVDVGGGTGTTAKAIANAFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  254

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VKILK+CKEA+  G+    KVII+DM++ +T++    D E +++Q+
Sbjct  255   ILKWILHDWSDEDAVKILKRCKEALGKGKGKKQKVIIIDMVMDNTKS----DKETVETQL  310

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  311   FYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 241/350 (69%), Gaps = 7/350 (2%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQT ++NHIF+FINS SLKCA++L IPDVIH +GQPI L +L+  L I+ +K   +
Sbjct  25    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  84

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMRVLT SGFF  +K      Y L   S LL+KDHPF++   +      I + PW+++
Sbjct  85    HRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKPWYQL  144

Query  417   SEWFHNDDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEG  593
             S W+ NDDP+P+ T   G  FWD A  D   N+ FN+AMAC+T L  ++V   C+ VFEG
Sbjct  145   SNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMGKCKGVFEG  204

Query  594   LDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQ  773
             L+SLVDVGGG G + + IA  FP+ +C V DLPHVV GL+ ++NL YV GDMF+AIPP  
Sbjct  205   LESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGDMFEAIPPTH  264

Query  774   AIFLK-WVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQS  950
             +I LK  VLHDWND +C+KILKKCKEAI  +   GKVII+D ++G+ +    +D+E I++
Sbjct  265   SILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEK----EDNESIEA  320

Query  951   QIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             Q+F D++MMV   G+ER  KEW  +F  AGF  YK T  LG +SLI++FP
Sbjct  321   QLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  370



>ref|XP_010058046.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 237/348 (68%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKC +QLGIPD IH HGQP+TL+ LV  L I+ ++AH + RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCTIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  75    RILVHSGFFEQKKLAPDGQGAYVLNRVSKLLLTDNPSNVAPFALSVLDPILINPWHGLSA  134

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G +FW  A Q+   +  FN  MA D  L+ ++V    + VFEG+ 
Sbjct  135   WFHNHADPTPFEMVQGMSFWRYAGQEPGFDRLFNDGMASDARLVASMVVNEHKGVFEGIT  194

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG +A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF+AIPPA AI
Sbjct  195   SLVDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAI  254

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VK+LK+C+EA+  G     KVII++M++ +T++    D E++++Q+
Sbjct  255   ILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS----DKEMVETQL  310

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  311   FYDMLMMTLASGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  358



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 238/357 (67%), Gaps = 12/357 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQTH+WNHIFNFINS SLKCA+QLGIPD+IH H QP+TL ELV  L +   K   
Sbjct  10    SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  234   LGRLMRVLTRSGFFLDAKIK---DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L  SGFF   +++   D +GY L   S LL+KDHP +  PF+L       T P
Sbjct  70    VHRLMRILVHSGFFTMQRVQESADEEGYXLANASRLLLKDHPLSATPFLLAMLDPDLTEP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH VS WF NDDPTP+ TA+G+T WD    +   N++FN+AMA D  L+ +++ K C+  
Sbjct  130   WHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLIKECKGA  189

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNL-----AYVAGDM  749
             FEGL+S VDVGGGTG VA+ I   FP    TVLDLPHVVA L+  K L      YV G+ 
Sbjct  190   FEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRRGYVRGNS  249

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
                    + I  +W+LHDW+D +C+KILK+C+ AIP +E GGKV+I+DM +   + GD D
Sbjct  250   SCGCHFTEGI-TQWILHDWSDEECLKILKQCRXAIPSKEKGGKVMIIDMAI-XNKKGD-D  306

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+  +++Q+F D+ MMV   GRER  KEW K+F D+GF  YK T  LG RSLI+++P
Sbjct  307   DESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  363



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   358 bits (918),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/355 (47%), Positives = 243/355 (68%), Gaps = 7/355 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  + ++ AQ+H+WNH+FNFINS SLKC V LGIPD+IH +G+PI L +L+ +L+I+ +K
Sbjct  8     QVASNLLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSIHPSK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              H + RLMR++T SGFF    +   +    Y L   S LL+KD+P ++AP+V    + + 
Sbjct  68    NHGIHRLMRIMTHSGFFSQKNVIGNELEIEYMLTDASKLLLKDNPMSVAPYVHAMVNPVM  127

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
               PW++ S W  NDD   ++T +G + W+ A++D E+N+ FN++MA DT L+  L+ + C
Sbjct  128   MNPWYQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRLVSDLLVEKC  187

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             + VF  ++SLVDVGGGTG +A+ +   FP  +C V DLPHVV GL+ ++ L YV GDMFK
Sbjct  188   KGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGSEKLRYVGGDMFK  247

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
              IPPA AI LKW+LHDWND  C+KILK CK+AI  +   GKV+I+DM++   +    D++
Sbjct  248   EIPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVVIIDMVLDCEKG---DNN  304

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             E +++Q+F D+ MM    G+ER  KEW+K+ + AGF  YK T  LG RS+I+++P
Sbjct  305   ESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 246/353 (70%), Gaps = 10/353 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKAHH  233
             E++ A+ HIWNH+FN+INS+SLKCA +LGIPDVIH+HG P+TL ELVD L  ++KAKA  
Sbjct  11    ELLEAEAHIWNHVFNYINSTSLKCATELGIPDVIHKHGGPMTLLELVDALPGVDKAKADC  70

Query  234   LGRLMRVLTRSGFFLDAKIKDG--DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
             + RLMR+L  SGFF+  KI     + Y+L P S LL+ D P ++ P+V+     I   P 
Sbjct  71    MYRLMRILVHSGFFVLEKINSSNEEAYSLTPASRLLVGDLPMSMKPYVISQIDPILVEPM  130

Query  408   HRVSEWFHN-DDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             H +S WF N ++ TP+QT   G +FW++  ++   +H F+Q +A DT ++  ++ + CR+
Sbjct  131   HHLSRWFQNANNHTPFQTINNGMSFWEQKERNLRFSHLFDQGVASDTPMVAHVITRDCRQ  190

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFEGLDSLVDVGGGTG +A+AIA+ FP   CTVLDL  VVAG++ TKNL Y+ G+MF+ I
Sbjct  191   VFEGLDSLVDVGGGTGTLAKAIAEAFPQIHCTVLDLAPVVAGMDGTKNLKYIEGNMFEYI  250

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PP+ A+ LKW+LHDW+D   V+ILKKCKEAI      GKVI+++M+V   ++    + E 
Sbjct  251   PPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKVILIEMVVDDERS----NTES  306

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q+  D+ MM   GG+ER  KEW K+F DAGF  Y+    LG RS+I+++P
Sbjct  307   VETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYPVLGLRSIIEVYP  359



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 239/359 (67%), Gaps = 15/359 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             NE++ A   IWN   NFI   SLKCAV+LGIPD+I+ HGQPITL +L+ +L I+ +KAH 
Sbjct  10    NELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHC  69

Query  234   LGRLMRVLTRSGFFLDAKIKDG----------DGYALGPPSCLLIKDHPFNLAPFVLGAS  383
             + RLMR+L  SGFF   K+ +           + Y+L   S LL+KD P+   PF L   
Sbjct  70    IYRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQL  129

Query  384   STIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALV  563
                   PWH VS W  N DPTP++  +GKTFWD    +  L + F +AMA D+ L++ ++
Sbjct  130   EPHLMTPWHFVSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKVI  189

Query  564   KKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAG  743
              + C++VFEGL SLVDVGGGTG+VA+AIA  FP+  CTVLDLP+VVA  +  KNL ++AG
Sbjct  190   VEECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVANSQGAKNLNFIAG  249

Query  744   DMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGD  923
             DMFK IPPA AI LKW+LHDW+D + V ILK+C+EAI  +E G KVII+DM++ + +   
Sbjct  250   DMFKEIPPANAILLKWILHDWSDEEAVMILKRCREAIWSKEKGEKVIIIDMVIENPKM--  307

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
               D +  ++Q++ D+ MMV   GRER  KEW  +F  AGF +YK T + G RSL++++P
Sbjct  308   --DKKSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEVYP  364



>gb|KDP21022.1| hypothetical protein JCGZ_21493 [Jatropha curcas]
Length=356

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 247/354 (70%), Gaps = 9/354 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE+  AQ HI+ H+++++ S SLKC V LGIPD+IH++ +P+TL ELV  L I   K 
Sbjct  8     EANELFQAQCHIYKHMYHYMESMSLKCVVHLGIPDIIHKYKRPVTLPELVSALQIPPTKE  67

Query  228   HHLGRLMRVLTRSGFFLDAKIKDG--DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             + L R+MR+L  SGFF   KI D   +GY L P S LL+K+ P +L+ FV+         
Sbjct  68    NCLQRVMRILVHSGFFAAKKIHDNQEEGYVLTPSSSLLLKESPTSLSTFVVAMVDPALIT  127

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PW  ++E F  ++ TP++T +G  FWD   ++ E     N+AMACD+ L+  +VK++ +E
Sbjct  128   PWFSLAENFKGNELTPFETCHGNNFWDYGKKNPEFISSLNEAMACDSRLVSLIVKEH-KE  186

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             +F+G+ SLVDVGGGTG +AR+IAD +PD KCTVLDLP VVA L E+KNL +VAGDMF+++
Sbjct  187   MFKGVASLVDVGGGTGTLARSIADAYPDMKCTVLDLPQVVANLPESKNLKFVAGDMFRSV  246

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P AQA+ +K VLH+W+D  C+KILK C+E+IP ++ GGKVII++M++    N   D+ +L
Sbjct  247   PSAQAVMIKSVLHNWSDQACIKILKLCRESIPNKDEGGKVIIIEMVI----NEKKDEYQL  302

Query  942   IQSQIFADVQMMVYY-GGRERTLKEWVKIFNDAGFFYYK-TTQLGSRSLIQLFP  1097
              ++++FAD+QMM+   GGRER  +EW ++F +AGF +YK T   G  S+I+ +P
Sbjct  303   AETKLFADMQMMLLCPGGRERNEQEWARLFLEAGFNHYKITNTCGLNSIIEAYP  356



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 237/351 (68%), Gaps = 7/351 (2%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             + ++ AQ+H+WNHIFNFINS SLKC V LGIPD+IH HG+P+ + +L+ +L I+ +K   
Sbjct  12    SNLLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPC  71

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR++T SGFF    I   +    Y L   S LL+KD+P ++ PFV      +   P
Sbjct  72    IHRLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLDPVMMNP  131

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH+ S W  NDD T ++T +G   W+ A+ D + N+ FN++MA D  L+  L+ + C+ V
Sbjct  132   WHQFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVEKCKGV  191

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F   +SLVDVGGGTG +A+  A  FP  +C V DLPHVV GL+ ++NL+YV GDMFK IP
Sbjct  192   FNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMFKEIP  251

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             P  AI LKW+LHDWND +CVKILK CK+AI  +   GKV+I+DM++   +    D++E +
Sbjct  252   PTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKG---DNNESV  308

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLF  1094
             ++++F D+ MMV   G+ERT KEWVK+ + AGF  YK T  LG R++I+++
Sbjct  309   ETKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIY  359



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   359 bits (922),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 243/353 (69%), Gaps = 9/353 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKAKAH  230
             +E++ A  HIWN +F++INS SLKC  +LGIP++IH+HG+P+TL +L++ L  +++AKA 
Sbjct  110   SELLEAGAHIWNQVFSYINSMSLKCVTELGIPEIIHKHGRPMTLTQLMEALPGVDRAKAD  169

Query  231   HLGRLMRVLTRSGFFLDAKIKDGD--GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             H+ RLMR +  SGFF+  K+   D  GY L P S LL++DHP ++  FVL    ++   P
Sbjct  170   HVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFVLSQLGSVLCEP  229

Query  405   WHRVSEWFHN-DDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             W  +S WF N +D T + T +G + W+   Q+    H F++ M  D  ++  ++ + CR+
Sbjct  230   WQHLSGWFRNTEDRTSFHTTHGMSLWELKEQNPSFGHLFDRGMENDATIVADVITRDCRQ  289

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFEGL SLVDVGGGTG VA+AIA+ FP   CTVLDL  V+AGLE T+NL YV GDMF+ I
Sbjct  290   VFEGLGSLVDVGGGTGTVAKAIAEVFPQIHCTVLDLAPVIAGLEGTRNLKYVEGDMFEYI  349

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PPA A+ LKW+LHDWND +CV+ILK+CKEAI   E  GKV+I++M+V   QN    D + 
Sbjct  350   PPADAVLLKWLLHDWNDEECVEILKRCKEAIKSNEKRGKVVIIEMVV-DDQN---SDHKS  405

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q+F D  +M    GRER+ KEW K+F DAGF  YK +  LG RS+I+++P
Sbjct  406   VETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYKISPLLGLRSIIEVYP  458



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 183/362 (51%), Positives = 246/362 (68%), Gaps = 21/362 (6%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIH-RHGQPITLEELVDTLAINKA  221
             + ++E++ AQ+HIW H   FI S SLKCAV+LG+P      HGQP+ L +LV  L +N A
Sbjct  7     ENIDELLKAQSHIWTHSLQFIKSMSLKCAVELGVPVAFSTHHGQPMPLSDLVSALQVNPA  66

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             K HHL RLMR+L  SGFF    +K+ DGY L   S LL+KD P N  PF+      I T 
Sbjct  67    KTHHLHRLMRILVHSGFF---SLKE-DGYLLTASSRLLLKDTPLNSRPFISLVLDPILTE  122

Query  402   PWHRVSEWFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
             P++ +S+W  +D D TP+ TA+G++ W+ A  +  +N+ FN+AMA D+ L+   V   C+
Sbjct  123   PYNCMSKWLKDDHDQTPFVTAFGESLWEHAGHEIRVNNLFNEAMASDSFLISEAVIVKCK  182

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
             EVFEGLDSLVDV GGTG +A+AIA+ FP+ KCTVLDLPHVVAGL+  KNL ++AGDMF+A
Sbjct  183   EVFEGLDSLVDVAGGTGNMAKAIANTFPNLKCTVLDLPHVVAGLQGIKNLNFLAGDMFEA  242

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGK--------VIIVDMIVGSTQ  914
             +PPA A+ LKW+LHDW D DCVKILK CKEAI    NG +        VII+DM++G+  
Sbjct  243   VPPADAVLLKWILHDWTDEDCVKILKNCKEAI--TRNGEQENKKKKKKVIIIDMVMGN--  298

Query  915   NGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQL  1091
                  D++  ++Q+  D++MMV   G+ERT KEW K+F DAGF  YK    LG R++I++
Sbjct  299   --QTWDNDWTEAQVLFDMEMMVCLVGKERTEKEWAKLFFDAGFTKYKIDYVLGPRAVIEV  356

Query  1092  FP  1097
             +P
Sbjct  357   YP  358



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 238/356 (67%), Gaps = 12/356 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+  L I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHPTKTQC  73

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L  SGFF   K  + +   GY L   S LL+KDHP +LAPF+L     I T P
Sbjct  74    VYRLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  405   WHRVSEWFHNDDPTP----YQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
             WH+VS W  NDD       +   +G  FWD A ++  LNH+FN+ MA DT L  + +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHK  193

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
             C++VFEGL++LVDVGGGTG +A AIA +FP  +CTV D PHVVA L+   NL YV G+MF
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNMF  253

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+ +K VLH+WND +CVKILK CK+AI      GKVII+D+ + S +     D
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK----AD  309

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +  ++Q+F D+ MMV   G ER  KEW K+F +AGF  YK T  LG RSLI+++P
Sbjct  310   YKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 244/351 (70%), Gaps = 10/351 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQTH+WNHIFNFINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +KA ++
Sbjct  11    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMR+L  +GFF    + + + Y+L   + LL+KD+P ++ P +L     + T P   +
Sbjct  71    HRLMRILVHAGFFSQQNL-NQEAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLTKPHDCL  129

Query  417   SEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGL  596
             S WF ND+ T +  A+ +T W+ A QD  L++ FN+AMA D++L   LV   C+ +FEG+
Sbjct  130   STWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVVSKCQGIFEGV  189

Query  597   DSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEE-TKNLAYVAGDMFKAIPPAQ  773
             +SLVDVGGG+G +A+ IA+ FP   CTV DLP VV+ L+  +KNL YV GDMF+A+PPA 
Sbjct  190   NSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGSKNLKYVGGDMFEAVPPAD  249

Query  774   AIFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVDDDELIQ  947
              I LKW LHDWND DCVKILK+CK AI   G++  GKVII+D++ GS QNG    DE  +
Sbjct  250   VILLKWTLHDWNDEDCVKILKQCKHAIMSKGQQKAGKVIIIDIVRGS-QNG----DESNE  304

Query  948   SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +Q+  D++MMV   G ER   EW K+F DAGF  YK    LG+R+LI+L P
Sbjct  305   TQLLWDLEMMVTVTGLERNEMEWAKLFFDAGFVSYKIHNVLGTRALIELHP  355



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   355 bits (911),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 238/356 (67%), Gaps = 12/356 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+ TL I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQC  73

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             +  LMR+L  SGFF   K  + +   GY L   S LL+KDHP +LAPF+L     I T P
Sbjct  74    VYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  405   WHRVSEWFHNDDPTP----YQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
             WH+VS W  NDD       +   +G  FWD A ++  LNH+FN+ MA DT L  + +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALIHK  193

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
             C++VFEGL++LVDVGGGTG +A AIA +FP  +CTV D PHVVA L+   NL YV G+MF
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKYVGGNMF  253

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+ +K VLH+WND +CVKILK CK+AI      GKVII+D+ + S +     D
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK----AD  309

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +  ++Q+F D+ MMV   G ER  KEW K+F +AGF  YK T  LG RSLI+++P
Sbjct  310   YKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>ref|XP_011092041.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=355

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 246/363 (68%), Gaps = 15/363 (4%)
 Frame = +3

Query  30    IGMALQEMN-EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL  206
             + M  Q+ N E++ A+ HIWN +FN+INS+SLKCA +LGIPDVIH+HG P+TL EL+D L
Sbjct  1     MAMVNQKQNLEVLEAEAHIWNQVFNYINSTSLKCATELGIPDVIHKHGGPMTLTELLDAL  60

Query  207   -AINKAKAHHLGRLMRVLTRSGFFLDAKIKDG--DGYALGPPSCLLIKDHPFNLAPFVLG  377
              A++KAKA+ + RLMR L  SGFF+  K+     +GY+L P   LL+ D P ++ PFV+ 
Sbjct  61    PAVDKAKANCMYRLMRTLVHSGFFVLEKLNSSNEEGYSLTPAPRLLVGDRPMSMKPFVIS  120

Query  378   ASSTIFTGPWHRVSEWFHND-DPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLL  551
                 I T   H +  WF    D T + TA  G +FW++  ++   +H F+Q M  DT ++
Sbjct  121   QIDPILTESMHHLGRWFQTTHDRTTFHTANNGTSFWEQKERNPRFSHLFDQGMESDTPMV  180

Query  552   MALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLA  731
              +++ + CR+VFEGLDS+VDVGGGTG +A+AIA+ FP   CTVLDLPH+VAGLE  +NL 
Sbjct  181   ASVITRDCRQVFEGLDSVVDVGGGTGTLAKAIAEAFPQIHCTVLDLPHIVAGLEGRRNLK  240

Query  732   YVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGST  911
             Y+ G+MF  IPP+ A+ LKW+LHDW+D + VKILKKCKEA+      GKVII++M+    
Sbjct  241   YIEGNMFDYIPPSDAVVLKWLLHDWSDEESVKILKKCKEAVTSNGKRGKVIIIEMV----  296

Query  912   QNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQ  1088
                 V ++E +++Q+  D+ MM  + G+ERT KEW  + +DAGF  Y+    L  RS+I+
Sbjct  297   ----VKENESVETQLLLDMLMMATFKGKERTEKEWADLISDAGFSGYRIYPVLPLRSIIE  352

Query  1089  LFP  1097
             ++P
Sbjct  353   IYP  355



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 239/356 (67%), Gaps = 9/356 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQ  + NH+FNF+NS +LKCA+ L IPDVIH HGQP+ L +LV  L++  +K
Sbjct  7     ERADELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPSK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKI----KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             A  L RLMR+L  SGFF   ++    +  +GY+L   S  L+KD P    P  L   + +
Sbjct  67    APCLHRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHLNPV  126

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
              T PWH +S WF N DPTP+ TA+GK +WD  +Q+ + N  FN+AMA D+ ++ +++   
Sbjct  127   LTAPWHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLITK  186

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
             C+E F+GL SLVDVG GTG + +AIA  FP  KC V D PHVVA L+   NL  V GDMF
Sbjct  187   CKEQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGGNLEVVGGDMF  246

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             + IP A A+ LKW+LH+W+D +CVKILKKCKEAIP ++ GGK++I+DM++ + +     D
Sbjct  247   ETIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKG----D  302

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+ +++Q+F D+ MM    G++R   EW K+F  AGF +YK +  LG RSLI+++P
Sbjct  303   DQAVETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVYP  358



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/358 (49%), Positives = 240/358 (67%), Gaps = 13/358 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E+  A TH+ + +FN+INS SL CA QLGIPD+IH HG+PITL  LV  L I   K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNK  67

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDG------YALGPPSCLLIKDHPFNLAPFVLGASS  386
                + RLMR+L  SGFF   +  +G G      Y L PPS LL+KD+   L+PF +   +
Sbjct  68    TSIIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPF-MSLIN  126

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
               F  PW  + +WF  ++PT ++ AYG  FW+  +Q+ ELN  FN+AMACD+ + M LV 
Sbjct  127   PAFVTPWLSLGDWFRGNEPTAFEQAYGMAFWEYHNQNPELNRLFNEAMACDSQM-MNLVI  185

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
             + C+ +FEGL+S+VDVGGGTG ++R I++ FP   CTVL+LP V+  LE TKNL YV GD
Sbjct  186   RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGD  245

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IP A A+ LK + H W+D DC+KILKKCKEAI  +  GGKVIIVD+++   +    
Sbjct  246   MFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKGKGGKVIIVDVVIDEKK----  301

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             D+ EL ++++  D+ MMV   G+ER++KEW K+F +AGF +Y  T L G RSLI+++P
Sbjct  302   DEKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGLRSLIEVYP  359



>gb|KCW89599.1| hypothetical protein EUGRSUZ_A01884 [Eucalyptus grandis]
Length=357

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 234/348 (67%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QL IPD IH H QP+TL+ LV  L I+ ++AH L RLM
Sbjct  13    AQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPSRAHCLDRLM  72

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  73    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIVINPWHGLSA  132

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G + W    Q+  LN  FN  MA D  L+ ++V    + +FEG+ 
Sbjct  133   WFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKGMFEGIT  192

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG  A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF++IPPA AI
Sbjct  193   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  252

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VKILK+C+EA+  G     KVII+DM++ +T++    D E++++Q+
Sbjct  253   ILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKS----DKEMVETQL  308

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  309   FYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  356



>ref|XP_010070255.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 234/348 (67%), Gaps = 9/348 (3%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QL IPD IH H QP+TL+ LV  L I+ ++AH L RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCAIQLRIPDTIHHHDQPMTLDALVSALQIHPSRAHCLDRLM  74

Query  249   RVLTRSGFFLDAKIK-DGDG-YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSE  422
             R+L  SGFF   K+  DG G Y L   S LL+ D+P N+APF L     I   PWH +S 
Sbjct  75    RILVHSGFFEQKKLAPDGRGAYVLNRVSKLLLTDNPSNVAPFALSMLDPIVINPWHGLSA  134

Query  423   WFHND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLD  599
             WFHN  DPTP++   G + W    Q+  LN  FN  MA D  L+ ++V    + +FEG+ 
Sbjct  135   WFHNHVDPTPFEMVQGMSIWRYVGQEPGLNRLFNDGMATDARLVASMVVNEHKGMFEGIT  194

Query  600   SLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAI  779
             SLVDVGGGTG  A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF++IPPA AI
Sbjct  195   SLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFESIPPADAI  254

Query  780   FLKWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
              LKW+LHDW+D D VKILK+C+EA+  G     KVII+DM++ +T++    D E++++Q+
Sbjct  255   ILKWILHDWSDEDAVKILKRCREALGKGEGKKKKVIIIDMVMDNTKS----DKEMVETQL  310

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             F D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  311   FYDMLMMTLVSGRERNEAEWAKLFVTAGFGDYKITPALGLRSLIEVYP  358



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/350 (51%), Positives = 242/350 (69%), Gaps = 9/350 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQTH+WNHIF FINS +LKCAVQLGIPDVI +HG+P+TL ELV  L I+ +KA ++
Sbjct  11    ELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMR+L  SGFF    + + + Y+L   + LL+KD+P ++ P +L     + T P   +
Sbjct  71    HRLMRILVHSGFFSQQNL-NQEAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLTKPHDCL  129

Query  417   SEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGL  596
             S WF ND+ T +  A+ +T W+ A QD  L++ FN+AMA D++L   LV   C+ +F+G+
Sbjct  130   STWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVLSQCKGIFDGV  189

Query  597   DSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQA  776
             DSLVDVGGG+G +A+ IA+ FP   CTV DLP VV+ L+  KNL YV GDMF+A+PPA  
Sbjct  190   DSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGRKNLKYVGGDMFEAVPPADV  249

Query  777   IFLKWVLHDWNDVDCVKILKKCKEAI--PGRENGGKVIIVDMIVGSTQNGDVDDDELIQS  950
             I LKW LHDW+D DCVKILK+CK AI   G++  GKVII+D++ GS QNG    +E  ++
Sbjct  250   ILLKWTLHDWSDEDCVKILKQCKHAIMSKGQQKAGKVIIIDIVRGS-QNG----EESNET  304

Query  951   QIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             Q+  D++MMV   G ER   EW K+F DAGF  YK    LG+R+LI+L P
Sbjct  305   QLLWDLEMMVTVTGLERNEMEWAKLFFDAGFISYKIHNVLGTRALIELHP  354



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 225/328 (69%), Gaps = 21/328 (6%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLMRVLTRSGFFLDAKIKD  296
             SLKCA+QLGIPD+IH HG+P+TL ELV  L ++  ++  + RLMR+L  SGF    +++ 
Sbjct  2     SLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQ  61

Query  297   GDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSEWFHNDDPTPYQTAYGKTF  476
             G                     P VL     I T PWH +S WF NDDPTP+ TAY ++F
Sbjct  62    GKEEE----------------GPLVLAMLDPILTKPWHYLSAWFQNDDPTPFHTAYERSF  105

Query  477   WDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADE  656
             WD A  + +LN+ FN+AMA D  LL +++ K  + VF GL+SLVDVGGGTG VA+AIA+ 
Sbjct  106   WDYAGHEPQLNNSFNEAMASDARLLTSVLLKEGQGVFAGLNSLVDVGGGTGKVAKAIANA  165

Query  657   FPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILK  836
             FP   CTVLDL HVVAGL+ +KNL Y AGDMF+AIPPA AI LKW+LHDW++ +CVKILK
Sbjct  166   FPHLNCTVLDLSHVVAGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSNEECVKILK  225

Query  837   KCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEW  1016
             +C+EAIP +ENGGKVII+DMI+   Q GD    E   +Q+F D+ MM++  GRER   EW
Sbjct  226   RCREAIPSKENGGKVIIIDMIMMKNQ-GDYKSTE---TQLFFDMTMMIFAPGRERDENEW  281

Query  1017  VKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              K+F DAGF +YK T  LG RSLI+++P
Sbjct  282   EKLFLDAGFSHYKITPILGLRSLIEVYP  309



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 241/357 (68%), Gaps = 14/357 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E+  AQ+H++ HIFNFINS +LKCAV+LGIPD+IH H  PI+L +LV  L +   K  +
Sbjct  10    SELFQAQSHMYKHIFNFINSMALKCAVELGIPDIIHTHNHPISLPQLVSALHLPPTKTRY  69

Query  234   LGRLMRVLTRSGFFLDAKI-----KDGDGYALGPPSCLLIK---DHPFNLAPFVLGASST  389
             + RLMRVL  SGFF  AK+     ++ +GY L   S LL+    ++  NL+ FVL     
Sbjct  70    VNRLMRVLVHSGFFATAKVHENQEEEDEGYVLTTSSRLLLSKDNNNVPNLSAFVLAMLDP  129

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
             +   PWH + +WF  +D T + TA+GK+FWD  S D +  + FN+AMA D+ + M+LV K
Sbjct  130   VLVTPWHFLGDWFRGNDLTAFDTAHGKSFWDYGSHDHKFFNLFNEAMASDSRM-MSLVIK  188

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              CR VFEGL SLVDVGGG G++AR I++ FP  KCTV DLPHVV+   E  NL YV GDM
Sbjct  189   DCRPVFEGLGSLVDVGGGKGLIARIISEAFPQLKCTVFDLPHVVSNFPECGNLKYVGGDM  248

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
             F+++P A AI LK VLH  +D +CVKILKKC+EAIP +E GGKVI++D+++    N   +
Sbjct  249   FQSVPTADAILLKLVLHSLSDEECVKILKKCREAIPSKEKGGKVIVIDIVI----NEKKE  304

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             + ++ ++++  D+ MM    GRER  KEW K+F +AGF +YK   + G RSLI++FP
Sbjct  305   EHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHYKINPIFGLRSLIEVFP  361



>sp|Q6VMW0.1|Q8OMT_MENPI RecName: Full=8-hydroxyquercetin 8-O-methyltransferase; AltName: 
Full=Flavonol 8-O-methyltransferase [Mentha x piperita]
 gb|AAR09600.1| flavonoid 8-O-methyltransferase [Mentha x piperita]
Length=366

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 246/358 (69%), Gaps = 14/358 (4%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E++ AQ H+WNHI+++INS SLKCA+QLGIPD IH+HG PITL +L D L INKAK+H L
Sbjct  12    ELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGL  71

Query  237   GRLMRVLTRSGFF----------LDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASS  386
              RLMR+L  SGFF           + + ++ D Y+L P S LL++  P ++APF L  S 
Sbjct  72    FRLMRILVHSGFFDKVKVKVKVEGEDEEEEEDAYSLTPASRLLLRSEPLSVAPFALAMSD  131

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
              ++T  WH +SEWF ND    + T YG TF + A  D  LN  FN+AMACD   + +++ 
Sbjct  132   PVYTETWHHLSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFVNSILT  191

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               CRE+F+GL+S+VDVGGGTG  A+ IA  FP  +CTVLDLP+VV GL+ ++NL++V+GD
Sbjct  192   TECREIFDGLESMVDVGGGTGATAKGIAAAFPGMECTVLDLPNVVGGLKGSENLSFVSGD  251

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF  IP A AIF+K++LHDWND +CVKILKKCKEAI    N  + II+  IV   +    
Sbjct  252   MFDFIPHADAIFMKFILHDWNDEECVKILKKCKEAISRSNNSCRKIILVEIVMEDEK---  308

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +  E  ++++F D+QM+    G+ER+ KEW K+F DAGF  YK T+ LG RS+I++FP
Sbjct  309   ETHEATETKLFFDMQMLAIITGKERSEKEWGKLFFDAGFTNYKITRVLGLRSVIEVFP  366



>gb|KDP21023.1| hypothetical protein JCGZ_21494 [Jatropha curcas]
Length=358

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/357 (48%), Positives = 240/357 (67%), Gaps = 11/357 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+ +EI+ AQ H+ NH+ N++NS +LKCAVQLGIPD++H HG+PITL EL+  L I   K
Sbjct  7     QKASEILQAQVHLINHMLNYMNSMALKCAVQLGIPDILHSHGKPITLPELLSALHIPPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDG-----YALGPPSCLLIKDHPFNLAPFVLGASST  389
               ++ RLMR+L  SGFF   K+ +G G     Y L P S LL+K +P  LAPFV      
Sbjct  67    LSNMYRLMRMLVFSGFFSTTKVLNGQGDGQEAYVLTPSSRLLVKGNPNCLAPFVNSLLKA  126

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
              F  P H + +WF  ++ T ++ A+G  FW+   +  E N  FN+AMACD+ + M LV +
Sbjct  127   EFVSPGHLLGDWFQGNELTVFEKAHGMAFWEYNERKPEFNQLFNEAMACDSRM-MNLVIR  185

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+++FEG++SLVDVGGG G +AR I++ FPD KCTVLDLP V+A LE TKNL+YV GDM
Sbjct  186   DCKQIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLDLPQVIANLEGTKNLSYVGGDM  245

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVD  929
             FK IP    I LK +LH W+D +C+ ILKKCKEAI  +  GGK++++D+++    N   D
Sbjct  246   FKHIPSGDCIILKLILHGWSDDECLTILKKCKEAISSKGKGGKLVVIDLVI----NEKKD  301

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             + EL ++++  D+ MM    GRERT +EW  +F  AGF ++K T  LG RSLI+++P
Sbjct  302   EPELTETKLLFDMLMMSVTCGRERTEREWEGLFLKAGFSHFKITPLLGLRSLIEVYP  358



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 237/353 (67%), Gaps = 39/353 (11%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
              E++ A  H+WNHIFNFINS SLKCA++LGIPD+IH HG+P+TL ELV  L +N  K   
Sbjct  10    TELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEKTKC  69

Query  234   LGRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             + RLMR+L +SGFF   ++++    +GY L   S LL+KD P +  PF+L     +   P
Sbjct  70    VYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDPVLITP  129

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             W                              Q LN++FN+AMA D  L+ +++ K C+ +
Sbjct  130   W------------------------------QYLNNFFNEAMASDARLVTSVLIKDCKGI  159

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             F GL+SLVDVGGGTG VARAIA+ FP   CTVLDLPHVVAGLE +KNL Y+AGDMF+AIP
Sbjct  160   FVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAGDMFEAIP  219

Query  765   PAQAIFLK-WVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             PA AI LK W+LHDWN  +CVKILK+C++AIP +E GGKVII+DM++ + +     DDE 
Sbjct  220   PADAILLKQWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKA----DDES  275

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             I++Q+F D+ MM+   G+ER +K+W K+F DAGF  YK T  LG RSLI+++P
Sbjct  276   IETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  328



>ref|XP_009597680.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009597681.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 236/355 (66%), Gaps = 12/355 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E+  AQ HI+ H F+F NS  L+CA+QLGIPD+IH H QP TL ELV  L +  AK++ 
Sbjct  10    SEMFLAQAHIYKHTFHFANSMVLRCAIQLGIPDIIHSHKQPTTLSELVSELKLPPAKSNG  69

Query  234   LGRLMRVLTRSGFF----LDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             + RLMR+L  SGFF    LD   +  +GY L   S LL+K    NL+PF       I   
Sbjct  70    IHRLMRLLVYSGFFATKKLDENSETQEGYVLTASSKLLLKSEIPNLSPFARAMLDPIMVN  129

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PWH + +WF  ++ TP++TAYG   W+   Q+   N   N+AMA D+ + M+LV K C+ 
Sbjct  130   PWHSLGDWFLGNEATPFETAYGTPLWEYCDQNPGFNKVINEAMASDSEM-MSLVVKDCKL  188

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             VFE +DSLVDVGGGTG++A+ I   FP  KCTVLDLPHVVA + +T+NL YV GDMF++I
Sbjct  189   VFEEVDSLVDVGGGTGVIAKTILAAFPHLKCTVLDLPHVVANMPDTENLKYVGGDMFQSI  248

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG--GKVIIVDMIVGSTQNGDVDDD  935
             PPA     K V+HDWND DCVK+LK+C+EA+  +  G  GKVII+D+++    NGD ++ 
Sbjct  249   PPAGVFLFKLVMHDWNDEDCVKMLKRCREAMRDKNEGRKGKVIIIDIVL----NGDEEEA  304

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             ++ Q ++  DV MMVY  GRERT KEW KIF +AGF  +K T + G RSL ++FP
Sbjct  305   DMTQLKLIFDVLMMVYLPGRERTEKEWEKIFLEAGFMTFKITPVFGLRSLTEVFP  359



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 237/356 (67%), Gaps = 12/356 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ +Q H+WN+IF+F+NS SLKCA+QLGIPD+IH H +P+TL +L+ TL I+  K   
Sbjct  14    DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQC  73

Query  234   LGRLMRVLTRSGFFLDAKIKDGD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
             +  LMR+L  SGFF   K  + +   GY L   S LL+KDHP +LAPF+L     I T P
Sbjct  74    VYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLDPILTKP  133

Query  405   WHRVSEWFHNDDPTP----YQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
             WH+VS W  NDD       +   +G  FWD A ++  LNH+FN+ MA DT L  + +   
Sbjct  134   WHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSALINK  193

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
             C++VFEGL++LVDVGGGTG +A AIA +FP  +CTV D PHVVA L+    L YV G+MF
Sbjct  194   CKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGYLKYVGGNMF  253

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
             +AIPPA A+ +K VLH+WND +CVKILK CK+AI      GKVII+D+ + S +     D
Sbjct  254   EAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKMESEK----AD  309

Query  933   DELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +  ++Q+F D+ MMV   G ER  KEW K+F +AGF  YK T  LG RSLI+++P
Sbjct  310   YKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEVYP  365



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 228/332 (69%), Gaps = 9/332 (3%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLMRVLTRSGFFL----DA  284
             SLKC V LGIPD+IH +GQP+ L  L+ +L I+ +K   + RLMR++  SGFF     D 
Sbjct  2     SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  285   KIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSEWFHNDDPTPYQTAY  464
             + +    Y L   S LL+K+HP ++ PF+      + T PW++ S WF N DPTP++TA+
Sbjct  62    ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFETAH  121

Query  465   GKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLDSLVDVGGGTGMVARA  644
             G   WD A  D +LNH FN AMA D   + +LV + C+ VF GL+SLVDVGGGTG +A+A
Sbjct  122   GMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIEKCKGVFMGLESLVDVGGGTGTMAKA  181

Query  645   IADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCV  824
             IA  FP  +C V DLPHVV+GL+ ++NL YVAGDMF+AIPPA AI LKW+LHDWND +CV
Sbjct  182   IAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECV  241

Query  825   KILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQIFADVQMMVYYGGRERT  1004
              ILKKCKEAI  +   GKVII+DM+V + +     DDE +++Q+F D+ MMV   G+ER+
Sbjct  242   DILKKCKEAITRKGKEGKVIIIDMVVENEKR----DDESVETQLFFDMLMMVLVTGKERS  297

Query  1005  LKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              KEW K+ + AG+  YK T  LG RSLI+++P
Sbjct  298   KKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  329



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 240/353 (68%), Gaps = 9/353 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
              E++ AQ HIWNHIFN INS +LK AVQLGIPD+IH+H +P+TL +L D + IN+AK+  
Sbjct  11    QELLDAQAHIWNHIFNHINSMTLKWAVQLGIPDIIHKHDKPMTLSQLADAIPINRAKSDA  70

Query  234   LGRLMRVLTRSGFFLDAKI--KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPW  407
             L R+MR+L  S FF   +    + + Y L   S LL++D P +L PF L        G +
Sbjct  71    LHRIMRILVHSKFFDRVRTLPNEEEAYCLTRASRLLLRDEPLSLTPFALAVLDEDLMGTF  130

Query  408   HRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVF  587
             H V EWF N+ P+P +  + K+  + A  +Q  +  FN+ MA D  L+ +++ K  R+VF
Sbjct  131   HCVPEWFGNECPSPLEFKHEKSIREFAENNQRWSLLFNEGMANDARLVGSILAKESRKVF  190

Query  588   EGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPP  767
             EGL+++VDVGGGTGMV++AI D FP  K  VLDLP+VV+GL+ + NL YV GDMF ++PP
Sbjct  191   EGLETMVDVGGGTGMVSKAIVDAFPGMKGIVLDLPYVVSGLKGSGNLRYVGGDMFHSVPP  250

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGREN--GGKVIIVDMIVGSTQNGDVDDDEL  941
             A A+FLKW+LH+W+D +C+KIL+KCKEAI   +N  GGKVIIVDMI+G  +      DE 
Sbjct  251   ADAVFLKWILHNWSDDECIKILEKCKEAITTSKNMKGGKVIIVDMILGYEKQ----QDEA  306

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +++Q+F D+ MM    G+ERT +EW KIF  AGF  YK    LG RSLI++FP
Sbjct  307   VETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYKIYPLLGLRSLIEVFP  359



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 229/331 (69%), Gaps = 13/331 (4%)
 Frame = +3

Query  117   SLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLMRVLTRSGFFLDAKIKD  296
             SLKCA++L IPD+IH++GQP+ L +L  +L+I+ +KA+ + RLMR+LT SGFF   K+ +
Sbjct  2     SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNE  61

Query  297   GD---GYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSEWFHNDDPTPYQTAYG  467
              +   GY L   S LL+KD+P ++ PF+        T PW ++  WF NDDP+P+QTA+G
Sbjct  62    NELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTLTQPWLQLPTWFKNDDPSPFQTAHG  121

Query  468   KTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLDSLVDVGGGTGMVARAI  647
                WD A ++  LN  FN AMA DT L+  +V + C+ VF GL+SLVDVGGGTG +A AI
Sbjct  122   MKIWDYADREPRLNDLFNDAMASDTQLVANVVIERCKGVFNGLESLVDVGGGTGTMAMAI  181

Query  648   ADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVK  827
             A  FP  +CTV DLPHVVA L+ ++NL YV GDMF++IP A AI LKW+LHDWND  CVK
Sbjct  182   AKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDEQCVK  241

Query  828   ILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQIFADVQMMVYYGGRERTL  1007
             ILKKCKEAI       KVII+DM+V + +     DDE I++Q+F D+ +MV Y G+ERT 
Sbjct  242   ILKKCKEAI-----KSKVIIIDMVVENEKG----DDESIETQLFIDMVVMVLYPGKERTE  292

Query  1008  KEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             KEW K+    GF  YK T  LG RSLI+++P
Sbjct  293   KEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  323



>ref|XP_011085639.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score =   350 bits (898),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 245/365 (67%), Gaps = 15/365 (4%)
 Frame = +3

Query  36    MALQ--EMN--EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDT  203
             MA Q  EM+  +++ AQ H+WNH+F+FINS SLKCA++LGIPD+IH H +P++L +LVD 
Sbjct  1     MAFQIGEMSTEQLLDAQAHVWNHLFSFINSMSLKCAIELGIPDIIHNHAKPMSLSQLVDA  60

Query  204   LAINKAKAHHLGRLMRVLTRSGFFLDAKIKD---GDGYALGPPSCLLIKDHPFNLAPFVL  374
             L I K K+H + RLMR+L  S FF+   + D    + Y L P S LL+++ P  + P V 
Sbjct  61    LPIPKVKSHFVYRLMRLLIHSEFFVKVDVSDEEEKEHYWLTPASLLLLRNAPLTVVPLVP  120

Query  375   GASSTIFTGPWHRVSEWFHNDD--PTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLL  548
                  IFT P+  VS+W  ++    +P++  +G+  ++ A  +  +N   N+AM+ D  L
Sbjct  121   LILDPIFTTPFDYVSKWLASEHHYSSPFEMRHGRKVFEHAGHELGVNKLLNEAMSSDARL  180

Query  549   LMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNL  728
             L  ++ +  ++V EG+  LVDVGGGTG  A+AI D FPD KC VLDLPHVV GLE T NL
Sbjct  181   LTHVLVRDHKQVLEGIKLLVDVGGGTGATAKAILDAFPDMKCIVLDLPHVVGGLEGTDNL  240

Query  729   AYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG-GKVIIVDMIVG  905
             +Y AG+MF+ IP A A+FLKW+LHDWND DCVKILKKCKEAI G++ G  KV+I+DM++ 
Sbjct  241   SYAAGNMFETIPSADAVFLKWILHDWNDEDCVKILKKCKEAITGKDMGDTKVMIIDMVLD  300

Query  906   STQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSL  1082
                     DD+ +++ +F D+ MM Y  G+ERT KEW K+F D+GF  YK T   G RSL
Sbjct  301   IYGR----DDKAVETHLFFDIAMMSYINGKERTEKEWAKLFFDSGFTSYKITNAFGLRSL  356

Query  1083  IQLFP  1097
             I+++P
Sbjct  357   IEVYP  361



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 236/353 (67%), Gaps = 7/353 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  +E+  AQ+ I+ H+F+F++S SLKCAVQLGIPD IH H QPITL EL   + +   K
Sbjct  7     QGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPEK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKI-KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
                L +LMR+L  SGFF   K+ ++ +GY L PPS LL+K +  +LAP VLG    +   
Sbjct  67    TSRLHQLMRLLVHSGFFAMQKVDENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVLVT  126

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PWH +  W      T ++ A+G   W+  +Q+ E      + MA D+ + M+L  + C+E
Sbjct  127   PWHFLGSWLQGSSLTAFEAAHGMDLWNYGNQNPEFFSLIGEIMATDSRM-MSLAIRECKE  185

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             +FEGL SLVDVGGGTG +AR I + FP  KCTVLDLP VVA L +++NL YV GDMF++I
Sbjct  186   IFEGLSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDMFQSI  245

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P A AIF+K VLH+W D DCVKILK+C+EAIP    GGKVII+D+++ + +    D+ EL
Sbjct  246   PSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKK----DEHEL  301

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
              ++++F D+ MMV   G+ER  +EW K+F +AGF +YK T + G  SLI+++P
Sbjct  302   AKTKLFNDMMMMVLVAGKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVYP  354



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 239/358 (67%), Gaps = 12/358 (3%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q+  E++ AQ H++NHIFN+INS  LKCAVQLGIPD+IH+HG+PITL ELV  L I+  K
Sbjct  7     QKATELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDG-----DGYALGPPSCLLIKDHPFNLAPFVLGASST  389
              + + RLMR+L  SGFF   K  +G     + Y L P S LL+KD+P  L PFV      
Sbjct  67    INFMYRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFVDSLLKP  126

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
              F  P H + +WF  ++ T +Q A+G  FW+   ++ E N  FN+AMA D+ + M LV +
Sbjct  127   DFVTPGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRM-MNLVIR  185

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              C+ +FEG++SLVDVGGG G +AR I++ FPD KCTVL+LP V+  LE TKNL YV GDM
Sbjct  186   DCKPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGTKNLNYVGGDM  245

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGG-KVIIVDMIVGSTQNGDV  926
             F+ IP A AI LK +LH WND +CVKILKKCKEAI     G  KVI++D+++    N   
Sbjct  246   FQHIPSADAIILKLILHGWNDEECVKILKKCKEAISSTGKGSEKVIVIDLVI----NDKK  301

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+ E  ++++  D+ MM    G+ERT KEW ++F  AGF ++K T  LG RSLI+++P
Sbjct  302   DEYEFTETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIEVYP  359



>ref|XP_002522500.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39800.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 244/357 (68%), Gaps = 12/357 (3%)
 Frame = +3

Query  48    EMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKA  227
             E NE+  AQ HI+ H+++++ S SLKCAVQLGIPD+IH+H +P+TL EL   L I  AKA
Sbjct  8     EANELFQAQCHIYKHMYHYLESMSLKCAVQLGIPDIIHKHNKPMTLLELASALDIPPAKA  67

Query  228   HHLGRLMRVLTRSGFFLDAKIKDG-----DGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             + L R++R+L  SGFF  AK+ D      DGY L   S LL+KD P  L+PF L   +  
Sbjct  68    NCLQRVIRILVHSGFFTIAKVHDQEEVEEDGYVLTTSSRLLLKDSPTTLSPFALAMLNPA  127

Query  393   FTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKY  572
                PW  +SEW+  +  T ++T +GK FW    ++Q+     N+ MACD+ L+  +VK +
Sbjct  128   LITPWFSLSEWYQGNQLTAFETYHGKDFWQYGKENQDFIKSLNEGMACDSQLVSLIVKDH  187

Query  573   CREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMF  752
              +E+FEG+ SLVDVGGGTG +ARAIAD +P   C VLDLP VVA L+ETKN+ +VAGDMF
Sbjct  188   -KEIFEGVASLVDVGGGTGTLARAIADAYPLMTCAVLDLPQVVANLQETKNMKFVAGDMF  246

Query  753   KAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDD  932
              +IP A AI +K VLH+W+D  C+KILK+C+EAI  ++ GGKVII+++++    N   D+
Sbjct  247   HSIPSADAILIKSVLHNWSDEACIKILKRCREAIQSKDEGGKVIIIEVVI----NEKKDE  302

Query  933   DELIQ-SQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
              E+++ +++F D++MM+   G+ER  +EW ++F +AGF +YK T   G  S+I+++P
Sbjct  303   CEVVEKTKLFMDMEMMLICTGKERNEEEWARLFLEAGFNHYKITATSGLNSIIEVYP  359



>sp|Q8GSN1.1|MOMT_CATRO RecName: Full=Myricetin O-methyltransferase; AltName: Full=CrOMT2; 
AltName: Full=Flavonoid O-methyltransferase [Catharanthus 
roseus]
 gb|AAM97497.1| flavonoid O-methyltransferase [Catharanthus roseus]
Length=348

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 244/355 (69%), Gaps = 8/355 (2%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M LQ  +EI  AQ H +  +F+F + SSLKCAVQLGIPD IH HG+P+ L +L ++L IN
Sbjct  1     MELQS-SEIRNAQAHFFTQVFSFTSMSSLKCAVQLGIPDAIHSHGKPMALSDLTNSLPIN  59

Query  216   KAKAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
              +KA ++ RLMR+L  +G+F +   ++ + Y+L P + LL+K+ P N    VLG +    
Sbjct  60    PSKAPYIYRLMRILVAAGYFSE---EEKNVYSLTPFTRLLLKNDPLNSISMVLGVNQIAE  116

Query  396   TGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
                W+ +SEWF N+D T ++TA+GK FWD  ++D+     F+  MA D++L+  ++    
Sbjct  117   LKAWNAMSEWFQNEDLTAFETAHGKNFWDFGAEDK-YGKNFDGVMAADSILVSKMLIPEF  175

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
               +FEGLDSLVDVGGGTG +A+AIA  FPD KCTV DLPHVVA LE T+NL +V GDMF+
Sbjct  176   NYLFEGLDSLVDVGGGTGTIAKAIAKSFPDLKCTVFDLPHVVANLESTENLEFVGGDMFE  235

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDD  935
              IP A AI LKW+LHDW D +CVK+LK C++AIP +E GGKVI+++ ++  ++    +++
Sbjct  236   KIPSANAILLKWILHDWKDEECVKVLKMCRKAIPEKEKGGKVILIETVLMDSKKH--ENE  293

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKT-TQLGSRSLIQLFP  1097
             E +++QI +D+ MMV++  +ERT +EW  +F +AGF  YK    +  RS I+++P
Sbjct  294   EAVKAQISSDIDMMVFFTAKERTEEEWATLFREAGFSGYKIFPMIDFRSPIEVYP  348



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 242/357 (68%), Gaps = 13/357 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA-INKAKAH  230
             NE++ A  H+W+H F+FI S SLKCAV+LGIPD+IH HGQP+TL ELV  L  +  +K+H
Sbjct  10    NELLQAHAHVWSHAFSFIKSMSLKCAVELGIPDIIHNHGQPMTLSELVAGLPHVLPSKSH  69

Query  231   HLGRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
             H+ RLMRVLT SGFF   K    +D DGY L  P  LL+KD P +  P++      I T 
Sbjct  70    HVCRLMRVLTHSGFFTLQKASDNRDEDGYLLTKPCLLLLKDSPISARPYLFAVLDPILTK  129

Query  402   PWHRVSEWFHNDDP--TPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYC  575
             PW  +S WF NDD   +P+  A+GKTFWD AS +   N  FN+AMA D+ ++  +V   C
Sbjct  130   PWDCLSSWFQNDDSKCSPFSIAHGKTFWDLASHEARFNSIFNEAMASDSSVVREVVISKC  189

Query  576   REVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFK  755
             ++VF GL+SLVDVGG TG++A+AI + FP+ KCTVLDLPHVVAG+++  NL+++ GDMF+
Sbjct  190   KDVFMGLNSLVDVGGSTGIMAKAIVETFPELKCTVLDLPHVVAGMQDDHNLSFLGGDMFE  249

Query  756   AIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGR--ENGGKVIIVDMIVGSTQNGDVD  929
             +IPPA AI LK + H   D DC+K+LKKCKEAI     E  GKVII+D ++G+ ++    
Sbjct  250   SIPPADAIMLKMIFHVLGDEDCLKLLKKCKEAITSNNGERPGKVIIIDTVMGN-KDWIKQ  308

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
               E IQ     D++MMV   G+ERT KEW K+F DAGF  Y     LG RS+I++FP
Sbjct  309   STETIQ---LYDLEMMVLVSGQERTEKEWAKLFFDAGFSSYNINPILGLRSIIEVFP  362



>ref|XP_002278208.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=369

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 242/352 (69%), Gaps = 9/352 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E+  AQ+H++ HI +F+NS +L+CAVQLGIPD+IH H  P TL +LV  L I   KA  +
Sbjct  22    ELFQAQSHMYKHICSFMNSMALRCAVQLGIPDIIHNHAHPTTLPQLVSALHIPPTKASCV  81

Query  237   GRLMRVLTRSGFFLDAKI---KDGDGYALGPPSCLLIKDHPF-NLAPFVLGASSTIFTGP  404
              RLMR+L  SGFF  AK+   ++ +GY L P S LL+KD+P  NL+P VL     +   P
Sbjct  82    HRLMRLLVHSGFFAMAKVHEHEEEEGYILTPSSRLLLKDNPTSNLSPLVLTMLHPVLVTP  141

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             WH   +W   DD T ++TA+G +FWD  S + E+ + FN+ MA D+ ++  +  +  + V
Sbjct  142   WHFFGDWLRGDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGMASDSQMMSVVNFRELKPV  201

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGL SLVD+GGGTG++AR I++ FP  KCTV DLPHVVA L E++NL YV GDMF+++P
Sbjct  202   FEGLSSLVDLGGGTGLLARIISEAFPQLKCTVFDLPHVVANLPESRNLEYVGGDMFQSVP  261

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
              A AI LK VLHDW+D DC+KILKKC+EAI   E GGKVII+D+++    N   D+D++ 
Sbjct  262   SADAILLKCVLHDWSDEDCLKILKKCREAIRSEEEGGKVIIIDVVI----NEKKDEDDIT  317

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
             ++++  D+ MM    GRER  KEW K+F +AGF ++K + + G RSLI++FP
Sbjct  318   ETKLLMDMMMMTLVNGRERNEKEWEKLFLEAGFRHHKISPIFGLRSLIEVFP  369



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 230/354 (65%), Gaps = 7/354 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             +  +E++ AQTHI N  F+FI S SLKCAVQLGIPD I+ HGQP+TL ELV  L ++  K
Sbjct  7     ENTDELIKAQTHIRNETFHFIKSMSLKCAVQLGIPDTINSHGQPMTLSELVRALQVHPTK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKD--GDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
              HHL  LMRVL  SGFF      D     Y L P S LL+KD  F+  PF+      I T
Sbjct  67    THHLYCLMRVLVHSGFFNLQNASDNYSQKYVLTPASRLLLKDSSFDTRPFISLVLDPIMT  126

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              P++ ++ +  NDD TP+ TA+G T W     +   NH  N  MA D+ ++   V   C+
Sbjct  127   EPYNSLTPFLRNDDLTPFVTAFGVTLWGYTGNEARANHLVNDCMASDSSVIGRAVIIKCK  186

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
             EVFEGL+SLVDVGGGTG +A+AIA  FP+ KCTVLDLPHVV  L+   NL+++ GDMF+ 
Sbjct  187   EVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLGGDMFQP  246

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             +PPA AI LKW+LHDW D +C+KILK CKEAI  +   GKV+I+ +++G+       DD 
Sbjct  247   VPPADAILLKWILHDWPDEECIKILKNCKEAISRKGKEGKVMIIGIVMGNQS----PDDS  302

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             L + Q+  D++MMV   G+ER  +EW K+F DAGF  YK    LG R+LI+++P
Sbjct  303   LTELQLLFDMEMMVAAMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEVYP  356



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 234/350 (67%), Gaps = 9/350 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHH  233
             +E++ AQ  +WN  FN++NS SLKCAV+LGI D+IH HGQP TL ++   L I   K   
Sbjct  11    SELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASALNIKPNKVEC  70

Query  234   LGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHR  413
             +  +MR+L  SGFF  A+ KD D Y L P S LL+KD P   APFV   +  ++T  +H 
Sbjct  71    IQSVMRILVHSGFF--AQQKD-DEYFLTPASRLLLKDTPLKAAPFVDLVADPLYTTAFHC  127

Query  414   VSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEG  593
             +  W  NDDPT ++TA+GK  WDR + + +    F   M  D+ L+  +V K C+EVFEG
Sbjct  128   LGTWLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIAGIVIKDCKEVFEG  187

Query  594   LDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETK-NLAYVAGDMFKAIPPA  770
             L SLVDV GGTG++ARAIA  FPD KCTV DLPHVV  L+ T  NL ++ G+MF+AIP A
Sbjct  188   LKSLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTNDNLDFLGGNMFEAIPQA  247

Query  771   QAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQS  950
              A+ LKW+LH+WND + VK+LKKCKEAIP ++ GGKVII+DM + +       D E +++
Sbjct  248   NAVLLKWILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQ----DKESMET  303

Query  951   QIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
             Q+  D+ M+  + G+ER++ +W K+F  AGF +YK T  LG RSLI+ +P
Sbjct  304   QLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEAYP  353



>gb|KCW44789.1| hypothetical protein EUGRSUZ_L01645 [Eucalyptus grandis]
Length=349

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 230/346 (66%), Gaps = 15/346 (4%)
 Frame = +3

Query  69    AQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHLGRLM  248
             AQ HIWNHIFNFINS  LKCA+QLGIPD IH HGQP+TL+ LV  L I+ ++AH + RLM
Sbjct  15    AQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHPSRAHCVDRLM  74

Query  249   RVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRVSEWF  428
             R+L  SGFF   K+   DG A  PP            APF L     I   PWH +S WF
Sbjct  75    RILVHSGFFEQKKLAP-DGQA--PP-----YGQSLQCAPFALSMLDPILINPWHGLSAWF  126

Query  429   HND-DPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGLDSL  605
             HN  DPTP++   G +FW  A Q+  LN  FN  MA D  L+ ++V    + VFEG+ SL
Sbjct  127   HNHVDPTPFEMVQGMSFWRNAGQEPGLNRLFNDGMASDARLVASMVVNEHKGVFEGITSL  186

Query  606   VDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQAIFL  785
             VDVGGGTG +A+AIA+ FP  +CT+ DLPHVVA LE ++N+  V GDMF+AIPPA AI L
Sbjct  187   VDVGGGTGTMAKAIANSFPHMECTIFDLPHVVANLEVSENVRCVPGDMFEAIPPADAIIL  246

Query  786   KWVLHDWNDVDCVKILKKCKEAI-PGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQIFA  962
             KW+LHDW+D D VK+LK+C+EA+  G     KVII++M++ +T++    D E++++Q+F 
Sbjct  247   KWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIEMVMDNTKS----DKEMVETQLFY  302

Query  963   DVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             D+ MM    GRER   EW K+F  AGF  YK T  LG RSLI+++P
Sbjct  303   DMLMMTVASGRERNEAEWAKLFVAAGFGDYKITLVLGLRSLIEVYP  348



>emb|CAN75970.1| hypothetical protein VITISV_009881 [Vitis vinifera]
Length=354

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/353 (48%), Positives = 235/353 (67%), Gaps = 7/353 (2%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             Q  +E+  AQ+ I+ H+F+F++S SLKCAVQLGIPD IH H QPITL EL   + +   K
Sbjct  7     QGRSELFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHNQPITLPELASAIQVPPEK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKI-KDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
                L +LMR+L  SGFF   K+ ++ +GY L PPS LL+K +  +LAP VLG    +   
Sbjct  67    TSRLHQLMRLLVHSGFFAMQKVDENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVLVT  126

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             PWH +  W      T ++ A+G   W+  +Q+ E      + MA D+ + M+L  + C+E
Sbjct  127   PWHFLGSWLQGSSLTAFEAAHGMDLWNYGNQNPEXFSXIGEIMATDSRM-MSLAIRECKE  185

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             +FEG  SLVDVGGGTG +AR I + FP  KCTVLDLP VVA L +++NL YV GDMF++I
Sbjct  186   IFEGXSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDMFQSI  245

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDEL  941
             P A AIF+K VLH+W D DCVKILK+C+EAIP    GGKVII+D+++ + +    D+ EL
Sbjct  246   PSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKK----DEHEL  301

Query  942   IQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
              ++++F D+ MMV   G+ER  +EW K+F +AGF +YK T + G  SLI+++P
Sbjct  302   AKTKLFNDMMMMVLVAGKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVYP  354



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   353 bits (905),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 243/360 (68%), Gaps = 16/360 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTL-AINKA  221
             +  +E++ AQ HIWN +F++INS SLKCA +LGIPD+IH+HG+P+TL ELVD L   +K 
Sbjct  208   ERSSELLEAQAHIWNQVFSYINSMSLKCATELGIPDIIHKHGRPMTLTELVDALPGADKP  267

Query  222   KAHHLGRLMRVLTRSGFFLDAKIK--DGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIF  395
             KA  + RLMR+L  SGFF+  KI   + + Y+L P S LLI DH  ++  +VL     I 
Sbjct  268   KADCVYRLMRILVHSGFFVLEKIDSCNKEAYSLTPASRLLIGDHTMSMKAYVLSQLDPIL  327

Query  396   TGPWHRVSEWFHNDDPTPYQTAY-----GKTFWDRASQDQELNHYFNQAMACDTLLLMAL  560
             T PW  +S WF N   T Y TA+     G + W++  ++   +H F+Q MACDT ++   
Sbjct  328   TEPWQHLSRWFQN---TEYHTAFHTANNGTSIWEQKERNPRFSHLFDQGMACDTPMVADA  384

Query  561   VKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVA  740
             + + CR+VFEGLDS+VDVGGGTG +A+AIA+ FP   C VL+L  V+AGL+ T+NL YV 
Sbjct  385   ITRDCRQVFEGLDSIVDVGGGTGTLAKAIAEAFPQIHCLVLELAPVIAGLQGTRNLEYVE  444

Query  741   GDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNG  920
             GDMF+ IPPA A+ LKW+LHDW+D +CV ILKKCK AI      GKV+I++M++   QN 
Sbjct  445   GDMFEYIPPADAVVLKWILHDWSDEECVGILKKCKAAITSNGKRGKVVIIEMVLDD-QNA  503

Query  921   DVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
                D + +++Q+F D+ MM    GRER   EW K+F+DAGF  YK +  LG RS+I+++P
Sbjct  504   ---DHKSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISPILGLRSIIEVYP  560



>gb|AAR02421.1| putative O-methyltransferase [Catharanthus roseus]
 gb|AAR02422.1| putative O-methyltransferase [Catharanthus roseus]
Length=354

 Score =   345 bits (885),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 231/352 (66%), Gaps = 9/352 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E   AQ HIW+  F+FI  +SLKCA+QLGI D I  HG+P+ L +L +TL IN +K+ +L
Sbjct  7     EFRKAQVHIWSQSFSFITCASLKCALQLGIADAIENHGKPMALSDLTNTLQINPSKSQYL  66

Query  237   GRLMRVLTRSGFFLDAKIKDGDG----YALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
              RLMR+L  SGFF + ++ D  G    Y L P   LL+K+ P NL   VL     +    
Sbjct  67    PRLMRLLVNSGFFSEQQLGDAGGGENVYGLTPSMRLLLKNEPLNLRGIVLPMLDPLQIKA  126

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             W+ +  WF N+D T ++TA+GK++WD  ++D +    F + MA D+LL+   V    + +
Sbjct  127   WNSLGNWFKNEDGTAFETAHGKSYWDCVTEDPKDVEIFTETMASDSLLVAKFVITEHKSL  186

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIP  764
             FEGLDS++DVGG TG  ARAIA+ FP  KCTVLDLP  VA +E T NL +V G+MF+ IP
Sbjct  187   FEGLDSIIDVGGSTGTFARAIAESFPSLKCTVLDLPETVANIEPTNNLEFVGGNMFEKIP  246

Query  765   PAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELI  944
             PA  +FLK VLHDWND DCVKILK C++AIP +E GGKVI+++ +V     G + D E +
Sbjct  247   PAHVVFLKMVLHDWNDEDCVKILKNCRKAIPEKEKGGKVILIETVV----QGQMHDSESV  302

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQLGS-RSLIQLFP  1097
             ++QI  D+ M+V +G +ERT KEW  +F +AGF  YK   +   RSLI+++P
Sbjct  303   KTQIAMDMDMLVSFGTKERTEKEWEILFKEAGFSSYKIFPIVDIRSLIEVYP  354



>emb|CDP21583.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 222/347 (64%), Gaps = 55/347 (16%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             E   AQ HIWNHIFNFINS SLKCA+QLGIPD+IH+HGQP+TL++L+D L I  AKA  +
Sbjct  13    EFFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMTLDQLIDALPIKNAKAPFI  72

Query  237   GRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWHRV  416
              RLMR+L  SG                                                 
Sbjct  73    YRLMRILIHSG-------------------------------------------------  83

Query  417   SEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFEGL  596
                F N D +P+ T +G+  W+ A  +  LN +FN+AMA D  L+ +LV K  + VFEGL
Sbjct  84    ---FFNSDESPFYTCHGRPLWELAGHEPRLNQFFNEAMASDARLVSSLVIKDYKHVFEGL  140

Query  597   DSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAIPPAQA  776
             +SLVDVGGGTG  A AIAD FP  KCTVLDLPHVV GLE +KNLAYV GDMF+AIPPA  
Sbjct  141   NSLVDVGGGTGTFAEAIADAFPRLKCTVLDLPHVVNGLE-SKNLAYVGGDMFEAIPPADT  199

Query  777   IFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDELIQSQI  956
             + LKW+LHDW+D +CV+IL+KCKEAIP +E GGKVII+D+++ S Q GD DD E I++Q+
Sbjct  200   VLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVIIIDILLKSQQKGD-DDHEAIETQL  258

Query  957   FADVQMMVYYGGRERTLKEWVKIFNDAGFFYYK-TTQLGSRSLIQLF  1094
               D+ MMV   GRER  K+W K+F  AGF  YK T  LG RS+I+++
Sbjct  259   LFDMLMMVLLKGRERNEKDWAKLFFGAGFNDYKITAALGLRSIIEVY  305



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 241/354 (68%), Gaps = 12/354 (3%)
 Frame = +3

Query  57    EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAHHL  236
             +++ AQTHI++  F FINS SLKCA+ L IPDVIH++GQP+ L +L+ +L I+ +KA  +
Sbjct  11    KLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIHPSKACFI  70

Query  237   GRLMRVLTRSGFF------LDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFT  398
              RLM++LT SGFF       +   ++   Y L   S LL+KDH F++          I  
Sbjct  71    FRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISLPQVILDPILV  130

Query  399   GPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCR  578
              PW + S WF N+DPTP+ T  G  FWD AS + +LNH FN AM  D+ L+ +++ + C+
Sbjct  131   NPWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISSVLIEKCK  190

Query  579   EVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKA  758
              VF GL+SLVDVGGGTG +A+AIA  FP  KC V DLPHVV GL+ T+N+ YV GDMF+A
Sbjct  191   GVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGTENVEYVHGDMFEA  250

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDVDDDE  938
             IP A +I LK ++H+WND +C+KILK+CKEAI  ++  GKVII+D+++G+ +     D E
Sbjct  251   IPSADSIMLKTIMHNWNDEECLKILKRCKEAIANKDK-GKVIIIDVVIGNEKG----DSE  305

Query  939   LIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             L Q+++F D++MMV   G+ER  K+W K+F  AGF  YK T  LG +SLI+++P
Sbjct  306   LDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYKITPVLGFKSLIEVYP  359



>ref|XP_004232927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 241/359 (67%), Gaps = 12/359 (3%)
 Frame = +3

Query  42    LQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKA  221
             ++  NE+  AQ HI+ H F + NS +L CA+QLGIPD+IH H +PITL +L+  L +  +
Sbjct  7     VERANELFKAQAHIYKHAFAYANSMALNCAIQLGIPDIIHNHKKPITLPDLLSGLKLPSS  66

Query  222   KAHHLGRLMRVLTRSGFFLDAKIKDG---DGYALGPPSCLLIKDHPFNLAPFVLGASSTI  392
             K++ + RLMR+L  + FF   K+++    +GY L   S LL+K    NL P V      +
Sbjct  67    KSNAIHRLMRLLVHAQFFDIIKLEENSETEGYVLTTSSRLLLKSEIPNLLPCVRLMVDPV  126

Query  393   FTGPWHRVSEWFH-NDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKK  569
                PW  + EWFH N++ TP++TA+G   WD  +Q+   +  FN+AMA D+ + M LV K
Sbjct  127   LVTPWQLLGEWFHKNEEATPFETAHGMPMWDFCAQNPIFDTAFNEAMASDSQM-MKLVVK  185

Query  570   YCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDM  749
              CREVFEGL+SLVDVGGGTG++A+ I +  P  KCTVLDLPHVVA + +T+NL YV G+M
Sbjct  186   DCREVFEGLNSLVDVGGGTGVIAKTILEAIPHLKCTVLDLPHVVANMPQTENLIYVGGNM  245

Query  750   FKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG--GKVIIVDMIVGSTQNGD  923
             F+ IP A AI LK V+HDW+D DCVKILK+C+EAI  ++ G  GKV+I+DM++G     D
Sbjct  246   FQCIPHADAILLKHVMHDWSDEDCVKILKRCREAIEDKDEGRKGKVLIIDMVLGR----D  301

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              ++  + + ++  DV MMV   GR+RT KEW K+F +AGF  YK T  LG RSLIQ+FP
Sbjct  302   EEEANMTEVKLIFDVLMMVVTTGRQRTEKEWEKLFTEAGFMSYKITPLLGLRSLIQVFP  360



>ref|XP_011085377.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=368

 Score =   345 bits (885),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 179/365 (49%), Positives = 241/365 (66%), Gaps = 19/365 (5%)
 Frame = +3

Query  36    MALQ--EMN--EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDT  203
             MA Q  EM+  +++  Q H+WNH+F+FINS SLKCA++LGIPD+IH H +P++L +LVD 
Sbjct  12    MAFQIGEMSAEQLLDGQAHVWNHLFSFINSMSLKCAIELGIPDIIHNHAKPMSLSQLVDA  71

Query  204   LAINKAKAHHLGRLMRVLTRSGFFLDAKIKD---GDGYALGPPSCLLIKDHPFNLAPFVL  374
             L I K K+H + RLMR+L  S FF+   + D    + Y L P S LL+++ P ++AP V 
Sbjct  72    LPIPKVKSHFVYRLMRLLIHSEFFVKVDVSDEEEKEHYWLTPASLLLLRNAPLSVAPLVQ  131

Query  375   GASSTIFTGPWHRVSEWFHNDDPT-PYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLL  551
                    T P   +SEW  +   T PY+  +GK  ++       LN+ +N A + D+ LL
Sbjct  132   LILDPNMTEPLDHLSEWLASQRHTSPYELVHGKVLFEHLGLQPGLNNLYNDATSSDSRLL  191

Query  552   MALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLA  731
               ++ + C+++FEG+ SLVDVGGGTG  A+AIAD FPD KC VLDLPHVV GLE T N  
Sbjct  192   THVLVRDCKQIFEGIKSLVDVGGGTGTTAKAIADAFPDMKCIVLDLPHVVGGLEGTNNFT  251

Query  732   YVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMI--VG  905
             YVAGDMF+ IP A A+FLKW+LHDWND DCVKILKKCKEAI     GGKVII+DM+  V 
Sbjct  252   YVAGDMFENIPSADAVFLKWILHDWNDEDCVKILKKCKEAIAVE--GGKVIIIDMVLDVH  309

Query  906   STQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSL  1082
              T +G      + ++ +  D+ ++ YY G+ERT KE+ K+  DAGF  YK T   G RSL
Sbjct  310   GTDSG------VRETHLLLDMAVLGYYNGKERTEKEFAKLLFDAGFTSYKITPAFGMRSL  363

Query  1083  IQLFP  1097
             I+++P
Sbjct  364   IEIYP  368



>gb|KDP35397.1| hypothetical protein JCGZ_10381 [Jatropha curcas]
Length=355

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 171/357 (48%), Positives = 237/357 (66%), Gaps = 14/357 (4%)
 Frame = +3

Query  45    QEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAK  224
             + ++E++ AQTH+WNH   FI S SLKCAV+LGIPD+I+ H QP+ L +LV  L +N AK
Sbjct  7     ENVDELLKAQTHMWNHTLQFIKSMSLKCAVELGIPDIINNHDQPMPLSDLVSALQVNPAK  66

Query  225   AHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGP  404
              HH+ RLMR L  SGFF   +    +GY L P S  L+KD      PF+      I   P
Sbjct  67    THHVYRLMRFLVHSGFFSLQE----EGYLLTPFSRFLLKDTSVGSIPFISLFLDPIMMDP  122

Query  405   WHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREV  584
             ++ +S W  NDD TP+ TA+GK+ ++ A  D   N+  N+  ACD++ L  +    C+EV
Sbjct  123   FNCLSRWLKNDDQTPFVTAFGKSLYEYAGHDIRANNMVNEVTACDSIFLGQVTTLKCKEV  182

Query  585   FEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEE--TKNLAYVAGDMFKA  758
             F+GL+SLVDV GGTG ++++IA+ FP  KCT+LDLPHVVA ++    KNL +VAGDMF+A
Sbjct  183   FKGLNSLVDVAGGTGNMSKSIANAFPSIKCTILDLPHVVAVVDSQGAKNLNFVAGDMFQA  242

Query  759   IPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIP---GRENGGKVIIVDMIVGSTQNGDVD  929
             +PPA A+ +KWVL DW D  CVKILK CKEAI     +EN  KVII+DM++G+  +    
Sbjct  243   VPPADAVLIKWVLCDWADEYCVKILKNCKEAITRNGKQENNNKVIIIDMVMGNKNS----  298

Query  930   DDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             DD+ I++++F D+  M Y  G++R  +EW K+F DAGF  YK    LG R+LI+++P
Sbjct  299   DDDCIEAELFFDMAEMAYLTGKQRNEEEWAKLFFDAGFIKYKINYVLGPRALIEVYP  355



>gb|AAR09603.1| O-methyltransferase [Mentha x piperita]
Length=361

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 238/355 (67%), Gaps = 10/355 (3%)
 Frame = +3

Query  51    MNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAINKAKAH  230
             + E++ A+ H+WNHIF++INS SLK A+QLGIPD+IH+HG PITL +L D L INKAK  
Sbjct  11    VEELLDAEAHVWNHIFSYINSMSLKSALQLGIPDIIHKHGNPITLSQLADALNINKAKTD  70

Query  231   HLGRLMRVLTRSGFF---LDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTG  401
              L RLMR+L  S FF         + + Y+L   S LL++D P +LAP++       F  
Sbjct  71    GLFRLMRLLEHSKFFDKVKVEGEGEEEAYSLTRASRLLLRDEPSSLAPYIRAMLDPNFMD  130

Query  402   PWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCRE  581
             P+H +SEW  ++ P+P++  +G++ W+ A  ++  N  FNQAMA D  L+ +++ K CR 
Sbjct  131   PFHHLSEWLGSECPSPFEFKHGRSLWEYAGIEERWNQLFNQAMANDAKLVTSILVKECRH  190

Query  582   VFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGDMFKAI  761
             +F+GL+SLVDVGGG G VA+ +AD FP  K  VLDLPHVVA L  ++NL YV+GDMF+ I
Sbjct  191   IFQGLESLVDVGGGAGTVAKVVADAFPGLKAVVLDLPHVVADLATSENLRYVSGDMFEDI  250

Query  762   PPAQAIFLKWVLHDWNDVDCVKILKKCKEAI-PGR-ENGGKVIIVDMIVGSTQNGDVDDD  935
             P A A+ LKW+LH+W+D +C+KIL+KCKEAI P +  NGGKVI++DMI+   +       
Sbjct  251   PRADAVLLKWILHNWSDEECIKILEKCKEAITPSKNNNGGKVIVIDMILKDEKQ----HH  306

Query  936   ELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             +  ++Q+  DV MM    G+ERT KEW  +F  AGF  YK    L  RS+I++FP
Sbjct  307   KGTETQLLFDVLMMTALTGKERTEKEWANLFFAAGFKTYKIHPVLRLRSVIEIFP  361



>ref|XP_009345025.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score =   342 bits (878),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 240/364 (66%), Gaps = 18/364 (5%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+FNFI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFNFITSMSLKCVVQLGIPDIIDRHGQPITLLDLVTALQIH  60

Query  216   KAKAHHLGRLMRVLTRSGFFLDAKIKDGDG---------YALGPPSCLLIKDHPFNLAPF  368
              AK  ++ RLMR++  SGFF   ++    G         Y L P S LL+KD   +L+PF
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHGEADKGEEEAYDLTPSSRLLLKDKVPSLSPF  120

Query  369   VLGASSTIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLL  548
             VLG        PW  +  WF   + TP+++A+G  FW+    + E N  FN+AMA D+ +
Sbjct  121   VLGMLDPAIAAPWQFLGNWFRGTEVTPFESAHGMGFWEYGEGNPEFNSLFNKAMASDSGM  180

Query  549   LMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNL  728
              M LV + C+ +F+GL SLVDVGGGTG VAR + D FP  KCTVL+LPHVVA L + +NL
Sbjct  181   -MNLVIRDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDGENL  239

Query  729   AYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG-GKVIIVDMIVG  905
              +V GDMF+ IPPA A+FLK  LH  +D DC+K+LKKC+EAI    NG GKVII+D+++ 
Sbjct  240   KFVGGDMFQGIPPADAVFLKLTLHALSDEDCLKVLKKCREAIA--SNGQGKVIIIDIVI-  296

Query  906   STQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSL  1082
                N + D+ E+ ++++  D+ MMV   GRER+ K+W K+F +AGF  YK T + G RSL
Sbjct  297   ---NEEKDEHEITEAKLLFDLLMMVVVTGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSL  353

Query  1083  IQLF  1094
             +++F
Sbjct  354   LEVF  357



>ref|XP_008364163.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Malus 
domestica]
Length=358

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 244/364 (67%), Gaps = 18/364 (5%)
 Frame = +3

Query  36    MALQEMNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLAIN  215
             M   E  ++ GAQ+H++ H+F+FI S SLKC VQLGIPD+I RHGQPITL +LV  L I+
Sbjct  1     MEGDEARDLFGAQSHLYKHVFSFITSMSLKCVVQLGIPDIIDRHGQPITLPDLVTALQIH  60

Query  216   KAKAHHLGRLMRVLTRSGFF---------LDAKIKDGDGYALGPPSCLLIKDHPFNLAPF  368
              AK  ++ RLMR++  SGFF         ++A   + + Y L P S LL+KD   +L+ F
Sbjct  61    PAKTGNVHRLMRLMVHSGFFARKQVPKNHVEADEGEEEAYDLTPSSTLLLKDKVPSLSSF  120

Query  369   VLGASSTIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLL  548
             VLG        PW  +  WF   + TP+++A+G  FW+ A  + E N  FN+AMA D+ +
Sbjct  121   VLGMLDPASAAPWQFLGNWFRGTEVTPFESAHGMGFWEYAEGNPEFNSLFNKAMASDSGM  180

Query  549   LMALVKKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNL  728
              M LV + C+ +F+GL SLVDVGGGTG VAR + D FP  KCTVL+LPHVVA L + +NL
Sbjct  181   -MNLVIRDCKPIFDGLSSLVDVGGGTGKVARILCDAFPQLKCTVLELPHVVADLPDCENL  239

Query  729   AYVAGDMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENG-GKVIIVDMIVG  905
              +V GDMF+ IPPA A+FLK +LHD +D +C+K+LKKC+EAI    NG GKVII+D+++ 
Sbjct  240   KFVRGDMFQGIPPADAVFLKLILHDLSDEECLKVLKKCREAIAS--NGQGKVIIIDIVM-  296

Query  906   STQNGDVDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSL  1082
                N + D+ E+ ++++  D+ MMV   GRER+ K+W K+F +AGF  YK T + G RSL
Sbjct  297   ---NEEKDEHEITEAKLLFDLLMMVVITGRERSEKDWKKLFLEAGFSSYKVTPIFGLRSL  353

Query  1083  IQLF  1094
             I++F
Sbjct  354   IEVF  357



>gb|AJD20223.1| norcoclaurine 6-O-methyltransferase [Podophyllum peltatum]
Length=373

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 234/359 (65%), Gaps = 14/359 (4%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQ-PITLEELVDTLAINKAKAH  230
              E++ AQ HIWNHIFNFI++ SLKCAVQL IP++IH H Q PITL +LV  L I + K+ 
Sbjct  18    EELLAAQAHIWNHIFNFISTMSLKCAVQLNIPEIIHNHPQKPITLAQLVQALQIPETKSI  77

Query  231   HLGRLMRVLTRSGFFLDAKIKDGD-------GYALGPPSCLLIKDHPFNLAPFVLGASST  389
             +L RLMR+L  S FF   +I++         GY L   S LL K+HP +++ ++L  S  
Sbjct  78    YLYRLMRILVHSRFFGIERIQETAEEQVEEEGYVLTLSSKLLRKNHPVSMSLYLLCLSDP  137

Query  390   IFTGPWHRVSEWFHNDDP--TPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALV  563
             I   P H +S+WF   D   TP++   G  FW     +QE    F+++MACD  ++M++V
Sbjct  138   IMVTPCHFLSDWFKKTDELITPFEATQGMPFWKYFGDNQESGKLFDKSMACDAKMVMSIV  197

Query  564   KKYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAG  743
              K C+  FEG+ SLVDVGGGTG VAR IA+  P  KCTVLDLPHVV  L+ +KNL +V+G
Sbjct  198   LKECKMKFEGIMSLVDVGGGTGTVARVIAEAVPGVKCTVLDLPHVVGTLQGSKNLEFVSG  257

Query  744   DMFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGD  923
             DMF++IP A    LK ++HDW+D +CV ILK+CKEAIP +E GGKVII+DM+V       
Sbjct  258   DMFESIPSADVALLKSIMHDWSDDECVMILKRCKEAIPSKEAGGKVIIIDMVVDDKNKNH  317

Query  924   VDDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
              +  E   +Q+F D+ MMV   G+ERT  EW K+F+DAGF  Y  T  LG RS I++ P
Sbjct  318   YESTE---TQLFFDMLMMVLITGKERTETEWKKLFSDAGFTGYTITPILGLRSFIEVLP  373



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 234/352 (66%), Gaps = 12/352 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHG-QPITLEELVDTLAINKAKAH  230
             +E++ AQ+H+WNHIFNFINS SLKCA+QLGIPD IH HG  P+ L  LV +L ++  K  
Sbjct  14    DELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQ  73

Query  231   HLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWH  410
              + RLMR+LT SGFF    ++  +GY L   S LL+KD+P  ++PF+L       T PW 
Sbjct  74    FIYRLMRLLTHSGFF----VQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQ  129

Query  411   RVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFE  590
              +S WF  DD TP++TA+G  FW       +    FN  MA D  L++ ++ +  R VFE
Sbjct  130   FLSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFE  189

Query  591   GLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMFKAIPP  767
             G++SLVDVGGGTG VA+AI+  FP  +CTVLDLP VVA L+ +  N  YV GDMF  IPP
Sbjct  190   GVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPP  249

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGR-ENGGKVIIVDMIVGSTQNGDVDDDELI  944
             A  I LKW+LHDW+D +CV+ILKKCKEAI G     GKV+++D+++ +T+N    D + I
Sbjct  250   ADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKN----DADSI  305

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+  D+ MM+  GG+ER  KEW K+  +AGF  YK    L  RSLI+++P
Sbjct  306   ETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 234/352 (66%), Gaps = 12/352 (3%)
 Frame = +3

Query  54    NEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHG-QPITLEELVDTLAINKAKAH  230
             +E++ AQ+H+WNHIFNFINS SLKCA+QLGIPD IH HG  P+ L  LV +L ++  K  
Sbjct  14    DELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQ  73

Query  231   HLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASSTIFTGPWH  410
              + RLMR+LT SGFF    ++  +GY L   S LL+KD+P  ++PF+L       T PW 
Sbjct  74    FIYRLMRLLTHSGFF----VQQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQ  129

Query  411   RVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVKKYCREVFE  590
              +S WF  DD TP++TA+G  FW       +    FN  MA D  L++ ++ +  R VFE
Sbjct  130   FLSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLEKHRSVFE  189

Query  591   GLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLE-ETKNLAYVAGDMFKAIPP  767
             G++SLVDVGGGTG VA+AI+  FP  +CTVLDLP VVA L+ +  N  YV GDMF  IPP
Sbjct  190   GVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQPNFKYVEGDMFTLIPP  249

Query  768   AQAIFLKWVLHDWNDVDCVKILKKCKEAIPGR-ENGGKVIIVDMIVGSTQNGDVDDDELI  944
             A  I LKW+LHDW+D +CV+ILKKCKEAI G     GKV+++D+++ +T+N    D + I
Sbjct  250   ADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKN----DADSI  305

Query  945   QSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQ-LGSRSLIQLFP  1097
             ++Q+  D+ MM+  GG+ER  KEW K+  +AGF  YK    L  RSLI+++P
Sbjct  306   ETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 237/358 (66%), Gaps = 12/358 (3%)
 Frame = +3

Query  36    MALQE--MNEIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA  209
             MA+ E    E++ A T IWNHI+NF++SS+ KCAVQLGIPDV+++HG+ + L +L   L 
Sbjct  1     MAMNENGSTELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALP  60

Query  210   INKAKAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASST  389
             +N +K   L  L+R L  SGF  + +    D Y+L P S L +KD P ++  + L     
Sbjct  61    LNPSKISFLPILIRSLVHSGFLNEHE----DYYSLTPASRLFLKDDPLSMRSYFLIMHDP  116

Query  390   IFTGPWHRVSEWFHNDDPTPYQTAY-GKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
                 PW  +S WF ND PT +  A+ GK+FWD  + +  +N+ FN +MA D+ L+  ++ 
Sbjct  117   CVQKPWFELSSWFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIANVLI  176

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               C+ VFEGL SLVDVGGGTG +A AIA  FP   CTVLDLPHV+  L+ + NL +V G 
Sbjct  177   TECKHVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSGNLEFVGGS  236

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IP A AI LKW+LH+W D DCVKILKKCKE+IP RE GGKVII+D+++   +N   
Sbjct  237   MFEKIPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVIIIDIVL---ENPKQ  293

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTT-QLGSRSLIQLFP  1097
              DD  +++Q   D+ MMV +G +ERT KEW K+F +AGF  Y+ T  LG+RSLI+++P
Sbjct  294   KDDS-VRAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEIYP  350



>ref|XP_006357086.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Solanum tuberosum]
Length=351

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 234/358 (65%), Gaps = 11/358 (3%)
 Frame = +3

Query  36    MALQEMN-EIVGAQTHIWNHIFNFINSSSLKCAVQLGIPDVIHRHGQPITLEELVDTLA-  209
             M+  E N E++ AQT IWNHIF+F++SS+L+CAVQL IPD++++HG+P+ L +L   L+ 
Sbjct  1     MSTSESNSELLQAQTQIWNHIFSFMSSSALRCAVQLDIPDILYKHGKPMHLSDLSTELSL  60

Query  210   -INKAKAHHLGRLMRVLTRSGFFLDAKIKDGDGYALGPPSCLLIKDHPFNLAPFVLGASS  386
              I+ +K   L  LMR L  SG     +  D D Y+L P S  L+KD PFNL   VL    
Sbjct  61    IIDPSKISFLPNLMRFLVHSGII---EQHDHDYYSLTPSSRFLVKDEPFNLRSLVLLTHD  117

Query  387   TIFTGPWHRVSEWFHNDDPTPYQTAYGKTFWDRASQDQELNHYFNQAMACDTLLLMALVK  566
                   W  +  W+ ND PT + TA GK FWD  S++ +L   FN  MA ++ L++ ++ 
Sbjct  118   PSVQKAWFELGNWYKNDIPTSFHTANGKYFWDYFSKEPKLGDIFNDVMASESGLIVNMLI  177

Query  567   KYCREVFEGLDSLVDVGGGTGMVARAIADEFPDTKCTVLDLPHVVAGLEETKNLAYVAGD  746
               CR VFEGL SLVDVGGGTG +A AIA  FP   C V DLPHV+  L+   N+ +V GD
Sbjct  178   TECRHVFEGLTSLVDVGGGTGTMAIAIAKAFPSINCIVFDLPHVIEDLKSNGNMEFVGGD  237

Query  747   MFKAIPPAQAIFLKWVLHDWNDVDCVKILKKCKEAIPGRENGGKVIIVDMIVGSTQNGDV  926
             MF+ IP A AI LKW+LH+WND DCVKILKKCKE+IP R+ GGK+II+D+++   +N   
Sbjct  238   MFQKIPNANAILLKWILHNWNDEDCVKILKKCKESIPSRDEGGKLIIIDIVLEDPKNM--  295

Query  927   DDDELIQSQIFADVQMMVYYGGRERTLKEWVKIFNDAGFFYYKTTQL-GSRSLIQLFP  1097
                + +++Q   D+ MMV +  +ERT KEW K+FN+AGF   K T + GSRSLI+++P
Sbjct  296   --SDYVRAQHNMDMMMMVCFAAKERTKKEWEKLFNEAGFNECKITSIPGSRSLIEVYP  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3350347003940